Technologies developed by CNES balloon team
Sosa-Sesma, Sergio; Charbonnier, Jean-Marc; Deramecourt, Arnaud
CNES balloon team develops and operates all the components of this kind of vehicle: it means envelope and gondola. This abstract will point out only developments done for envelope. Nowadays CNES offers to scientists four types of envelops that cover a large range of mission demands. These envelops are: 1. Zero pressure balloons: Size going from 3,000m3 to 600,000m3, this kind of envelop is ideal for short duration flights (a few hours) but if we use an intelligent management of ballast consumption and if we chose the best launch site, it is possible to perform medium duration flights (10/20 days depending on the ballast on board). Flight train mass starts at 50kg for small balloons and reach 1000kg for larger ones. Zero pressure balloons are inflated with helium gas. 2. Super pressure balloons: Diameter going from 2.5m to 12m, this kind of envelop is ideal for long duration flights (1 to 6 months). Flight train is inside the envelop for small balloons, it means 2.5 diameter meters which is usually called BPCL (Super pressure balloon for Earth boundary layer) and it is about 3kg of mass. Larger ones could lift external flight trains about 50kg of mass. Super pressure balloons are inflated with helium gas. 3. MIR balloons: Size going from 36,000m3 to 46,000m3. Ceiling is reach with helium gas but after three days helium is no longer present inside and lift force is produced by difference of temperature between air inside and air of atmosphere. Flight trains must not be over 50kg. 4. Aero Clipper balloons: A concept to correlate measurements done in oceans and in nearest layers of atmosphere simultaneously. Flight train is made by a "fish" that drags inside water and an atmospheric gondola few meters above "fish", both pushed by a balloon which profits of the wind force. Materials used for construction and assembling depend on balloon type; they are usually made of polyester or polyethylene. Thickness varies from 12 micrometers to 120 micrometers. Balloon assembling
Janichewski, S.; Ben Aı̈m, H.
2004-04-01
CNES's latest strategic plan defines the French space agency's strategic focus and charts its course for the 2001-2005 timeframe. Based on a vision of how the space sector will evolve over the period up to 2010, the Strategic Plan sets out the agency's ambition for 2005: " CNES—space technology serving society". This ambition is structured around four challenges: Focusing actions on society's needs in three areas where space technology can make a major difference—environment, science and the information society and mobility. Building the foundation for success by ensuring competitive access to space and boosting basic research and technological innovation. Strengthening national and European synergies to ensure complementarity between: the ESA European framework, which is well adapted for major projects and the development of a European Space Strategy (ESS); and the national framework to support activities of national responsibility such as defence, science and technology development, and to improve competitiveness through direct international cooperation with other space agencies. Forging effective partnerships with its research and industry partners in Europe and France to enhance performance by: developing a service culture; building partnerships; concentrating on core competencies where it can most add value; improving skills and responsiveness in line with its strategic position; ensuring transparent and rigorous management of public funds. This Strategic Plan will be implemented in the 2001-2005 timeframe at all management levels. Implementation will be eased by the fact that the plan has been drawn up through a specific process designed to make internal management aware of the analysis underlying it. This will ensure that all stakeholders understand and appropriate the plan's orientations and thus play an active role in CNES' development. This process involved five successive steps: shared assessment of the space sector's evolution, providing a common
MYRIADE: CNES Micro-Satellite Program
Thoby, Michel
2001-01-01
CNES is currently leading the development of a program of micro-satellites, which has been now blessed with a name in line with the ambition: MYRIADE. The intention is to primarily fulfill the needs of the national scientific research in small space missions. Technology experiments as well as demonstration flights for new mission concepts shall however not be forgotten. The main objective is to make access to space much easier and affordable. The first five scientific and technological mixed ...
Electric current activated/assisted sintering (ECAS): a review of patents 1906-2008
International Nuclear Information System (INIS)
Grasso, Salvatore; Sakka, Yoshio; Maizza, Giovanni
2009-01-01
The electric current activated/assisted sintering (ECAS) is an ever growing class of versatile techniques for sintering particulate materials. Despite the tremendous advances over the last two decades in ECASed materials and products there is a lack of comprehensive reviews on ECAS apparatuses and methods. This paper fills the gap by tracing the progress of ECAS technology from 1906 to 2008 and surveys 642 ECAS patents published over more than a century. It is found that the ECAS technology was pioneered by Bloxam (1906 GB Patent No. 9020) who developed the first resistive sintering apparatus. The patents were searched by keywords or by cross-links and were withdrawn from the Japanese Patent Office (342 patents), the United States Patent and Trademark Office (175 patents), the Chinese State Intellectual Property Office of P.R.C. (69 patents) and the World Intellectual Property Organization (12 patents). A subset of 119 (out of 642) ECAS patents on methods and apparatuses was selected and described in detail with respect to their fundamental concepts, physical principles and importance in either present ECAS apparatuses or future ECAS technologies for enhancing efficiency, reliability, repeatability, controllability and productivity. The paper is divided into two parts, the first deals with the basic concepts, features and definitions of basic ECAS and the second analyzes the auxiliary devices/peripherals. The basic ECAS is classified with reference to discharge time (fast and ultrafast ECAS). The fundamental principles and definitions of ECAS are outlined in accordance with the scientific and patent literature. (topical review)
CNES-NASA Disruption-Tolerant Networking (DTN) Interoperability
Mortensen, Dale; Eddy, Wesley M.; Reinhart, Richard C.; Lassere, Francois
2014-01-01
Future missions requiring robust internetworking services may use Delay-Disruption-Tolerant Networking (DTN) technology. CNES, NASA, and other international space agencies are committed to using CCSDS standards in their space and ground mission communications systems. The experiment described in this presentation will evaluate operations concepts, system performance, and advance technology readiness for the use of DTN protocols in conjunction with CCSDS ground systems, CCSDS data links, and CCSDS file transfer applications
DEFF Research Database (Denmark)
Hansen, Carsten Ørts; Grønsedt, Peter; Hendriksen, Christian
This report examines the effect that ECA-zone regulation has on the optimal vessel fuel strategies for compliance. The findings of this report are trifold, and this report is coupled with a calculation tool which is released to assist ship-owners in the ECA decision making. The first key insight...... much time their operated vessels navigate the ECA in the future....
A space Fresnel imager concept assessment study led by CNES for astrophysical applications
Hinglais, Emmanuel
2011-06-01
In 2009, the Centre National d'Etudes Spatiales (CNES) carried out an assessment study on a "Fresnel telescope" concept based on a two-spacecraftformation flying configuration. This concept uses a binary Fresnel zone plate, and the principle of diffraction focusing, which allows high resolution optical imaging for astrophysics. In addition to CNES, the Laboratoire d'Astrophysique de Toulouse Tarbes (LATT) was deeply involved at two levels: through Research & Technology (R&T) studies to simulate and validate on a test bench the Fresnel concept performance, and through active participation in the CNES team for the optical aspects and to define the astrophysical fields of Fresnel-based space missions. The study was conducted within the technical limitations that resulted from a compromise between the R&T state of the art and the potential scientific domains of interest. The main technical limitations are linked to the size of the primary Fresnel array and to its usable spectral bandwidth. In this framework, the study covers ambitious architectures, correlating the technology readiness of the main critical components with the time-scale and programmatic horizons. The possible scientific topics arise from this range of missions. In this paper, I present a mission launched by a Soyuz, dedicated to astrophysics in the Ultra Violet (UV) band: 120 to 300 nm using a 4-m Fresnel array. It could be competitive in the next fifteen years, whereas a 10-m aperture mission in different bands; UV, visible or Infra Red (IR) (up to 6 μm) could be achievable in the future. Larger missions, using a primary array larger than 20 m, request technologies not yet available but that will probably be based on new inflatable structures with membranes, as already tested in the USA for other ends.
ECA konverents ja kongress Bledis / Jaan Elken
Elken, Jaan, 1954-
2000-01-01
ECA (European Council of Artists) konverents ja aastakongress 12.-14. X 1999 Sloveenias. 1995. a. moodustatud ECA ühendab 24 Euroopa maa kunstnikke, kirjanikke, heliloojaid, näitlejaid, arhitekte. Konverents keskendus organisatsiooni siseprobleemidele. IAA-st (International Association of Art), mille tegevus on hetkel paralüseeritud
An Overview of the CNES Propulsion Program for Spacecraft
Cadiou, A.; Darnon, F.; Gibek, I.; Jolivet, L.; Pillet, N.
2004-10-01
This paper presents an overview of the CNES spacecraft propulsion activities. The main existing and future projects corresponding to low earth orbit and geostationary platforms are described. These projects cover various types of propulsion subsystems: monopropellant, bipropellant and electric. Monopropellant is mainly used for low earth orbit applications such as earth observation (SPOT/Helios, PLEIADES) or scientific applications (minisatellite PROTEUS line and micro satellites MYRIADE line). Bipropellant is used for geostationary telecommunications satellites (@BUS). The field of application of electric propulsion is the station keeping of geostationary telecommunication satellites (@BUS), main propulsion for specific probes (SMART 1) and fine attitude control for dedicated micro satellites (MICROSCOPE). The preparation of the future and the associated Research and Technology program are also described in the paper. The future developments are mainly dedicated to the performance improvements of electric propulsion which leads to the development of thrusters with higher thrust and higher specific impulse than those existing today, the evaluation of the different low thrust technologies for formation flying applications, the development of new systems to pressurize the propellants (volatile liquid, micro pump), the research on green propellants and different actions concerning components such as over wrapped pressure vessels, valves, micro propulsion. A constant effort is also put on plume effect in chemical and electrical propulsion area (improvement of tools and test activities) in the continuity of the previous work. These different R &T activities are described in detail after a presentation of the different projects and of their propulsion subsystems. The scientific activity supporting the development of Hall thrusters is going on in the frame of the GDR (Groupement de Recherche) CNRS / Universities / CNES / SNECMA on Plasma Propulsion.
The structure and significance of enterobacterial common antigen (ECA
Directory of Open Access Journals (Sweden)
Tomasz Kasper Goździewicz
2015-09-01
Full Text Available The enterobacterial common antigen (ECA is a carbohydrate-derived cell surface antigen present in all Gram-negative bacteria belonging to Enterobacteriaceae family. Biosynthetic pathways shared by ECA and LPS (endotoxin suggest close connections between these antigens. ECA occurs in three different forms: a phosphatidyl-linked linear polysaccharide anchored on the cell surface (ECAPG, a cyclic form built of 4-6 repeating units localized in the periplasm (ECACYC and as a linear polysaccharide covalently linked to LPS core oligosaccharide (ECALPS. Regardless of ECA form, poly- and oligosaccharides of ECA consist of the biological trisaccharide repeating units: →3-α-d-Fucp4NAc-(1→4-β-d-ManpNAcA-(1→4-α-d-GlcpNAc-(1→, where Fucp4NAc refers to 4-acetamido-2,4-dideoxygalactose, ManpNAcA to N-acetyl-mannosaminuronic acid and GlcpNAc to N-acetylglucosamine. ECAPG and ECALPS consisting of one unit with Fucp4NAc as a terminal sugar were also identified. The number of the studies shows its occurrence in all members of enteric bacteria with a few exceptions such as Erwinia chrysanthemi. The presence of ECA was also shown for such genera as Plesiomonas [4] and Yersinia [36], previously belonging to the Vibrionaceae and Pasteurellaceae families, respectively. It was one of the reasons to include these two taxa in the Enterobacteriaceae family. The function of ECA is not fully understood, but it was reported that its occurrence is important in resistance of bacterial cells to environmental conditions, such as bile salts in the human digestive tract. The immunogenicity of ECA seems very interesting in the fact that only sparse rough Gram-negative strains, such as Shigella sonnei phase II, Escherichia coli R1, R2, R4, K-12, and Yersinia enterocolitica O:3 are able to induce the production of specific anti-ECA antibodies. It is the effect of the ECALPS, and the evidence for the existence of such covalent linkage was provided by structural analysis of S
Designing for friendship: Becoming friends with your ECA
Stronks, Bas; Marriott, A.; Nijholt, Antinus; Pelachaud, C.; van der Vet, P.E.; Rist, T.; Heylen, Dirk K.J.; Ruttkay, Z.M.; Vilhjalmsson, H.
2002-01-01
This paper is about the design of Embodied Conversational Agents (ECAs). In this field of Human Computer Interaction (HCI) and Artificial Intelligence (AI), the design of ECAs, or ‘virtual humans’, and the communication between those agents and human users is the main object of our research. A lot
Davies, Kalina T J; Tsagkogeorga, Georgia; Rossiter, Stephen J
2014-12-19
The majority of DNA contained within vertebrate genomes is non-coding, with a certain proportion of this thought to play regulatory roles during development. Conserved Non-coding Elements (CNEs) are an abundant group of putative regulatory sequences that are highly conserved across divergent groups and thus assumed to be under strong selective constraint. Many CNEs may contain regulatory factor binding sites, and their frequent spatial association with key developmental genes - such as those regulating sensory system development - suggests crucial roles in regulating gene expression and cellular patterning. Yet surprisingly little is known about the molecular evolution of CNEs across diverse mammalian taxa or their role in specific phenotypic adaptations. We examined 3,110 vertebrate-specific and ~82,000 mammalian-specific CNEs across 19 and 9 mammalian orders respectively, and tested for changes in the rate of evolution of CNEs located in the proximity of genes underlying the development or functioning of auditory systems. As we focused on CNEs putatively associated with genes underlying the development/functioning of auditory systems, we incorporated echolocating taxa in our dataset because of their highly specialised and derived auditory systems. Phylogenetic reconstructions of concatenated CNEs broadly recovered accepted mammal relationships despite high levels of sequence conservation. We found that CNE substitution rates were highest in rodents and lowest in primates, consistent with previous findings. Comparisons of CNE substitution rates from several genomic regions containing genes linked to auditory system development and hearing revealed differences between echolocating and non-echolocating taxa. Wider taxonomic sampling of four CNEs associated with the homeobox genes Hmx2 and Hmx3 - which are required for inner ear development - revealed family-wise variation across diverse bat species. Specifically within one family of echolocating bats that utilise
2012-10-29
... Corporation of America; Eastern American Energy Corporation; First ECA Midstream LLC; Notice of Application Take notice that on October 16, 2012, Energy Corporation of America and Eastern American Energy Corporation (collectively, ECA), and First ECA Midstream LLC (First ECA Midstream), 501 56th Street SE...
MFE/Magnolia - A joint CNES/NASA mission for the earth magnetic field investigation
Runavot, Josette; Ousley, Gilbert W.
1988-01-01
The joint phase B study in the CNES/NASA MFE/Magnolia mission to study the earth's magnetic field are reported. The scientific objectives are summarized and the respective responsibilities of NASA and CNES are outlined. The MFE/Magnolia structure and power systems, mass and power budgets, attitude control system, instrument platform and boom, tape recorders, rf system, propellant system, and scientific instruments are described.
Crockford, Christopher; Newton, Judith; Lonergan, Katie; Madden, Caoifa; Mays, Iain; O'Sullivan, Meabhdh; Costello, Emmet; Pinto-Grau, Marta; Vajda, Alice; Heverin, Mark; Pender, Niall; Al-Chalabi, Ammar; Hardiman, Orla; Abrahams, Sharon
2018-02-01
Cognitive impairment affects approximately 50% of people with amyotrophic lateral sclerosis (ALS). Research has indicated that impairment may worsen with disease progression. The Edinburgh Cognitive and Behavioural ALS Screen (ECAS) was designed to measure neuropsychological functioning in ALS, with its alternate forms (ECAS-A, B, and C) allowing for serial assessment over time. The aim of the present study was to establish reliable change scores for the alternate forms of the ECAS, and to explore practice effects and test-retest reliability of the ECAS's alternate forms. Eighty healthy participants were recruited, with 57 completing two and 51 completing three assessments. Participants were administered alternate versions of the ECAS serially (A-B-C) at four-month intervals. Intra-class correlation analysis was employed to explore test-retest reliability, while analysis of variance was used to examine the presence of practice effects. Reliable change indices (RCI) and regression-based methods were utilized to establish change scores for the ECAS alternate forms. Test-retest reliability was excellent for ALS Specific, ALS Non-Specific, and ECAS Total scores of the combined ECAS A, B, and C (all > .90). No significant practice effects were observed over the three testing sessions. RCI and regression-based methods produced similar change scores. The alternate forms of the ECAS possess excellent test-retest reliability in a healthy control sample, with no significant practice effects. The use of conservative RCI scores is recommended. Therefore, a change of ≥8, ≥4, and ≥9 for ALS Specific, ALS Non-Specific, and ECAS Total score is required for reliable change.
Persuasive Dialogue Based on a Narrative Theory: An ECA Implementation
Cavazza, Marc; Smith, Cameron; Charlton, Daniel; Crook, Nigel; Boye, Johan; Pulman, Stephen; Moilanen, Karo; Pizzi, David; de La Camara, Raul Santos; Turunen, Markku
Embodied Conversational Agents (ECA) are poised to constitute a specific category within persuasive systems, in particular through their ability to support affective dialogue. One possible approach consists in using ECA as virtual coaches or personal assistants and to make persuasion part of a dialogue game implementing specific argumentation or negotiation features. In this paper, we explore an alternative framework, which emerges from the long-term development of ECA as "Companions" supporting free conversation with the user, rather than task-oriented dialogue. Our system aims at influencing user attitudes as part of free conversation, albeit on a limited set of topics. We describe the implementation of a Companion ECA to which the user reports on his working day, and which can assess the user's emotional attitude towards daily events in the office, trying to influence such attitude using affective strategies derived from a narrative model. This discussion is illustrated through examples from a first fully-implemented prototype.
Directory of Open Access Journals (Sweden)
Ioannis Doumanis
2015-09-01
Full Text Available Mobile Guides are mobile applications that provide players with local and location-based services (LBS, such as navigation assistance, where and when they need them most. Advances in mobile technologies in recent years have enabled the gamification of these applications, opening up new opportunities to transfer education and culture through game play. However, adding traditional game elements such as PBLs (points, badges, and leaderboards alone cannot ensure that the intended learning outcomes will be met, as the player’s cognitive resources are shared between the application and the surrounding environment. This distribution of resources prevents players from easily immersing themselves into the educational scenario. Adding artificial conversational characters (ECAs that simulate the social norms found in real-life human-to-human guide scenarios has the potential to address this problem and improve the player’s experience and learning of cultural narratives [1]. Although significant progress has been made towards creating game-like mobile guides with ECAs ([2], [3], there is still a lack of a unified framework that enables researchers and practitioners to investigate the potential effects of such applications to players and how to approach the concepts of player experience, cognitive accessibility and usability in this context. This paper presents a theoretically-well supported research framework consisted of four key components: differences in players, different features of the gamified task, aspects of how the ECA looks, sound or behaves and different mobile environments. Furthermore, it provides based on this framework a working definition of what player experience, cognitive accessibility and usability are in the context of game-like mobile guide applications. Finally, a synthesis of the results of six empirical studies conducted within this research framework is discussed and a series of design guidelines for the effective gamification
Cayeux, P.; Raballand, F.; Borde, J.; Berges, J.-C.; Meyssignac, B.
2007-01-01
Within the framework of a partnership agreement, EADS ASTRIUM has worked since June 2006 for the CNES formation flying experiment on the PRISMA mission. EADS ASTRIUM is responsible for the anti-collision function. This responsibility covers the design and the development of the function as a Matlab/Simulink library, as well as its functional validation and performance assessment. PRISMA is a technology in-orbit testbed mission from the Swedish National Space Board, mainly devoted to formation flying demonstration. PRISMA is made of two micro-satellites that will be launched in 2009 on a quasi-circular SSO at about 700 km of altitude. The CNES FFIORD experiment embedded on PRISMA aims at flight validating an FFRF sensor designed for formation control, and assessing its performances, in preparation to future formation flying missions such as Simbol X; FFIORD aims as well at validating various typical autonomous rendezvous and formation guidance and control algorithms. This paper presents the principles of the collision avoidance function developed by EADS ASTRIUM for FFIORD; three kinds of maneuvers were implemented and are presented in this paper with their performances.
Ship Compliance in Emission Control Areas: Technology Costs and Policy Instruments.
Carr, Edward W; Corbett, James J
2015-08-18
This paper explores whether a Panama Canal Authority pollution tax could be an effective economic instrument to achieve Emission Control Area (ECA)-like reductions in emissions from ships transiting the Panama Canal. This tariff-based policy action, whereby vessels in compliance with International Maritime Organisation (IMO) ECA standards pay a lower transit tariff than noncompliant vessels, could be a feasible alternative to petitioning for a Panamanian ECA through the IMO. A $4.06/container fuel tax could incentivize ECA-compliant emissions reductions for nearly two-thirds of Panama Canal container vessels, mainly through fuel switching; if the vessel(s) also operate in IMO-defined ECAs, exhaust-gas treatment technologies may be cost-effective. The RATES model presented here compares current abatement technologies based on hours of operation within an ECA, computing costs for a container vessel to comply with ECA standards in addition to computing the Canal tax that would reduce emissions in Panama. Retrofitted open-loop scrubbers are cost-effective only for vessels operating within an ECA for more than 4500 h annually. Fuel switching is the least-cost option to industry for vessels that operate mostly outside of ECA regions, whereas vessels operating entirely within an ECA region could reduce compliance cost with exhaust-gas treatment technology (scrubbers).
Siciliano, Mattia; Trojano, Luigi; Trojsi, Francesca; Greco, Roberta; Santoro, Manuela; Basile, Giuseppe; Piscopo, Fausta; D'Iorio, Alfonsina; Patrone, Manila; Femiano, Cinzia; Monsurrò, Mariarosaria; Tedeschi, Gioacchino; Santangelo, Gabriella
2017-06-01
Cognitive assessment for individuals with Amyotrophic Lateral Sclerosis (ALS) can be difficult because of frequent occurrence of difficulties with speech, writing, and drawing. The Edinburgh Cognitive and Behavioural ALS Screen (ECAS) is a recent multi-domain neuropsychological screening tool specifically devised for this purpose, and it assesses the following domains: executive functions, social cognition, verbal fluency and language (ALS-specific), but also memory and visuospatial abilities (Non-ALS specific). ECAS total score ranges from 0 (worst performance) to 136 (best performance). Moreover, a brief caregiver interview provides an assessment of behaviour changes and psychotic symptoms usually associated with ALS patients. The aim of the present study was to provide normative values for ECAS total score and sub-scores in a sample of Italian healthy subjects. Two hundred and seventy-seven Italian healthy subjects (151 women and 126 men; age range 30-79 years; educational level from primary school to university) underwent ECAS and Montreal Cognitive Assessment (MoCA). Multiple linear regression analysis revealed that age and education significantly influenced performance on ECAS total score and sub-scale scores. From the derived linear equation, a correction grid for raw scores was built. Inferential cut-off scores were estimated using a non-parametric technique and equivalent scores (ES) were computed. Correlation analysis showed a good significant correlation between adjusted ECAS total scores with adjusted MoCA total scores (r rho = 0.669, p < 0.0001). The present study provided normative data for the ECAS in an Italian population useful for both clinical and research purposes.
The CNES Gaia Data Processing Center: A Challenge and its Solutions
Chaoul, Laurence; Valette, Veronique
2011-08-01
After a brief reminder of the ESA Gaia project, this paper presents the data processing consortium (DPAC) and then the CNES data processing centre (DPCC). We focus on the challenge in terms of organisational aspects, processing capabilities, databases volumetry, and how we deal with these topics.
Singkhorn, Sawana; Tantisira, Mayuree H; Tanasawet, Supita; Hutamekalin, Pilaiwanwadee; Wongtawatchai, Tulaporn; Sukketsiri, Wanida
2018-03-13
Centella asiatica is widely considered the most important medicinal plant for treating and relieving skin diseases. Recently developed standardized extract of Centella asiatica ECa 233 has demonstrated positive effects on wound healing of incision and burn wound in rats. However, knowledge associated with wound healing mechanism of ECa 233 was scare. Therefore, this study aimed to investigate the effect and underlying molecular mechanisms of ECa 233 on the migration of a human keratinocyte cell line (HaCaT) using scratch wound healing assay. Formation of filopodia, a key protein in cell migration as well as signaling pathways possibly involved were subsequently assessed. It was found that HaCaT cell migration was significantly enhanced by ECa 233 in a concentration- and time-dependent manner. The filopodia formations were accordingly increased in exposure to ECa 233 at concentrations of 0.1-100 μg/ml. Furthermore, ECa 233 was found to significantly upregulate the expression of Rac1 and RhoA and to induce phosphorylation of FAK and Akt as well as ERK and p38 MAPK. Taken all together, it is suggestive that ECa 233 induces cell migration and subsequently promotes wound healing activity, through the activation of FAK, Akt, and MAPK signaling pathways thereby supporting the role of ECa 233 to be further developed for the clinical treatment of wound. Copyright © 2018 John Wiley & Sons, Ltd.
Status of the CNES-CEA joint program on space nuclear Brayton systems
International Nuclear Information System (INIS)
Carre, F.; Proust, E.; Chaudourne, S.; Keirle, P.; Tilliette, Z.; Vrillon, B.
1989-01-01
A Cooperative program between the French Centre National d'Etudes Spatiales (CNES) and the Commissariat a l'Engergie Atomique (CEA) was initiated in 1983, to investigate the possible development of 20 to 200 kWe space nuclear power systems to be launched by the next version of the European launcher, Ariane V. After completion in 1986 of preliminary conceptual studies of a reference 200 kWe turboelectric power system, an additional 3 year study phase was decided, with the double objective of assessing the potential advantage of nuclear power systems versus solar photovoltaic or dynamic systems in the 20 kWe power range, and comparing various reactor candidate technologies and systems options for 20 kWe space nuclear power systems, likely to meet the projected energy needs of future European space missions. The results of this study are discussed by the authors
Innovation Forms and Firm Export Performance: Empirical Evidence from ECA Countries
Directory of Open Access Journals (Sweden)
Andrzej Cieślik
2017-06-01
Full Text Available Objective: The main objective of this paper is to verify empirically the relationship between various forms of innovation and export performance of firms from European and Central Asian (ECA countries. Research Design & Methods: In our empirical approach we refer to the self-selection hypothesis derived from the Melitz (2003 model which proposed the existence of a positive relationship between firm productivity and the probability of exporting. We argue that innovation activities should be regarded as a key element that can increase the level of firm productivity. We focus our analysis on four forms of innovation activities: product, process, marketing, organizational and managerial innovation. The empirical implementation of our analytical framework is based on the probit model, applied to the fifth edition of the BEEPS firm level dataset covering 2011-2014. Findings: Our empirical results indicate that the probability of exporting is positively related to both product and process innovations. The marketing and managerial innovations do not seem to affect positively export performance of firms from ECA countries. Implications & Recommendations: It is recommended to develop innovation supporting mechanisms that would target both product and process innovations rather than other forms of innovation in the ECA countries. Contribution & Value Added: The originality of this work lies in the use of the multi-country firm level dataset that allows distinguishing between various forms of innovations in the ECA countries.
A comparative study of sensor fault diagnosis methods based on observer for ECAS system
Xu, Xing; Wang, Wei; Zou, Nannan; Chen, Long; Cui, Xiaoli
2017-03-01
The performance and practicality of electronically controlled air suspension (ECAS) system are highly dependent on the state information supplied by kinds of sensors, but faults of sensors occur frequently. Based on a non-linearized 3-DOF 1/4 vehicle model, different methods of fault detection and isolation (FDI) are used to diagnose the sensor faults for ECAS system. The considered approaches include an extended Kalman filter (EKF) with concise algorithm, a strong tracking filter (STF) with robust tracking ability, and the cubature Kalman filter (CKF) with numerical precision. We propose three filters of EKF, STF, and CKF to design a state observer of ECAS system under typical sensor faults and noise. Results show that three approaches can successfully detect and isolate faults respectively despite of the existence of environmental noise, FDI time delay and fault sensitivity of different algorithms are different, meanwhile, compared with EKF and STF, CKF method has best performing FDI of sensor faults for ECAS system.
Overview of CNES-CEA joint programme on space nuclear Brayton systems
International Nuclear Information System (INIS)
Carre, F.; Proust, E.; Chaudourne, S.; Keirle, P.; Tilliette, Z.; Vrillon, B.
1990-01-01
In 1982, a cooperative programme on space nuclear power systems was initiated between the French Centre National d'Etudes Spatiales (CNES) and the Commissariat a l'Energie Atomique (CEA), to assess the feasibility, lead time, cost, competitiveness and development prospects for space nuclear power systems (SPS) in the 20 to 200 kWe range. The present three-year study phase is primarily oriented toward the assessment of various reactor candidate technologies and system design options for nuclear SPS in the 20 kWe class, which corresponds to the expected power needs of the first European space missions, anticipated to begin in 2005. This paper presents an overview of the present programme phase, with emphasis on design studies of three reference design concepts for 20 kWe turboelectric nuclear power systems selected so as to cover a wide range of reactor temperatures and corresponding technologies. The systems differ mainly in their nuclear reactors which are: the Liquid Metal Fast Breeder derivative or UO 2 /Na/Stainless steel -650 0 C; the High Temperature Gas-cooled derivative or UO 2 /direct cycle/super alloys - 850 0 C; and the UN/Li/MoRe alloy - 1120 0 C. All three systems use a Brayton cycle with recuperation for power conversion. (author)
Status of the CNES-CEA joint program on space nuclear Brayton systems
International Nuclear Information System (INIS)
Carre, F.; Proust, E.; Chaudourne, S.; Keirle, P.; Tilliette, Z.; Vrillon, B.
1989-01-01
A cooperative program between the French Centre National d'Etudes Spatiales (CNES) and the Commissariat a l'Energie Atomique (CEA) was initiated in 1983, to investigate the possible development of 20 to 200 kWe space nuclear power systems to be launched by the next version of the European launcher, Ariane V. After completion in 1986 of preliminary conceptual studies of a reference 200 kWe turbo-electric power system, an additional 3 year study phase was decided, with the double objective of assessing the potential advantage of nuclear power systems versus solar photovoltaic or dynamic systems in the 20 kWe power range, and comparing various reactor candidate technologies and system options for 20 kWe space nuclear power systems, likely to meet the projected energy needs of future European space missions. A comprehensive program including conceptual design studies, operating transient analyses and technology base assessment, is currently applied to a few reference concepts of 20 kWe nuclear Brayton and thermoelectric systems, in order to establish sound technical and economical bases for selecting the design options and the development strategy of a first space nuclear power system in Europe
Pinto-Grau, Marta; Burke, Tom; Lonergan, Katie; McHugh, Caroline; Mays, Iain; Madden, Caoifa; Vajda, Alice; Heverin, Mark; Elamin, Marwa; Hardiman, Orla; Pender, Niall
2017-02-01
Cognitive and behavioural changes are an important aspect in Amyotrophic Lateral Sclerosis (ALS). The Edinburgh Cognitive and Behavioural ALS Screen (ECAS) briefly assesses these changes in ALS. To validate the ECAS against a standardised neuropsychological battery and assess its sensitivity and specificity using age and education adjusted cut-off scores. 30 incident ALS cases were assessed on both, ECAS and neuropsychological battery. Age and education adjusted cut-off scores were created from a sample of 82 healthy controls. ECAS composite scores (Total, ALS Specific and Non-Specific) were highly correlated with battery composite scores. High correlations were also observed between ECAS and full battery cognitive domains and subtests. The ECAS Total, ALS Specific and Non-Specific scores were highly sensitive to cognitive impairment. ECAS ALS-Specific cognitive domains also evidenced high sensitivity. Individual subtest sensitivity was medium to low, suggesting that caution should be used when interpreting these scores. Low positive predictive values indicated the presence of false positives. Psychometric properties of the ECAS using age and education adjusted norms indicate that the ECAS, when used as an overall measure of cognitive decline, is highly sensitive. Further comprehensive assessment is required for patients that present as impaired on the ECAS.
ECAE-processed Cu-Nb and Cu-Ag nanocomposite wires for pulse magnet applications
International Nuclear Information System (INIS)
Edgecumbe Summers, T.S.; Walsh, R.P.; Pernambuco-Wise, P.
1997-01-01
Cu-Nb and Cu-Ag nanocomposites have recently become of interest to pulse magnet designers because of their unusual combination of high strength with reasonable conductivity. In the as-cast condition, these conductors consist of two phases, one of almost pure Nb (or Ag) and the other almost pure Cu. When these castings are cold worked as in a wire-drawing operation for example, the two phases are drawn into very fine filaments which produce considerable strengthening without an unacceptable decrease in conductivity. Unfortunately, any increase in strength with operations such as wire drawing is accompanied by a reduction in the cross section of the billet, and thus far, no wires with strengths on the order of 1.5 GPa or more have been produced with cross sections large enough to be useful in magnet applications. Equal Channel Angular Extrusion (ECAE) is an innovative technique which allows for the refinement of the as-cast ingot structure without a reduction in the cross sectional dimensions. Samples processed by the ECAE technique prior to wire drawing should be stronger at a given wire diameter than those processed by wire drawing alone. The tensile properties of wire-drawn Cu-18%Nb and Cu-25%Ag both with and without prior ECAE processing were tested and compared at both room temperature and 77K. All samples were found to have resistivities consistent with their strengths, and the strengths of the ECAE-processed wires were significantly higher than their as-cast and drawn counterparts. Therefore, with ECAE processing prior to wire drawing, it appears to be possible to make high-strength conductors with adequately large cross sections for pulse magnets
Energy Conversion Alternatives Study (ECAS)
1977-01-01
ECAS compared various advanced energy conversion systems that can use coal or coal-derived fuels for baseload electric power generation. It was conducted in two phases. Phase 1 consisted of parametric studies. From these results, 11 concepts were selected for further study in Phase 2. For each of the Phase 2 systems and a common set of ground rules, performance, cost, environmental intrusion, and natural resource requirements were estimated. In addition, the contractors defined the state of the associated technology, identified the advances required, prepared preliminary research and development plans, and assessed other factors that would affect the implementation of each type of powerplant. The systems studied in Phase 2 include steam systems with atmospheric- and pressurized-fluidized-bed boilers; combined cycle gas turbine/steam systems with integrated gasifiers or fired by a semiclean, coal derived fuel; a potassium/steam system with a pressurized-fluidized-bed boiler; a closed-cycle gas turbine/organic system with a high-temperature, atmospheric-fluidized-bed furnace; a direct-coal-fired, open- cycle magnetohydrodynamic/steam system; and a molten-carbonate fuel cell/steam system with an integrated gasifier. The sensitivity of the results to changes in the ground rules and the impact of uncertainties in capital cost estimates were also examined.
A CNES remote operations center for the MSL ChemCam instrument
Energy Technology Data Exchange (ETDEWEB)
Wiens, Roger C [Los Alamos National Laboratory; Lafaille, Vivian [CNES; Lorgny, Eric [CNES; Baroukh, Julien [CNES; Gaboriaud, Alain [CNES; Saccoccio, Muriel [CNES; Perez, Rene [CNES; Gasnault, Olivier [CNRS/CESR; Maurice, Sylvestre [CNRS/CESR; Blaney, Diana [JPL
2010-01-01
For the first time, a CNES remote operations center in Toulouse will be involved in the tactical operations of a Martian rover in order to operate the ChemCam science instrument in the framework of the NASA MSL (Mars Science Laboratory) mission in 2012. CNES/CESR and LANL have developed and delivered to JPL the ChemCam (Chemistry Camera) instrument located on the top of mast and in the body of the rover. This instrument incorporates a Laser-Induced Breakdown Spectrometer (LIBS) and a Remote Micro-Imager (RMI) for determining elemental compositions of rock targets or soil samples at remote distances from the rover (2-7 m). An agreement has been achieved for operating ChemCam, alternatively, from Toulouse (FR) and Los Alamos (NM, USA), through the JPL ground data system in Pasadena (CA, USA) for a complete Martian year (2 years on Earth). After a brief overview of the MSL mission, this paper presents the instrument, the mission operational system and JPL organization requirements for the scientific investigators (PI and Co-Is). This paper emphasizes innovations applied on the ground segment components and on the operational approach to satisfy the requirements and constraints due to these shared and distributed operations over the world.
Chen, Size; Chen, Xuemei; Li, Yuqi; Yang, Shu; Mo, Xianyi; Zhang, Fan; Mo, Kailan; Ding, Ying
2015-06-01
To investigate the effect of 17-AAG combined with paclitaxel (PTX) on the proliferation and apoptosis of esophageal squamous cell carcinoma cell line Eca-109 in vitro. Eca-109 cells were treated with 17-AAG and PTX either alone or in combination. The proliferation of Eca-109 cells was detected by MTT assay, and the cell cycle changes and cell apoptosis were determined by flow cytometry. Compared with the control group, both 17-AAG and PTX significantly inhibited the proliferation of Eca-109 cells. A combined treatment of the cells with 0.5 µmol/L PTX and 0.625 µmol/L 17-AAG produced an obviously stronger inhibitory effect on the cell proliferation than either of the agents used alone (PAAG and PTX used alone caused Eca-109 cell cycle arrest in G2/M phase and S phase, respectively, and their combined use caused cell cycle arrest in both G2/M and S phases. The cell apoptosis rates of Eca-109 cells treated with 17-AAG, PTX and their combination were 4.52%, 10.91%, and 29.88%, respectively, all significantly higher than that in the control group (1.32%); the combined treatment resulted in a distinct apoptotic peak that was significantly higher than that caused by either of the agents alone. 17-AAG and PTX can inhibit cell proliferation and promote apoptosis of Eca-109 cells, and their combination produces stronger effects in inhibiting cell proliferation and increasing cell apoptosis.
Andrographolide radiosensitizes human esophageal cancer cell line ECA109 to radiation in vitro.
Wang, Z-M; Kang, Y-H; Yang, X; Wang, J-F; Zhang, Q; Yang, B-X; Zhao, K-L; Xu, L-P; Yang, L-P; Ma, J-X; Huang, G-H; Cai, J; Sun, X-C
2016-01-01
To explore the radiosensitivity of andrographolide on esophageal cancer cell line ECA109. The inhibition effects of andrographolide were measured using 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium (MTT) assay. Clonogenic survival assay was used to evaluate the effects of andrographolide on the radiosensitivity of esophageal cancer cells. Immunofluorescence was employed to examine Bax expression. The changes in cell cycle distribution and apoptosis were assayed using flow cytometry. The expression of NF-κb/Cleaved-Caspase3/Bax/Bcl-2 was measured using Western blot analysis. DNA damage was detected via γ-H2AX foci counting. With a clear dose and time effects, andrographolide was found to inhibit the proliferation of esophageal cell line ECA109. The results of the clonogenic survival assay show that andrographolide could markedly enhance radiosensitivity (P Andrographolide caused a dose-dependent increase in Cleaved-Caspase3/Bax protein expression and a decrease in Bcl-2/NF-κb expression. Apoptosis in andrographolide-treated ECA-109 increased significantly compared with the apoptosis in the simple drug and radiation combined with drug groups (P andrographolide combined with radiation group increased the number of DNA double chain breaks. Andrographolide can increase the radiosensitivity of esophageal cell line ECA109. This result may be associated with the decrease in the NF-κb level and the induced apoptosis of esophageal cancer cells. © 2014 International Society for Diseases of the Esophagus.
Cosas de muñecas : (las prácticas que habitan los objetos)
Suárez, Natalia
2015-01-01
El objeto muñeca, o las figuras similares a estas en las primeras culturas, fueron objetos mágicos de protección y culto. Todas las civilizaciones del mundo han realizado muñecas. A lo largo de la historia, el hombre ha encontrado diferentes formas de vincularse y de cargar de sentido a estos objetos, los ha utilizados para narrar cuentos, para expresar deseos y temores o para materializar una comunicación o establecer vínculos hacia otro espacio tiempo, abarcando una diversidad de relatos y ...
ECA3, a Golgi-localized P2A-type-ATPase, plays a crucial role in manganese nutrition in Arabidopsis
DEFF Research Database (Denmark)
Mills, Rebecca F.; Doherty, Melissa Louise; Lopez Marques, Rosa Laura
2008-01-01
and development, and transport processes play a key role in regulating their cellular levels. Arabidopsis (Arabidopsis thaliana) contains four P(2A)-type ATPase genes, AtECA1 to AtECA4, which are expressed in all major organs of Arabidopsis. To elucidate the physiological role of AtECA2 and AtECA3 in Arabidopsis...... not so striking because in this case all plants were severely affected. ECA3 partially restored the growth defect on high Mn of the yeast (Saccharomyces cerevisiae) pmr1 mutant, which is defective in a Golgi Ca/Mn pump (PMR1), and the yeast K616 mutant (Deltapmc1 Deltapmr1 Deltacnb1), defective in Golgi...
O ECA e a violência na sala de aula: vulnerabilidade da escola brasileira
Directory of Open Access Journals (Sweden)
Marilda da Silva
2015-12-01
Full Text Available http://dx.doi.org/10.5007/2175-795X.2015v33n2p789 Este artigo trata de uma pesquisa quanti-qualitativa exploratória sobre a produção do fenômeno violência em espaço escolar, especificamente a violência cometida por professores em sala de aula contra crianças e adolescentes, explicitando a vulnerabilidade institucional que essa violência gera. O objetivo é abrir uma chave interpretativa sobre violência em sala de aula por professores contra alunos à luz do Estatuto da Criança e do Adolescente (ECA e do mecanismo da produção da cultura da violência, a partir desse entrecruzamento. As fontes foram o ECA e 184 histórias de escolarização produzidas nos anos de 2004, 2007 e 2010 por alunos do Curso de Pedagogia oferecido pela Faculdade de Ciências e Letras, campus de Araraquara, da Universidade Estadual Paulista Júlio de Mesquita Filho (UNESP, que diziam respeito às experiências vivenciadas na escolarização básica. As narrativas foram trabalhadas por meio de uma inflexão à Análise de Conteúdo, configurando uma análise categorial que permitiu uma base empírica que dialogou, analiticamente, com as prescrições do ECA. Dos resultados pode-se destacar que os professores cometem violência contra alunos na sala de aula de várias maneiras e por diferentes razões em todos os níveis de ensino; o tipo de violência mais cometida é a verbal; o contexto das situações em que ocorrem essa violência é, sobretudo, o de aprendizagem de algum conteúdo; a faixa etária mais atingida é de 8 a 9 anos; o ECA não é respeitado por professores no âmbito da relação professor-aluno. Sendo assim, esse conjunto gera vulnerabilidade da escola. ECA and violence in class: vulnerability of the Brazilian school Abstract This is a exploratory quantitative and qualitative research about school violence production, mainly when it is committed by teachers against children and adolescents, since it demonstrates the vulnerability of
Imagenología y distribución de cargas en la muñeca normal y postquirúrgica
Márquez Flórez, Kalenia María
2014-01-01
En este trabajo se determinó la distribución de cargas en la articulación radio-carpiana en la muñeca, bajo condiciones de carga y geometría, asociadas a tratamientos de artrodesis en estado estático. Para esto, se empleó el método discreto Rigid Body Spring Model (RBSM) en un modelo tridimensional de una muñeca sana. El método RBSM también se aplicó a modelos en los cuales se simularon condiciones de la muñeca luego de algún tratamiento de artrodesis, y los resultados obtenido...
2011-03-10
... that the program continues to recruit new diversity and talent, American Music Abroad musicians may... Accountability and Transparency Act (FFATA), and will be made available to the public by the Office of Management... sent to: Program Management Division, ECA-IIP/EX/PM, Ref.: ECA/PE/C/CU-11-09, SA-5, Floor 4, Department...
Artrosis de muñeca, estudio y opciones de tratamiento
Directory of Open Access Journals (Sweden)
Dr. G. Francisco Andrade
2014-09-01
Full Text Available La artrosis de muñeca es una patología que se origina generalmente tras una lesión ligamentosa intraósea del carpo, debido a una no unión de fractura de escafoides o después de una fractura articular del radio. Se sabe que la artrosis no mejora ni retrocede, por lo que se debe tener el tratamiento ideal para cada paciente según sus propias necesidades, que van desde el manejo médico (cambios de actividad, inmovilización, AINES o infiltración con corticoides. Cuando falla el tratamiento médico, se pueden realizar procedimientos poco invasivos como la denervación, carpectomía proximal o una artrodesis de cuatro esquinas. En estadios avanzados, sólo se puede proponer una artroplastia o artrodesis total de la muñeca.
Directory of Open Access Journals (Sweden)
C. J. Luis
2013-01-01
Full Text Available The manufacturing of a functional hollow mechanical element or ring of the AA5083 alloy previously equal channel angular extrusion (ECAE processed, which presents a submicrometric microstructure, is dealt with. For this purpose, the design of two isothermal forging dies (preform and final shape is carried out using the design of experiments (DOE methodology. Moreover, after manufacturing the dies and carrying out tests so as to achieve real rings, the mechanical properties of these rings are analysed as well as their microstructure. Furthermore, a comparison between the different forged rings is made from ECAE-processed material subjected to different heat treatments, previous to the forging stage. On the other hand, the ring forging process is modelled through the use of finite element simulation in order to improve the die design and to study the force required for the isothermal forging, the damage value, and the strain the material predeformed by ECAE has undergone. With this present research work, it is intended to improve the knowledge about the mechanical properties of nanostructured material and the applicability of this material to industrial processes that allow the manufacturing of functional parts.
Energy Technology Data Exchange (ETDEWEB)
Anon.
2003-02-01
A new type of tri-generation plant has been set up at the French national centre of space studies (CNES) in Toulouse (SW France) for the joint production of heat, coldness and electric power. Beside its high operational efficiency, this plant presents interesting energy and use flexibilities combined with low environmental impacts. (J.S.)
Directory of Open Access Journals (Sweden)
Marcella Castells i Sanabra
2014-03-01
Full Text Available Appendix III of MARPOL's Annex VI sets out the criteria and procedures for designating an emission control area (ECA.These criteria includes: a clear delineation of the proposed ECA; types of emissions proposed for control, land and sea areas at risk; emission quantification and impact assessment; prevailing weather conditions; data and quality on marine traffic; land based measures concurrent with the ECA adoption and the relative costs of reducing emissions from ships. This paper analyses the climate parameter together with traffic conditions: prevailing weather conditions as a parameter to be kept in mind for the adoption of a future ECA in the Mediterranean Sea. Preliminary results would show how marine emissions coming from existing traffic will impact the sea and land ecology in the Mediterranean area.
2010-07-01
... (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Recordkeeping and Reporting Requirements... in the NRLM diesel fuel, ECA marine fuel, and diesel fuel additive production, importation, and...
2010-07-01
... PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel General Information § 80.511 What are the per-gallon and... requirements that apply to NRLM diesel fuel, ECA marine fuel, and heating oil downstream of the refiner or...
EBSD Analysis of Deformed and Partially Recrystallized Microstructures in ECAE-Processed Copper
DEFF Research Database (Denmark)
Mishin, Oleg; Bowen, Jacob R.; Godfrey, A.
2012-01-01
The deformed microstructure and recrystallization behavior of copper samples processed using equal channel angular extrusion (ECAE) have been investigated. The heavily deformed microstructure was found to be non-uniform through the sample thickness and to vary in a manner consistent with the non...
Directory of Open Access Journals (Sweden)
Jeeser Alves Almeida
2012-04-01
Full Text Available FUNDAMENTO: O gene da enzima conversora de angiotensina (gene ECA tem sido amplamente estudado em relação a fenótipos de aptidão cardiorrespiratória, contudo a associação do genótipo da ECA com corridas de meia-distância tem sido pouco investigada. OBJETIVO: O presente estudo investigou a possível influência da enzima conversora de angiotensina (ECA (I/D sobre a aptidão cardiovascular e o desempenho em corridas de meia-distância por parte de brasileiros jovens do sexo masculino. A validade da previsão de VO2max em relação ao genótipo da ECA também foi analisada. MÉTODOS: Um grupo homogêneo de homens jovens moderadamente ativos foi avaliado em um teste de corrida (V1600 m; m.min-1 e em um teste adicional em esteira ergométrica para a determinação de VO2max. Posteriormente, o [(0,177*V1600m + 8.101] VO2max real e previsto foi comparado com os genótipos da ECA. RESULTADOS: O VO2max e V1600m registrados para os genótipos DD, ID e II foram 45,6 (1,8; 51,9 (0,8 e 54,4 (1,0 mL.kg-1.min-1 e 211,2 (8,3; 249,1 (4,3 e 258,6 (5,4 m.min-1, respectivamente e foram significativamente mais baixos para os genótipos DD (p < 0,05. O VO2max real e previsto não diferiram entre si, apesar do genótipo da ECA, mas o nível de concordância entre os métodos de VO2max real e estimado foi menor para o genótipo DD. CONCLUSÃO: Concluiu-se que existe uma possível associação entre o genótipo da ECA, a aptidão cardiovascular e o desempenho em corridas de média distância de jovens do sexo masculino moderadamente ativos e que a precisão da previsão do VO2max também pode ser dependente do genótipo da ECA dos participantes.
Camarero, R.; Thiebaut, C.; Dejean, Ph.; Speciel, A.
2010-08-01
Future CNES high resolution instruments for remote sensing missions will lead to higher data-rates because of the increase in resolution and dynamic range. For example, the ground resolution improvement has induced a data-rate multiplied by 8 from SPOT4 to SPOT5 [1] and by 28 to PLEIADES-HR [2]. Innovative "smart" compression techniques will be then required, performing different types of compression inside a scene, in order to reach higher global compression ratios while complying with image quality requirements. This socalled "selective compression", allows important compression gains by detecting and then differently compressing the regions-of-interest (ROI) and non-interest in the image (e.g. higher compression ratios are assigned to the non-interesting data). Given that most of CNES high resolution images are cloudy [1], significant mass-memory and transmission gain could be reached by just detecting and suppressing (or compressing significantly) the areas covered by clouds. Since 2007, CNES works on a cloud detection module [3] as a simplification for on-board implementation of an already existing module used on-ground for PLEIADES-HR album images [4]. The different steps of this Support Vector Machine classifier have already been analyzed, for simplification and optimization, during this on-board implementation study: reflectance computation, characteristics vector computation (based on multispectral criteria) and computation of the SVM output. In order to speed up the hardware design phase, a new approach based on HLS [5] tools is being tested for the VHDL description stage. The aim is to obtain a bit-true VDHL design directly from a high level description language as C or Matlab/Simulink [6].
Through-Thickness Variations of Deformed and Annealed Microstructures in ECAE-Processed Copper
DEFF Research Database (Denmark)
Mishin, Oleg; Bowen, Jacob R.
2009-01-01
in the deformed sample follows the distribution of strain imposed by ECAE, where lower strain is imparted to the material that passes through the outer die corner. Also, the macroscopic distribution of recrystallized grains as a function of depth in the billet is found to be in correspondence to the applied...
Solca, Federica; Faini, Andrea; Madotto, Fabiana; Lafronza, Annalisa; Monti, Alessia; Zago, Stefano; Doretti, Alberto; Ciammola, Andrea; Ticozzi, Nicola; Silani, Vincenzo; Poletti, Barbara
2018-01-01
Introduction: The observed association between depressive symptoms and cognitive performances has not been previously clarified in patients with amyotrophic lateral sclerosis (pALS). In fact, the use of cognitive measures often not accommodating for motor disability has led to heterogeneous and not conclusive findings about this issue. The aim of the present study was to evaluate the relationship between cognitive and depressive/anxiety symptoms by means of the recently developed Edinburgh Cognitive and Behavioral ALS Screen (ECAS), a brief assessment specifically designed for pALS. Methods: Sample included 168 pALS (114 males, 54 females); they were administered two standard cognitive screening tools (FAB; MoCA) and the ECAS, assessing different cognitive domains, including ALS-specific (executive functions, verbal fluency, and language tests) and ALS non-specific subtests (memory and visuospatial tests). Two psychological questionnaires for depression and anxiety (BDI; STAI/Y) were also administered to patients. Pearson’s correlation coefficient was used to assess the degree of association between cognitive and psychological measures. Results: Depression assessment negatively correlated with the ECAS, more significantly with regard to the executive functions subdomain. In particular, Sentence Completion and Social Cognition subscores were negatively associated with depression levels measured by BDI total score and Somatic-Performance symptoms subscore. Conversely, no significant correlations were observed between depression level and cognitive functions as measured by traditional screening tools for frontal abilities (FAB) and global cognition (MoCA) assessment. Finally, no significant correlations were observed between state/trait anxiety and the ECAS. Discussion and conclusion: This represents the first study focusing on the relationship between cognitive and psychological components in pALS by means of the ECAS, the current gold standard for ALS cognitive
Ship Technology Workshop Materials from Collaboration with Mexico to Reduce Emissions from Ships
On September 26, 2012, a ship technology seminar was held to provide Mexican stakeholders with information about some of the ship technologies needed to meet the requirements of MARPOL Annex VI and an ECA.
Modulation of the epithelial Ca2+ channel ECaC by extracellular pH.
Vennekens, R.; Prenen, J.; Hoenderop, J.G.J.; Bindels, R.J.M.; Droogmans, G.; Nilius, B.
2001-01-01
We investigated the effect of extracellular pH on whole-cell currents through the epithelial Ca2+ channel, ECaC, expressed in HEK 293 cells. Both mono- and divalent current densities were significantly smaller at pH 6.0 than at pH 7.4. At pH 8.5 they were slightly larger. Lowering extracellular pH
DORIS and GNSS processing at CNES/CLS for the contribution to the next ITRF2013
Loyer, Sylvain; Capdeville, Hugues; Soudarin, Laurent; Mezerette, Adrien; Lemoine, Jean-Michel; Mercier, Flavien; Perosanz, Felix
2014-05-01
CNES serves as Analysis Center in the International DORIS Service (IDS) and the International GNSS Service (IGS). DORIS and GNSS data are processed by its subsidiary CLS with the GRGS package software GINS/DYNAMO. For the contribution to the next release of the International Terrestrial Reference Frame planned this year (ITRF2013), two decades of data were analyzed (1993-2013 for DORIS, 1998-2013 for GPS, and 2009-2013 for GLONASS). In this context, the CNES/CLS Analysis Centers provided SINEX solutions to the IDS and IGS Combination Centers, respectively multi-satellite weekly solutions and daily solutions. Normal equations derived from this analysis are also made available to the GRGS Combination Center for the combination at the observation level of the geodetic parameters measured by DORIS, GPS, SLR and VLBI techniques. The purpose of this presentation is to point out how the overall quality of the DORIS and GNSS data processing benefits from the use of the same software and a common basis of models. Here, we present the modeling standards, the networks and the processing strategies. Assessments of some models are also discussed. The quality and the homogeneity of the products (orbits, station coordinates and Earth Orientation Parameters) over the complete period are shown, as well as the temporal variations of some parameters (dynamical parameters, orbit residuals, internal orbit overlaps ...). Some examples of time series of DORIS and GNSS station positions at collocated sites complete this presentation.
POPSCAN: A CNES Geo-Information Study for Re-Entry Risk Assessment
Fuentes, N.; Tholey, N.; Battiston, S.; Montabord, M.; Studer, M.
2013-09-01
Within the framework of the FSOA, French Space Operations Act (referred to as the "Loi relative aux Opérations Spatiales" or LOS in French), including in particular the monitoring of safety requirements for people and property, one major parameter to consider is Geographic Information (GI) on population distribution, human activity, and land occupation.This article gives an overview of the set of geographic and demographic data examined for CNES control offices, outlining the advantages and limits of each one : coverage, precision, update frequency, availability, distribution, ...It focuses on the two major available global population databases: GPW-GRUMP from CIESIN of COLUMBIA University and LandScan from ORNL. The work engaged on POPSCAN integrates digital analysis about these two world population grids and also comparisons on other databases such as GLOBAL- INSIGHT, VMAP0, ESRI, DMSP-ISA, GLOBCOVER, OpenFlights, ... for urban areas, communication networks, sensitive human activities and land use.
International Nuclear Information System (INIS)
Sanford, P.C.; Moe, M.A.; Hombach, W.G.; Urdangaray, R.
2013-01-01
The Department of Energy (DOE) Office of Environmental Management (EM) has developed a web-accessible database to collect actual cost data from completed EM projects to support cost estimating and analysis. This Environmental Cost Analysis System (ECAS) database was initially deployed in early 2009 containing the cost and parametric data from 77 decommissioning, restoration, and waste management projects completed under the Rocky Flats Closure Project. In subsequent years we have added many more projects to ECAS and now have a total of 280 projects from 8 major DOE sites. This data is now accessible to DOE users through a web-based reporting tool that allows users to tailor report outputs to meet their specific needs. We are using it as a principal resource supporting the EM Consolidated Business Center (EMCBC) and the EM Applied Cost Engineering (ACE) team cost estimating and analysis efforts across the country. The database has received Government Accountability Office review as supporting its recommended improvements in DOE's cost estimating process, as well as review from the DOE Office of Acquisition and Project Management (APM). Moving forward, the EMCBC has developed a Special Contract Requirement clause or 'H-Clause' to be included in all current and future EMCBC procurements identifying the process that contractors will follow to provide DOE their historical project data in a format compatible with ECAS. Changes to DOE O 413.3B implementation are also in progress to capture historical costs as part of the Critical Decision project closeout process. (authors)
Energy Technology Data Exchange (ETDEWEB)
Sanford, P.C. [Consultant, 11221 E. Cimmarron Dr., Englewood, CO 80111 (United States); Moe, M.A. [EMCBC Office of Cost Estimating and Analysis, United States Department of Energy, 250 E. 5th Street, Suite 500, Cincinnati, OH 45202 (United States); Hombach, W.G. [Team Analysis, Inc., 2 Cardinal Park Drive, Suite 105A, Leesburg, VA 20175 (United States); Urdangaray, R. [Project Performance Corporation, 1760 Old Meadow Road, McLean, VA 22102 (United States)
2013-07-01
The Department of Energy (DOE) Office of Environmental Management (EM) has developed a web-accessible database to collect actual cost data from completed EM projects to support cost estimating and analysis. This Environmental Cost Analysis System (ECAS) database was initially deployed in early 2009 containing the cost and parametric data from 77 decommissioning, restoration, and waste management projects completed under the Rocky Flats Closure Project. In subsequent years we have added many more projects to ECAS and now have a total of 280 projects from 8 major DOE sites. This data is now accessible to DOE users through a web-based reporting tool that allows users to tailor report outputs to meet their specific needs. We are using it as a principal resource supporting the EM Consolidated Business Center (EMCBC) and the EM Applied Cost Engineering (ACE) team cost estimating and analysis efforts across the country. The database has received Government Accountability Office review as supporting its recommended improvements in DOE's cost estimating process, as well as review from the DOE Office of Acquisition and Project Management (APM). Moving forward, the EMCBC has developed a Special Contract Requirement clause or 'H-Clause' to be included in all current and future EMCBC procurements identifying the process that contractors will follow to provide DOE their historical project data in a format compatible with ECAS. Changes to DOE O 413.3B implementation are also in progress to capture historical costs as part of the Critical Decision project closeout process. (authors)
2011-05-05
... for Grant Proposals: Youth Leadership Program Announcement Type: New Cooperative Agreement. Funding... Bureau of Educational and Cultural Affairs (ECA) announces an open competition for the Youth Leadership... leadership development, and to support follow-on projects in their home communities. U.S. Embassies in the...
Directory of Open Access Journals (Sweden)
Wang H
2014-06-01
Full Text Available Haiping Wang,1 Xiaobing Wang,1 Shaoliang Zhang,2 Pan Wang,1 Kun Zhang,1 Quanhong Liu1 1Key Laboratory of Medicinal Resources and Natural Pharmaceutical Chemistry, Ministry of Education, National Engineering Laboratory for Resource Developing of Endangered Chinese Crude Drugs in Northwest of China, College of Life Sciences, Shaanxi Normal University, Xi'an, Shaanxi, 2Qinglong High-Tech Co, Ltd, Yichun, Jiangxi, People's Republic of China Background: Sonodynamic therapy (SDT is a promising method that uses ultrasound to activate certain chemical sensitizers for the treatment of cancer. The purpose of this study was to investigate the sonoactivity of a novel sensitizer, sinoporphyrin sodium (DVDMS, and its sonotoxicity in an esophageal cancer (ECA-109 cell line. Methods: The fluorescence intensity of DVDMS, hematoporphyrin, protoporphyrin IX, and Photofrin II was detected by fluorescence microscopy and flow cytometry. Generation of singlet oxygen was measured using a 1, 3-diphenylisobenzofuran experiment. A 3-(4, 5-dimethylthiazol-2-yl-2, 5-diphenyl tetrazolium bromide assay was used to examine cell viability. Production of reactive oxygen species (ROS and destabilization of the mitochondrial membrane potential were assessed by flow cytometry. Apoptosis was analyzed using Annexin-PE/7-amino-actinomycin D staining. Confocal microscopy was performed to assess mitochondrial damage and identify release of cytochrome C after treatment. Western blots were used to determine expression of oxidative stress-related and apoptosis-associated protein. Ultrastructural changes in the cell were studied by scanning electron microscopy. Results: DVDMS showed higher autofluorescence intensity and singlet oxygen production efficiency compared with other photosensitizers in both cancerous and normal cells. Compared with hematoporphyrin, DVDMS-mediated SDT was more cytotoxic in ECA-109 cells. Abundant intracellular ROS was found in the SDT groups, and the cytotoxicity
International Nuclear Information System (INIS)
Ba, Yaye Awa; Wenger, Christian; Surleau, Romain; Boudon, Vincent; Rotger, Maud; Daumont, Ludovic; Bonhommeau, David A.; Tyuterev, Vladimir G.; Dubernet, Marie-Lise
2013-01-01
Two spectroscopic relational databases, denoted MeCaSDa and ECaSDa, have been implemented for methane and ethene, and included in VAMDC (Virtual Atomic and Molecular Data Centre, (http://portal.vamdc.eu/vamdc_portal/home.seam)). These databases collect calculated spectroscopic data from the accurate analyses previously performed for the electronic ground state of methane, ethene, and some of their isotopologues: 12 CH 4 , 13 CH 4 , and 12 C 2 H 4 . Both infrared absorption and Raman scattering lines are included. The polyad structures are reported and the transitions are precisely described by their energy, their intensity and the full description of the lower and upper states involved in the transitions. The relational schemas of ECaSDa and MeCaSDa databases are equivalent and optimised to enable the better compromise between data retrieval and compatibility with the XSAMS (XML Schema for Atoms, Molecules, and Solids) format adopted within the VAMDC European project. -- Highlights: • We present two new spectroscopic databases, MeCaSDa and ECaSDa. • They contain calculated line lists for methane and ethene, respectively. • They collect data from accurate analyses previously preformed. • They are included in the Virtual Atomic and Molecular Data Centre (VAMDC)
2011-05-10
... English, math, science and social studies although the majority of participants are teachers of English as... Award: Cooperative Agreement(s). ECA's level of involvement in this program is listed under number I... maximum levels of cost sharing and funding in support of its programs. When cost sharing is offered, it is...
2011-03-17
... methodology, etc. Please refer to guidance in PSI under ``Diversity, Freedom and Democracy Guidelines.'' I.8b..., (ECA/EC/D), SA-5, Floor C2, Department of State, Washington, DC 20037. IV.3d2. Diversity, Freedom and... including, but not limited to ethnicity, race, gender, religion, geographic location, socio-economic status...
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false What labeling requirements apply to retailers and wholesale purchaser-consumers of ECA marine fuel beginning June 1, 2014? 80.574 Section 80.574 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF...
Aslam, Roohi; Williams, Lorraine E; Bhatti, Muhammad Faraz; Virk, Nasar
2017-10-27
P 2 - type calcium ATPases (ACAs-auto inhibited calcium ATPases and ECAs-endoplasmic reticulum calcium ATPases) belong to the P- type ATPase family of active membrane transporters and are significantly involved in maintaining accurate levels of Ca 2+ , Mn 2+ and Zn 2+ in the cytosol as well as playing a very important role in stress signaling, stomatal opening and closing and pollen tube growth. Here we report the identification and possible role of some of these ATPases from wheat. In this study, ACA and ECA sequences of six species (belonging to Poaceae) were retrieved from different databases and a phylogenetic tree was constructed. A high degree of evolutionary relatedness was observed among P 2 sequences characterized in this study. Members of the respective groups from different plant species were observed to fall under the same clade. This pattern highlights the common ancestry of P 2- type calcium ATPases. Furthermore, qRT-PCR was used to analyse the expression of selected ACAs and ECAs from Triticum aestivum (wheat) under calcium toxicity and calcium deficiency. The data indicated that expression of ECAs is enhanced under calcium stress, suggesting possible roles of these ATPases in calcium homeostasis in wheat. Similarly, the expression of ACAs was significantly different in plants grown under calcium stress as compared to plants grown under control conditions. This gives clues to the role of ACAs in signal transduction during calcium stress in wheat. Here we concluded that wheat genome consists of nine P 2B and three P 2A -type calcium ATPases. Moreover, gene loss events in wheat ancestors lead to the loss of a particular homoeolog of a gene in wheat. To elaborate the role of these wheat ATPases, qRT-PCR was performed. The results indicated that when plants are exposed to calcium stress, both P 2A and P 2B gene expression get enhanced. This further gives clues about the possible role of these ATPases in wheat in calcium management. These findings can be
2011-11-17
..., freedom of expression, equality, and diversity and tolerance should be addressed. All Institutes should... expertise. The Institutes should address topics such as: civil rights, minority rights, politics, religion... for further information. IV.3d.2 Diversity, Freedom, and Democracy Guidelines Pursuant to ECA's...
Influência do polimorfismo I/D do gene da eca na HPE de jovens normotensos
Directory of Open Access Journals (Sweden)
Manuella de Oliveira Fernandes
2015-08-01
Full Text Available INTRODUÇÃO: A hipotensão pós-exercício (HPE é considerada uma estratégia não farmacológica adotada para redução da pressão arterial (PA. Ademais, sabe-se que a presença de alguns polimorfismos genéticos influencia a resposta pressórica, como o I/D do gene da enzima conversora da angiotensina (ECA. Objetivo: Analisar a influência do polimorfismo I/D da ECA sobre a HPE após três diferentes intensidades de exercício em jovens normotensos e fisicamente ativos.MÉTODOS: Vinte e seis jovens saudáveis (DD = 11; ID/II = 15 realizaram uma sessão máxima de 1.600 metros, na pista de atletismo e outras três sessões experimentais (Sessão Moderada: 6% abaixo do limiar anaeróbio, Sessão Intensa: 6% acima do limiar anaeróbio e Sessão de Controle, com aferições prévias da PA, por 20 minutos e posteriores ao exercício por 60 minutos.RESULTADOS: Observou-se que o exercício moderado ocasionou HPE independentemente do grupo genotípico, sendo mais evidente para a pressão arterial sistólica nos momentos 45 minutos e 60 minutos (p ≤ 0,05. Verificou-se também que a característica gênica exerceu influência sobre a área abaixo da curva pressórica (p ≤ 0,005 sobre a pressão arterial diastólica, formada 1 hora após o exercício.CONCLUSÃO: Conclui-se que o exercício moderado ocasiona HPE em jovens normotensos e fisicamente ativos, independentemente do polimorfismo I/D no gene da ECA, sendo que esse polimorfismo exerce influência sobre a hipotensão diastólica, e os indivíduos portadores do alelo I apresentam maior decaimento da PA diastólica (PAD.
Hoenderop, J.G.J.; Vennekens, R.; Müller, D.G.; Prenen, J.; Droogmans, G.; Bindels, R.J.M.; Nilius, B.
2001-01-01
1. The epithelial Ca(2+) channel (ECaC) family represents a unique group of Ca(2+)-selective channels that share limited homology to the ligand-gated capsaicin receptors, the osmolarity-sensitive channel OTRPC4, as well as the transient receptor potential family. Southern blot analysis demonstrated
Bertrand, Régis; Alby, Fernand; Costes, Thierry; Dejoie, Joël; Delmas, Dominique-Roland; Delobette, Damien; Gibek, Isabelle; Gleyzes, Alain; Masson, Françoise; Meyer, Jean-Renaud; Moreau, Agathe; Perret, Lionel; Riclet, François; Ruiz, Hélène; Schiavon, Françoise; Spizzi, Pierre; Viallefont, Pierre; Villaret, Colette
2012-10-01
The French Space Agency (CNES) is currently operating thirteen satellites among which five remote sensing satellites. This fleet is composed of two civilian (SPOT) and three military (HELIOS) satellites and it has been recently completed by the first PLEIADES satellite which is devoted to both civil and military purposes. The CNES operation board decided to appoint a Working Group (WG) in order to anticipate and tackle issues related to the emergency End Of Life (EOL) operations due to unexpected on-board events affecting the satellite. This is of particular interest in the context of the French Law on Space Operations (LSO), entered in force on Dec. 2010, which states that any satellite operator must demonstrate its capability to control the space vehicle whatever the mission phase from the launch up to the EOL. Indeed, after several years in orbit the satellites may be affected by on-board anomalies which could damage the implementation of EOL operations, i.e. orbital manoeuvres or platform disposal. Even if automatic recovery actions ensure autonomous reconfigurations on redundant equipment, i.e. setting for instance the satellite into a safe mode, it is crucial to anticipate the consequences of failures of every equipment and functions necessary for the EOL operations. For this purpose, the WG has focused on each potential anomaly by analysing: its emergency level, as well as the EOL operations potentially inhibited by the failure and the needs of on-board software workarounds… The main contribution of the WG consisted in identifying a particular satellite configuration called "minimal Withdrawal From Service (WFS) configuration". This configuration corresponds to an operational status which involves a redundancy necessary for the EOL operations. Therefore as soon as a satellite reaches this state, a dedicated steering committee is activated and decides of the future of the satellite with respect to three options: a/. the satellite is considered safe and can
2010-07-01
... Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel General... of marker solvent yellow 124. (2) All motor vehicle and NRLM diesel fuel shall be free of solvent... yellow 124 shall be considered motor vehicle diesel fuel or NRLM diesel fuel, as appropriate. (5) Any...
2010-07-01
... PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive... fuel will be segregated from motor vehicle diesel fuel, NRLM diesel fuel, or ECA marine fuel, as... documents associated with research and development motor vehicle diesel fuel must comply with requirements...
2010-07-01
... Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Exemptions... sulfur standards of § 80.520(a)(1) and (c) related to motor vehicle diesel fuel, of § 80.510(a), (b), and... 40 Protection of Environment 16 2010-07-01 2010-07-01 false What requirements apply to diesel fuel...
Inspection of welded zone and flat plate using flexible ECA probe
Energy Technology Data Exchange (ETDEWEB)
Lee, Chang Jun; Lee, Kyu Sung; Shin, Chung Ho; Lee, Kyoung Jun; Jang, Yoon Young [ANSCO Inc., Daejeon (Korea, Republic of)
2016-08-15
This paper aims to compare the ability to detect notch defects existing in the plate and welded area using a flexible ECA (eddy current array) probe with OmniScan MX and MS-5800E. The characteristics of signals with various frequencies and lift-offs were also compared. As a result, when signals of frequencies 500, 1000, and 1500 kHz were used, the amplitude of the signal increased, as the depth of the notch increased, but reduced linearly in accordance with the lift-off variation. In addition, the detection sensitivity of the weld defect was found to be closely related to the contact surface of the probe and specimen. In this paper, it was demonstrated that the detection sensitivity was excellent when the contact surface of the probe and the specimen was sufficient, but it was poor when the contact surface was insufficient.
Directory of Open Access Journals (Sweden)
Photiadou Christiana
2017-01-01
Full Text Available Climate change and climate variability profoundly affect the production of wine. When facing a changing climate, the characteristics of wine produced in each region will change while the natural year-to-year variations in climate will increase variability of income for wine businesses and therefore affect profitability and economic resilience. The challenge posed to the viticulture community is thus to closely monitor these changes to be able to adapt business practices. The European Climate Assessment and Dataset (ECA&D and its gridded version E-OBS are tools to monitor the changing climatic conditions over Europe, with an emphasis on changes in extreme climatic conditions. In this paper, the potential of ECA&D and E-OBS for viticulture is demonstrated by a few examples. The examples include the changing areal suitable for Chardonnay cultivation, showing an expansion to areas which have been too cold only a few decades ago and retraction of optimal conditions from areas which have been suitable in the recent past. Other examples show the change in the diurnal temperature range in the latter stages of the ripening process of grapes and the variability in heavy precipitation events. Finally, first results of a new dataset for South America are presented.
Elckerlyc goes mobile: enabling technology for ECAs in mobile applications
Klaassen, Randy; Hendrix, J.; Reidsma, Dennis; op den Akker, Hendrikus J.A.
2012-01-01
The fast growth of computational resources and speech technology available on mobile devices makes it pos- sible for users of these devices to interact with service sys- tems through natural dialogue. These systems are sometimes perceived as social agents and presented by means of an animated
Directory of Open Access Journals (Sweden)
Sonia Boczkal
2011-05-01
Full Text Available In 2014 alloy deformed by Equal Channel Angular Extrusion process (ECAE the changes in the size and shape of structural constituents were examined. The samples subjected after deformation to additional annealing at 300°C/10min were characterized by larger grains of nearly-equiaxial shapes. The microstructure after deformation was composed of a large number of the mutually crossing bands and microbands. The intersection of microbands resulted in formation of rectangular and rhombohedral grains. It was noted that the average grain size after ε = 4.6 (4 passes was 0.2 μm.
MUJERES BRAVAS: REPRESENTACIONES DE LA VIOLENCIA EN MUÑECA BRAVA DE LUCÍA GUERRA
Directory of Open Access Journals (Sweden)
Paula Daniela Bianchi
2013-01-01
Full Text Available El propósito de este texto es explorar algunas representaciones de cuerpos muertos de prostitutas que responden a diversas articulaciones —discursivas, sexuales y políticas— en la novela de Lucía Guerra Muñeca brava (1993. Para abordar este análisis se teje una cartografía textual vinculada con distintos modos de producción que atraviesan escenas simbólicas con nociones de rituales funerarios y “usos” de estos cuerpos en relación con diferentes representaciones de la violencia. El cuerpo de las prostitutas resignifica el espacio de la calle como lugar de lucha política invisibilizado por la dictadura chilena.
Gondola development for CNES stratospheric balloons
Vargas, A.; Audoubert, J.; Cau, M.; Evrard, J.; Verdier, N.
The CNES has been supporting scientific ballooning since its establishment in 1962. The two main parts of the balloon system or aerostat are the balloon itself and the flight train, comprising the house-keeping gondola, for the control of balloon flight (localization and operational telemetry & telecommand - TM/TC), and the scientific gondola with its dedicated telecommunication system. For zero pressure balloon, the development of new TM/TC system for the housekeeping and science data transmission are going on from 1999. The main concepts are : - for balloon house-keeping and low rate scientific telemetry, the ELITE system, which is based on single I2C bus standardizing communication between the different components of the system : trajectography, balloon control, power supply, scientific TM/TC, .... In this concept, Radio Frequency links are developed between the house keeping gondola and the components of the aerostat (balloon valve, ballast machine, balloon gas temperature measurements, ...). The main objectives are to simplify the flight train preparation in term of gondola testing before flight, and also by reducing the number of long electrical cables integrated in the balloon and the flight train; - for high rate scientific telemetry, the use of functional interconnection Internet Protocol (IP) in interface with the Radio Frequency link. The main idea is to use off-the-shelf IP hardware products (routers, industrial PC, ...) and IP software (Telnet, FTP, Web-HTTP, ...) to reduce the development costs; - for safety increase, the adding, in the flight train, of a totally independent house keeping gondola based on the satellite Inmarsat M and Iridium telecommunication systems, which permits to get real time communications between the on-board data mobile and the ground station, reduced to a PC computer with modem connected to the phone network. These GEO and LEO telecommunication systems give also the capability to operate balloon flights over longer distance
Marinho, Mara de A.; Dafonte, Jorge D.; Armesto, Montserrat V.; Paz-González, Antonio; Raposo, Juan R.
2013-04-01
Spatial characterization of the variability of soil properties is a central point in site-specific agricultural management and precision agriculture. Geospatial measures of geophysical attributes are useful not only to rapidly characterize the spatial variability of soil properties but also for soil sampling optimization. This work reports partial results obtained at an experimental parcel under pasture located at Castro de Ribeira do Lea (Lugo/ Galicia/ Spain). An ECa automated survey was conducted in September 2011 employing an EM-38 DD (Geonics Ltd.) installed in a nonmetallic car, according to parallel lines spaced 10m one from each other and oriented at the east-west direction. The ECa values were recorded every second with a field computer and the locations were geo-referenced using a GPS. The entire survey was carried out in 1hour and 45 minutes and corrections due to differences in temperature were made. A total of 9.581 ECa registers were retained, configuring a sampling intensity of approximately 1 register per 1.5 m2. Employing the software ESAP 2.35 and the computational tool ESAP-RSSD, eighty positions were selected at the field to extract disturbed and undisturbed soil samples at two depths: 0.0-0.2m, 0.2-0.4m. Ten physical attributes (clay, silt, total sand, coarse sand and fine sand contents, soil bulk density, particle density, total porosity, soil water content, percentage of gravels) and 17 chemical attributes (soil organic matter-SOM, pH, P, K, Ca, Mg, Al, H+Al, Sum of bases-S, Cation exchange capacity-CEC, Base saturation-V%, Cd, Cr, Cu, Fe, Mn, Ni, Pb and Zn) were determined. The relationship between the geophysical variables and the soil attributes was performed using statistical and spatial analysis. There were significant correlations (pmanagement zones in the area. Acknowledgements: This work was funded in part by Spanish Ministry of Science and Innovation (MICINN) in the frame of project CGL2009-13700-C02. Financial support from CAPES
Directory of Open Access Journals (Sweden)
Alkorta, J.
2004-04-01
Full Text Available Al 5083 samples have been subjected to 90º equal-channel angular extrusion (ECAE at 270ºC. After ECAE, the microhardness was measured and the texture for the plane perpendicular to the extrusion direction was analysed by X-Rays and EBSD. The microstructure was characterized by optical microscopy and EBSD. As deformation accumulates the hardness increases until it reaches saturation at an effective strain of about ε∼4. With regard to the texture, it has been shown that a high density of {111} planes are oriented parallel to the shear plane of the last pass.
Varias muestras de aluminio 5083 se han sometido a extrusiones en canal angular de 90º a 270ºC. A continuación se midieron las durezas de las muestras obtenidas y se caracterizó la textura en el plano perpendicular a la dirección de extrusión mediante Rayos-X y difracción de electrones retrodispersados (EBSD. La caracterización microestructural se hizo mediante microscopio óptico y EBSD. Se ha observado que la dureza aumenta sensiblemente con el grado de deformación y que alcanza un nivel máximo de saturación a partir de ε∼4. En cuanto a la textura, se observa que los planos {111} tienden a orientarse paralelos al plano de la última cortadura.
The Design and Simulation of the Modular Vehicle Air Suspension Height Control System Based on ECAS
Directory of Open Access Journals (Sweden)
Yang Peigang
2014-02-01
Full Text Available Based on ECAS, this paper intended to develop a modular air suspension height control system with WABCO4728800010 two-position three way solenoid valves and Free scale MC9S12D64 microprocessor as its core components. And a simulation test was conducted in MATLAB/Simulink environment. The air suspension height control strategy of this system was divided into four modules: start control module, dynamic adjustment module, manual adjustment module and errors adjustment module, which were controlled by module select switch. Simulation tests indicated that the air suspension height control strategy is featured by its logical control accuracy and debug convenience, and the modular design greatly reduced the system complexity and software development cycle and costs as well.
The DECLIC Research Facility - a Fertile Platform for NASA/CNES Scientific Collaboration
Hicks, Michael C.; Hegde,Uday G.; Hahn, Inseob; Strutzenberg, Louise S.; Pont, Gabriel; Zappoli, Bernard
2012-01-01
The DECLIC (Device for the Study of Critical Liquids and Crystalization) Facility was launched to the International Space Station (ISS) on Shuttle flight 17-A (August 2009) and has been in service for a little over three years. Activity from the three originally planned investigations, the HTI (High Temperature Insert) investigation, the ALI (Alice Like Insert) investigation and the DSI (Directional Solidication Insert) investigation has led to fruitful collaborations among a team of scientists, sponsored by NASA and CNES, to extend the utility of the inserts and the breadth of science beyond its initial scope. These follow-on investigations plan to use inserts that have been returned to earth for refurbishment, two of which (i.e., HTI-R and DSI-R) simply entail changing the test sample and the third (i.e., ALI-R) entails a slight hardware modication to allow for precise changes in sample volume. The first investigation, the Supercritical Water Mixture (SCWM) experiment, uses the refurbished HTI-R, which will accommodate a dilute aqueous mixture of Na2SO4 -0.5% w. This investigation will extend earlier observations of pure water at near-critical conditions. The second experiment uses a modified insert, the DSI-R, with a different concentration of succinonitrile-camphor than the original flight sample. This will allow, among other objectives, a detailed study of dendritic sidebranch formation in extended three-dimensional arrays, with the goal of elucidating whether noise amplication and/or a deterministic limit cycle is the main cause of sidebranch formation. The final experiment, the ALI-R, uses a sample cell with variable density to allow for additional observations of thermo-physical properties on SF6 at near critical conditions. The presentation will provide a discussion of the DECLIC facility's hardware, its modied inserts, and an overview of the extended science that will be achieved through these collaborative activities.
Directory of Open Access Journals (Sweden)
Senior Roca , Diana Margarita
2008-09-01
Full Text Available Teniendo en cuenta el impacto que los resultados de los exámenes de calidad de la educación superior (ECAES tienen en la comunidad académica en general, se consideró importante estudiar aspectos sociodemográficos, psicol ógicos y condiciones educativas relacionadas con la vida universitaria, de estudiantes que obtuvieron puntajes en el examen ECAES, por encima de dos desviaciones estándar; calificación que supera al 97% de la poblaci ón que presenta este examen. Se pretende contribuir con este trabajo a la reflexión y análisis sobre el rendimiento académico, para incorporar los resultados encontrados, en el diseño de alternativas de trabajo que ayuden a otros estudiantes a alcanzar el éxito académico. En este estudio participaron 36 profesionales de psicología, egresados de cinco universidades colombianas. Se encontró que estos estudiantes se caracterizan porque atribuyen su alto puntaje en el ECAES a su capacidad intelectual, consideran que el éxito académico se debe a su esfuerzo personal, no tienen problemas para leer y comprender textos en inglés, tienen fácil acceso a Internet, se encuentran motivados para seguir estudiando luego de culminar su carrera universitaria, desean realizar estudios fuera del país, las actividades académicas desarrolladas en la universidad tenían sentido para ellos, no les preocupaba que los docentes fueran estrictos, se encontraban orgullosos de pertenecer a su universidad y consideraban que su opinión era tenida en cuenta al momento de tomar decisiones en su familia. Los resultados suministrados por la prueba AF-5, muestran que tienen un autoconcepto alto en la dimensión académico-laboral.
Guhl, Emily N; Schlusser, Courtney L; Henault, Lori E; Bickmore, Timothy W; Kimani, Everlyne; Paasche-Orlow, Michael K; Magnani, Jared W
2017-11-01
Atrial Fibrillation (AF) is a common cardiac arrhythmia that is challenging for patients and adversely impacts health-related quality of life (HRQoL). Long-term management of AF requires that patients adhere to complex therapies, understand difficult terminology, navigate subspecialty care, and have continued symptom monitoring with the goal of preventing adverse outcomes. Continued interventions to ameliorate the patient experience of AF are essential. The Atrial Fibrillation health Literacy Information Technology Trial (AF-LITT; NCT03093558) is an investigator-initiated, 2-arm randomized clinical trial (RCT). This RCT is a pilot in order to implement a novel, smartphone-based intervention to address the patient experience of AF. This pilot RCT will compare a combination of the Embodied Conversational Agent (ECA) and the Alive Cor Kardia Mobile heart rhythm monitor to the current standard of care. The study will enroll 180 adults with non-valvular AF who are receiving anticoagulation for stroke prevention and randomize them to receive a 30-day intervention (smartphone-based ECA/Kardia) or standard of care, which will include a symptom and adherence journal. The primary end-points are improvement in HRQoL and self-reported adherence to anticoagulation. The secondary end-points are the acceptability of the intervention to participants, its use by participants, and acceptability to referring physicians. The AF-LITT pilot aims to evaluate the efficacy of the ECA/Kardia to improve HRQoL and anticoagulant adherence, and to guide its implementation in a larger, multicenter clinical trial. The intervention has potential to improve HRQoL, adherence, and health care utilization in individuals with chronic AF. Copyright © 2017 Elsevier Inc. All rights reserved.
Monoartritis gotosa de muñeca asociada a necrosis del semilunar: a propósito de un caso clínico
Olmedo García, N.; Mackenney Carrasco, Enrique
1994-01-01
Se presenta un caso de monoartritis de muñeca asociada a imágenes radiológicas de necrosis avascular del semilunar que, tras biopsia de la sinovial, se diagnostica de artritis gotosa. Esta asociación es rara. La alteración metabólica que se produce en la gota da lugar a una sinovitis, que provoca un aumento de presión intraarticular. Esta hiperpresión en el carpo podría determinar una necrosis isquémica del semilunar, pero con una evolución diferente a la enfermedad de Kienböck...
Riccio, Edson Luiz; Sakata, Marici Cristine Gramacho
2016-01-01
RESUMO Procuramos relatar neste documento as estatísticas, os dados e a importância do 13º CONTECSI – International Conference on Information Systems and Technology Management - Congresso Internacional de Gestão da Tecnologia e Sistemas de Informação, realizado nos dias 1, 2 e 3 de junho de 2016 pelo TECSI/EAC/FEA/USP/ECA/POLI na Universidade de São Paulo, Brasil. Este relatório apresenta: Estatísticas do 13º CONTECSI, Justificativas e Objetivos do evento, Programa, Sessões Plenárias, Consórc...
The international handbook of space technology
Badescu, Viorel
2014-01-01
This comprehensive handbook provides an overview of space technology and a holistic understanding of the system-of-systems that is a modern spacecraft. With a foreword by Elon Musk, CEO and CTO of SpaceX, and contributions from globally leading agency experts from NASA, ESA, JAXA, and CNES, as well as European and North American academics and industrialists, this handbook, as well as giving an interdisciplinary overview, offers, through individual self-contained chapters, more detailed understanding of specific fields, ranging through: · Launch systems, structures, power, thermal, communications, propulsion, and software, to · entry, descent and landing, ground segment, robotics, and data systems, to · technology management, legal and regulatory issues, and project management. This handbook is an equally invaluable asset to those on a career path towards the space industry as it is to those already within the industry.
Apupalo, Lissette; Barcia Villacreses, Kleber F.
2009-01-01
La empresa XY es una de las empresas ecuatorianas más importante dentro del área andina, dedicada a la elaboración de artículos plásticos para el hogar, línea de calzado de lona y PVC (tipo tenis), además del área de juguetería y viniles, con una trayectoria de casi cincuenta años. La presente tesis se enfoca dentro del área de juguetes, específicamente en el proceso de rotomoldeo, el objetivo principal de este estudio es mejorar el proceso de fabricación de piezas de muñecas de plastisol, us...
Directory of Open Access Journals (Sweden)
Luis Eduardo Sandoval
2007-01-01
Full Text Available El presente documento realiza un análisis comparativo entre los resultados obtenidos por las Universidades Privadas con Jornada Diurna y Nocturna, así como en las Universidades Públicas para luego analizar estos resultados en términos de la población evaluada en el programa de economía de la Universidad Militar Nueva Granada en la prueba ECAES realizada en el periodo comprendido entre 2004-2006, con esto se busca conocer el comportamiento de la población de estudiantes en cada uno de los componentes de manera que se puedan analizar las diferencias según el tipo de jornada y de institución.
Directory of Open Access Journals (Sweden)
Nahuel R. Peralta
2015-12-01
Full Text Available The spatial variability in soils used for livestock production (i.e. Natraquoll and Natraqualf at farm and paddock scale is usually very high. Understanding this spatial variation within a field is the first step for site-specific crop management. For this reason, we evaluated whether apparent electrical conductivity (ECa, a widely used proximal soil sensing technology, is a potential estimator of the edaphic variability in these types of soils. ECa and elevation data were collected in a paddock of 16 ha. Elevation was negatively associated with ECa. Geo-referenced soil samples were collected and analyzed for soil organic matter (OM content, pH, the saturation extract electrical conductivity (ECext, available phosphorous (P, and anaerobically incubated Nitrogen (Nan. Relationships between soil properties and ECa were analyzed using regression analysis, principal components analysis (PCA, and stepwise regression. Principal components (PC and the PC-stepwise were used to determine which soil properties have an important influence on ECa. In this experiment elevation was negatively associated with ECa. The data showed that pH, OM, and ECext exhibited a high correlation with ECa (R2=0.76; 0.70 and 0.65, respectively. Whereas P and Nan showed a lower correlation (R2=0.54 and 0.11 respectively. The model resulting from the PC-stepwise regression analysis explained slightly more than 69% of the total variation of the measured ECa, only retaining PC1. Therefore, ECext, pH and OM were considered key latent variables because they substantially influence the relationship between the PC1 and the ECa (loading factors>0.4. Results showed that ECa is associated with the spatial distribution of some important soil properties. Thus, ECa can be used as a support tool to implement site-specific management in soils for livestock use.
Energy Technology Data Exchange (ETDEWEB)
Peralta, N.R.; Cicore, P.L.; Marino, M.A.; Marques da Silva, J. R.; Costa, J.L.
2015-07-01
The spatial variability in soils used for livestock production (i.e. Natraquoll and Natraqualf) at farm and paddock scale is usually very high. Understanding this spatial variation within a field is the first step for site-specific crop management. For this reason, we evaluated whether apparent electrical conductivity (ECa), a widely used proximal soil sensing technology, is a potential estimator of the edaphic variability in these types of soils. ECa and elevation data were collected in a paddock of 16 ha. Elevation was negatively associated with ECa. Geo-referenced soil samples were collected and analyzed for soil organic matter (OM) content, pH, the saturation extract electrical conductivity (ECext), available phosphorous (P), and anaerobically incubated Nitrogen (Nan). Relationships between soil properties and ECa were analyzed using regression analysis, principal components analysis (PCA), and stepwise regression. Principal components (PC) and the PC-stepwise were used to determine which soil properties have an important influence on ECa. In this experiment elevation was negatively associated with ECa. The data showed that pH, OM, and ECext exhibited a high correlation with ECa (R2=0.76; 0.70 and 0.65, respectively). Whereas P and Nan showed a lower correlation (R2=0.54 and 0.11 respectively). The model resulting from the PC-stepwise regression analysis explained slightly more than 69% of the total variation of the measured ECa, only retaining PC1. Therefore, ECext, pH and OM were considered key latent variables because they substantially influence the relationship between the PC1 and the ECa (loading factors>0.4). Results showed that ECa is associated with the spatial distribution of some important soil properties. Thus, ECa can be used as a support tool to implement site-specific management in soils for livestock use. (Author)
Acceptability of an Embodied Conversational Agent-based Computer Application for Hispanic Women
Wells, Kristen J.; Vázquez-Otero, Coralia; Bredice, Marissa; Meade, Cathy D.; Chaet, Alexis; Rivera, Maria I.; Arroyo, Gloria; Proctor, Sara K.; Barnes, Laura E.
2015-01-01
There are few Spanish language interactive, technology-driven health education programs. Objectives of this feasibility study were to: 1) learn more about computer and technology usage among Hispanic women living in a rural community; and 2) evaluate acceptability of the concept of using an embodied conversational agent (ECA) computer application among this population. A survey about computer usage history and interest in computers was administered to a convenience sample of 26 women. A sample video prototype of a hospital discharge ECA was administered followed by questions to gauge opinion about the ECA. Data indicate women exhibited both a high level of computer experience and enthusiasm for the ECA. Feedback from community is essential to ensure equity in state of the art dissemination of health information. Hay algunos programas interactivos en español que usan la tecnología para educar sobre la salud. Los objetivos de este estudio fueron: 1) aprender más sobre el uso de computadoras y tecnología entre mujeres Hispanas que viven en comunidades rurales y 2) evaluar la aceptabilidad del concepto de usar un programa de computadora utilizando un agente de conversación encarnado (ECA) en esta población. Se administro una encuesta sobre el historial de uso y del interés de aprender sobre computadoras fue a 26 mujeres por muestreo de conveniencia. Un ejemplo del prototipo ECA en forma de video de un alta hospitalaria fue administrado y fue seguido por preguntas sobre la opinión que tenían del ECA. Los datos indican que las mujeres mostraron un alto nivel de experiencia con las computadoras y un alto nivel de entusiasmo sobre el ECA. La retroalimentación de la comunidad es esencial para asegurar equidad en la diseminación de información sobre la salud con tecnología de punta. PMID:26671558
Directory of Open Access Journals (Sweden)
Cristian Aguilar
2011-06-01
Full Text Available Objetivos. Evaluar el efecto de atorvastatina sobre la progresión del remodelado cardiaco y la expresión de ECA-2 en el miocardio de ratas diabéticas. Materiales y métodos. La diabetes fue inducida en ratas Holtzman con una inyección intraperitoneal de estreptozotocina. Los animales fueron divididos en tres grupos: (1 ratas control, (2 ratas diabéticas y (3 ratas diabéticas tratadas con atorvastatina (50 mg/kg/día. Después de ocho semanas de tratamiento, los corazones fueron extraídos para el análisis morfométrico, la cuantificación de colágeno y la determinación de los niveles de ARNm de ECA y ECA-2. Resultados. El índice de hipertrofia ventricular y el depósito de colágeno se incrementaron significativamente en las ratas diabéticas. La administración de atorvastatina previno estos cambios sin modificar los niveles de colesterol. La hiperglicemia produjo un incremento significativo en los niveles del ARNm de ECA y una marcada disminución en la expresión de ECA-2 en el miocardio de ratas diabéticas. La administración de atorvastatina indujo la expresión del ARNm de ECA-2 e inhibió la sobreexpresión del ARNm de ECA en el miocardio de las ratas diabéticas. Conclusiones. Nuestros resultados indican que la atorvastatina, independientemente de su capacidad para disminuir el colesterol, normaliza la relación de la expresión de ECA/ECA-2 y atenúa el desarrollo del remodelado adverso en el corazón diabético.Objectives. This study has investigated the effect of atorvastatin on the progression of cardiac remodelling and ACE- 2 expression in diabetic myocardium in rats. Materials and Methods. Diabetes was induced in Holtzman rats with an intraperitoneal injection of streptozotocin. The animals were divided into 3 groups: (1 normal control rats, (2 diabetic rats and (3 diabetic rats treated orally with atorvastatin (50 mg/kg/day. After eight weeks of treatment, the hearts were removed for morphometric studies, collagen
Embodied Conversational Agents in Clinical Psychology
DEFF Research Database (Denmark)
Provoost, Simon; Lau, Ho Ming; Ruwaard, Jeroen
2017-01-01
BACKGROUND: Embodied conversational agents (ECAs) are computer-generated characters that simulate key properties of human face-to-face conversation, such as verbal and nonverbal behavior. In Internet-based eHealth interventions, ECAs may be used for the delivery of automated human support factors....... OBJECTIVE: We aim to provide an overview of the technological and clinical possibilities, as well as the evidence base for ECA applications in clinical psychology, to inform health professionals about the activity in this field of research. METHODS: Given the large variety of applied methodologies, types...... applications in the treatment of mood, anxiety, psychotic, autism spectrum, and substance use disorders were conducted in databases in the fields of psychology and computer science, as well as in interdisciplinary databases. Studies were included if they conveyed primary research findings on an ECA application...
Scholten, Mark R; Kelders, Saskia M; Van Gemert-Pijnen, Julia Ewc
2017-11-16
Web-based mental health interventions have evolved from innovative prototypes to evidence-based and clinically applied solutions for mental diseases such as depression and anxiety. Open-access, self-guided types of these solutions hold the promise of reaching and treating a large population at a reasonable cost. However, a considerable factor that currently hinders the effectiveness of these self-guided Web-based interventions is the high level of nonadherence. The absence of a human caregiver apparently has a negative effect on user adherence. It is unknown to what extent this human support can be handed over to the technology of the intervention to mitigate this negative effect. The first objective of this paper was to explore what is known in literature about what support a user needs to stay motivated and engaged in an electronic health (eHealth) intervention that requires repeated use. The second objective was to explore the current potential of embodied conversational agents (ECAs) to provide this support. This study reviews and interprets the available literature on (1) support within eHealth interventions that require repeated use and (2) the potential of ECAs by means of a scoping review. The rationale for choosing a scoping review is that the subject is broad, diverse, and largely unexplored. Themes for (1) and (2) were proposed based on grounded theory and mapped on each other to find relationships. The results of the first part of this study suggest the presence of user needs that largely remain implicit and unaddressed. These support needs can be categorized as task-related support and emotion-related support. The results of the second part of this study suggest that ECAs are capable of engaging and motivating users of information technology applications in the domains of learning and behavioral change. Longitudinal studies must be conducted to determine under what circumstances ECAs can create and maintain a productive user relationship. Mapping the
Directory of Open Access Journals (Sweden)
Jeeser Alves Almeida
2012-04-01
Full Text Available FUNDAMENTO: O gene da enzima conversora de angiotensina (gene ECA tem sido amplamente estudado em relação a fenótipos de aptidão cardiorrespiratória, contudo a associação do genótipo da ECA com corridas de meia-distância tem sido pouco investigada. OBJETIVO: O presente estudo investigou a possível influência da enzima conversora de angiotensina (ECA (I/D sobre a aptidão cardiovascular e o desempenho em corridas de meia-distância por parte de brasileiros jovens do sexo masculino. A validade da previsão de VO2max em relação ao genótipo da ECA também foi analisada. MÉTODOS: Um grupo homogêneo de homens jovens moderadamente ativos foi avaliado em um teste de corrida (V1600 m; m.min-1 e em um teste adicional em esteira ergométrica para a determinação de VO2max. Posteriormente, o [(0,177*V1600m + 8.101] VO2max real e previsto foi comparado com os genótipos da ECA. RESULTADOS: O VO2max e V1600m registrados para os genótipos DD, ID e II foram 45,6 (1,8; 51,9 (0,8 e 54,4 (1,0 mL.kg-1.min-1 e 211,2 (8,3; 249,1 (4,3 e 258,6 (5,4 m.min-1, respectivamente e foram significativamente mais baixos para os genótipos DD (p BACKGROUND: The angiotensin I-converting enzyme gene (ACE gene has been broadly studied as for cardiorespiratory fitness phenotypes, but the association of the ACE genotype to middle-distance running has been poorly investigated. OBJECTIVE: This study investigated the possible influence of Angiotensin-Converting Enzyme (ACE genotype (I/D on cardiovascular fitness and middle-distance running performance of Brazilian young males. The validity of VO2max to predict the ACE genotype was also analyzed. METHODS: A homogeneous group of moderately active young males were evaluated in a 1,600 m running track test (V1600m; m.min-1 and in an incremental treadmill test for VO2max determination. Subsequently, the actual and the predicted [(0.177*V1600m + 8.101] VO2max were compared to ACE genotypes. RESULTS: The VO2max and V1600m
Un héroe fragmentado. El cura muñecas y la historiografia andina
Directory of Open Access Journals (Sweden)
Luis Miguel Glave
2002-01-01
Full Text Available La naturaleza nacional de las historiografías es una limitación a la hora de comprender realidades múltiples, que anteceden a la creación de los estados nacionales y de los discursos historiográficos que también surgen y se justifican con ellos. Una muestra de ello es la biografía de un presonaje que resultó central en la historia popular de la revolución andina por la Independencia, Ildefonso de las Muñecas. De origen vasco, nacido en Tucumán, se hizo jefe revolucionario en Cuzco en 1814 y mantuvo luego alzada la provincia de Larecaja, llamada republiqueta, por un largo año después de la derrota de la revolución, influyendo casi míticamente en el imaginario popular del altiplano por mucho tiempo después. Su lucha y su biografía no pueden ser tenidas ni por argentina, boliviana o peruana pues ambas rebasan la limitación impuesta por esa parcelación ideológica de la realidad. La biografía del personaje sirve para revisar la perspectiva que sobre la revolución de la independencia podemos tener en el mundo andino, discutiendo también los discursos nacionalistas.
Water dephts and macronutrients accumulation in 'pérola' pineapple irrigated by drip
Directory of Open Access Journals (Sweden)
Uirá do Amaral
2014-09-01
Full Text Available Brazil is one of the largest pineapple producers worldwide, and those fruits are for the juice industry and the in natura market. Its cultivation requires high technology investment by using irrigation and balanced fertilization. However, little is known about the influence of drip irrigation on nutrient uptake by pineapple plants. This study aimed to evaluate the influence of different irrigation depths on nutrients accumulation by 'Pérola' pineapples grown in northern region of Minas Gerais State, Brazil. The experimental design was in randomized blocks with five treatments referring to: 30% of Class A Evaporation Pan (ECA; 50% of ECA; 70% of ECA; 100% of ECA; and 150% of ECA. To determine the levels of macronutrients and dry matter, the plants were separated in root, stem, leaves, 'D' leaf, crown, fruit and whole plant. The sequence of macronutrients accumulated in the whole plant was K>N>Ca>P>Mg. The fruits exported from the cultivated area the following amounts of macronutrients: 17.52 kg ha-1 of K (12.8%; 16.91 kg ha-1 of N (20.7%; 10.77 kg ha-1 of Ca (15.9%, 1.29 kg ha-1 of P (12.4% and 1.04 kg ha-1 of Mg (20.5%. The irrigation depths that provided the maximum N, P, K and Ca accumulation in the whole plant are 53.6, 61.6, 54.5 and 60.2% of ECA, respectively.
Directory of Open Access Journals (Sweden)
Henry Montecino Castro
Full Text Available Most aspects related to the horizontal component of the Geocentric Reference System for the Americas (SIRGAS have been solved. However, in the case of the vertical component there are still aspects of definition, national realizations and continental unification still not accomplished. Chile is no exception; due to its particular geographic characteristics, a number of tide gauges (TG had to be installed in the coast from which the leveling lines that compose the Chilean Vertical Network (CHVN were established. This study explored the offsets of the CHVN by two different approaches; one geodetic and one oceanographic. In the first approach, the offsets were obtained in relation to the following Global Geopotential Models (GGM: the satellite-only model (unbiased GO_CONS_gcf_2_tim_r3 derived from GOCE satellite mission; EGM2008 (combined-biased; and GOEGM08, combining information from the GO_CONS_gcf_2_tim_r3 in long wavelengths (n max~200 with the mean/short wavelengths of EGM2008 (n>200. In the oceanographic method, we used the CNES CLS 2011 Global Mean Sea surface and EIGEN_GRACE_5C GGM to obtain the values of MDT at the different TG. We also evaluated the CHVN in relation to different GGMs. The results showed consistency between the values obtained by the two methods at the TG of Valparaíso and Puerto Chacabuco. In terms of the evaluation of the GGM, GOEGM08 produced the best results.
Directory of Open Access Journals (Sweden)
Pérez, I.
2011-02-01
Full Text Available In the present work, a study on the modification of the mechanical properties of the aluminium alloy AA6060 F has been made when severe plastic deformation is applied to it through Equal Channel Angular Extrusion (ECAE. Moreover, a study about the effect of the artificial aging on the modification of such mechanical properties has been carried out after having processed the material by ECAE. In order to do this, thermal treatments at different values of temperature and holding time have been performed. Hardness, tensile tests and Charpy impact test, along with metallographic techniques, have been carried out in order to analyse the mechanical behaviour and the state of the material. In spite of the existence of several studies that have analysed the effect of aging thermal treatments on 6000 aluminium alloys, such studies are focused on laboratory alloys with industrial compositions not very usual. Therefore, in the present work, the employed starting material is a commercial alloy as-cast, which has not been studied up to now.
En el presente trabajo se ha realizado un estudio de la modificación de las propiedades mecánicas de la aleación de aluminio AA6060 F, al ser deformada mediante deformación plástica severa empleando el proceso de extrusión en canal angular (ECAE. Asimismo, se ha efectuado un estudio del efecto del envejecimiento artificial sobre la modificación de dichas propiedades mecánicas. Para ello, se han realizado tratamientos térmicos a diferentes temperaturas y tiempos de permanencia, efectuando mediciones de dureza, ensayos de tracción, ensayos con péndulo Charpy y técnicas de revelado metalográfico, para conocer los comportamientos mecánicos y el estado del material. Existe un elevado número de publicaciones, que han analizado el efecto de tratamientos térmicos de envejecimiento en aleaciones de la serie 6000. Sin embargo, la aleación AA6060 no ha sido tan ampliamente estudiada. Por ello, en este trabajo
International Nuclear Information System (INIS)
Wulf, Sven-Erik; Krauss, Wolfgang; Konys, Jürgen
2014-01-01
Highlights: •Electrochemical processes ECA and ECX are suitable for Al deposition on RAFM steels. •ECA and ECX are able to produce thin Al layers with adjustable thicknesses. •All aluminization processes need a subsequent heat treatment. •Scales made by ECA or ECX exhibit reduced thicknesses compared to HDA. •ECX provides higher flexibility compared to ECA to produce scales on RAFM steels. -- Abstract: Reduced activation ferritic-martensitic steels (RAFM), e.g. Eurofer 97, are envisaged in future fusion technology as structural material, which will be in direct contact with a flowing liquid lead–lithium melt serving as breeder material. Aluminum-based barrier layers had proven their ability to protect the structural material from corrosion attack in flowing Pb–15.7Li and to reduce tritium permeation into the coolant. Coming from scales produced by hot dipping aluminization (HDA), the development of processes based on electrochemical methods to produce defined aluminum-based scales on RAFM steels gained attention in research during the last years. Two different electrochemical processes are proposed: The first one, referred to as ECA process, is based on the electrodeposition of aluminum from volatile, metal-organic electrolytes. The other process called ECX is based on ionic liquids. All three processes exhibit specific characteristics, for example in the field of processability, control of coating thicknesses (low activation criteria) and heat treatment behavior. The aim of this article is to compare these different coating processes critically, whereby the focus is on the comparison of ECA and ECX processes. New results for ECX-process will be presented and occurring development needs for the future will be discussed
Energy Technology Data Exchange (ETDEWEB)
Wulf, Sven-Erik, E-mail: sven-erik.wulf@kit.edu; Krauss, Wolfgang; Konys, Jürgen
2014-10-15
Highlights: •Electrochemical processes ECA and ECX are suitable for Al deposition on RAFM steels. •ECA and ECX are able to produce thin Al layers with adjustable thicknesses. •All aluminization processes need a subsequent heat treatment. •Scales made by ECA or ECX exhibit reduced thicknesses compared to HDA. •ECX provides higher flexibility compared to ECA to produce scales on RAFM steels. -- Abstract: Reduced activation ferritic-martensitic steels (RAFM), e.g. Eurofer 97, are envisaged in future fusion technology as structural material, which will be in direct contact with a flowing liquid lead–lithium melt serving as breeder material. Aluminum-based barrier layers had proven their ability to protect the structural material from corrosion attack in flowing Pb–15.7Li and to reduce tritium permeation into the coolant. Coming from scales produced by hot dipping aluminization (HDA), the development of processes based on electrochemical methods to produce defined aluminum-based scales on RAFM steels gained attention in research during the last years. Two different electrochemical processes are proposed: The first one, referred to as ECA process, is based on the electrodeposition of aluminum from volatile, metal-organic electrolytes. The other process called ECX is based on ionic liquids. All three processes exhibit specific characteristics, for example in the field of processability, control of coating thicknesses (low activation criteria) and heat treatment behavior. The aim of this article is to compare these different coating processes critically, whereby the focus is on the comparison of ECA and ECX processes. New results for ECX-process will be presented and occurring development needs for the future will be discussed.
Technology Combination Analysis Tool (TCAT) for Active Debris Removal
Chamot, B.; Richard, M.; Salmon, T.; Pisseloup, A.; Cougnet, C.; Axthelm, R.; Saunder, C.; Dupont, C.; Lequette, L.
2013-08-01
This paper present the work of the Swiss Space Center EPFL within the CNES-funded OTV-2 study. In order to find the most performant Active Debris Removal (ADR) mission architectures and technologies, a tool was developed in order to design and compare ADR spacecraft, and to plan ADR campaigns to remove large debris. Two types of architectures are considered to be efficient: the Chaser (single-debris spacecraft), the Mothership/ Kits (multiple-debris spacecraft). Both are able to perform controlled re-entry. The tool includes modules to optimise the launch dates and the order of capture, to design missions and spacecraft, and to select launch vehicles. The propulsion, power and structure subsystems are sized by the tool thanks to high-level parametric models whilst the other ones are defined by their mass and power consumption. Final results are still under investigation by the consortium but two concrete examples of the tool's outputs are presented in the paper.
Al-Ansari, Asim; Al-Harbi, Fahad; AbdelAziz, Wafaa; AbdelSalam, Maha; El Tantawi, Maha M; ElRefae, Ismail
2016-01-01
This study was conducted to assess the level of participation of dental undergraduate students in extracurricular activities (ECAs) and the factors affecting this participation. The study included dental students enrolled in undergraduate programs at the Faculty of Dentistry, Alexandria University, Egypt, and the College of Dentistry, University of Dammam, Saudi Arabia. A questionnaire was developed to collect background information about students, their participation in ECAs, and time allocated for these activities. Students were asked about their perceptions of the relationship between ECAs and academic studies, and their reasons for participating in and satisfaction with ECAs. The study included 199 students from Alexandria and 146 students from Dammam, with response rates of 99.5% and 73%, respectively. The percentages of those reporting ECA participation were 27.1% and 43.8%, respectively, mostly in community service, sports, and social activities. About 60% of students did not think that ECAs affected their studies, although the perceived difficulty of balancing ECAs and academics was associated with lower odds of participation (odds ratio = 0.51). Most students participated in ECAs to socialize and make friends, and the majority was dissatisfied with school-organized ECAs (52% and 59%, respectively). Gender and/or perceived relation between ECAs and academic studies affected actual participation in ECAs in one school but not the other. ECA participation among these students was low. Gender and perception of ECAs in relation to academic studies affected ECA participation differently in the two schools. Better planning and management of ECAs that incorporate students' preferences and reasons for participation is needed. Gender issues and the relationship between ECAs and academic performance should be addressed in relation to school and social characteristics.
Directory of Open Access Journals (Sweden)
Renato De Vecchis
2011-12-01
Full Text Available FUNDAMENTO: O efeito renoprotetor dos inibidores da ECA vem sendo questionado no caso de diminuição do volume circulante efetivo, como na insuficiência cardíaca crônica direita ou biventricular. Objetivo: Detectar os preditores clínicos de agravamento renal na população de pacientes com ICC, caracterizado por dois tipos de regime de dosagem de inibidores da ECA. MÉTODOS: De acordo com um desenho de coorte retrospectiva, seguimos dois grupos de pacientes com ICC - tanto direita quanto biventricular -, todos na classe III da NYHA, tratados com inibidores da ECA (enalapril ou lisinopril, e com fração de ejeção do ventrículo esquerdo (FEVE 10 mg por dia de enalapril ou lisinopril. A disfunção renal agravada (ARD foi definida pelo aumento de Cr > 30% com relação ao segmento basal. O modelo de risco proporcional de Cox foi utilizado para identificar os preditores da ARD entre as seguintes variáveis: os inibidores da ECA com "alta" dosagem, idade, FEVE basal, histórico de repetidas terapias intensivas com diuréticos de alça por via intravenosa (diurético intravenoso, diabete, Cr basal, histórico de hipertensão, pressão arterial sistólica BACKGROUND: Renoprotective effect of ACE-inhibitors has been questioned in case of decreased effective circulating volume, like in right or biventricular chronic heart failure. OBJECTIVE: To detect clinical predictors of renal worsening in CHF patient population characterized by two types of ACE-inhibitor dosing regimens. METHODS: According to a retrospective cohort design, we followed 2 groups of patients with CHF - whether right or biventricular -, all in III NYHA class treated with ACE-inhibitors (enalapril or lisinopril, and with left ventricular ejection fraction (LVEF 10 mg per day of enalapril or lisinopril. Worsened renal failure (ARD was defined by Cr increase >30% from baseline. Cox proportional hazards model was used to identify the predictors of ARD among the following variables
Pletser, Vladimir; Rouquette, Sebastien; Friedrich, Ulrike; Clervoy, Jean-Francois; Gharib, Thierry; Gai, Frederic; Mora, Christophe
2015-09-01
Aircraft parabolic flights repetitively provide up to 23 s of reduced gravity during ballistic flight manoeuvres. Parabolic flights are used to conduct short microgravity investigations in Physical and Life Sciences and in Technology, to test instrumentation prior to space flights and to train astronauts before a space mission. The use of parabolic flights is complementary to other microgravity carriers (drop towers, sounding rockets), and preparatory to manned space missions on board the International Space Station and other manned spacecraft, such as Shenzhou and the Chinese Space Station CSS. The European Space Agency (ESA), the 'Centre National d'Etudes Spatiales' (CNES, French Space Agency) and the 'Deutsches Zentrum für Luft- und Raumfahrt e.V.' (DLR, the German Aerospace Centre) have used the Airbus A300 ZERO-G for research experiments in microgravity, and at Moon and Mars gravity levels, from 1997 until October 2014. The French company Novespace, a subsidiary of CNES, based in Bordeaux, France, is in charge of the organisation of Airbus A300 ZERO-G flights. A total of 104 parabolic flight campaigns have been organised by ESA, CNES and DLR since 1997, including 38 ESA, 34 CNES and 23 DLR microgravity campaigns, two Joint European ESA-CNES-DLR Partial-g Parabolic Flight Campaigns, and seven ESA Student campaigns. After 17 years of good and loyal services, this European workhorse for microgravity research in parabolic flights has been retired. The successor aircraft, the Airbus A310 ZERO-G, is being prepared for a first ESA-CNES-DLR cooperative campaign in Spring 2015. This paper looks back over 17 years of microgravity research in parabolic flights with the A300 ZERO-G, and introduces the new A310 ZERO-G that will be used from 2015 onwards.
Energy Technology Data Exchange (ETDEWEB)
Ramuhalli, Pradeep [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hirt, Evelyn H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Veeramany, Arun [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bonebrake, Christopher A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Ivans, William J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Coles, Garill A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Coble, Jamie B. [Univ. of Tennessee, Knoxville, TN (United States); Liu, X. [Univ. of Tennessee, Knoxville, TN (United States); Wootan, David W. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Mitchell, Mark R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Brass, Mary F. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2015-09-24
This research report summaries the development and evaluation of a prototypic enhanced risk monitor (ERM) methodology (framework) that includes alternative risk metrics and uncertainty analysis. This updated ERM methodology accounts for uncertainty in the equipment condition assessment (ECA), the prognostic result, and the probabilistic risk assessment (PRA) model. It is anticipated that the ability to characterize uncertainty in the estimated risk and update the risk estimates in real time based on equipment condition assessment (ECA) will provide a mechanism for optimizing plant performance while staying within specified safety margins. These results (based on impacting active component O&M using real-time equipment condition information) are a step towards ERMs that, if integrated with AR supervisory plant control systems, can help control O&M costs and improve affordability of advanced reactors.
Directory of Open Access Journals (Sweden)
. Marwan
2015-01-01
Full Text Available Conventional soil sampling is time consuming and requires meticulous laboratory analysis. Hence, mapping of soil apparent in respect to electrical conductivity (ECa has been developed to identify areas of contrasting soil properties. Such ECa values are represent measures of soil properties. The sensor system, GF Instrument model CMD-4 were used to analyze soil physical properties. This system consists of three important parts, ECa sensor, data logger and Global Positioning System (DGPS receiver. This research was aimed to evaluate the relationships between ECa and soil properties as well as the yield of rice (paddy in paddy’s farming fields. One study site was chosen. The sensor was pulled through a plotted area of 0.25 km2. The distribution map of ECa was developed to identify the contrast of ECa. More than 100 ECa of data points were collected in 3-hour for the large plot. The data was later transferred to a notebook computer for generation of ECa maps using Surfer 11 software. According to the data analyses, field and ECa showed positive correlation. The average values of ECa are significantly different between hilly area and drainage canal area signifying differences in soil structure. Soil ECa could provide a measure of the spatial differences associated with soil physical and chemical properties, which for paddy soil may be a measure of soil suitability for crop growth and its productivity. This sensor can measure the soil ECa through the field quickly for detailed features of the soil and can be operated by just one worker. The ECa map provides some ideas for future soil management
Directory of Open Access Journals (Sweden)
Patricia Angélica Alves MARQUES
2005-12-01
Full Text Available The radish (Raphanus sativus L. is a herbaceous plant which roots present high nutritious value. One of the more used methods of the cultures evapotranspiration estimative (Eto is the pan evaporation. This method integrated the effects of solar radiation, wind, temperature and relative humidity based on the water evaporation of a free surface. This work studied the effect of different irrigation levels, based on pan evaporation (ECA - 80% ECA; 100% ECA; 120% ECA and hydric stress (0% ECA, about the 'Crinson Giant' radish production cultivated in pots. The fractions of pan evaporation tested didn't cause a reduction in the radish production in relation to the total irrigation (100% ECA. However the plants submitted to the hydric stress (0% ECA had presented a reduction in dry matter of 42% and 64% in aerial part and roots, respectively, when compared to the control (100% ECA.
Energy Technology Data Exchange (ETDEWEB)
Lim, Ruth P., E-mail: ruthplim74@gmail.com [New York University School of Medicine, Bernard and Irene Schwartz Center for Biomedical Imaging, Department of Radiology, 660 1st Avenue, New York, NY 10016 (United States); Austin Health, Department of Radiology, Heidelberg, Victoria 3084 (Australia); The University of Melbourne, School of Medicine, Parkville, Victoria 3010 (Australia); Bruno, Mary, E-mail: mary.bruno@nyumc.org [New York University School of Medicine, Bernard and Irene Schwartz Center for Biomedical Imaging, Department of Radiology, 660 1st Avenue, New York, NY 10016 (United States); Rosenkrantz, Andrew B., E-mail: Andrew.rosenkrantz@nyumc.org [New York University School of Medicine, Bernard and Irene Schwartz Center for Biomedical Imaging, Department of Radiology, 660 1st Avenue, New York, NY 10016 (United States); Kim, Danny C., E-mail: danny.kim@nyumc.org [New York University School of Medicine, Bernard and Irene Schwartz Center for Biomedical Imaging, Department of Radiology, 660 1st Avenue, New York, NY 10016 (United States); Mulholland, Thomas, E-mail: Thomas.mulholland@nyumc.org [New York University School of Medicine, Bernard and Irene Schwartz Center for Biomedical Imaging, Department of Radiology, 660 1st Avenue, New York, NY 10016 (United States); Kwon, Jane, E-mail: jane.kwon@nyumc.org [New York University School of Medicine, Bernard and Irene Schwartz Center for Biomedical Imaging, Department of Radiology, 660 1st Avenue, New York, NY 10016 (United States); Palfrey, Amy P., E-mail: amy.pastva10@stjohns.edu [St John' s University, Department of Psychology, 8000 Utopia Parkway, Jamaica-Queens, NY 11439 (United States); Ogedegbe, Olugbenga, E-mail: Olugbenga.Ogedegbe@nyumc.org [New York University School of Medicine, Clinical and Translational Science Institute, 227 E30th St, 8th Floor, New York, NY 10016 (United States)
2014-07-15
Objective: To compare performance of single-injection blood pool agent (gadofosveset trisodium, BPA) against dual-injection extracellular contrast (gadopentetate dimeglumine, ECA) for MRA/MRV in assessment of suspected vascular TOS. Materials and methods: Thirty-one patients referred for vascular TOS evaluation were assessed with BPA (n = 18) or ECA (n = 13) MRA/MRV in arm abduction and adduction. Images were retrospectively assessed for: image quality (1 = non-diagnostic, 5 = excellent), vessel contrast (1 = same signal as muscle, 4 = much brighter than muscle) and vascular pathology by two independent readers, with a separate experienced reader providing reference assessment of vascular pathology. Results: Median image quality was diagnostic or better (score ≥3) for ECA and BPA at all time points, with BPA image quality superior at abduction late (BPA 4.5, ECA 4, p = 0.042) and ECA image quality superior at adduction-early (BPA 4.5; ECA 4.0, p = 0.018). High qualitative vessel contrast (mean score ≥3) was observed at all time points with both BPA and ECA, with superior BPA vessel contrast at abduction-late (BPA 3.97 ± 0.12; ECA 3.73 ± 0.26, p = 0.007) and ECA at adduction-early (BPA 3.42 ± 0.52; ECA 3.96 ± 0.14, p < 0.001). Readers readily identified arterial and venous pathology with BPA, similar to ECA examinations. Conclusion: Single-injection BPA MRA/MRV for TOS evaluation demonstrated diagnostic image quality and high vessel contrast, similar to dual-injection ECA imaging, enabling identification of fixed and functional arterial and venous pathology.
Directory of Open Access Journals (Sweden)
Alicja Pacholewska
2017-12-01
Full Text Available MicroRNAs (miRNAs regulate post-transcriptional gene expression and may be exported from cells via exosomes or in partnership with RNA-binding proteins. MiRNAs in body fluids can act in a hormone-like manner and play important roles in disease initiation and progression. Hence, miRNAs are promising candidates as biomarkers. To identify serum miRNA biomarkers in the equine model of asthma we investigated small RNA derived from the serum of 34 control and 37 asthmatic horses. These samples were used for next generation sequencing, novel miRNA identification and differential miRNA expression analysis. We identified 11 significantly differentially expressed miRNAs between case and control horses: eca-miR-128, eca-miR-744, eca-miR-197, eca-miR-103, eca-miR-107a, eca-miR-30d, eca-miR-140-3p, eca-miR-7, eca-miR-361-3p, eca-miR-148b-3p and eca-miR-215. Pathway enrichment using experimentally validated target genes of the human homologous miRNAs showed a significant enrichment in the regulation of epithelial-to-mesenchymal transition (key player in airway remodeling in asthma and the phosphatidylinositol (3,4,5-triphosphate (PIP3 signaling pathway (modulator of CD4+ T cell maturation and function. Downregulated miR-128 and miR-744 supports a Th2/Th17 type immune response in severe equine asthma.
Comparing weld inspection codes: radiography vs. ultrasonics
International Nuclear Information System (INIS)
Moles, M.; Ginzel, E.
2007-01-01
Requirements for weld quality are continually increasing. This is due to a combination of factors: increased public awareness; bigger legal penalties; improved and thinner steels; better analysis techniques such as Engineering Critical Assessment (ECA); higher material costs. Weld quality is primarily dictated by construction codes, which should reflect the needs of society and industry: safety, the environment, society, and cost-effectiveness. As R and D produces new products, techniques and procedures, ideally these developments should be reflected in the codes. While pressure vessel and structural welding are certainly included here, it is really pipeline weld inspections that are setting the pace on new developments. For pipelines, a major shift was made from radiography to ultrasonics in Alberta some decades ago. This was driven by the 'need for speed', plus the requirement to size defects in the vertical plane for ECA (also called Fracture Mechanics or Fitness-For-Purpose). One of the main objectives of ECA was to benefit from the calculated fracture toughness of materials, and not to rely on the overly conservative workmanship criteria in radiography. In practice, performing repairs on higher quality material often does more harm than good; changing the microstructure can seriously compromise the material properties. Rising steel costs are another major driving force, so higher strength, thinner materials are being used. Under these conditions, ECA and defect sizing are critical. This paper compares where the various North American codes for pipelines, pressure vessels and structural welds stand on using advanced inspection techniques: ultrasonics, phased arrays, ECA, sizing techniques. For those codes which are not using the latest technologies, there are typical routes for incorporating them. (author)
International Nuclear Information System (INIS)
Hu Yuan
2012-01-01
Fast economic growth in China has generated energy and environmental problems. Fixed-asset investments have contributed significantly to energy consumption. In China, an energy conservation assessment (ECA), a mechanism similar to the existing environmental impact assessment (EIA), has been applied to improve the energy efficiency of new fixed-asset investment projects. In this paper the origin and development of the ECA system is analyzed and the major features of ECA are discussed. To identify the success and failure of the ECA system, case studies are analyzed and comparison between ECA and EIA, which has been used in China for over 30 years, is made. Based on the analysis, recommendations are provided for the improvement of the ECA system in China. Despite the ECA system only being established for a relatively short time, it has clearly achieved significant success. With further efforts it could play an important role in achieving the goals of improving China’s energy efficiency and reducing green house gas emissions. - Highlights: ► We examine origin and development of energy conservation assessment (ECA) in China. ► ECA has great potential in energy efficiency improvement and GHGs reduction. ► Compared with EIA, ECA is still in its early stages. More efforts are needed. ► Improvements of legal system, assessment procedure, etc. are essential for next step.
Apparent soil electrical conductivity in two different soil types
Directory of Open Access Journals (Sweden)
Wilker Nunes Medeiros
Full Text Available ABSTRACT Mapping the apparent soil electrical conductivity (ECa has become important for the characterization of the soil variability in precision agriculture systems. Could the ECa be used to locate the soil sampling points for mapping the chemical and physical soil attributes? The objective of this work was to examine the relations between ECa and soil attributes in two fields presenting different soil textures. In each field, 50 sampling points were chosen using a path that presented a high variability of ECa obtained from a preliminary ECa map. At each sampling point, the ECa was measured in soil depths of 0-20, 0-40 and 0-60 cm. In addition, at each point, soil samples were collected for the determination of physical and chemical attributes in the laboratory. The ECa data obtained for different soil depths was very similar. A large number of significant correlations between ECa and the soil attributes were found. In the sandy clay loam texture field there was no correlation between ECa and organic matter or between ECa and soil clay and sand content. However, a significant positive correlation was shown for the remaining phosphorus. In the sandy loam texture field the ECa had a significant positive correlation with clay content and a significant negative correlation with sand content. The results suggest that the mapping of apparent soil electrical conductivity does not replace traditional soil sampling, however, it can be used as information to delimit regions in a field that have similar soil attributes.
Graphene-Decorated Nanocomposites for Printable Electrodes in Thin Wafer Devices
Bakhshizadeh, N.; Sivoththaman, S.
2017-12-01
Printable electrodes that induce less stress and require lower curing temperatures compared to traditional screen-printed metal pastes are needed in thin wafer devices such as future solar cells, and in flexible electronics. The synthesis of nanocomposites by incorporating graphene nanopowders as well as silver nanowires into epoxy-based electrically conductive adhesives (ECA) is examined to improve electrical conductivity and to develop alternate printable electrode materials that induce less stress on the wafer. For the synthesized graphene and Ag nanowire-decorated ECA nanocomposites, the curing kinetics were studied by dynamic and isothermal differential scanning calorimetry measurements. Thermogravimetric analysis on ECA, ECA-AG and ECA/graphene nanopowder nanocomposites showed that the temperatures for onset of decomposition are higher than their corresponding glass transition temperature ( T g) indicating an excellent thermal resistance. Printed ECA/Ag nanowire nanocomposites showed 90% higher electrical conductivity than ECA films, whereas the ECA/graphene nanocomposites increased the conductivity by over two orders of magnitude. Scanning electron microscopy results also revealed the effect of fillers morphology on the conductivity improvement and current transfer mechanisms in nanocomposites. Residual stress analysis performed on Si wafers showed that the ECA and nanocomposite printed wafers are subjected to much lower stress compared to those printed with metallic pastes. The observed parameters of low curing temperature, good thermal resistance, reasonably high conductivity, and low residual stress in the ECA/graphene nanocomposite makes this material a promising alternative in screen-printed electrode formation in thin substrates.
Materne, A.; Bardoux, A.; Geoffray, H.; Tournier, T.; Kubik, P.; Morris, D.; Wallace, I.; Renard, C.
2017-11-01
The PLEIADES-HR Earth observing satellites, under CNES development, combine a 0.7m resolution panchromatic channel, and a multispectral channel allowing a 2.8 m resolution, in 4 spectral bands. The 2 satellites will be placed on a sun-synchronous orbit at an altitude of 695 km. The camera operates in push broom mode, providing images across a 20 km swath. This paper focuses on the specifications, design and performance of the TDI detectors developed by e2v technologies under CNES contract for the panchromatic channel. Design drivers, derived from the mission and satellite requirements, architecture of the sensor and measurement results for key performances of the first prototypes are presented.
Genetic diversity and paternal origin of domestic donkeys.
Han, H; Chen, N; Jordana, J; Li, C; Sun, T; Xia, X; Zhao, X; Ji, C; Shen, S; Yu, J; Ainhoa, F; Chen, H; Lei, C; Dang, R
2017-12-01
Numerous studies have been conducted to investigate genetic diversity, origins and domestication of donkey using autosomal microsatellites and the mitochondrial genome, whereas the male-specific region of the Y chromosome of modern donkeys is largely uncharacterized. In the current study, 14 published equine Y chromosome-specific microsatellites (Y-STR) were investigated in 395 male donkey samples from China, Egypt, Spain and Peru using fluorescent labeled microsatellite markers. The results showed that seven Y-STRs-EcaYP9, EcaYM2, EcaYE2, EcaYE3, EcaYNO1, EcaYNO2 and EcaYNO4-were male specific and polymorphic, showing two to eight alleles in the donkeys studied. A total of 21 haplotypes corresponding to three haplogroups were identified, indicating three independent patrilines in domestic donkey. These markers are useful for the study the Y-chromosome diversity and population genetics of donkeys in Africa, Europe, South America and China. © 2017 Stichting International Foundation for Animal Genetics.
Investigation of electrochemical intrusion of cations by the method of contact electric resistance
International Nuclear Information System (INIS)
Marichev, V.A.
1997-01-01
Paper shows the possibility and prospects of application of contact electric resistance technique (CER) to study in-situ the initial stages of electrochemical admission of cations (ECA). ECA is shown to increase CER of metals. It enables to determine ECA potential and to investigate kinetics of this process. Using ECA in copper, silver and zinc from alkali solutions as an example one has shown that CER technique enables to obtain results that do not contradict well-known published data. Potentials of ECA cations from acid and neutral solutions in copper, platinum, iron, titanium and tungsten are determined
Effect of friction stirring on microstructure in equal channel angular pressed aluminum alloys
Energy Technology Data Exchange (ETDEWEB)
Sato, Y.S.; Urata, M.; Kokawa, H.; Ikeda, K. [Dept. of Materials Processing, Graduate School of Engineering, Tohoku Univ., Aoba-yama, Sendai (Japan)
2003-07-01
Friction stir welding (FSW) was applied to equal channel angular (ECA) pressed aluminum (Al) alloys with high strength and toughness, and the effect of FSW on microstructure and the hardness profile in ECA-pressed alloys was examined. In the weld of ECA-pressed Al alloy 1050 and 5083, the stir zone had roughly the same hardness as the ECA-pressed material, while the hardness was slightly reduced in the thermo-mechanically affected zone (TMAZ). The reduction of hardness in the TMAZ was due to dynamic recovery of dislocation cells of the ECA-pressed material. The addition of Zr to Al suppressed the reduction of hardness in the TMAZ. Consequently, friction stir (FS) weld of Al-Zr alloy retained the hardness of the ECA-pressed material throughout the weld. (orig.)
UMA ANÁLISE PEDAGÓGICA DA MÍDIA NO ESTATUTO DA CRIANÇA E DO ADOLESCENTE
Directory of Open Access Journals (Sweden)
Laur Duarte Marinoski
2015-12-01
Full Text Available RESUMO: Contemporaneamente, nos encontramos imersos em um mundo no qual a tecnologia permeia grande parte das relações sociais, assim não há como alijá-la de inserção na vida. Nesse artigo refletimos acerca da tecnologia como um aspecto abordado no Estatuto da Criança e do Adolescente – ECA, por constituir, na atualidade, a formação desses sujeitos em desenvolvimento. Com esse preâmbulo introduzimos nosso objeto de pesquisa que investiga de que maneira a mídia está posta na lei 8.069/90. A forte presença dos aparelhos tecnológicos na vida da sociedade, mais especificamente na vida das crianças e dos adolescentes, ensejou compreender a mídia como opção de lazer e agentes de cultura, em que esses sujeitos estão imersos no mundo midiático, no qual crescem influenciados diariamente pelos meios de comunicação. Para contribuir com as reflexões, a pesquisa está ancorada nos Estudos Culturais e na lei 8.069/90 que se refere especificamente ao ECA. O objetivo da pesquisa é de construir uma relação de análise entre a legislação que ampara as crianças e os adolescentes brasileiros e a abordagem midiática, como influência na construção da identidade dos sujeitos que estão na fase infantojuvenil. Como recurso metodológico optamos pela leitura do documento e textos específicos, tendo a internet como auxiliadora da investigação. Abordar o ECA é dialogar com um cenário multifacetado, a fim de que nossas lutas sejam pela garantia de direitos fundamentais desses sujeitos em formação. PALAVRAS-CHAVE: Criança e Adolescente; ECA; Mídia. ABSTRACT: Modern life has immersed us in a world where technology greatly underpins social relationships. There is, thus, no way to dispel it from our lives. This paper then approaches technology as an aspect contained in the Child and Adolescent Statute (ECA, as in the Brazilian Portuguese acronym, for it currently constitutes the educational foundation of subjects in
Duclos, D.; Lonnoy, J.; Guillerm, Q.; Jurie, F.; Herbin, S.; D'Angelo, E.
2008-04-01
The last five years have seen a renewal of Automatic Target Recognition applications, mainly because of the latest advances in machine learning techniques. In this context, large collections of image datasets are essential for training algorithms as well as for their evaluation. Indeed, the recent proliferation of recognition algorithms, generally applied to slightly different problems, make their comparisons through clean evaluation campaigns necessary. The ROBIN project tries to fulfil these two needs by putting unclassified datasets, ground truths, competitions and metrics for the evaluation of ATR algorithms at the disposition of the scientific community. The scope of this project includes single and multi-class generic target detection and generic target recognition, in military and security contexts. From our knowledge, it is the first time that a database of this importance (several hundred thousands of visible and infrared hand annotated images) has been publicly released. Funded by the French Ministry of Defence (DGA) and by the French Ministry of Research, ROBIN is one of the ten Techno-vision projects. Techno-vision is a large and ambitious government initiative for building evaluation means for computer vision technologies, for various application contexts. ROBIN's consortium includes major companies and research centres involved in Computer Vision R&D in the field of defence: Bertin Technologies, CNES, ECA, DGA, EADS, INRIA, ONERA, MBDA, SAGEM, THALES. This paper, which first gives an overview of the whole project, is focused on one of ROBIN's key competitions, the SAGEM Defence Security database. This dataset contains more than eight hundred ground and aerial infrared images of six different vehicles in cluttered scenes including distracters. Two different sets of data are available for each target. The first set includes different views of each vehicle at close range in a "simple" background, and can be used to train algorithms. The second set
Kenya | Page 87 | IDRC - International Development Research Centre
International Development Research Centre (IDRC) Digital Library (Canada)
That dire warning, from Dr Lalla Ben Barka of the UN Economic Commission for Africa (ECA), reflects the growing alarm over Africa's increasing exodus of human capital ... Language English. A profile of Michael Clarke, director of IDRC's Information and Communication Technologies for Development (ICT4D) program area.
Directory of Open Access Journals (Sweden)
Luiz Antônio Lima
2008-12-01
foi de 225,6 sc e a média anual de 45,12 sc ha-1, com acréscimo de 119% na produtividade do cafeeiro quando comparada ao tratamento não irrigado, que produziu, em média, 24 sc ha-1 ano-1. O grau de maturação, no momento da colheita, influenciou o rendimento dos tratamentos, sendo os frutos nos estádios cereja e seco, os que mais interferiram no rendimento.Search for sustainability on agricultural exploration and incorporation of new technologies impose the necessity for knowledge and management of main factors related to production, such as irrigation. This experiment evaluated the irrigation effect on yield and production efficiency (amount of beans to produce a bag of 60Kg of coffee irrigated by center pivot in Lavras-MG, Brazil. The experiment was planted with the cultivar Rubi MG-1192, planted on March, 1999. spaced 3.5 meters between rows and 0.8 meters between plants. The experimental design was the one of randomized blocks, with six treatment levels and three replicates. The irrigation was applied at intervals of 2 or 3 days, on Mondays, Wednesdays and Fridays, based on the amount estimated by the water blance considering the class A pan evaporation (ECA and rain depths. The irrigation was calculated as 0% of the difference between ECA and rain depth - 0% ECA (T1, non irrigated, 60% ECA (T2, 80% ECA (T3, 100% ECA (T4, 120% ECA (T5 and 140% ECA (T6. After harvesting the coffee grains from the experimental plots, coffee samples were packed in ventilated plastic bags and dried on wood benches exposed to air long enough to decrease its moisture content between 11 and 12%, gravimetric water content. After drying, the beans were unpeeled and weighed to calculate the yield and production efficiency. Irrigation increased the yield of irrigated plots compared to non irrigated. Although non significant difference was statistically observed when comparing annual yields, the differences were statistically significant when the total production was compared among
Goh, Glenda; Raudsepp, Terje; Durkin, Keith; Wagner, Michelle L; Schäffer, Alejandro A; Agarwala, Richa; Tozaki, Teruaki; Mickelson, James R; Chowdhary, Bhanu P
2007-01-01
High-resolution physically ordered gene maps for equine homologs of human chromosome 5 (HSA5), viz., horse chromosomes 14 and 21 (ECA14 and ECA21), were generated by adding 179 new loci (131 gene-specific and 48 microsatellites) to the existing maps of the two chromosomes. The loci were mapped primarily by genotyping on a 5000-rad horse x hamster radiation hybrid panel, of which 28 were mapped by fluorescence in situ hybridization. The approximately fivefold increase in the number of mapped markers on the two chromosomes improves the average resolution of the map to 1 marker/0.9 Mb. The improved resolution is vital for rapid chromosomal localization of traits of interest on these chromosomes and for facilitating candidate gene searches. The comparative gene mapping data on ECA14 and ECA21 finely align the chromosomes to sequence/gene maps of a range of evolutionarily distantly related species. It also demonstrates that compared to ECA14, the ECA21 segment corresponding to HSA5 is a more conserved region because of preserved gene order in a larger number of and more diverse species. Further, comparison of ECA14 and the distal three-quarters region of ECA21 with corresponding chromosomal segments in 50 species belonging to 11 mammalian orders provides a broad overview of the evolution of these segments in individual orders from the putative ancestral chromosomal configuration. Of particular interest is the identification and precise demarcation of equid/Perissodactyl-specific features that for the first time clearly distinguish the origins of ECA14 and ECA21 from similar-looking status in the Cetartiodactyls.
Robinson, Gareth; Thorn, Robin; Reynolds, Darren
2012-12-24
Electrochemically activated solutions (ECAS) are generated by electrolysis of NaCl solutions, and demonstrate broad spectrum antimicrobial activity and high environmental compatibility. The biocidal efficacy of ECAS at the point of production is widely reported in the literature, as are its credentials as a "green biocide." Acidic ECAS are considered most effective as biocides at the point of production and ill suited for extended storage. Acidic ECAS samples were stored at 4 °C and 20 °C in glass and polystyrene containers for 398 days, and tested for free chlorine, pH, ORP and bactericidal activity throughout. ORP and free chlorine (mg/L) in stored ECAS declined over time, declining at the fastest rate when stored at 20 °C in polystyrene and at the slowest rate when stored at 4 °C in glass. Bactericidal efficacy was also affected by storage and ECAS failed to produce a 5 log(10) reduction on five occasions when stored at 20 °C. pH remained stable throughout the storage period. This study represents the longest storage evaluation of the physiochemical parameters and bactericidal efficacy of acidic ECAS within the published literature and reveals that acidic ECAS retain useful bactericidal activity for in excess of 12 months, widening potential applications.
Directory of Open Access Journals (Sweden)
Gareth Robinson
2012-12-01
Full Text Available Electrochemically activated solutions (ECAS are generated by electrolysis of NaCl solutions, and demonstrate broad spectrum antimicrobial activity and high environmental compatibility. The biocidal efficacy of ECAS at the point of production is widely reported in the literature, as are its credentials as a “green biocide.” Acidic ECAS are considered most effective as biocides at the point of production and ill suited for extended storage. Acidic ECAS samples were stored at 4 °C and 20 °C in glass and polystyrene containers for 398 days, and tested for free chlorine, pH, ORP and bactericidal activity throughout. ORP and free chlorine (mg/L in stored ECAS declined over time, declining at the fastest rate when stored at 20 °C in polystyrene and at the slowest rate when stored at 4 °C in glass. Bactericidal efficacy was also affected by storage and ECAS failed to produce a 5 log10 reduction on five occasions when stored at 20 °C. pH remained stable throughout the storage period. This study represents the longest storage evaluation of the physiochemical parameters and bactericidal efficacy of acidic ECAS within the published literature and reveals that acidic ECAS retain useful bactericidal activity for in excess of 12 months, widening potential applications.
On two speed optimization problems for ships that sail in and out of emission control areas
DEFF Research Database (Denmark)
Fagerholt, Kjetil; Psaraftis, Harilaos N.
2015-01-01
This paper deals with two speed optimization problems for ships that sail in and out of Emission Control Areas (ECAs) with strict limits on sulfur emissions. For ships crossing in and out of ECAs, such as deep-sea vessels, one of the common options for complying with these limits is to burn heavy...... fuel oil (HFO) outside the ECA and switch to low-sulfur fuel such as marine gas oil (MGO) inside the ECA. As the prices of these two fuels are generally very different, so may be the speeds that the ship will sail at outside and inside the ECA. The first optimization problem examined by the paper...
Health, environmental risks and externalities of nuclear and other energy systems of Russia
International Nuclear Information System (INIS)
Vasiliev, A.P.; Demin, V.F.
2000-01-01
Due to different reasons the structure of electricity production systems of Russia should be reconsidered and changed. In this reconsideration the results of comparative risk assessment (CRA) and external cost assessment (ECA) are needed. CRA and ECA study has been carried out in the frame of the research program of International Center of Environmental Safety of Ministry of Atomic Energy of Russia. Main directions of this study are: 1) developing CRA and ECA methodology and data base ; 2) performing CRA and ECA for nuclear and other energy systems. Some tendencies in development of electricity production systems in Russia and preliminary results of CRA and ECA are described. (author)
Robinson, Gareth; Thorn, Robin; Reynolds, Darren
2012-01-01
Electrochemically activated solutions (ECAS) are generated by electrolysis of NaCl solutions, and demonstrate broad spectrum antimicrobial activity and high environmental compatibility. The biocidal efficacy of ECAS at the point of production is widely reported in the literature, as are its credentials as a “green biocide.” Acidic ECAS are considered most effective as biocides at the point of production and ill suited for extended storage. Acidic ECAS samples were stored a...
Martinez, G.; Vanderlinden, K.; Ordóñez, R.; Muriel, J. L.
2009-04-01
Soil organic carbon (SOC) spatial characterization is necessary to evaluate under what circumstances soil acts as a source or sink of carbon dioxide. However, at the field or catchment scale it is hard to accurately characterize its spatial distribution since large numbers of soil samples are necessary. As an alternative, near-surface geophysical sensor-based information can improve the spatial estimation of soil properties at these scales. Electromagnetic induction (EMI) sensors provide non-invasive and non-destructive measurements of the soil apparent electrical conductivity (ECa), which depends under non-saline conditions on clay content, water content or SOC, among other properties that determine the electromagnetic behavior of the soil. This study deals with the possible use of ECa-derived maps to improve SOC spatial estimation by Simple Kriging with varying local means (SKlm). Field work was carried out in a vertisol in SW Spain. The field is part of a long-term tillage experiment set up in 1982 with three replicates of conventional tillage (CT) and Direct Drilling (DD) plots with unitary dimensions of 15x65m. Shallow and deep (up to 0.8m depth) apparent electrical conductivity (ECas and ECad, respectively) was measured using the EM38-DD EMI sensor. Soil samples were taken from the upper horizont and analyzed for their SOC content. Correlation coefficients of ECas and ECad with SOC were low (0.331 and 0.175) due to the small range of SOC values and possibly also to the different support of the ECa and SOC data. Especially the ECas values were higher in the DD plots. The normalized ECa difference (ΔECa), calculated as the difference between the normalized ECas and ECad values, distinguished clearly the CT and DD plots, with the DD plots showing positive ΔECa values and CT plots ΔECa negative values. The field was stratified using fuzzy k-means (FKM) classification of ΔECa (FKM1), and ECas and ECad (FKM2). The FKM1 map mainly showed the difference between
Martínez, G.; Vanderlinden, K.; Giraldez, J. V.; Espejo, A. J.; Muriel, J. L.
2009-12-01
Soil moisture plays an important role in a wide variety of biogeochemical fluxes in the soil-plant-atmosphere system and governs the (eco)hydrological response of a catchment to an external forcing such as rainfall. Near-surface electromagnetic induction (EMI) sensors that measure the soil apparent electrical conductivity (ECa) provide a fast and non-invasive means for characterizing this response at the field or catchment scale through high-resolution time-lapse mapping. Here we show how ECa maps, obtained before and after an intense rainfall event of 125 mm h-1, elucidate differences in soil moisture patterns and hydrologic response of an experimental field as a consequence of differed soil management. The dryland field (Vertisol) was located in SW Spain and cropped with a typical wheat-sunflower-legume rotation. Both, near-surface and subsurface ECa (ECas and ECad, respectively), were measured using the EM38-DD EMI sensor in a mobile configuration. Raw ECa measurements and Mean Relative Differences (MRD) provided information on soil moisture patterns while time-lapse maps were used to evaluate the hydrologic response of the field. ECa maps of the field, measured before and after the rainfall event showed similar patterns. The field depressions where most of water and sediments accumulated had the highest ECa and MRD values. The SE-oriented soil, which was deeper and more exposed to sun and wind, showed the lowest ECa and MRD. The largest differences raised in the central part of the field where a high ECa and MRD area appeared after the rainfall event as a consequence of the smaller soil depth and a possible subsurface flux concentration. Time-lapse maps of both ECa and MRD were also similar. The direct drill plots showed higher increments of ECa and MRD as a result of the smaller runoff production. Time-lapse ECa increments showed a bimodal distribution differentiating clearly the direct drill from the conventional and minimum tillage plots. However this kind
Fertilization effects on the electrical conductivity measured by EMI, ERT, and GPR
Weihermueller, L.; Kaufmann, M.; Steinberger, P.; Pätzold, S.; Vereecken, H.; Van Der Kruk, J.
2017-12-01
Near surface geophysics such as electromagnetic induction (EMI), electrical resistivity tomography (ERT), and ground penetrating radar (GPR) are widely used for field characterization, to delineate soil units, and to estimate soil texture, bulk densities and/or soil water contents. Hereby, the measured soil apparent conductivity (ECa) is often used. Soil ECa is governed by horizontal and vertical changes in soil texture, mineralogy, soil water content, and temperature, and the single contributions are not easy to disentangle. Within single fields and between fields fertilization management may vary spatially, which holds especially for field trials. As a result, ECa might vary due to differences in electrolyte concentration and subsequent pore fluid conductivity, but secondary fertilization effects might also play a major role in ECa differences such as differences in soil water uptake by growing plants. To study the direct effect of mineral fertilization on ECa, a field experiment was performed on 21 bare soil plots each of a size of 9 m2, where 7 different fertilization treatments were established in triplicates. As mineral fertilizers, commercial calcium ammonium nitrate and potassium chloride were chosen and applied in dosages of 200, 400, and 2000 kg ha-1 N equivalent. Additionally, soil water, soil temperature, and EC were recorded in a pit at different depths using commercial sensors. Changes in ECa were measured every 10 days using EMI and monthly using GPR and ERT. Additionally, soil samples were monthly taken at all plots and nitrate, chloride, and potassium contents were measured in the lab. The poster will show the effect of ECa changes due to fertilization and corresponding leaching of the fertilized elements over time. The experimental results provide information of how fertilization is influencing ECa readings and how long the fertilizers are influencing ECa measurements with geophysical instruments. This study helps to overcome restricted
Lectin binding assays for in-process monitoring of sialylation in protein production.
Xu, Weiduan; Chen, Jianmin; Yamasaki, Glenn; Murphy, John E; Mei, Baisong
2010-07-01
Many therapeutic proteins require appropriate glycosylation for their biological activities and plasma half life. Coagulation factor VIII (FVIII) is a glycoprotein which has extensive post-translational modification by N-linked glycosylation. The terminal sialic acid in the N-linked glycans of FVIII is required for maximal circulatory half life. The extent of FVIII sialylation can be determined by high pH anion-exchange chromatography coupled with a pulse electrochemical detector (HPAEC-PED), but this requires a large amount of purified protein. Using FVIII as a model, the objective of the present study was to develop assays that enable detection and prediction of sialylation deficiency at an early stage in the process and thus prevent downstream product quality excursions. Lectin ECA (Erythrina Cristagalli) binds to unsialylated Galbeta1-4 GlcNAc and the ECA-binding level (i.e., terminal Gal(beta1-4) exposure) is inversely proportional to the level of sialylation. By using ECA, a cell-based assay was developed to measure the global sialylation profile in FVIII producing cells. To examine the Galbeta1-4 exposure on the FVIII molecule in bioreactor tissue culture fluid (TCF), an ELISA-based ECA-FVIII binding assay was developed. The ECA-binding specificity in both assays was assessed by ECA-specific sugar inhibitors and neuraminidase digestion. The ECA-binding specificity was also independently confirmed by a ST3GAL4 siRNA knockdown experiment. To establish the correlation between Galbeta1-4 exposure and the HPAEC-PED determined FVIII sialylation value, the FVIII containing bioreactor TCF and the purified FVIII samples were tested with ECA ELISA binding assay. The results indicated an inverse correlation between ECA binding and the corresponding HPAEC-PED sialylation value. The ECA-binding assays are cost effective and can be rapidly performed, thereby making them effective for in-process monitoring of protein sialylation.
Mast cells in Canine parvovirus-2-associated enteritis with crypt abscess.
Woldemeskel, M W; Saliki, J T; Blas-Machado, U; Whittington, L
2013-11-01
The role of mast cells (MCs) in allergic reactions and parasitic infections is well established. Their involvement in host immune response against bacterial and viral infections is reported. In this study, investigation is made to determine if MCs are associated with Canine parvovirus-2 (CPV-2)-induced enteritis with crypt abscess (ECA). Mast cell count (MCC) was made on toluidine blue-stained intestinal sections from a total of 34 dogs. These included 16 dogs exhibiting ECA positive for CPV-2 and negative for Canine distemper virus and Canine coronavirus by immunohistochemistry and fluorescent antibody test, 12 dogs with inflammatory bowel disease (IBD), and 6 non-ECA/non-IBD (control) dogs. The average total MCC per high-power field in ECA (40.8 ± 2.2) and IBD (24.7 ± 2.1) was significantly higher (P .05), MCC was also higher in ECA than in IBD. The present study for the first time has documented significantly increased MCs in CPV-2-associated ECA as was previously reported for IBD, showing that MCs may also play an important role in CPV-2-associated ECA. Further studies involving more CPV-infected dogs are recommended to substantiate the findings.
Directory of Open Access Journals (Sweden)
Oliver Lieven
Full Text Available Besides the active Wnt signalling itself, the extracellular inhibition by Dkk1 is important for various embryonic developmental processes, such as optic vesicle differentiation and facial outgrowth. Although a feedback crosstalk of the active Wnt/β-catenin signaling and Dkk1 regulation has been suggested, the control of Dkk1 transcription by the Tcf/Lef1 mediated Wnt signalling and its connection to additional signalling factors has not been elucidated in vivo. Here, we used a combination of transgenic mouse approaches and biochemical analyses to unravel the direct Dkk1 transcriptional regulation via Tcf/Lefs. By using site directed mutagenesis, we tested several conserved Tcf/Lef1 binding sites within Dkk1 conserved non-coding elements (CNEs and found that these are required for tissue specific reporter expression. In addition a conserved Msx1/2 binding site is required for retinal reporter expression and Msx2 but not Msx1 binds its conserved binding site within CNE195 in the optic cups. Within craniofacial expression domains, Lef1 interferes with Dkk1 directly via two conserved Tcf/Lef1 binding sites in the craniofacial enhancer CNE114, both of which are required for the general craniofacial Dkk1 reporter activation. Furthermore, these Tcf/Lef1 sites are commonly bound in the whisker hair bud mesenchyme but specifically Tcf/Lef1 (no. 2 is required for mandibular activation and repression of maxillar Dkk1 activation. Lastly, we tested the Tcf/Lef1 binding capacities of the Dkk1 promoter and found that although Lef1 binds the Dkk1 promoter, these sites are not sufficient for tissue specific Dkk1 activation. Together, we here present the importance of conserved Tcf/Lef1 and Msx1/2 sites that are required for differential Dkk1 transcriptional reporter activation in vivo. This requirement directly correlates with Lef1 and Msx1/2 interaction with these genomic loci.
Evaluation of InGaAS array detector suitability to space environment
Tauziede, L.; Beulé, K.; Boutillier, M.; Bernard, F.; Reverchon, J.-L.; Buffaz, A.
2017-11-01
InGaAs material has a natural cutoff wavelength of 1.65µm so it is naturally suitable for detection in Short Wavelength InfraRed (SWIR) spectral range. Regarding Earth Observation Spacecraft missions this spectral range can be used for the CO2 concentration measurements in the atmosphere. CNES (French Space agency) is studying a new mission, Microcarb with a spectral band centered on 1.6µm wavelength. InGaAs detector looks attractive for space application because its low dark current allows high temperature operation, reducing by the way the needed instrument resources. The Alcatel Thales III-VLab group has developed InGaAs arrays technology (320x256 & 640x512) that has been studied by CNES, using internal facilities. Performance tests and technological evaluation were performed on a 320x256 pixels array with a pitch of 30µm. The aim of this evaluation was to assess this new technology suitability for space applications. The carried out test plan includes proton radiations with Random Telegraph Signal (RTS) study, operating lifetest and evolution of performances as a function of the operating temperature.
Fibre optic gyroscopes for space use
Faussot, Nicolas; Cottreau, Yann; Hardy, Guillaume; Simonpietri, Pascal; Gaiffe, Thierry
2017-11-01
Among the technologies available for gyroscopes usable in space, the Fibre Optic Gyroscope (FOG) technology appears to be the most suitable: no moving parts, very good lifetime, low power consumption, very low random walk, arbitrarily low angular resolution and very good behaviour in radiations and vacuum. Benefiting from more than ten years of experience with this technology, Ixsea (formerly the Navigation Division of Photonetics) is developing space FOG under both CNES and ESA contracts since many years. In the 1996-1998 period, two space FOG demonstrators in the 0,01°/h class were manufactured, including an optical head (optic and optoelectronic part) designed for space use and a standard ground electronics. Beyond the demonstration of the specified FOG performances, the behaviour of the optical head has been validated for use in typical space environment: vibrations, shocks, radiations (up to 50 krad) and thermal vacuum. Since the beginning of 1999, Ixsea is developing a space electronics in order to manufacture two complete space FOG. The first one entered in qualification in October. The second one will be delivered beginning of next year, it will be used in a CNES attitude measurement experiment (MAGI) onboard the FrenchBrazilian Microsatellite (FBM) partly dedicated to technology evaluation.
Martini, Edoardo; Wollschläger, Ute; Kögler, Simon; Behrens, Thorsten; Dietrich, Peter; Reinstorf, Frido; Schmidt, Karsten; Weiler, Markus; Werban, Ulrike; Zacharias, Steffen
2016-04-01
Characterizing the spatial patterns of soil moisture is critical for hydrological and meteorological models, as soil moisture is a key variable that controls matter and energy fluxes and soil-vegetation-atmosphere exchange processes. Deriving detailed process understanding at the hillslope scale is not trivial, because of the temporal variability of local soil moisture dynamics. Nevertheless, it remains a challenge to provide adequate information on the temporal variability of soil moisture and its controlling factors. Recent advances in wireless sensor technology allow monitoring of soil moisture dynamics with high temporal resolution at varying scales. In addition, mobile geophysical methods such as electromagnetic induction (EMI) have been widely used for mapping soil water content at the field scale with high spatial resolution, as being related to soil apparent electrical conductivity (ECa). The objective of this study was to characterize the spatial and temporal pattern of soil moisture at the hillslope scale and to infer the controlling hydrological processes, integrating well established and innovative sensing techniques, as well as new statistical methods. We combined soil hydrological and pedological expertise with geophysical measurements and methods from digital soil mapping for designing a wireless soil moisture monitoring network. For a hillslope site within the Schäfertal catchment (Central Germany), soil water dynamics were observed during 14 months, and soil ECa was mapped on seven occasions whithin this period of time using an EM38-DD device. Using the Spearman rank correlation coefficient, we described the temporal persistence of a dry and a wet characteristic state of soil moisture as well as the switching mechanisms, inferring the local properties that control the observed spatial patterns and the hydrological processes driving the transitions. Based on this, we evaluated the use of EMI for mapping the spatial pattern of soil moisture under
Ii, Noriko; Fuwa, Nobukazu; Toyomasu, Yutaka; Takada, Akinori; Nomura, Miwako; Kawamura, Tomoko; Sakuma, Hajime; Nomoto, Yoshihito
2017-07-01
The purpose of this study was to describe a novel system for treating advanced head and neck cancer consisting of an external carotid arterial sheath (ECAS) and a microcatheter to inject drugs retrogradely into multiple feeding arteries through the superficial temporal artery (STA). Four consecutive patients with head and neck cancer that had more than one feeding artery were enrolled in this study. The ECAS was made of polyurethane and surface-coated with heparin resin to prevent thrombus formation, allowing it to remain in place for a prolonged period of time. The ECAS was inserted through the STA, and its tip was placed between the maxillary artery and facial artery. The tumor-feeding arteries were selected using a hooked-shaped microcatheter through the ECAS. A total of 13 target arteries were selected in the four patients. The microcatheter inserted via the ECAS was used to catheterize ten arteries (five lingual arteries and five facial arteries). The remaining three lingual arteries were directly selected by the catheter without ECAS. All of the target arteries were able to be catheterized superselectively. The technical success rate was 100%. Vascular occlusion, which might have been caused by the ECAS, was observed in one patient. No neurologic toxicities occurred. This ECAS system is a new approach for retrograde superselective intra-arterial chemotherapy that covers the entire tumor with anticancer drugs. It has the potential to increase the effectiveness of therapy for advanced head and neck cancer. Level 4, Case Series.
Directory of Open Access Journals (Sweden)
Yan Jing Li
2014-05-01
Full Text Available Background: Photodynamic therapy (PDT is a new treatment for esophageal cancer which has been shown to be effective in the elimination of tumor. However, PDT could induce the activation of nuclear factor-kappa B (NF-κB in many photosensitizers based PDT, which plays a negative role in PDT. In addition, our previous results have shown that dihydroartemisinin (DHA, which was the most potent one of artemisinin derivatives, has anticancer activity in esophageal cancer cells. Methods: Cell viability was determined by MTT analysis, and apoptosis was evaluated by flow cytometry. Nuclear extract was obtained for determining NF-κB DNA-binding activity, while total protein extract obtained for downstream gene expression by western blot. Results: We demonstrated DHA enhanced PDT-induced growth inhibition and apoptosis in both human esophageal cancer cell lines Eca109 and Ec9706 in vitro. The mechanism was at least partially due to DHA deactivated PDT-induced NF-κB activation, so as to decrease tremendously the expression of its target gene Bcl-2. Conclusion: Our results demonstrate that DHA augments PDT-induced growth inhibition and apoptosis in esophageal cancer cells, and that inactivation of NF-κB activity is a potential mechanism by which DHA sensitizes esophageal cancer cells to PDT-induced growth inhibition and apoptosis.
Usefulness of Models in Precision Nutrient Management
DEFF Research Database (Denmark)
Plauborg, Finn; Manevski, Kiril; Zhenjiang, Zhou
Modern agriculture increasingly applies new methods and technologies to increase production and nutrient use efficiencies and at the same time reduce leaching of nutrients and greenhouse gas emissions. GPS based ECa-measurement equipment, ER or EM instrumentations, are used to spatially character......Modern agriculture increasingly applies new methods and technologies to increase production and nutrient use efficiencies and at the same time reduce leaching of nutrients and greenhouse gas emissions. GPS based ECa-measurement equipment, ER or EM instrumentations, are used to spatially...... and mineral composition. Mapping of crop status and the spatial-temporal variability within fields with red-infrared reflection are used to support decision on split fertilisation and more precise dosing. The interpretation and use of these various data in precise nutrient management is not straightforward...... of mineralisation. However, whether the crop would benefit from this depended to a large extent on soil hydraulic conductivity within the range of natural variation when testing the model. In addition the initialisation of the distribution of soil total carbon and nitrogen into conceptual model compartments...
Directory of Open Access Journals (Sweden)
Alexander V. Perig
2017-11-01
Full Text Available Minimization of the dead zone (DZA in the process of material forming is a materials science problem. Geometric and kinematic approaches to the minimization of the DZA during Equal Channel Angular Extrusion (ECAE have been proposed, developed, analyzed, and documented. The present article is focused on a 2D Computational Fluid Dynamics (CFD description of the kinematic effects of punch shape geometry and inlet (IDW and outlet (ODW die wall motion on the DZA during ECAE of Viscous Incompressible Continuum (VIC through a Segal 2θ-die for a range of channel angles 60° ≤ 2θ ≤ 135°. Due attention has been given to the independent alternating transport motions of the IDW and ODW. Punch shape geometry and the kinematic modes of IDW and ODW motions for DZA minimization have been determined with a numerical solution of the boundary value problem for the Navier-Stokes equations in curl transfer form for VIC. Experimental verification was accomplished with an introduction of initial circular gridlines-based physical simulation techniques. For the first time, experimental verification of CFD-derived results was made through an additional superposition of empirically-derived digital photos with deformed elliptical gridlines in the channel intersection deformation zones and correspondent 2D numerical plots with CFD-derived flow lines and full flow velocities. An empirical DZA localization was experimentally determined as the location of minimally-deformed near circular markers. The computational DZA localization was numerically determined as a flow-lines-free zone (the first hypothesis or as a zone with near-zero values of full flow velocities (the second hypothesis. The relative DZA was estimated as a ratio of the measured DZA with respect to the area of the deformation zone in the channel intersection region. A good agreement was obtained between DZA values obtained with the first hypothesis and experimental results.
Regulating Intracellular Calcium in Plants: From Molecular Genetics to Physiology
International Nuclear Information System (INIS)
Sze, Heven
2008-01-01
To grow, develop, adapt, and reproduce, plants have evolved mechanisms to regulate the uptake, translocation and sorting of calcium ions into different cells and subcellular compartments. Yet how plants accomplish this remarkable feat is still poorly understood. The spatial and temporal changes in intracellular (Ca2+) during growth and during responses to hormonal and environmental stimuli indicate that Ca2+ influx and efflux transporters are diverse and tightly regulated in plants. The specific goals were to determine the biological roles of multiple Ca pumps (ECAs) in the model plant Arabidopsis thaliana. We had pioneered the use of K616 yeast strain to functionally express plant Ca pumps, and demonstrated two distinct types of Ca pumps in plants (Sze et al., 2000. Annu Rev Plant Biol. 51,433). ACA2 represented one type that was auto-inhibited by the N-terminal region and stimulated by calmodulin. ECA1 represented another type that was not sensitive to calmodulin and phylogenetically distinct from ACAs. The goal to determine the biological roles of multiple ECA-type Ca pumps in Arabidopsis has been accomplished. Although we demonstrated ECA1 was a Ca pump by functional expression in yeast, the in vivo roles of ECAs was unclear. A few highlights are described. ECA1 and/or ECA4 are Ca/Mn pumps localized to the ER and are highly expressed in all cell types. Using homozygous T-DNA insertional mutants of eca1, we demonstrated that the ER-bound ECA1 supports growth and confers tolerance of plants growing on medium low in Ca or containing toxic levels of Mn. This is the first genetic study to determine the in vivo function of a Ca pump in plants. A phylogenetically distinct ECA3 is also a Ca/Mn pump that is localized to endosome, such as post-Golgi compartments. Although it is expressed at lower levels than ECA1, eca3 mutants are impaired in Ca-dependent root growth and in pollen tube elongation. Increased secretion of wall proteins in mutants suggests that Ca and Mn
Energy Technology Data Exchange (ETDEWEB)
Alkan, Ozlem [Department of Radiology, Baskent University, Faculty of Medicine, Ankara (Turkey)], E-mail: yalinozlem@hotmail.com; Kizilkilic, Osman; Yildirim, Tulin [Department of Radiology, Baskent University, Faculty of Medicine, Ankara (Turkey); Atalay, Hakan [Department of Cardiovascular Surgery, Baskent University, Faculty of Medicine, Ankara (Turkey)
2009-09-15
Purpose: Although it has been demonstrated that there is a high prevalence of extracranial carotid artery stenosis (ECAS) in patients with severe coronary artery disease, intracranial cerebral artery stenosis (ICAS) is rarely mentioned. We evaluated the prevalence of ICAS in patients with ECAS having elective coronary artery bypass grafting (CABG) surgery to determine the relations between ICAS, ECAS and atherosclerotic risk factors. Methods: We retrospectively reviewed the digital subtraction angiography findings of 183 patients with ECAS {>=} 50% preparing for CABG surgery. The analyses focused on the intracranial or extracranial location and degree of the stenosis. The degree of extracranial stenoses were categorized as normal, <50%, 50-69%, 70-89%, and 90-99% stenosis and occluded. The degree of intracranial stenosis was classified as normal or {<=}25%, 25-49%, and {>=}50% stenosis and occluded. Traditional atherosclerotic risk factors were recorded. Results: ECAS < 70% in 42 patients and ECAS {>=} 70% in 141 patients. ICAS was found in 51 patients and ICAS {>=} 50% in 30 patients. Regarding risk factors, we found hypertension in 135 patients, diabetes mellitus in 91 patients, hyperlipidemia in 84 patients, and smoking in 81 patients. No risk factor was significant predictors of intracranial atherosclerosis. The severity of ICAS was not significantly associated with that of the ECAS. Conclusions: We found ICAS in 27.8% of the patients with ECAS > 50% on digital subtraction angiography preparing for CABG. Therefore a complete evaluation of the neck vessels with magnetic resonance or catheter angiography seems to be indicated as well as intracranial circulation for the risk assessment of CABG.
Small Scale Spatial Variability of Apparent Electrical Conductivity within a Paddy Field
International Nuclear Information System (INIS)
Aimrun, W.; Amin, M.S.M.; Ezrin, M.H.; Amin, M.S.M.
2010-01-01
Quick variability description is an important component for zone management practices. Precision farming requires topping up of only the nutrients that are lacking in the soil to attain the highest yield with the least input. The apparent soil electrical conductivity (ECa) sensor is a useful tool in mapping to identify areas of contrasting soil properties. In non saline soils, ECa is a substitute measurement for soil texture. It is directly related to both water holding capacity and Cation Exchange Capacity (CEC), which are key ingredients of productivity. This sensor measures the ECa across a field quickly and gives detailed soil features (one-second interval) with few operators. Hence, a dense sampling is possible and therefore a high-resolution ECa map can be produced. This study aims to characterize the variability of soil ECa within a Malaysian paddy field with respect to the spatial and seasonal variability. The study was conducted at Block C, Sawah Sempadan, Selangor, Malaysia, for three continuous seasons. Soil ECa was collected after harvesting period. The results showed that deep ECa visualized the pattern of the former river routes clearly as continuous lines (about 45 m width) at the northern and central regions of the study area. This exploration has shown different maps with higher contrast as compared to the existing soil series map for the study area. Seasonal variability test showed that the ECa that was acquired during rainy season (collected after harvest in December to January) has the highest value as compared to another season.
Directory of Open Access Journals (Sweden)
Gurbir Singh
2016-11-01
Full Text Available Use of electromagnetic induction (EMI sensors along with geospatial modeling provide a better opportunity for understanding spatial distribution of soil properties and crop yields on a landscape level and to map site-specific management zones. The first objective of this research was to evaluate the relationship of crop yields, soil properties and apparent electrical conductivity (ECa at different topographic positions (shoulder, backslope, and deposition slope. The second objective was to examine whether the correlation of ECa with soil properties and crop yields on a watershed scale can be improved by considering topography in modeling ECa and soil properties compared to a whole field scale with no topographic separation. This study was conducted in two headwater agricultural watersheds in southern Illinois, USA. The experimental design consisted of three basins per watershed and each basin was divided into three topographic positions (shoulder, backslope and deposition using the Slope Position Classification model in ESRI ArcMap. A combine harvester equipped with a GPS-based recording system was used for yield monitoring and mapping from 2012 to 2015. Soil samples were taken at depths from 0–15 cm and 15–30 cm from 54 locations in the two watersheds in fall 2015 and analyzed for physical and chemical properties. The ECa was measured using EMI device, EM38-MK2, which provides four dipole readings ECa-H-0.5, ECa-H-1, ECa-V-0.5, and ECa-V-1. Soybean and corn yields at depositional position were 38% and 62% lower than the shoulder position in 2014 and 2015, respectively. Soil pH, total carbon (TC, total nitrogen (TN, Mehlich-3 Phosphorus (P, Bray-1 P and ECa at depositional positions were significantly higher compared to shoulder positions. Corn and soybeans yields were weakly to moderately (<±0.75 correlated with ECa. At the deposition position at the 0–15 cm depth ECa-H-0.5 was weakly correlated (r < ±0.50 with soil pH and was
DEFF Research Database (Denmark)
Rehm, Matthias; Wissner, Michael
2005-01-01
In this article, we present Gamble, a small game of dice that is played by two users and an embodied conversational agent (ECA). By its abilities to communicate and collaborate, an ECA is well suited for engaging users in entertaining social interactions. Gamble is used as a test bed for such mul......In this article, we present Gamble, a small game of dice that is played by two users and an embodied conversational agent (ECA). By its abilities to communicate and collaborate, an ECA is well suited for engaging users in entertaining social interactions. Gamble is used as a test bed...
NASA Cryogenic Propellant Systems Technology Development and Potential Opportunities for Discussion
Meyer, Michael L.
2015-01-01
Members of the eCryo Team are traveling to France to meet with CNES (Centre National d'Etudes Spatiales) on the benchmarking of CFM (Cryogenic Fluids Management) analytical models the week of January 26th, 2015. Mike Meyer is representing the Agency and eCryo Project and will conduct a conversation to explore future work. This slide package (28 charts and 3 movies) requires approval via a 1676. ISS data in this chart set has been copied from public websites.
Yoshida, Tomonori; Muto, Daiki; Tamai, Tomoya; Suzuki, Shinsuke
2018-06-01
Porous aluminum alloy with aligned unidirectional pores was fabricated by dipping A1050 tubes into A6061 semi-solid slurry. The porous aluminum alloy was processed through Equal-channel Angular Extrusion (ECAE) while preventing cracking and maintaining both the pore size and porosity by setting the insert material and loading back pressure. The specific compressive yield strength of the sample aged after 13 passes of ECAE was approximately 2.5 times higher than that of the solid-solutionized sample without ECAE. Both the energy absorption E V and energy absorption efficiency η V after four passes of ECAE were approximately 1.2 times higher than that of the solid-solutionized sample without ECAE. The specific yield strength was improved via work hardening and precipitation following dynamic aging during ECAE. E V was improved by the application of high compressive stress at the beginning of the compression owing to work hardening via ECAE. η V was improved by a steep increase of stress at low compressive strain and by a gradual increase of stress in the range up to 50 pct of compressive strain. The gradual increase of stress was caused by continuous shear fracture in the metallic part, which was due to the high dislocation density and existence of unidirectional pores parallel to the compressive direction in the structure.
McFarland, Daniel C; Shen, Megan Johnson; Polizzi, Heather; Mascarenhas, John; Kremyanskaya, Marina; Holland, Jimmie; Hoffman, Ronald
Myeloproliferative neoplasms (MPNs), a group of chronic hematologic malignancies, carry significant physical and psychological symptom burdens that significantly affect patients' quality of life. We sought to identify the relationship between early childhood adversity (ECA) and psychological distress in patients with MPNs, as ECA may compound symptom burden. Patients with MPNs were assessed for ECA (i.e., the Risky Families Questionnaire-subscales include abuse/neglect/chaotic home environment), distress (i.e., Distress Thermometer and Problem List), anxiety (i.e., Hospital Anxiety and Depression Scale-Anxiety [HADS-A]), depression (i.e., Hospital Anxiety and Depression Scale-Depression [HADS-D]), meeting standardized cutoff thresholds for distress (i.e., Distress Thermometer and Problem List≥ 4 or ≥ 7)/anxiety (HADS-A ≥8)/depression (HADS-D ≥ 8), and demographic factors. A total of 117 participants completed the study (78% response rate). ECA was associated with depression (p psychological outcomes. ECA was higher based on disease subtypes with greater symptom burden (other > polycythemia vera > myelofibrosis > essential thrombocythemia) (p = 0.047) and taking an antidepressant (p = 0.011). ECA is associated with psychological distress and meets screening criteria for anxiety and depression in patients with MPNs. ECA may help to explain individual patient trajectories, and further understanding may enhance patient-centered care among patients with MPNs. Copyright © 2017 The Academy of Psychosomatic Medicine. Published by Elsevier Inc. All rights reserved.
Electrochemically activated water as an alternative to chlorine for decentralized disinfection
Ghebremichael, Kebreab A.
2011-06-01
Electrochemically activated (ECA) water is being extensively studied and considered as an alternative to chlorine for disinfection. Some researchers claim that ECA is by and large a chlorine solution, while others claim the presence of reactive oxygen species such as ozone and hydroxyl radicals in addition to chlorine. This study compares sodium hypochlorite (NaOCl) and ECA in terms of disinfection efficacy, trihalomethanes (THMs) formation, stability and composition. The studies were carried out under different process conditions (pH 5,7 and 9, disinfectant concentrations of 2-5 mg/L and dissolved organic carbon (DOC) concentration of 2-4 mg/L). The results indicated that in the presence of low DOC (<2 mg/L) ECA showed better disinfection efficacy for Escherichia coli inactivation, formed lower THM and had better stability compared with NaOCl at both pH 5 and 7. Stability studies of stock solutions showed that over a period of 30 days, ECA decayed by only 5% while NaOCl decayed by 37.5% at temperatures of 4 °C. In a fresh ECA of 200 mg/L chlorine, about 5.3 mg/L ozone and 36.9 mg/L ClO2 were detected. The study demonstrates that ECA could be a suitable alternative to NaOCl where decentralized production and use are required. © IWA Publishing 2011.
Yoshida, Tomonori; Muto, Daiki; Tamai, Tomoya; Suzuki, Shinsuke
2018-04-01
Porous aluminum alloy with aligned unidirectional pores was fabricated by dipping A1050 tubes into A6061 semi-solid slurry. The porous aluminum alloy was processed through Equal-channel Angular Extrusion (ECAE) while preventing cracking and maintaining both the pore size and porosity by setting the insert material and loading back pressure. The specific compressive yield strength of the sample aged after 13 passes of ECAE was approximately 2.5 times higher than that of the solid-solutionized sample without ECAE. Both the energy absorption E V and energy absorption efficiency η V after four passes of ECAE were approximately 1.2 times higher than that of the solid-solutionized sample without ECAE. The specific yield strength was improved via work hardening and precipitation following dynamic aging during ECAE. E V was improved by the application of high compressive stress at the beginning of the compression owing to work hardening via ECAE. η V was improved by a steep increase of stress at low compressive strain and by a gradual increase of stress in the range up to 50 pct of compressive strain. The gradual increase of stress was caused by continuous shear fracture in the metallic part, which was due to the high dislocation density and existence of unidirectional pores parallel to the compressive direction in the structure.
Laser communication experiments between Sota and Meo optical ground station
Artaud, G.,; Issler, J.-L.; Védrenne, N.; Robert, C.; Petit, C.; Samain, E.; Phung, D.-H.; Maurice, N.; Toyoshima, M.; Kolev, D.
2017-09-01
Optical transmissions between earth and space have been identified as key technologies for future high data rate transmissions between satellites and ground. CNES is investigating the use of optics both for High data rate direct to Earth transfer from observation satellites in LEO, and for future telecommunications applications using optics for the high capacity Gateway link.
International Nuclear Information System (INIS)
Jin Li; Lin Dongliang; Mao Dali; Zeng Xiaoqin; Ding Wenjiang
2006-01-01
Microstructure evolution of AZ31 Mg alloy during equal channel angular extrusion (ECAE) was investigated by electron back-scattered diffraction (EBSD). The grains of AZ31 Mg alloy were refined significantly after ECAE 1-8 passes at 498 K and the distributions of grain size tended to be more uniform with pass number increasing. Frequency of sub-boundaries and low angle grain boundaries (LAGBs) increased at initial stage of deformation, and sub-boundaries and LAGBs evolved into high angle grain boundaries (HAGBs) with further deformation, which resulted in the high frequency of HAGBs in the alloy after ECAE 8 passes. Preferred misorientation angle with frequency peak near 30 deg. and 90 deg. were observed. The frequency peaks were weak after ECAE 1 pass but became stronger with the increase of pass numbers. Micro-textures were formed in AZ31 microstructure during ECAE and were stronger with the pass number increasing
Maritime routing and speed optimization with emission control areas
DEFF Research Database (Denmark)
Fagerholt, Kjetil; Gausel, Nora T.; Rakke, Jørgen G.
2015-01-01
a computational study on a number of realistic shipping routes in order to evaluate possible impacts on sailing paths and speeds, and hence fuel consumption and costs, from the ECA regulations. Moreover, the aim is to examine the implications for the society with regards to environmental effects. Comparisons...... of cases show that a likely effect of the regulations is that ship operators will often choose to sail longer distances to avoid sailing time within ECAs. Another effect is that they will sail at lower speeds within and higher speeds outside the ECAs in order to use less of the more expensive fuel. On some......Strict limits on the maximum sulphur content in fuel used by ships have recently been imposed in some Emission Control Areas (ECAs). In order to comply with these regulations many ship operators will switch to more expensive low-sulphur fuel when sailing inside ECAs. Since they are concerned about...
Corrosion barriers processed by Al electroplating and their resistance against flowing Pb–15.7Li
Energy Technology Data Exchange (ETDEWEB)
Krauss, Wolfgang, E-mail: wolfgang.krauss@kit.edu; Konys, Jürgen; Wulf, Sven-Erik
2014-12-15
In the HCLL blanket design, ferritic–martensitic steels are in direct contact with the flowing liquid breeder Pb–15.7Li and have to withstand severe corrosion attack. Beyond corrosion, T-permeation from the breeder into the RAFM-steels is also an important issue and has to be reduced significantly. Earlier work showed that Al-based coatings can act as barriers for both, however, applied processes e.g. HDA or VPS exhibited strong drawbacks in the past. Meanwhile new industrial relevant coating processes, using electroplating technology are under development and called ECA (electrochemical aluminization) and ECX (electrochemical deposition from ionic liquids) process. In this study electrochemically Al-coated and heat-treated Eurofer samples were tested in PICOLO loop for exposure times up to 12,000 h (ECA) and 2000 h (first results ECX) respectively to determine corrosion properties in flowing Pb–15.7Li (550 °C, 0.1 m/s). Cross section analysis afterward corrosion testing proved the ability of thin Al-based barriers made by electrochemical techniques to protect the bare Eurofer from corrosion attack even at exposure times of 12,000 h. Determined radial corrosion rates lay between 10 and 20 μm/a. First results for ECX coated samples (2000 h) revealed more homogeneous corrosion behavior of the barrier layer itself compared to ECA.
Geophysical characterization of soil moisture spatial patterns in a tillage experiment
Martinez, G.; Vanderlinden, K.; Giráldez, J. V.; Muriel, J. L.
2009-04-01
Knowledge on the spatial soil moisture pattern can improve the characterisation of the hydrological response of either field-plots or small watersheds. Near-surface geophysical methods, such as electromagnetic induction (EMI), provide a means to map such patterns using non-invasive and non-destructive measurements of the soil apparent electrical conductivity (ECa. In this study ECa was measured using an EMI sensor and used to characterize spatially the hydrologic response of a cropped field to an intense shower. The study site is part of a long-term tillage experiment in Southern Spain in which Conventional Tillage (CT), Direct Drilling (DD) and Minimum Tillage (MT) are being evaluated since 1982. Soil ECa was measured before and after a rain event of 115 mm, near the soil surface and at deeper depth (ECas and ECad, respectively) using the EM38-DD EMI sensor. Simultaneously, elevation data were collected at each sampling point to generate a Digital Elevation Model (DEM). Soil moisture during the first survey was close to permanent wilting point and near field capacity during the second survey. For the first survey, both ECas and ECad, were higher in the CT and MT than in the DD plots. After the rain event, rill erosion appeared only in CT and MT plots were soil was uncovered, matching the drainage lines obtained from the DEM. Apparent electrical conductivity increased all over the field plot with higher increments in the DD plots. These plots showed the highest ECas and ECad values, in contrast to the spatial pattern found during the first sampling. Difference maps obtained from the two ECas and ECad samplings showed a clear difference between DD plots and CT and MT plots due to their distinct hydrologic response. Water infiltration was higher in the soil of the DD plots than in the MT and CT plots, as reflected by their ECad increment. Higher ECa increments were observed in the depressions of the terrain, where water and sediments accumulated. On the contrary, the
Wang, Dandan; Wang, Jing; Jin, Cheng; Ji, Ruijun; Wang, Anxin; Li, Xin; Gao, Xiang; Wu, Shouling; Zhou, Yong; Zhao, Xingquan
2016-01-01
Asymptomatic extracranial artery stenosis (ECAS) is a well-known risk factor for stroke events, but it remains unclear whether it has the same role in predicting cardiovascular and cerebrovascular diseases, especially in China. We investigated the potential associations between ECAS, carotid plaque and carotid intima-media thickness and the new occurrence of cardiovascular and cerebrovascular diseases in the study. Out of 5440 study participants, 364 showed an asymptomatic ECAS at baseline, a...
International Nuclear Information System (INIS)
Demin, V.F.
2002-01-01
The IAEA technical report involving description of the Manual for procedure of comparison risk assessment (CRA) and external cost (ECA) of environmental and public health effect from nuclear energetics and other power generation is treated. CRA and ECA results depend on national and regional social-economic, geographic, medical and demographic, and other features. When using CRA and ECA procedures developed in concrete countries their adaptation is necessary for conditions of other countries [ru
Marwan,
2015-01-01
Conventional soil sampling is time consuming and requires meticulous laboratory analysis. Hence, mapping of soil apparent in respect to electrical conductivity (ECa) has been developed to identify areas of contrasting soil properties. Such ECa values are represent measures of soil properties. The sensor system, GF Instrument model CMD-4 were used to analyze soil physical properties. This system consists of three important parts, ECa sensor, data logger and Global Positioning System (DGPS) rec...
Directory of Open Access Journals (Sweden)
Shan Ye
Full Text Available The existing screening batteries assessing multiple neuropsychological functions are not specific to amyotrophic lateral sclerosis (ALS patients and are limited to their physical dysfunctions, whereas category cognitive tests are too time-consuming to assess all the domains. The Edinburgh Cognitive and Behavioural ALS Screen (ECAS was recently developed as a fast and easy cognitive screening tool specifically designed for patients. The purpose of the study was to validate the effectiveness of the Chinese version in Chinese ALS populations.Eighty-four ALS patients and 84 age-, gender- and education-matched healthy controls were included in this cross-sectional study. All the participants took the ECAS, Mini-Mental State Examination (MMSE and Frontal Assessment Battery (FAB. Primary caregivers of patients were interviewed for behavioural and psychiatric changes.Significant differences were noted in language (p = 0.01, fluency, executive function, ALS-specific functions, and ECAS total score (p<0.01 between ALS patients and controls. The cut-off value of the total ECAS score was 81.92. Cognitive impairment was observed in 35.71% of patients, and 27.38% exhibited behavioural abnormalities. The ECAS total score had a medium correlation with education year. Memory was more easily impaired in the lower education group, whereas verbal fluency and language function tended to be preserved in the higher education group. The average time of ECAS was only 18 minutes.The Chinese version of the ECAS is the first screening battery assessing multiple neuropsychological functions specially designed for the ALS population in China, which provides an effective and rapid tool to screen cognitive and behavioural impairments.
Brown, Dale H.
1976-01-01
A study was performed to estimate the technical/economic characteristics of a steam power plant (3500 pounds per square inch gauge, 1000 degrees Fahrenheit / 1000 degrees Fahrenheit) with a coal-burning radiant furnace and a wet lime stack gas scrubber to control sulfur emissions. Particulate emissions were controlled by an electrostatic precipitator operating at 300 degrees Fahrenheit. The stack gas from the scrubber was reheated from 125 degrees Fahrenheit to 250 degrees Fahrenheit as a base case, and from 125 degrees Fahrenheit to 175 degrees Fahrenheit as an alternate case. The study was performed on a basis consistent with the General Electric ECAS Phase II evaluation of advanced energy conversion systems for electric utility baseload applications using coal or coal-derived fuels. A conceptual design of the power plant was developed, including the on-site calcination of limestone to lime and the provision of sludge ponds to store the products of flue gas scrubbing. From this design, estimates were derived for power plant efficiency, capital cost, environmental intrusion characteristics, natural resource requirements, and cost of electricity at an assumed capacity factor of 65 percent. An implementation assessment was performed where factors affecting applicability of the conceptual design power plant in electric utility generation systems were appraised. At 250 degrees Fahrenheit and 175 degrees Fahrenheit stack gas temperatures respectively, the plants showed a cost of electricity of 39.8 and 37.0 mills per kilowatt-hours and overall plant efficiencies of 32 percent and 34 percent.
The First European Parabolic Flight Campaign with the Airbus A310 ZERO-G
Pletser, Vladimir; Rouquette, Sebastien; Friedrich, Ulrike; Clervoy, Jean-Francois; Gharib, Thierry; Gai, Frederic; Mora, Christophe
2016-12-01
Aircraft parabolic flights repetitively provide up to 23 seconds of reduced gravity during ballistic flight manoeuvres. Parabolic flights are used to conduct short microgravity investigations in Physical and Life Sciences and in Technology, to test instrumentation prior to space flights and to train astronauts before a space mission. The use of parabolic flights is complementary to other microgravity carriers (drop towers, sounding rockets), and preparatory to manned space missions on board the International Space Station and other manned spacecraft, such as Shenzhou and the future Chinese Space Station. After 17 years of using the Airbus A300 ZERO-G, the French company Novespace, a subsidiary of the ' Centre National d'Etudes Spatiales' (CNES, French Space Agency), based in Bordeaux, France, purchased a new aircraft, an Airbus A310, to perform parabolic flights for microgravity research in Europe. Since April 2015, the European Space Agency (ESA), CNES and the ` Deutsches Zentrum für Luft- und Raumfahrt e.V.' (DLR, the German Aerospace Center) use this new aircraft, the Airbus A310 ZERO-G, for research experiments in microgravity. The first campaign was a Cooperative campaign shared by the three agencies, followed by respectively a CNES, an ESA and a DLR campaign. This paper presents the new Airbus A310 ZERO-G and its main characteristics and interfaces for scientific experiments. The experiments conducted during the first European campaign are presented.
Dickin, Katherine L; Dollahite, Jamie S; Habicht, Jean-Pierre
2010-01-01
To investigate how paraprofessional Community Nutrition Educators' (CNEs') perceptions of work context relate to job satisfaction and intention to leave the position. Cross-sectional statewide survey of program personnel. Expanded Food and Nutrition Education Program (EFNEP) sites (n = 32) serving low- income families in New York. CNEs delivering EFNEP (n = 115). CNE job satisfaction and intention to leave. Multivariate regression analysis predicting work attitudes from perceived work context, CNE personality traits, and characteristics of CNEs, supervisors, and programs. Despite low satisfaction with pay, overall job satisfaction was high and intention to leave was low. Satisfaction was positively related to CNEs' perceptions of program value, work relationships, and having a voice in relevant decisions (adjusted R(2) = 0.60). Intention to leave was negatively related to perceptions of program value and supervision and satisfaction with pay (adjusted R(2) = 0.36), but the latter relationship was found only among more educated CNEs. CNEs' satisfaction and intention to leave were strongly associated with perceptions of program value, work relationships, and consultative management. Intrinsically motivating work, often viewed as the domain of professionals, is critical for the morale and retention of paraprofessional nutrition educators. Copyright 2010 Society for Nutrition Education. Published by Elsevier Inc. All rights reserved.
The impact of regional environmental regulations on empirical vessel speeds
Ådland, Roar Os; Fonnes, Gro; Jia, Haiying; Daae Lampe, Ove; Strandenes, Siri Pettersen
2017-01-01
Economic theory suggests that the use of more expensive low-sulphur fuel within an Emission Control Area (ECA) should result in lower vessel speeds. The objective of this paper is to investigate empirically, for the first time, whether the introduction of an ECA affects vessel speeds. We utilize a dataset of observed vessel speeds derived from the Automated Information System (AIS) for nearly 7000 ECA boundary crossings over a three-year period. Our results suggest that introducing stricter s...
Dramatic Expression in Opera, and Its Implications for Conversational Agents
National Research Council Canada - National Science Library
Johnson, W. L
2003-01-01
It is commonly agreed among embodied conversational agent (ECA) researchers that ECA behavior should be based upon principles of human face-to-face communication (Cassell et al., 2000; Traum & Rickel, 2002...
Wang, Yan; Zhang, Jin; Qian, Yuesheng; Tang, Xiaofeng; Ling, Huawei; Chen, Kemin; Li, Yan; Gao, Pingjin; Zhu, Dingliang
2016-07-14
Inter-arm blood pressure (BP) difference has been associated with ischemic stroke. Local atherosclerosis of stroke differ among vulnerable individuals, whereas intracranial arterial stenosis (ICAS) is more frequently affected Asians, and extracranial arterial stenosis (ECAS) is more prevalent among whites. We hereby sought to explore the association of inter-arm BP difference with ICAS and ECAS in stroke-free hypertensive patients in Chinese population. All the 885 subjects were evaluated of ICAS and ECAS through computerized tomographic angiography. Both arm BP was measured simultaneously by Vascular Profiler-1000 device. In the continuous study, ICAS was significantly associated with age, male, average brachial SBP, diabetes, anti-hypertensive treatment and inter-arm DBP difference. ECAS was associated with age, inter-arm SBP and LDL. In the categorical study, subjects with the top quartile of inter-arm DBP difference (≥4 mmHg) showed significantly higher risk of ICAS (OR = 2.109; 95% CI, 1.24-3.587). And the participants with the top quartile of inter-arm SBP difference (≥6 mmHg) showed significantly higher risk of ECAS (OR = 2.288; 95% CI, 1.309-3.998). In conclusion, we reported a diverse association of inter-arm SBP/DBP difference with the ICAS/ECAS. Inter-arm DBP difference might be the early symbol of ICAS in Chinese population, which need further verification in long-term cohort study.
Jia, Zhiwei; Wu, Yaohong; Tang, Yong; Ji, Wei; Li, Wei; Zhao, Xiyan; Li, Hao; He, Qing; Ruan, Dike
2016-03-01
The practice of giving certain authors equal credit in scientific publications has become increasingly common in some medical specialties. However, whether this trend also exists in major spine journals remains unclear. This study aimed to investigate the prevalence and characteristics of the practice of giving authors equal credit in major spine journals. Manual searches were performed to identify original research articles with equally credited authors (ECA) published between January 1, 2004 and December 31, 2013 in three major spine journals: Spine, European Spine Journal, and The Spine Journal. The number of authors with ECA and their positions in the byline, total number of authors, year of publication, and country of origin were analysed. The practice of ECA was found in all three journals. Articles with ECA comprised a greater proportion of the total number of publications in each journal in 2013 versus 2004 (Spine, 7.2 vs. 0.2%; European Spine Journal, 7.5 vs. 0.0%; and The Spine Journal, 6.2 vs. 0.0%). There was a statistically significant increasing trend in the annual proportion of papers with ECA for all three spine journals (p applied in nearly every position in the byline, and the first two authors received equal credit in most cases. Articles with ECA were published by authors from various countries and regions around the world. However, none of the three spine journals provided specific guidance on this practice in their author instructions. The practice of ECA in original research articles is increasingly common in major spine journals. A guideline for authors regarding when and how to designate equal credit is warranted in the future.
Baig, Sofia; Medlyn, Belinda E; Mercado, Lina M; Zaehle, Sönke
2015-12-01
The temperature dependence of the reaction kinetics of the Rubisco enzyme implies that, at the level of a chloroplast, the response of photosynthesis to rising atmospheric CO2 concentration (Ca ) will increase with increasing air temperature. Vegetation models incorporating this interaction predict that the response of net primary productivity (NPP) to elevated CO2 (eCa ) will increase with rising temperature and will be substantially larger in warm tropical forests than in cold boreal forests. We tested these model predictions against evidence from eCa experiments by carrying out two meta-analyses. Firstly, we tested for an interaction effect on growth responses in factorial eCa × temperature experiments. This analysis showed a positive, but nonsignificant interaction effect (95% CI for above-ground biomass response = -0.8, 18.0%) between eCa and temperature. Secondly, we tested field-based eCa experiments on woody plants across the globe for a relationship between the eCa effect on plant biomass and mean annual temperature (MAT). This second analysis showed a positive but nonsignificant correlation between the eCa response and MAT. The magnitude of the interactions between CO2 and temperature found in both meta-analyses were consistent with model predictions, even though both analyses gave nonsignificant results. Thus, we conclude that it is not possible to distinguish between the competing hypotheses of no interaction vs. an interaction based on Rubisco kinetics from the available experimental database. Experiments in a wider range of temperature zones are required. Until such experimental data are available, model predictions should aim to incorporate uncertainty about this interaction. © 2015 John Wiley & Sons Ltd.
Measuring Corruption in Eastern Europe and Central Asia : A Critique of the Cross-Country Indicators
Knack, Stephen
2006-01-01
This paper assesses corruption levels and trends among countries in the transition countries of Eastern Europe and Central Asia (ECA) based on data from several sources that are both widely used and cover most or all countries in the region. Data from firm surveys tend to show improvement in most types of administrative corruption, but little change in "state capture" in the region. Broader, subjective corruption indicators tend to show somewhat greater improvement in ECA than in non-ECA coun...
Mercado-Vianco, L; Arenas-Díaz, G
1999-06-01
To demonstrate that the enzyme L-asparaginase from Escherichia coli (EcA) binds to the plasma membranes of normal human lymphocytes and monocytes. Lymphocytes and monocytes were isolated from heparinized blood samples which came from healthy volunteer donors. The cells were incubated with EcA to detect a possible binding of the enzyme to the mononuclear cells by indirect immunofluorescence using confocal microscopy. Meanwhile, ultracentrifugation was used to obtain the erythrocyte ghost microsomal fraction (P100) which was then analyzed by Western blotting to determine if EcA binds the lipid bilayer unspecifically. For the immunoassays, monospecific polyclonal antibodies were obtained from ascitic tumors developed in mice immunized with commercial L-asparaginase. EcA bins the lymphocyte and monocyte plasma membranes. In monocytes, there occurs a capping phenomenon, that is, the accumulation of fluorescent marker in one region. The image analyzer highlights it clearly at a depth of 3.8 microns. This binding would be unspecific, that is, there is no mediation of a specific receptor that binds EcA. This arises from the ability of the enzyme to bind to the membranes of erythrocyte ghost, as evidenced by the ability of the molecule to associate with a hydrophobic medium. The antibodies against EcA obtained from ascitic tumours developed in mice do not show cross reactivity with Na+/K+ ATPase, aspartate aminotransferase, nor with extracts of blood cells, which would make it a specific tool for the detection of EcA in whole cells and in homogenates electrotransfered to nitrocellulose membranes. L-asparaginase from E. coli behaves as a lipoprotein due to its ability to insert itself into hydrophobic environments, in which it resembles an isozyme present in T. pyriformis. The binding of this enzyme to lymphocytes and monocytes, demonstrated in this work, would permit the modification of the antileukemic treatment injecting doses of EcA bound to patient's own isolated immune
Van De Vijver, Ellen; Van Meirvenne, Marc; Seuntjens, Piet
2015-04-01
Bioremediation of soil contaminated with petroleum hydrocarbons through landfarming has been widely applied commercially at large scale. Biodegradation is one of the dominant pollutant removal mechanisms involved in landfarming, but strongly depends on the environmental conditions (e.g. presence of oxygen, moisture content). Conventionally the biodegradation process is monitored by the installation of field monitoring equipment and repeated sample collection and analysis. Because the presence of petroleum hydrocarbons and their degradation products can affect the electrical properties of the soil, proximal soil sensors such as electromagnetic induction (EMI) sensors may provide an alternative to investigate the biodegradation process of these contaminants. We investigated the relation between the EMI-based apparent electrical conductivity (ECa) of a landfarm soil and the presence and degradation status of petroleum hydrocarbons. The 3 ha study area was located in an oil refinery complex contaminated with petroleum hydrocarbons, mainly composed of diesel. At the site, a landfarm was constructed in 1999. The most recent survey of the petroleum hydrocarbon concentrations was conducted between 2011 and 2013. The sampling locations were defined by a grid with a 10 m by 10 m cell size and on each location a sample was taken from four successive soil layers with a thickness of 0.5 m each. Because the survey was carried out in phases using different georeferencing methods, the final dataset suffered from uncertainty in the coordinates of the sampling locations. In September 2013 the landfarm was surveyed for ECa with a multi-receiver electromagnetic induction sensor (DUALEM-21S) using motorized conveyance. The horizontal measurement resolution was 1 m by 0.25 m. On each measurement location the sensor recorded four ECa values representative of measurement depths of 0.5 m, 1.0 m, 1.6 m and 3.2 m. After the basic processing, the ECa measurements were filtered to remove
Keller, Jürgen; Krimly, Amon; Bauer, Lisa; Schulenburg, Sarah; Böhm, Sarah; Aho-Özhan, Helena E A; Uttner, Ingo; Gorges, Martin; Kassubek, Jan; Pinkhardt, Elmar H; Abrahams, Sharon; Ludolph, Albert C; Lulé, Dorothée
2017-08-01
Reliable assessment of cognitive functions is a challenging task in amyotrophic lateral sclerosis (ALS) patients unable to speak and write. We therefore present an eye-tracking based neuropsychological screening tool based on the Edinburgh Cognitive and Behavioural ALS Screen (ECAS), a standard screening tool for cognitive deficits in ALS. In total, 46 ALS patients and 50 healthy controls matched for age, gender and education were tested with an oculomotor based and a standard paper-and-pencil version of the ECAS. Significant correlation between both versions was observed for ALS patients and healthy controls in the ECAS total score and in all of its ALS-specific domains (all r > 0.3; all p ALS patients and healthy controls in the ECAS total score (p ALS patients who are unable to speak or write.
Electrochemically activated water as an alternative to chlorine for decentralized disinfection
Ghebremichael, Kebreab A.; Muchelemba, E.; Petruševski, Branislav; Amy, Gary L.
2011-01-01
Electrochemically activated (ECA) water is being extensively studied and considered as an alternative to chlorine for disinfection. Some researchers claim that ECA is by and large a chlorine solution, while others claim the presence of reactive
IASI instrument: technical description and measured performances
Hébert, Ph.; Blumstein, D.; Buil, C.; Carlier, T.; Chalon, G.; Astruc, P.; Clauss, A.; Siméoni, D.; Tournier, B.
2017-11-01
IASI is an infrared atmospheric sounder. It will provide meteorologist and scientific community with atmospheric spectra. The IASI system includes 3 instruments that will be mounted on the Metop satellite series, a data processing software integrated in the EPS (EUMETSAT Polar System) ground segment and a technical expertise centre implemented in CNES Toulouse. The instrument is composed of a Fourier transform spectrometer and an associated infrared imager. The optical configuration is based on a Michelson interferometer and the interferograms are processed by an on-board digital processing subsystem, which performs the inverse Fourier transforms and the radiometric calibration. The infrared imager co-registers the IASI soundings with AVHRR imager (AVHRR is another instrument on the Metop satellite). The presentation will focus on the architectures of the instrument, the description of the implemented technologies and the measured performance of the first flight model. CNES is leading the IASI program in association with EUMETSAT. The instrument Prime is ALCATEL SPACE.
Brevik, E. C.; Heilig, J.; Kempenich, J.; Doolittle, J.; Ulmer, M.
2012-04-01
Sodium-affected soils (SAS) cover over 4 million hectares in the Northern Great Plains of the United States. Improving the classification, interpretation, and mapping of SAS is a major goal of the United States Department of Agriculture-Natural Resource Conservation Service (USDA-NRCS) as Northern Great Plains soil surveys are updated. Apparent electrical conductivity (ECa) as measured with ground conductivity meters has shown promise for mapping SAS, however, this use of this geophysical tool needs additional evaluation. This study used an EM-38 MK2-2 meter (Geonics Limited, Mississauga, Ontario), a Trimble AgGPS 114 L-band DGPS (Trimble, Sunnyvale, CA) and the RTmap38MK2 program (Geomar Software, Inc., Mississauga, Ontario) on an Allegro CX field computer (Juniper Systems, North Logan, UT) to collect, observe, and interpret ECa data in the field. The ECa map generated on-site was then used to guide collection of soil samples for soil characterization and to evaluate the influence of soil properties in SAS on ECa as measured with the EM-38MK2-2. Stochastic models contained in the ESAP software package were used to estimate the SAR and salinity levels from the measured ECa data in 30 cm depth intervals to a depth of 90 cm and for the bulk soil (0 to 90 cm). This technique showed promise, with meaningful spatial patterns apparent in the ECa data. However, many of the stochastic models used for salinity and SAR for individual depth intervals and for the bulk soil had low R-squared values. At both sites, significant variability in soil clay and water contents along with a small number of soil samples taken to calibrate the ECa values to soil properties likely contributed to these low R-squared values.
McFarland, Daniel C; Andreotti, Charissa; Harris, Kirk; Mandeli, John; Tiersten, Amy; Holland, Jimmie
2016-01-01
Introduction Certain vulnerability factors have been found to place patients at risk for depression and anxiety, especially within the context of medical illness. Early childhood adversity (ECA) primes adults to become more vulnerable to depression by enhancing their reactivity to stress; this relationship is not adequately described in patients with breast cancer. Methods Breast cancer patients (Stage 0-IV) were assessed for ECA (i.e., the Risky Families Questionnaire [RFQ]-subscales include Abuse/Neglect/Chaotic Home Environment), distress (i.e., Distress Thermometer and Problem List [DT&PL]), anxiety (Hospital Anxiety and Depression Scale-Anxiety [HADS-A]), depression (Hospital Anxiety and Depression Scale-Depression [HADS-D]), meeting standardized cut-off thresholds for distress (DT&PL ≥4 or ≥7)/anxiety (HADS-A ≥8)/depression (HADS-D ≥8), and demographic factors. Results One hundred twenty-five participants completed the study (78% response rate). ECA was associated with depression (p<.001), anxiety (p=.001), and distress (p=.006) and with meeting cut-off threshold criteria for distress (p=.024), anxiety (p=.048), and depression (p=.001). On Multivariate analysis, only depression (p=.04) and emotional issues (i.e, component of DT&PL)(p=.001) were associated with ECA. Neglect, but not Abuse and Chaotic Home Environment, was associated with depression (β=.442, p<.001), anxiety (β=.342, p=.002), and self-identified problems with family (β−.288, p=.022), emotion (β=.345, p=.004), and physical issues (β=.408, p<.001). Conclusion ECA and neglect are associated with multiple psychological symptoms but most specifically depression in the setting of breast cancer. ECA contributes to psychological burden as a vulnerability factor. ECA may help to explain individual patient trajectories and influence the provision of patient centered care for psychological symptoms in patients with breast cancer. PMID:26876888
Mizukami, Maki; Yamada, Misaki; Fukui, Sayaka; Fujimoto, Nao; Yoshida, Shigeru; Kaga, Sanae; Obata, Keiko; Jin, Shigeki; Miwa, Keiko; Masauzi, Nobuo
2016-11-01
Morphological observation of blood or marrow film is still described nonquantitatively. We developed a semiautomatic method for segmenting vacuoles from the cytoplasm using Photoshop (PS) and Image-J (IJ), called PS-IJ, and measured the relative entire cell area (rECA) and relative areas of vacuoles (rAV) in the cytoplasm of neutrophil with PS-IJ. Whole-blood samples were stored at 4°C with ethylenediaminetetraacetate and in two different preserving manners (P1 and P2). Color-tone intensity levels of neutrophil images were semiautomatically compensated using PS, and then vacuole portions were automatically segmented by IJ. The rAV and rECA were measured by counting pixels by IJ. For evaluating the accuracy in segmentations of vacuoles with PS-IJ, the rAV/rECA ratios calculated with results from PS-IJ were compared with those calculated with human eye and IJ (HE-IJ). The rECA and rAV/ in P1 significantly (P < 0.05, P < 0.05) were enlarged and increased, but did not significantly (P = 0.46, P = 0.21) change in P2. The rAV/rECA ratios by PS-IJ were significantly correlated (r = 0.90, P < 0.01) with those by HE-IJ. PS-IJ method can successfully segment vacuoles and measure the rAV and rECA, becoming a useful tool for quantitative description of morphological observation of blood and marrow film. © 2016 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Vioque, Javier
2004-12-01
Full Text Available ACE activity is related to increased arterial pressure and coronary diseases. A rapeseed protein isolate was hydrolyzed with the protease Alcalase in order to investigate the possible presence of ACE inhibitory peptides in the resulting hydrolysates. Hydrolysis for 30 min yielded a hydrolysate with the highest ACE inhibitory activity. Two fractions of this hydrolysate obtained by Biogel P2 gel filtration chromatography were used for further purification of ACE inhibitory peptides. Three fractions with ACE inhibitory activity were purified by reverse-phase HPLC of Biogel P2 f ractions. This demonstrates that rapeseed protein hydrolysates represent a good source of ACE inhibitory peptides .La actividad de ECA está relacionada con una presión arterial alta y enfermedades cardíacas. Un aislado proteico de colza se hidrolizó con alcalasa para estudiar la posible presencia de péptidos inhibidores de ECA en el hidrolizado. La hidrólisis durante 30 min produjo el hidrolizado con la mayor actividad inhibidora de ECA. Dos fracciones de este hidrolizado, obtenidas por cromatografía de filtración en gel Biogel P2, se usaron para la purificación de péptidos inhibidores de ECA. Tres fracciones con actividad inhibidora de ECA se purificaron mediante HPLC en fase reversa de las fracciones obtenidas mediante Biogel P2. Esto demuestra que los hidrolizados proteicos de colza representan una buena fuente de péptidos inhibidores de ECA.
Challenges of Iran's energy conversion agreements in future competitive market
Energy Technology Data Exchange (ETDEWEB)
Sobhiyah, M.H.; Kashtiban, Y.Kh. [Project Management Department, Tarbiat Modares University, Jalale Ale-Ahmad Avenue, Tehran (Iran)
2008-08-15
Extensive need for electricity and lack of enough governmental resources for the development of related infrastructures forced the Iranian Government to invite private investors and to sign Energy Conversion Agreement (ECA) in the form of build-operate-transfer (BOT) and build-operate-own (BOO) contracts with them. Accordingly, electricity purchase would be based on a guaranteed price. Changes in some laws in 2007 caused the management of the ECAs and electricity purchase based on guaranteed price to face challenges. Shortening the commercial operation period of the earlier ECAs and signing some new short-term ECAs were the steps taken by the authorities to resolve the problems. By shortening the ECAs' commercial operation period, it is likely to cause serious problems concerning the payments of the project companies, because of shortages in the government's financial resources. The findings of the present viewpoint suggest signing of new long-term contracts (20 years long) in the form of a combinational agreement for buying the produced electricity with a guaranteed price (in the first 5 years) and supplying it in the competitive power market (for the following years) would be a better way to reduce the problems. (author)
Challenges of Iran's energy conversion agreements in future competitive market
International Nuclear Information System (INIS)
Sobhiyah, M.H.; Kashtiban, Y.Kh.
2008-01-01
Extensive need for electricity and lack of enough governmental resources for the development of related infrastructures forced the Iranian Government to invite private investors and to sign Energy Conversion Agreement (ECA) in the form of build-operate-transfer (BOT) and build-operate-own (BOO) contracts with them. Accordingly, electricity purchase would be based on a guaranteed price. Changes in some laws in 2007 caused the management of the ECAs and electricity purchase based on guaranteed price to face challenges. Shortening the commercial operation period of the earlier ECAs and signing some new short-term ECAs were the steps taken by the authorities to resolve the problems. By shortening the ECAs' commercial operation period, it is likely to cause serious problems concerning the payments of the project companies, because of shortages in the government's financial resources. The findings of the present viewpoint suggest signing of new long-term contracts (20 years long) in the form of a combinational agreement for buying the produced electricity with a guaranteed price (in the first 5 years) and supplying it in the competitive power market (for the following years) would be a better way to reduce the problems
Investigation of the response to the enterobacterial common antigen after typhoid vaccination
Directory of Open Access Journals (Sweden)
Arlete M. Milhomem
1987-03-01
Full Text Available Antibodies against the Salmonella typhi enterobacterial common antigen (ECA and the O and H antigens were investigated in sera from healthy male subjects who had been previously vaccinated with the typhoid vaccine. No serological response to ECA was observed. Sera from subjects not previously vaccinated presented titers of ECA hemagglutinins which quantitatively were related to the presence ofH titers, but not to O agglutinins but with no statistical significance. The results are discussed in relation to the possible protective immunological mechanisms in typhoid fever.
Evaluating Corrosion in SAVY Containers using Non-Destructive Techniques
Energy Technology Data Exchange (ETDEWEB)
Davenport, Matthew Nicholas [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Vaidya, Rajendra U. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Abeyta, Adrian Anthony [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-11-16
Powerpoint presentation on Ultrasonic and Eddy Current NDT; UT Theory; Eddy current (ECA): How it works; Controlled Corrosion at NM Tech; Results – HCl Corrosion; Waveform Data for 10M HCl; Accuracy Statistics; Results – FeCl3 Pitting; Waveforms for Anhydrous FeCl3; Analyzing Corroded Stainless Steel 316L Plates; 316L Plate to Imitate Pitting; ECA Pit Depth Calibration Curve; C Scan Imaging; UT Pit Detection; SST Containers: Ultrasonic (UT) vs. CMM; UT Data Analysis; UT Conclusions and Observations; ECA Conclusions; Automated System Vision.
Doorn, van J.; Wolf, J.
2005-01-01
Het meeste onderzoek aan Erwinia-bacteriën is uitgevoerd bij aardappel. In dit gewas worden drie ziekteverwekkende Erwinia-soorten gevonden: Erwinia carotovora subsp. atroseptica (Eca), Erwinia chrysanthemi (Echr) en Erwinia carotovora subsp. carotovora (Ecc). Eca speelt in gematigde
Apparent soil electrical conductivity (ECa) is an efficient technique for understanding within-field variability of physical and chemical soil characteristics. Commercial devices are readily available for collecting ECa on whole fields and used broadly for crop management in precision agriculture; h...
CdTe Based Hard X-ray Imager Technology For Space Borne Missions
Limousin, Olivier; Delagnes, E.; Laurent, P.; Lugiez, F.; Gevin, O.; Meuris, A.
2009-01-01
CEA Saclay has recently developed an innovative technology for CdTe based Pixelated Hard X-Ray Imagers with high spectral performance and high timing resolution for efficient background rejection when the camera is coupled to an active veto shield. This development has been done in a R&D program supported by CNES (French National Space Agency) and has been optimized towards the Simbol-X mission requirements. In the latter telescope, the hard X-Ray imager is 64 cm² and is equipped with 625µm pitch pixels (16384 independent channels) operating at -40°C in the range of 4 to 80 keV. The camera we demonstrate in this paper consists of a mosaic of 64 independent cameras, divided in 8 independent sectors. Each elementary detection unit, called Caliste, is the hybridization of a 256-pixel Cadmium Telluride (CdTe) detector with full custom front-end electronics into a unique 1 cm² component, juxtaposable on its four sides. Recently, promising results have been obtained from the first micro-camera prototypes called Caliste 64 and will be presented to illustrate the capabilities of the device as well as the expected performance of an instrument based on it. The modular design of Caliste enables to consider extended developments toward IXO type mission, according to its specific scientific requirements.
Mechanical twinning and texture evolution in severely deformed Ti-6Al-4V at high temperatures
International Nuclear Information System (INIS)
Yapici, Guney Guven; Karaman, Ibrahim; Luo Zhiping
2006-01-01
We have investigated the deformation behavior and texture evolution of two-phase Ti-6Al-4V subjected to severe plastic deformation using equal channel angular extrusion (ECAE) at a high temperature (∼0.55T m ). Significant deformation twinning activity was observed after one and two ECAE passes in a 90 deg, die at 800 deg. C. Twinning activity at such a high temperature is a first-time observation in this material and is attributed to the high strain and stress levels imposed during ECAE. High stress levels and the stress state can affect the separation of twinning partials considerably. Resolved shear stress magnitudes on twin partials were found to be high during the ECAE process that helps the nucleation of mechanical twinning. The twinning mode was identified as the {101-bar 1} type using electron diffraction patterns which is one of the twinning modes observed in Ti at temperatures above 350 deg. C. Although only one twinning variant was mainly evident after one pass, multiple twin variants of the same mode were observed after the second pass with a significant increase in twin volume fraction. ECAE processing aligned the basal planes of the hexagonal close-packed α phase, initially having a random texture, with the ECAE shear plane. Texture evolution during ECAE was successfully predicted using a viscoplastic self-consistent crystal plasticity framework capturing the effect of the observed twinning mode on texture. Mechanical twins formed during ECAE and grain refinement led to a noteworthy improvement in flow stresses under tension and compression at room temperature. A strong directional anisotropy in yield strengths was also evident which cannot be explained only by crystallographic texture. It was speculated that the asymmetry of critical resolved shear stresses of deformation modes and the processing-induced deformation structure should play a role. With the supporting evidence from our previous works on the severe plastic deformation of other
Stuart, Mary; Lido, Catherine; Morgan, Jessica; Solomon, Lucy; May, Steve
2011-01-01
This research examined extracurricular activity (ECA) effects on students' experiences, outcomes and future job prospects. A survey of diverse undergraduate students, along with alumni and potential employer interviews, revealed differences in students' engagement with ECAs beyond the classroom. Variations between "traditional" and…
Corpus-based Validation of a Dialogue Model for Social Support
Van der Zwaan, J.M.; Dignum, V.; Jonker, C.M.
2012-01-01
Recent developments in affective computing show that Embodied Conversational Agents (ECAs) are increasingly capable of complex social and emotional dialogues. Our research concerns the design and evaluation of an ECA that provides social support to children that are being bullied though the
Embodied Conversational Agents in Clinical Psychology : A Scoping Review
Provoost, Simon; Lau, Ho Ming; Ruwaard, Jeroen; Riper, Heleen
2017-01-01
BACKGROUND: Embodied conversational agents (ECAs) are computer-generated characters that simulate key properties of human face-to-face conversation, such as verbal and nonverbal behavior. In Internet-based eHealth interventions, ECAs may be used for the delivery of automated human support factors.
Chief nurse executives' balance of their work and personal lives.
Borman, J S
1993-01-01
Stress among chief nurse executives (CNEs) can result from the desire to meet work-related responsibilities and maintain a satisfying personal life. The purpose of this research was to determine if the stress level that results from balancing work-related and personal-life time pressures differs among CNEs by gender. CNEs experienced moderate levels of strain; gender differences were apparent. The research findings demonstrate that the influence of gender within a female-dominated profession is consistent not with the gender norms of females, but with the gender norms seen within the larger society.
Energy Technology Data Exchange (ETDEWEB)
Kim, Chang Hun [Dept. of Neurology, Stroke Center, Myongji Hospital, Goyang (Korea, Republic of); Cho, Young Dae; Kang, Hyun Seung; Kim, Jeong Eun; Han, Moon Hee [Seoul National University Hospital, Seoul National University College of Medicine, Seoul (Korea, Republic of); Jung, Seung Chai [Dept. of Radiology, Asan Medical Center, University of Ulsan College of Medicine, Seoul (Korea, Republic of); Ahn, Jun Hyong [Dept. of Neurosurgery, Hallym University Sacred Heart Hospital, Hallym University College of Medicine, Anyang (Korea, Republic of)
2015-08-15
Two angiographic instances of anomalous external carotid artery (ECA) and internal carotid artery (ICA) anastomosis are described, each occurring at the C2-3 level and bearing remnants of proximal ICA. The ICA remnant of one patient (identifiable immediately upon bifurcation of the common carotid artery) was hypoplastic, and that of the other patient was an occluded arterial stump. These features are not typical of non-bifurcating ICA. The occipital artery originated from an anomalous connection in one instance and from the main trunk of the ECA (just past the ECA-ICA connection) in the other.
Screen for intracranial dural arteriovenous fistulae with carotid duplex sonography.
Tsai, L-K; Yeh, S-J; Chen, Y-C; Liu, H-M; Jeng, J-S
2009-11-01
Early diagnosis and management of intracranial dural arteriovenous fistulae (DAVF) may prevent the occurrence of stroke. This study aimed to identify the best carotid duplex sonography (CDS) parameters for screening DAVF. 63 DAVF patients and 170 non-DAVF patients received both CDS and conventional angiography. The use of seven CDS haemodynamic parameter sets related to the resistance index (RI) of the external carotid artery (ECA) for the diagnosis of DAVF was validated and the applicability of the best CDS parameter set in 20 400 patients was tested. The CDS parameter set (ECA RI (cut-off point = 0.7) and internal carotid artery (ICA) to ECA RI ratio (cut-off point = 0.9)) had the highest specificity (99%) for diagnosis of DAVF with moderate sensitivity (51%). Location of the DAVF was a significant determinant of sensitivity of detection, which was 70% for non-cavernous DAVF and 0% for cavernous sinus DAVF (pdetected abnormality in 92 of 20 400 patients. These abnormalities included DAVF (n = 25), carotid stenosis (n = 32), vertebral artery stenosis (n = 7), intracranial arterial stenosis (n = 6), head and neck tumour (n = 3) and unknown aetiology (n = 19). Combined CDS parameters of ECA RI and ICA to ECA RI ratio can be used as a screening tool for the diagnosis of DAVF.
McFarland, Daniel C; Andreotti, Charissa; Harris, Kirk; Mandeli, John; Tiersten, Amy; Holland, Jimmie
2016-01-01
Certain vulnerability factors have been found to place patients at risk for depression and anxiety, especially within the context of medical illness. We sought to describe the relationships among early childhood adversity (ECA) and anxiety, depression and distress in patients with breast cancer. Patients with breast cancer (stages 0-IV) were assessed for ECA (i.e., the Risky Families Questionnaire subscales include Abuse/Neglect/Chaotic Home Environment), distress (i.e., Distress Thermometer and Problem List), anxiety (Hospital Anxiety and Depression Scale-Anxiety), depression (Hospital Anxiety and Depression Scale-Depression), meeting standardized cut-off thresholds for distress (Distress Thermometer and Problem List ≥4 or ≥7)/anxiety (Hospital Anxiety and Depression Scale-Anxiety ≥8)/depression (Hospital Anxiety and Depression Scale-Depression ≥8) and demographic factors. A total of 125 participants completed the study (78% response rate). ECA was associated with depression (p psychologic symptoms, but most specifically depression in the setting of breast cancer. ECA contributes to psychologic burden as a vulnerability factor. ECA may help to explain individual patient trajectories and influence the provision of patient-centered care for psychologic symptoms in patients with breast cancer. Copyright © 2016 The Academy of Psychosomatic Medicine. Published by Elsevier Inc. All rights reserved.
DEFF Research Database (Denmark)
Krummheuer, Antonia Lina
2015-01-01
Human-agent interaction (HAI), especially in the field of embodied conversational agents (ECA), is mainly construed as dyadic communication between a human user and a virtual agent. This is despite the fact that many application scenarios for future ECAs involve the presence of others. This paper...
DEFF Research Database (Denmark)
Mishin, Oleg; Hong, Chuanshi; Toftegaard, Helmuth Langmaack
2014-01-01
The microstructure, hardness, tensile properties and ballistic performance have been investigated in thick plates of the AA5754 alloy both in a coarse-grained as-received condition and after 4 passes of equal channel angular extrusion (ECAE) conducted at elevated temperatures. It is found that ECAE...
International Nuclear Information System (INIS)
Ko, Y.G.; Lee, Y.H.; Jung, W.S.; Shin, D.H.; Lee, C.S.
2003-01-01
The effects of pressing temperature and initial microstructure on the equal channel angular (ECA) pressing of Ti-6Al-4V alloy were investigated in this study. The ECA pressing was carried out isothermally with route C at 500 C, 600 C and 700 C for two typical microstructures, i.e., the Widmanstaetten microstructure and the equiaxed microstructure. The results showed that ECA pressing at 600 C and 700 C was successful without producing any noticeable segment at the specimen surfaces, while a large amount of surface segments were produced at 500 C. After 1 pass pressing at 600 C, the equiaxed microstructure showed more uniform material flow at the surface than the Widmanstaetten microstructure. However, this microstructural influence was diminished with increase of the number of the ECA pressing. A flow-localization parameter that quantifies the flow non-uniform tendency in case of flow softening materials was used to explain the different results in each microstructure. (orig.)
International Nuclear Information System (INIS)
Khakural, B.R.; Robert, P.C.; Hugins, D.R.
1998-01-01
There is a growing interest in real-time estimation of soil moisture for site-specific crop management. Non-contacting electromagnetic inductive (EMI) methods have potentials to provide real-time estimate of soil profile water contents. Soil profile water contents were monitored with a neutron probe at selected sites. A Geonics LTD EM-38 terrain meter was used to record bulk soil electrical conductivity (EC(A)) readings across a soil-landscape in West central Minnesota with variable moisture regimes. The relationships among EC(A), selected soil and landscape properties were examined. Bulk soil electrical conductivity (0-1.0 and 0-0.5 m) was negatively correlated with relative elevation. It was positively correlated with soil profile (1.0 m) clay content and negatively correlated with soil profile coarse fragments (2 mm) and sand content. There was significant linear relationship between ECA (0-1.0 and 0-0.5) and soil profile water storage. Soil water storage estimated from ECA reflected changes in landscape and soil characteristics
International Nuclear Information System (INIS)
Flaounas, Emmanouil; Drobinski, Philippe; Borga, Marco; Calvet, Jean-Christophe; Delrieu, Guy; Morin, Efrat; Tartari, Gianni; Toffolon, Roberta
2012-01-01
This letter assesses the quality of temperature and rainfall daily retrievals of the European Climate Assessment and Dataset (ECA and D) with respect to measurements collected locally in various parts of the Euro-Mediterranean region in the framework of the Hydrological Cycle in the Mediterranean Experiment (HyMeX), endorsed by the Global Energy and Water Cycle Experiment (GEWEX) of the World Climate Research Program (WCRP). The ECA and D, among other gridded datasets, is very often used as a reference for model calibration and evaluation. This is for instance the case in the context of the WCRP Coordinated Regional Downscaling Experiment (CORDEX) and its Mediterranean declination MED-CORDEX. This letter quantifies ECA and D dataset uncertainties associated with temperature and precipitation intra-seasonal variability, seasonal distribution and extremes. Our motivation is to help the interpretation of the results when validating or calibrating downscaling models by the ECA and D dataset in the context of regional climate research in the Euro-Mediterranean region. (letter)
Mainstreaming gender equality in the sustainable development process: 1992-1996.
1997-01-01
One of the major contributions of Economic Commission for Africa (ECA) in the mainstreaming of gender equality into a sustainable development process was organizing the 5th African Regional Conference on Women in November 1994, in which a comprehensive policy document was formulated and adopted by all African governments. The policy contained in a document entitled the African Platform for Action (APA), which promotes the advancement of women through sustainable development. Its recommendations are being implemented together with the Global Platform for Action (GPA). To ensure the implementation of APA and GPA, ECA has set up various monitoring and implementation-coordinating groups such as the African Regional Coordinating Committee and the African Women's Communications and Development Network. In addition, ECA also facilitated the creation of the African Women Committee for Peace in November 1996, which will ensure the participation of women in the peace process at the highest level. All work programs of the ECA are expected to mainstream gender in their plans and activities.
Novel Techniques for Dialectal Arabic Speech Recognition
Elmahdy, Mohamed; Minker, Wolfgang
2012-01-01
Novel Techniques for Dialectal Arabic Speech describes approaches to improve automatic speech recognition for dialectal Arabic. Since speech resources for dialectal Arabic speech recognition are very sparse, the authors describe how existing Modern Standard Arabic (MSA) speech data can be applied to dialectal Arabic speech recognition, while assuming that MSA is always a second language for all Arabic speakers. In this book, Egyptian Colloquial Arabic (ECA) has been chosen as a typical Arabic dialect. ECA is the first ranked Arabic dialect in terms of number of speakers, and a high quality ECA speech corpus with accurate phonetic transcription has been collected. MSA acoustic models were trained using news broadcast speech. In order to cross-lingually use MSA in dialectal Arabic speech recognition, the authors have normalized the phoneme sets for MSA and ECA. After this normalization, they have applied state-of-the-art acoustic model adaptation techniques like Maximum Likelihood Linear Regression (MLLR) and M...
Directory of Open Access Journals (Sweden)
Pirkko Harju
1993-07-01
Full Text Available Symptomless contamination with the rot-inducing bacterium Erwinia carotovora was detectable by the tuber incubation method in 82% of the commercial seed potato stocks surveyed. E. carotovora subsp. atroseptica (Eca was more common than E. carotovora subsp. carotovora (Ecc among the tuber contaminants. In a four-year survey of ten meristem-based seed stocks, recontamination with both Eca and Ecc occurred typically during the second field generation, but three stocks remained free of detectable contamination throughout the survey period. The first blackleg symptoms occurred typically during the third field generation. The serogroup distribution of Finnish Eca isolates was different from that reported from other countries. The predominant serogroup, I, constituted only 74% of all Eca isolates, since serogroups XXXV and XLI occurred relatively frequently. Serogroup I was more common among isolates from diseased stems than among those from latently contaminated tubers. The results also suggest that serogroup I is more dominant in the southern than in the northern parts of the country.
International Nuclear Information System (INIS)
Kannan, K.; Muthuraman, G.; Cho, G.; Moon, I. S.
2014-01-01
This investigation aimed to introduce printing technology for the first time to prepare a nanostrucutured PbO 2 electrode and its application to a cerium redox transfer process. The new method of nano-size PbO 2 preparation demonstrated that nano-PbO 2 could be obtained in less time and at less cost at room temperature. The prepared nano-PbO 2 screen printed on a Ti electrode by three different compositions under similar conditions showed through surface and electrochemical analyses no adherence on Ti and no contact with other nano-PbO 2 particles. Gravure printing of nano-PbO 2 on a PET (poly ethylene thin) film at high pressure was done with two different compositions for the first time. The selective composition of 57.14 % nano-PbO 2 powder with 4.28 % carbon black and 38.58 % ECA (ethyl carbitol acetate) produced a film with a nanoporous structure with an electron transfer ability. Finally, the optimized gravure-printed nano-PbO 2 electrode was applied to the oxidation of Ce(III) to Ce(IV) by using cyclic voltammetry. The gravure-printed nano-PbO 2 should pave the way to promising applications in electrochemical and sensor fields.
40 CFR 80.502 - What definitions apply for purposes of this subpart?
2010-07-01
... (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel General Information § 80.502 What... loading terminal means any facility that dyes NRLM diesel fuel or ECA marine fuel, pays taxes on motor...
Kralina, Linda M.
2009-01-01
Extracurricular activities (ECA) are informal settings offering free-choice experiences that are generally voluntary, open-ended, non-sequential, self-directed, hands-on, and evaluation-free. This mixed methods study investigates participation in a high school science ECA by collecting the memories of former student members for their perceptions…
A BML Based Embodied Conversational Agent for a Personality Detection Program
Solano Méndez, Guillermo; Reidsma, Dennis; Vilhjálmsson, Hannes Högni; Kopp, Stefan; Marsella, Stacy; Thórisson, Kristinn R.
2011-01-01
This paper presents a project in which an Embodied Conversational Agent (ECA) attemtps to detect the personality of the user by asking him (or her) a series of questions. The project uses the Elckerlyc platform, a Behavior Markup Language (BML) compliant behavior realizer for ECAs [1]. BML allows
Chuah, Joon Hao
2013-01-01
Embodied conversational agents (ECAs) have been used as virtual conversational partners in interpersonal skills training applications such as medical interviews, military decision making, and cultural training. Ideally, in interpersonal skills training users will perceive and treat the ECAs the same as they would real people. The perception and…
Acute hemifacial ischemia as a late complication of carotid stenting
Directory of Open Access Journals (Sweden)
Maurizio Domanin, MD
2017-06-01
Full Text Available Concerns about carotid artery stenting (CAS center primarily on procedural complications like acute occlusion, stroke, and long-term intrastent restenosis. External carotid artery (ECA thrombosis is observed during CAS follow-up, but it often remains asymptomatic or, at worst, results in jaw claudication. We report here a case of late occlusion of the ECA after CAS with symptoms of acute homolateral facial ischemia as well as pain, cyanosis, tongue numbness, and skin coldness. The patient was submitted to local thrombolysis and balloon angioplasty with regression of symptoms after recanalization. With this report, we add a caveat about blockage of the ECA ostium during CAS.
Directory of Open Access Journals (Sweden)
Patricia Angélica A Marques
2009-03-01
Full Text Available The purpose of this experiment was to analyze the effect of five irrigation water depths on oregano production. Oregano is a plant rich in essential oil, commonly used as seasoning in food preparation. The water depths were estimated based on the class A pan evaporation (CPE: 0 CPE (without water replacement; 25 CPE, 50 CPE, 75 CPE, and 100% CPE. The analyzed variables were fresh and dry weight of leaves and roots, yield, net return, and water use efficiency. The experiment was carried out in Presidente Prudente, São Paulo State, Brazil, from February to May 2006. The best results for all the studied variables were found when 100% CPE was used. A linear positive relation was observed between water increments and fresh and dry weight of both the aboveground part and roots. The use of a water depth corresponding to 100% CPE resulted in the maximum productivity (8,089.7 kg ha-1, and in the highest net annual return (R$ 57,637.87 ha-1.Foi analisado o efeito de cinco lâminas de irrigação na produção do orégano, planta rica em óleo essencial, muito usada como tempero na preparação de alimentos. As lâminas de água foram baseadas na evaporação do tanque classe A (ECA sendo: 0 ECA (sem reposição de água; 25 ECA; 50 ECA; 75 ECA e 100% ECA. As variáveis analisadas foram matéria fresca e seca de folhas e raízes, produtividade, receita líquida e eficiência do uso da água. O experimento foi instalado em Presidente Prudente (SP, de fevereiro a maio de 2006. Os melhores resultados para todas as variáveis estudadas foram encontrados com a reposição de 100% ECA. Observou-se uma relação linear positiva entre o incremento das lâminas de irrigação e as massas fresca e seca tanto da parte aérea, quanto das raízes. A aplicação da lâmina de irrigação equivalente a 100% ECA resultou na máxima produtividade observada (8.089,7 kg ha-1 e na receita líquida anual mais alta (R$ 57.637,87 ha-1.
Petti, Stefano; Messano, Giuseppe Alessio; Vingolo, Enzo Maria; Marsella, Luigi Tonino; Scully, Crispian
2015-12-11
The West-African (WA) Zaire Ebolavirus disease (EVD) outbreak was characterized by an exceptionally high number of cases and deaths as compared with the Eastern-Central African (ECA) outbreaks. Despite the Zaire Ebolavirus being the most lethal for humans, case-fatality rate, close to 80 % in ECA outbreaks, almost halved to 47 % in Guinea-Liberia-Sierra Leone (WA). Such an improvement was due to the remarkable implementation of international humanitarian aids. Some studies also suggested that the long human-to-human transmission cycle occurred in WA, gave rise to human adaptation and consequent immune escape. Haemorrhage, the main feature in seriously infected EVD patients, is due to the immune system that triggers the infected endothelial cells which expose the spike-like glycoprotein (GP) of the virion on their surface. If the human adaptation hypothesis holds true, the proportion of EVD patients with haemorrhage in the WA outbreak should be lower than in the ECA outbreaks due to immune escape. Therefore, the aim of this meta-analysis was to compare the relative frequencies of three typical haemorrhagic symptoms (conjunctival -CB, nasal -NB, gingival -GB- bleedings) in the ECA and WA outbreaks. Literature searches were performed through PubMed and Scopus using generic keywords; surveys including at least ten patients reporting CB, NB, GB relative frequencies were extracted and split into ECA and WA. The meta-analytical methods chosen were based on the levels of between-study heterogeneity and publication bias. Pooled CB, NB, GB relative frequencies in ECA and WA were estimated and compared. Subgroup analysis including only studies on Zaire Ebolavirus also was performed. Fifteen studies (10 ECA, 5 WA) were located with 4,867 (CB), 3,859 (NB), 4,278 (GB) EVD patients overall. GB pooled relative frequency was 45.3 % (95 % confidence interval -95 CI, 34.7-56.1 %) and 18.0 % (95 CI, 6.0-34.5 %), in ECA and WA; NB was 10.6 % (95 CI, 5.7-16.8 %) and 1.3 % (1
2010-07-01
... retention requirements for motor vehicle diesel fuel, NRLM diesel fuel, and ECA marine fuel? 80.581 Section...) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel... requirements for motor vehicle diesel fuel, NRLM diesel fuel, and ECA marine fuel? (a) Beginning on June 1...
McClure, Marissa; Tarr, Patricia; Thompson, Christine Marmé; Eckhoff, Angela
2017-01-01
This article reflects the collective voices of four early childhood visual arts educators, each of whom is a member of the Early Childhood Art Educators (ECAE) Issues Group of the National Arts Educators Association. The authors frame the article around the ECAE position statement, "Art: Essential for Early Learning" (2016), which…
2010-07-01
... distillates? 80.590 Section 80.590 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... oil, ECA marine fuel, and other distillates? (a) This paragraph (a) applies on each occasion that any... distillates used or intended to be used as MVNRLM diesel fuel, heating oil, or ECA marine fuel) except when...
Extracurricular Activities and Their Effect on the Student's Grade Point Average: Statistical Study
Bakoban, R. A.; Aljarallah, S. A.
2015-01-01
Extracurricular activities (ECA) are part of students' everyday life; they play important roles in students' lives. Few studies have addressed the question of how student engagements to ECA affect student's grade point average (GPA). This research was conducted to know whether the students' grade point average in King Abdulaziz University,…
Kang, Ji Eun; Han, Jae Woo; Jeon, Byeong Jun; Kim, Beom Seok
2016-03-01
To discover potential inhibitors of the quorum sensing (QS) system, a library of microbial culture extracts was screened with Chromobacterium violaceumCV026 strain. The culture extract of Streptomyces xanthocidicus KPP01532 contained quorum-sensing inhibitors (QSIs) of the CV026 strain. The active constituents of the culture extract of strain KPP01532 were purified using a series of chromatographic procedures, and based on data from NMR and mass spectroscopy, piericidin A and glucopiericidin A were identified. Erwinia carotovora subsp. atroseptica (Eca) is a plant pathogen that causes blackleg and soft rot diseases on potato stems and tubers. The virulence factors of Eca are regulated by QS. The expression of virulence genes (pelC, pehA, celV and nip) under the control of QS was monitored using quantitative real-time PCR (qRT-PCR). The transcription levels of the four genes were significantly lower when Eca was exposed to piericidin A or glucopiericidin A. These two compounds displayed similar control efficacies against soft rot caused by Eca in potato slices as furanone C-30. Therefore, piericidin A and glucopiericidin A are potential QSIs that suppress the expression of the virulence genes of Eca, suggesting that they could have potential use as control agents of soft rot disease on potato tubers. Copyright © 2015 Elsevier GmbH. All rights reserved.
Modelling effective soil depth at field scale from soil sensors and geomorphometric indices
Directory of Open Access Journals (Sweden)
Mauricio Castro Franco
2017-04-01
Full Text Available The effective soil depth (ESD affects both dynamic of hydrology and plant growth. In the southeast of Buenos Aires province, the presence of petrocalcic horizon constitutes a limitation to ESD. The aim of this study was to develop a statistic model to predict spatial patterns of ESD using apparent electrical conductivity at two depths: 0-30 (ECa_30 and 0-90 (ECa_90 and geomorphometric indices. To do this, a Random Forest (RF analysis was applied. RF was able to select those variables according to their predictive potential for ESD. In that order, ECa_90, catchment slope, elevation and ECa_30 had main prediction importance. For validating purposes, 3035 ESD measurements were carried out, in five fields. ECa and ESD values showed complex spatial pattern at short distances. RF parameters with lowest error (OOBerror were calibrated. RF model simplified which uses main predictors had a similar predictive development to it uses all predictors. Furthermore, RF model simplified had the ability to delineate similar pattern to those obtained from in situ measure of ESD in all fields. In general, RF was an effective method and easy to work. However, further studies are needed which add other types of variables importance calculation, greater number of fields and test other predictors in order to improve these results.
Energy Technology Data Exchange (ETDEWEB)
Kannan, K.; Muthuraman, G.; Cho, G.; Moon, I. S. [Sunchon National University, Suncheon (Korea, Republic of)
2014-08-15
This investigation aimed to introduce printing technology for the first time to prepare a nanostrucutured PbO{sub 2} electrode and its application to a cerium redox transfer process. The new method of nano-size PbO{sub 2} preparation demonstrated that nano-PbO{sub 2} could be obtained in less time and at less cost at room temperature. The prepared nano-PbO{sub 2} screen printed on a Ti electrode by three different compositions under similar conditions showed through surface and electrochemical analyses no adherence on Ti and no contact with other nano-PbO{sub 2} particles. Gravure printing of nano-PbO{sub 2} on a PET (poly ethylene thin) film at high pressure was done with two different compositions for the first time. The selective composition of 57.14 % nano-PbO{sub 2} powder with 4.28 % carbon black and 38.58 % ECA (ethyl carbitol acetate) produced a film with a nanoporous structure with an electron transfer ability. Finally, the optimized gravure-printed nano-PbO{sub 2} electrode was applied to the oxidation of Ce(III) to Ce(IV) by using cyclic voltammetry. The gravure-printed nano-PbO{sub 2} should pave the way to promising applications in electrochemical and sensor fields.
Ssempebwa, Jude; Teferra, Damtew; Bakkabulindi, Fred Edward K.
2016-01-01
Conducted as part of a multi-country study of the teaching-related experiences and expectations of early career academics (ECAs) in Africa, this study investigated the major influences on the teaching practice of ECAs at Makerere University; the mechanisms by which these academics learn to teach; the teaching-related challenges they experience;…
Dickin, Katherine L; Dollahite, Jamie S; Habicht, Jean-Pierre
2011-01-01
Mixed-methods research investigated the work motivation of paraprofessional community nutrition educators (CNEs) delivering a long-running public health nutrition program. In interviews, CNEs (n = 9) emphasized "freedom," supportive supervision, and "making a difference" as key sources of motivation. Community nutrition educator surveys (n = 115) confirmed high levels of autonomy, which was associated with supervisors' delegation and support, CNE decision-making on scheduling and curricula, and job satisfaction. Supervisors (n = 32) rated CNEs' job design as having inherently motivating characteristics comparable to professional jobs. Supervisory strategies can complement job design to create structured, supportive contexts that maintain fidelity, while granting autonomy to paraprofessionals to enhance intrinsic work motivation.
CCS-MIP: Low cost Customizable Control Centre
Labezin, Christian; Vielcanet, Pierre
1994-01-01
The positioning and station keeping of French national satellites are among the main missions of CNES French Space Agency CNES. The related experience and skills of the Toulouse Space Centre are reknown and often required at international level for a wide range of missions. CISI, a software engineering company, has been contributing during the last 20 years to the development of the French space programs, particularly in the field of space missions ground control segments. The CCS-MIP system, presented here, is a satellite positioning and station-keeping system designed to answer the CNES multi-mission needs, easily adaptable for a wide range of applications.
Directory of Open Access Journals (Sweden)
John Jairo Páez Rodríguez
2011-09-01
Full Text Available El proyecto de investigación en el campo de las ayudas aumentativas para discapacitados, tiene como objetivo principal desarrollar una prótesis del sistema biomecánico mano-muñeca para investigar la influencia que tiene en el desarrollo de ciertas habilidades y configuraciones cerebrales durante el proceso de aprendizaje; dado que la mano: permite crear un sistema de autorrepresentación, es un punto de convergencia en el sistema de retroalimentación visual, táctil y propioceptiva (percepción de la propia posición, materializa las intenciones del pensamiento, al tener conexión con el sistema ventral tiene acceso a las áreas lingü.sticas de los lóbulos temporales donde se desarrollan los procesos semánticos (debido a la relación de manipulación -identificación- transformación de objetos, ofrece al cerebro nuevos modos de aproximarse a viejas tareas y posibilidad de emprender otras nuevas y, porque el cerebro a través de la mano modela su proceso, formación del mundo y su espacio extrapersonal.
Wear Behavior and Microstructure of Mg-Sn Alloy Processed by Equal Channel Angular Extrusion.
Chen, Jung-Hsuan; Shen, Yen-Chen; Chao, Chuen-Guang; Liu, Tzeng-Feng
2017-11-16
Mg-5wt.% Sn alloy is often used in portable electronic devices and automobiles. In this study, mechanical properties of Mg-5wt.% Sn alloy processed by Equal Channel Angular Extrusion (ECAE) were characterized. More precisely, its hardness and wear behavior were measured using Vickers hardness test and a pin-on-disc wear test. The microstructures of ECAE-processed Mg-Sn alloys were investigated by scanning electron microscope and X-ray diffraction. ECAE process refined the grain sizes of the Mg-Sn alloy from 117.6 μm (as-cast) to 88.0 μm (one pass), 49.5 μm (two passes) and 24.4 μm (four passes), respectively. Meanwhile, the hardness of the alloy improved significantly. The maximum wear resistance achieved in the present work was around 73.77 m/mm³, which was obtained from the Mg-Sn alloy treated with a one-pass ECAE process with a grain size of 88.0 μm. The wear resistance improvement was caused by the grain size refinement and the precipitate of the second phase, Mg₂Sn against the oxidation of the processed alloy. The as-cast Mg-Sn alloy with the larger grain size, i.e., 117.6 μm, underwent wear mechanisms, mainly adhesive wear and abrasive wear. In ECAE-processed Mg-Sn alloy, high internal energy occurred due to the high dislocation density and the stress field produced by the plastic deformation, which led to an increased oxidation rate of the processed alloy during sliding. Therefore, the oxidative wear and a three-body abrasive wear in which the oxide debris acted as the three-body abrasive components became the dominant factors in the wear behavior, and as a result, reduced the wear resistance in the multi-pass ECAE-processed alloy.
Outsourcing Extra-Curricular Activities: A Management Strategy in a Time of Neoliberal Influence
Ng, Shun Wing; Chan, Tsan Ming Kenneth; Yuen, Wai Kwan Gail
2017-01-01
Purpose: The purpose of this paper is to report on an exploratory study designed to illuminate the complexity of outsourcing extra-curricular activities (ECAs) in primary schools in a time of neoliberal influence and to examine the views of teaching professionals on the reasons, issues and considerations of outsourcing ECAs such as the dynamic…
Maliska, Charles Miles; Blebea, John; Taubman, Kevin E
2017-01-01
A 56-year-old woman presented with episodic vertigo, dizziness, and diplopia during meals and prolonged verbal presentations at work. Subsequent work-up included an eventual catheter-based angiogram revealing an ostial left external carotid artery (ECA) occlusion with reconstituted retrograde flow via a variant collateral branch from the dominant left vertebral artery. The findings demonstrate that repetitive activities involving craniofacial muscular systems supplied by the ECA result in a symptomatic arterial steal syndrome via the enhanced diverted flow from the collateral vertebral-basilar arterial system. A left ECA endarterectomy with reimplantation of the vessel was performed, and the patient has been episode free thereafter. Copyright © 2016 Elsevier Inc. All rights reserved.
Very High Specific Energy, Medium Power Li/CFx Primary Battery for Launchers and Space Probes
Brochard, Paul; Godillot, Gerome; Peres, Jean Paul; Corbin, Julien; Espinosa, Amaya
2014-08-01
Benchmark with existing technologies shows the advantages of the lithium-fluorinated carbon (Li/CFx) technology for use aboard future launchers in terms of a low Total Cost of Ownership (TCO), especially for high energy demanding missions such as re-ignitable upper stages for long GTO+ missions and probes for deep space exploration.This paper presents the new results obtained on this chemistry in terms of electrical and climatic performances, abuse tests and life tests. Studies - co-financed between CNES and Saft - looked at a pure CFx version with a specific energy up to 500 Wh/kg along with a medium power of 80 to 100 W/kg.
Programmable wide field spectrograph for earth observation
Zamkotsian, Frédéric; Lanzoni, Patrick; Liotard, Arnaud; Viard, Thierry; Costes, Vincent; Hébert, Philippe-Jean
2017-11-01
In Earth Observation, Universe Observation and Planet Exploration, scientific return of the instruments must be optimized in future missions. Micro-Opto-Electro-Mechanical Systems (MOEMS) could be key components in future generation of space instruments. These devices are based on the mature micro-electronics technology and in addition to their compactness, scalability, and specific task customization, they could generate new functions not available with current technologies. French and European space agencies, the Centre National d'Etudes Spatiales (CNES) and the European Space Agency (ESA) have initiated several studies with LAM and TAS for listing the new functions associated with several types of MEMS, and developing new ideas of instruments.
Hidden Challenges to Education Systems in Transition Economies.
Berryman, Sue E.
This book, published by the World Bank, sounds the alarm for education in Europe and Central Asia (ECA). It describes how the transition from communism to free-market economies has left many countries' educational systems in disarray. At the start of transition, ECA education systems had solved problems that plagued other regions of the world,…
Financing of nuclear projects. Lessons from a recent experience
International Nuclear Information System (INIS)
Shubert, U.
2004-01-01
The advantages of mandating BNP Paribas as a lead bank and arranger for NPP Belene are presented. BNPP has an excellent record and credentials in Nuclear Power Plant Projects internationally and in the local energy sector and very recent experience as a lead bank for the fifth nuclear power plant in Finland. BNPP has a proven track record as Provider of rapid and efficient ECA financing in terms of: managing in parallel the number of ECA contractual relations, so as to provide 'matching opportunities' between the ECAs and leverage to improve their terms and conditions, and to harmonize them in one set of unified legal documentation. There is no cost to the Government of Bulgaria until the signing of the Facility Documentation
DEFF Research Database (Denmark)
Ogoh, Shigehiko; Sørensen, Henrik; Hirasawa, Ai
2016-01-01
men. Both ICA (mean ± SD; by 17 ± 8%, P = 0.005) and ECA (by 37 ± 15%, P 5 s) than for the ECA blood flow (17 ± 5 s; P = 0.019). The ICA blood flow recovery...... from hypoperfusion was delayed with prazosin (17 ± 4 s versus control 9 ± 5 s, P = 0.006), whereas ECA recovery remained unchanged (P = 0.313) despite a similar reduction in mean arterial pressure (−20 ± 4 mmHg versus control −23 ± 7 mmHg, P = 0.148). These findings suggest that α1-receptor blockade...
Dennis, V A; Klei, T R; Chapman, M R
1993-07-01
Supernatants generated by stimulation of peripheral blood mononuclear cells (PBMC) from Strongylus vulgaris sensitized or immunized ponies were assayed in vitro for eosinophil chemotactic activity (ECA) using the filter system in blind well chambers. The supernatants from these cultures were chemotactic for eosinophils, but not for neutrophils. Supernates from cultures of unsensitized PBMC stimulated with S. vulgaris antigen were not chemotactic for eosinophils. ECA was first detected in culture supernatants after 1.5 h of incubation and was dependent on both antigen and PBMC concentrations, but independent of serum concentrations. Both female and male S. vulgaris worm antigens stimulated ECA production from sensitized PBMC. ECA was not induced by in vitro stimulation of sensitized S. vulgaris PBMC by female Strongylus edentatus worm antigen. Partial characterization of the eosinophil chemotactic cytokine showed it to be nondialyzable, greater than 8000 molecular weight (MW), and sensitive to heating (56 and 95 degrees C), trypsin, and sodium metaperiodate treatments, suggesting that the cytokine is a protein containing some essential carbohydrate moieties. The cytokine described in this paper could partially contribute to the in vivo blood and tissue eosinophilia in experimental S. vulgaris infection.
Kulbrock, Maike; Lehner, Stefanie; Metzger, Julia; Ohnesorge, Bernhard; Distl, Ottmar
2013-01-01
Equine recurrent uveitis (ERU) is a common eye disease affecting up to 3–15% of the horse population. A genome-wide association study (GWAS) using the Illumina equine SNP50 bead chip was performed to identify loci conferring risk to ERU. The sample included a total of 144 German warmblood horses. A GWAS showed a significant single nucleotide polymorphism (SNP) on horse chromosome (ECA) 20 at 49.3 Mb, with IL-17A and IL-17F being the closest genes. This locus explained a fraction of 23% of the phenotypic variance for ERU. A GWAS taking into account the severity of ERU, revealed a SNP on ECA18 nearby to the crystalline gene cluster CRYGA-CRYGF. For both genomic regions on ECA18 and 20, significantly associated haplotypes containing the genome-wide significant SNPs could be demonstrated. In conclusion, our results are indicative for a genetic component regulating the possible critical role of IL-17A and IL-17F in the pathogenesis of ERU. The associated SNP on ECA18 may be indicative for cataract formation in the course of ERU. PMID:23977091
Variations in superior thyroid artery: A selective angiographic study
International Nuclear Information System (INIS)
Gupta, Pankaj; Bhalla, Ashu Seith; Thulkar, Sanjay; Kumar, Atin; Mohanti, Bidhu Kalyan; Thakar, Alok; Sharma, Atul
2014-01-01
To investigate variations in superior thyroid artery (STA) based on digital subtraction angiography (DSA). Twenty five angiography studies of 15 pts performed between June 2010 and December 2012 were retrospectively evaluated. These patients underwent DSA of the head and neck region as a part of their superselective neoadjuvant intra-arterial chemotherapy protocol for treatment of laryngeal and hypopharyngeal cancers. Depending upon the location of the tumor, unilateral or bilateral arteriograms of common carotid artery (CCA), external carotid artery (ECA), and STA were performed. Arteriograms were evaluated for the site of origin and branching pattern of STA. STA anatomy was ascribed to one of the three branching patterns. A total of 25 angiograms were evaluated, including 14 right and 11 left. On the right side, STA was noted to arise from ECA in 10 (71.5%), bifurcation of CCA in 3 (21.5%), and CCA in 1 (7%) patient. Left STA was seen to arise from ECA in 8 (72.5%), bifurcation of CCA in 2 (18.5%), and internal carotid artery (ICA) in 1 (9%) patient. Type III branching pattern (non-bifurcation, non-trifurcation) was found to be the most frequent (52%). Infrahyoid branch was found to be the most consistent in terms of its origin from STA. Origin of STA is predictable, arising from ECA in more than 70% cases. Branching pattern of STA, following origin from ECA, is, however, highly variable. Knowledge concerning the origin and branching pattern of STA is essential in enhancing precision and decreasing morbidity related to the surgical and interventional radiological head and neck procedures
International Nuclear Information System (INIS)
Ali, H.F.; Bibi, A.; Ahmad, M.; Junaid, M.; Ali, A.; Alam, S.
2014-01-01
Based upon colony morphology, physio-biochemical tests and polymerase chain reaction (using species or subspecies-specific primers) studies, 20 isolates (out of a total of 42) were found to be Erwinia carotovora subspecies atroseptica (Eca), 19 were identified as Erwinia carotovora subspecies carotovora (Ecc), and 3 as Erwinia chrysanthemi (Ech). Results of the subspecies-differentiating biochemical tests indicated that majority of the candidate Ecc isolates did not produce acid from methyle glucoside (as expected) but their reaction to the production of reducing substances from sucrose was variable. Likewise, some of our Eca and Ecc strains (unexpectedly) were sensitive to erythromycin. Also, most of our Eca strains unexpectedly grew at 36 degree C. Our strains slightly deviate from the standard description in some of their minor characteristics but they still remain the valid members of the Eca, Ecc or Ech group as similar variations in minor characteristics have been found by other workers. The occurrence of intermediate forms of Eca and Ecc (sharing some of the characteristics of both the groups) indicates variability happening among these strains. This variability indicates the potential ability of the pathogen to break the resistance of the host. The results of the effect of balanced nutrition in controlling blackleg and soft rot of potatoes indicated that the fertilizer combination of N3P1K3 (262/252/262 kg.ha-1) which is slightly higher than the normally practiced dose (247/247/247 kg.ha-1) was the best in bringing the disease to a minimum and subsequently increasing the yield. (author)
Directory of Open Access Journals (Sweden)
Charlene Joy E. Chua
2017-05-01
Full Text Available Filipinos have been regarding education as the leading avenue of success. Having the system patterned from the American Education structure, education in the country provides basic learning needs and a foundation on which successive learning can be based on. Aside from traditional learning inside the classroom, extracurricular activities (ECAs are also provided for students, which basically have the same goal as that of courses in a curriculum. These activities however, let the students have experiences not included in formal education. Moreover, ECAs are being promoted in some college institutions considering that it benefits students in ways that would prepare them for their future. Certain companies focus on investing on leadership development of their employees to make them globally competitive. This paper focused on determining the degree or extent of influence of ECAs to the employability of the University of Santo Tomas (UST Industrial Engineering graduates of Batches 2013, 2014, and 2015. A survey was administered to 43 sampled graduates. Logistic regression was used in determining the influence of participation in ECAs to the employability of the graduates. Correlational analysis showed that there exists a significant relationship between and among independent variables of number of jobs, number of initial interview, level of participation and soft skills developed through ECAs. Meanwhile, Paired Sample Means Test exhibited that at 95% level of significance, there exists no relationship between the soft skills possessed by the graduates and as expected by the company with which they are employed. Recommendations were provided to enhance the activities offered in UST towards increasing employability rate of graduate students.
Microstructures in the 6060 aluminium alloy after various severe plastic deformation treatments
International Nuclear Information System (INIS)
Adamczyk-Cieslak, Boguslawa; Mizera, Jaroslaw; Kurzydlowski, Krzysztof Jan
2011-01-01
This paper presents the results concerning the microstructural refinement of the industrial 6060 aluminium alloy processed by severe plastic deformation (SPD). The high level of plastic deformation was achieved using the three methods: hydrostatic extrusion (HE), equal channel angular extrusion (ECAE) and extrusion torsion (ET), which differed in the dynamics of the loading, intensity and homogeneity of the plastic strain field. Microstructure analyses were performed before and after SPD deformation using a transmission (TEM) and a scanning electron microscope (SEM). The refined microstructures were examined qualitatively and quantitatively by the stereological methods and computer image analyses. The microstructure of the industrial 6060 aluminium alloy after deformation was characterized by an average grain size of about 0.4 μm. The results show that the precipitates strongly affect the degree of refinement and the mechanism of microstructural transformations. During the SPD, the second phase particles break apart and homogenize. The HE method generates the largest increase of the volume fraction of the small primary particles. Moreover, the HE process is most effective in reducing the primary particle size. During HE and ECAE processes the second phase precipitates dissolve partially and change their shape. - Research Highlights: → SPD results in a significant increase in the density of the small primary particles. → SPD homogenizes the particle size distribution. → HE and ECAE processes bring nano-grains in the vicinity of the primary particles. → HE and ECAE processing results in the β' precipitates partial dissolutions. → During HE and ECAE processes the β' particles change their shape.
Kultuuride paljusus kultuuri tugevuse ja elujõu allikas / Jaan Elken
Elken, Jaan, 1954-
1998-01-01
ECA (European Council of Artists) aastakongress ja sellega kaasnev konvetents "Kunstnike ja intellektuaalide roll uuenevas Euroopas" 19.-22. novembrini Semmeringis Austrias. ECA (Eesti Kunstnike Liit liige 1995. aastast) eesmärgist, olulisusest Eesti kunstnikkonnale. Konverentsist teemade järgi: enesetsensuur ja väline kontroll, multikultuusus, meedia. J. Elken tõdeb, et Eesti realiteedid ja probleemid kattuvad suuresti Skandinaavia ja Kesk-Euroopa, mitte Ida-Euroopa omadega.
Directory of Open Access Journals (Sweden)
Keagile Bati
2017-03-01
Full Text Available Objectives: This study aimed to evaluate the hypoglycemic effects of an ethanol extract of Cassia abbreviata (ECA bark and the possible mechanisms of its action in diabetic albino rats. Methods: ECA was prepared by soaking the powdered plant material in 70% ethanol. It was filtered and made solvent-free by evaporation on a rotary evaporator. Type 2 diabetes was induced in albino rats by injecting 35 mg/kg body weight (bw of streptozotocin after having fed the rats a high-fat diet for 2 weeks. Diabetic rats were divided into ECA-150, ECA-300 and Metformin (MET-180 groups, where the numbers are the doses in mg.kg.bw administered to the groups. Normal (NC and diabetic (DC controls were given distilled water. The animals had their fasting blood glucose levels and body weights determined every 7 days for 21 days. Oral glucose tolerance tests (OGTTs were carried out in all animals at the beginning and the end of the experiment. Liver and kidney samples were harvested for glucose 6 phosphatase (G6Pase and hexokinase activity analyses. Small intestines and diaphragms from normal rats were used for α-glucosidase and glucose uptake studies against the extract. Results: Two doses, 150 and 300 mg/kg bw, significantly reduced the fasting blood glucose levels in diabetic rats and helped them maintain normal body weights. The glucose level in DC rats significantly increased while their body weights decreased. The 150 mg/kg bw dose significantly increased hexokinase and decreased G6Pase activities in the liver and the kidneys. ECA inhibited α-glucosidase activity and promoted glucose uptake in the rats’ hemi-diaphragms. Conclusion: This study revealed that ECA normalized blood glucose levels and body weights in type 2 diabetic rats. The normalization of the glucose levels may possibly be due to inhibition of α-glucosidase, decreased G6Pase activity, increased hexokinase activity and improved glucose uptake by muscle tissues.
Ding, R.; Cruz, L.; Whitney, J.; Telenko, D.; Oware, E. K.
2017-12-01
There is the growing need for the development of efficient irrigation management practices due to increasing irrigation water scarcity as a result of growing population and changing climate. Soil texture primarily controls the water-holding capacity of soils, which determines the amount of irrigation water that will be available to the plant. However, while there are significant variabilities in the textural properties of the soil across a field, conventional irrigation practices ignore the underlying variability in the soil properties, resulting in over- or under-irrigation. Over-irrigation leaches plant nutrients beyond the root-zone leading to fertilizer, energy, and water wastages with dire environmental consequences. Under-irrigation, in contrast, causes water stress of the plant, thereby reducing plant quality and yield. The goal of this project is to leverage soil textural map of a field to create water management zones (MZs) to guide site-specific precision irrigation. There is increasing application of electromagnetic induction methods to rapidly and inexpensively map spatially continuous soil properties in terms of the apparent electrical conductivity (ECa) of the soil. ECa is a measure of the bulk soil properties, including soil texture, moisture, salinity, and cation exchange capacity, making an ECa map a pseudo-soil map. Data for the project were collected from a farm site at Eden, NY. The objective is to leverage high-resolution ECa map to predict spatially dense soil textural properties from limited measurements of soil texture. Thus, after performing ECa mapping, we conducted particle-size analysis of soil samples to determine the textural properties of soils at selected locations across the field. We cokriged the high-resolution ECa measurements with the sparse soil textural data to estimate a soil texture map for the field. We conducted irrigation experiments at selected locations to calibrate representative water-holding capacities of each
PLEIADES-HR IMAGE QUALITY COMMISSIONING
Directory of Open Access Journals (Sweden)
L. Lebègue
2012-07-01
Full Text Available PLEIADES is the highest resolution civilian earth observing system ever developed in Europe. This imagery program is conducted by the French National Space Agency, CNES. It operates since 2012 a first satellite PLEIADES-HR launched on 2011 December 17th, a second one should be launched by the end of the year. Each satellite is designed to provide optical 70 cm resolution coloured images to civilian and defence users. The Image Quality requirements were defined from users studies from the different spatial imaging applications, taking into account the trade-off between on-board technological complexity and ground processing capacity. The assessment of the image quality and the calibration operation have been performed by CNES Image Quality team during the 6 month commissioning phase that followed the satellite launch. These activities cover many topics gathered in two families : radiometric and geometric image quality. The new capabilities offered by PLEIADES-HR agility allowed to imagine new methods of image calibration and performance assessment. Starting from an overview of the satellite characteristics, this paper presents all the calibration operations that were conducted during the commissioning phase and also gives the main results for every image quality performance.
Ancient Pbx-Hox signatures define hundreds of vertebrate developmental enhancers
Directory of Open Access Journals (Sweden)
Parker Hugo J
2011-12-01
Full Text Available Abstract Background Gene regulation through cis-regulatory elements plays a crucial role in development and disease. A major aim of the post-genomic era is to be able to read the function of cis-regulatory elements through scrutiny of their DNA sequence. Whilst comparative genomics approaches have identified thousands of putative regulatory elements, our knowledge of their mechanism of action is poor and very little progress has been made in systematically de-coding them. Results Here, we identify ancient functional signatures within vertebrate conserved non-coding elements (CNEs through a combination of phylogenetic footprinting and functional assay, using genomic sequence from the sea lamprey as a reference. We uncover a striking enrichment within vertebrate CNEs for conserved binding-site motifs of the Pbx-Hox hetero-dimer. We further show that these predict reporter gene expression in a segment specific manner in the hindbrain and pharyngeal arches during zebrafish development. Conclusions These findings evoke an evolutionary scenario in which many CNEs evolved early in the vertebrate lineage to co-ordinate Hox-dependent gene-regulatory interactions that pattern the vertebrate head. In a broader context, our evolutionary analyses reveal that CNEs are composed of tightly linked transcription-factor binding-sites (TFBSs, which can be systematically identified through phylogenetic footprinting approaches. By placing a large number of ancient vertebrate CNEs into a developmental context, our findings promise to have a significant impact on efforts toward de-coding gene-regulatory elements that underlie vertebrate development, and will facilitate building general models of regulatory element evolution.
Satellite end of life constraints: Technical and organisational solutions
Cabrières, Bernard; Alby, Fernand; Cazaux, Christian
2012-04-01
Since 1974 with the radiocommunication satellite Symphony1, CNES launched and operated 11 GEO and 20 LEO satellites. During those 36 years, both flight segment and ground segment dramatically evolved and operational organisations and techniques equally improved. At the present time, CNES operates 1 GEO satellite and 17 LEO satellites with not much more people and costs than in 1986 when its first Satellite Operation Direction in Toulouse was only in charge of Telecom1A, Telecom1B and Spot1. This fantastic technical evolution combined with the huge increase of services to citizens and governments given by Space systems was unfortunately also associated with an enormous growth of space pollution by debris of all sizes. From the beginning, CNES was a major actor of the international effort to promote regulations in order to try to reduce or at least control this problematic situation. Internally, CNES, not only set up an operational on-call service to deal with collision risks, but decided to do its best to apply the new guidelines to the end of life of satellites under its responsibility even for those developed and launched a very long time ago. For instance, that was the case in 2009 for the reorbitation of the GEO satellite Telecom 2C (launched in 1995) and for the deorbitation of the LEO satellite Spot2 (launched in 1990). In addition, CNES prepares procedures to be able to be as exemplary as possible for its other spacecrafts whose end of life approaches. The constraints and challenges to face in order to cope with these new requirements are multiple: choice of final orbit, realistic calculation of re-entry duration, estimation of residual propellant, electric passivation, management of explosion risks… All these studies and operational experience gained will be helpful for the new role of CNES, which recently became in charge of controlling space operators in the frame of the new French space law on space operations.
Particle processing technology
Sakka, Yoshio
2014-02-01
includes two papers on the fabrication of mechanically reliable nanocomposites by dispersing graphene into a ceramic matrix, and on supercapacitors with high energy densities in a Co(OH)2 system decorated with graphene and carbon nanotubes. As a novel preparation method of oxide films, the fabrication of alumina films with laminated structures by ac anodization is reviewed. Moreover a new type of nanosheet has been fabricated by the exfoliation of layered, ternary transition-metal carbide and nitride compounds, known as Mn + 1AXn phases (or MAX phases) where M is an early transition metal, such as Ti or Nb, A is an A group element, such as Si or Al, X is carbon and/or nitrogen and n = 1-3 [4]. Among the MAX phases, those containing Mo have been theoretically calculated by first-principles calculations to be a source for obtaining Mo2C nanosheets with potentially unique properties. As an example of improving bulk ceramic properties, texturing by using a high magnetic field [5] and sintering by the electric current activated/assisted sintering (ECAS) technology [6] have been demonstrated for ultra-high temperature ceramics with high-temperature strength. A project on the development of materials and particle processing for the field of environment and energy has been ongoing at the National Institute for Materials Science since April 2011. This project employs various core competence technologies for particle processing such as ion beam irradiation for nanoparticle fabrication [7], fullerene nanomaterial processing using liquid-liquid interface precipitation [8], a gas reduction nitridation process to obtain Si3N4-based phosphor materials [9], advanced phosphors via novel processing [10, 11], ultra-high pressure technology for processing and in situ analysis [12, 13], colloidal processing in a high magnetic field to obtain laminated, textured ceramics [1, 3, 5], the ECAS process for nanostructuring ceramics [6] and so forth. Here, I would like to introduce some research
Microstructures and recrystallization behavior of severely hot-deformed tungsten
International Nuclear Information System (INIS)
Mathaudhu, S.N.; De Rosset, A.J.; Hartwig, K.T.; Kecskes, L.J.
2009-01-01
When coarse-grained (CG) tungsten (W) is heavily worked by equal-channel angular extrusion (ECAE), the grain size is reduced to the ultrafine-grained/nanocrystalline regimes (UFG/NC) and the strength and ductility increase. Because of the brittle nature of CG W, the material must be hot-extruded, and, if the temperatures are near the recrystallization temperature (T rc ), gains in properties may not be maximized. In this study, the recrystallization behavior of ECAE-processed CG W is examined as a function of the imparted strain (i.e., number of extrusions) and the hot-working extrusion temperature. Up to four ECAE passes were performed in tooling with a 90 deg. channel intersection, and at temperatures of 1000 deg. C or 1200 deg. C. Subsequent 60 min annealing of the worked material to 1600 deg. C allowed for the determination of T rc . Vickers microhardness measurements and scanning electron microscopy, were used to characterize the microstructures in the as-worked and recrystallized states. The ECAE-processed W shows increased microstructural break-up and refinement with increasing strain and decreasing hot-working temperature in the fully worked state. T rc was determined to be ∼1400 deg. C, which is nearly independent of the number of extrusions and the working temperature. These results show that if ECAE is accomplished below 1400 deg. C (i.e., at 1000 deg. C or lower) the attractive properties of the UFG/NC-worked W may be retained. Specifically, below 1000 deg. C, with increasing strain imparted to the material, high hardness values with a concomitant grain size refinement (∼350 nm) could be expected
Not, C.; Thibodeau, B.; Yokoyama, Y.
2018-01-01
Measurement of elemental ratios (E/Ca) has been performed in two symbiont-bearing species of high-Mg calcite benthic foraminifers (hyaline, Baculogypsina sphaerulata and porcelaneous, Amphisorus hemprichii), cultured under five pCO2 levels, representing preindustrial, modern, and three predicted future values. E/Ca ratios were analyzed by Laser Ablation coupled with Inductively Coupled Plasma Mass Spectrometer (LA-ICP-MS). We measured several E/Ca, such as Mg/Ca, Sr/Ca, Ba/Ca, U/Ca, and B/Ca simultaneously. We observed that high-Mg calcite benthic foraminifers possess higher E/Ca than low-Mg calcite foraminifers, irrespective of their calcification mode (hyaline or porcelaneous). In both modes of calcification, Mg, Sr, Ba, U, and B incorporation could be controlled by Rayleigh fractionation. However, more data are needed to validate and quantify the relative importance of this process and closely investigate the presence/absence of other mechanism. Therefore, it highlights the need for a multielemental approach when looking at trace element incorporation. Finally, no significant relationship was observed between the different ratios and the pCO2 of the water, suggesting that none of the Mg/Ca, Sr/Ca, Ba/Ca, U/Ca, and B/Ca is sensitive to bottom water pCO2 or pH for these species.
Xu, Guobao; Liu, Xiaohong; Trouet, Valerie; Treydte, Kerstin; Wu, Guoju; Chen, Tuo; Sun, Weizhen; An, Wenling; Wang, Wenzhi; Zeng, Xiaomin; Qin, Dahe
2018-04-01
Drought occurrence and duration in central Asia are of important socioeconomic, ecological, and geophysical significance and have received increasing research attention in recent years. Understanding long-term drought trends and their driving forces require reliable records of past drought variability with broad spatial representativeness. Here, we compiled four tree-ring δ18O records from eastern central Asia (ECA) and composited them into a drought-sensitive proxy to explore regional ECA moisture variations over the past 301 years (1710-2010 CE). A robust regional standardized precipitation-evapotranspiration index (SPEI) reconstruction was established based on the tree-ring cellulose δ18O fractionation mechanism and statistically significant proxy-climate relationships. We identified prominent droughts in 1710-1770, 1810-1830, and the beginning of the twenty-first century, and a regime shift to a persistently wet period from the 1880s to 2000. Our reconstruction reveals the impact of drought and pluvial patterns on the decline of Zhungar Empire, and on historical agricultural and socio-economical activities, including increased migration into ECA during the 1770-1800 pluvial. Our findings also suggest that wet conditions in the twentieth century in ECA were related to a strengthening of the westerly circulation and thus shed light on large-scale atmospheric circulation dynamics in central Asia.
Wu, Haoyi; Chiang, Sum Wai; Lin, Wei; Yang, Cheng; Li, Zhuo; Liu, Jingping; Cui, Xiaoya; Kang, Feiyu; Wong, Ching Ping
2014-09-01
Direct printing nanoparticle-based conductive inks onto paper substrates has encountered difficulties e.g. the nanoparticles are prone to penetrate into the pores of the paper and become partially segmented, and the necessary low-temperature-sintering process is harmful to the dimension-stability of paper. Here we prototyped the paper-based circuit substrate in combination with printed thermoplastic electrically conductive adhesives (ECA), which takes the advantage of the capillarity of paper and thus both the conductivity and mechanical robustness of the printed circuitsweredrastically improved without sintering process. For instance, the electrical resistivity of the ECA specimen on a pulp paper (6 × 10-5Ω.cm, with 50 wt% loading of Ag) was only 14% of that on PET film than that on PET film. This improvement has been found directly related to the sizing degree of paper, in agreement with the effective medium approximation simulation results in this work. The thermoplastic nature also enables excellent mechanical strength of the printed ECA to resist repeated folding. Considering the generality of the process and the wide acceptance of ECA technique in the modern electronic packages, this method may find vast applications in e.g. circuit boards, capacitive touch pads, and radio frequency identification antennas, which have been prototyped in the manuscript.
KÖKKÜLÜNK, Görkem; AKDOĞAN, Erhan; AYHAN, Vezir
2014-01-01
Exhaust gases have many effects on human beings and the environment. Therefore, they must be kept under control. The International Convention for the Prevention of Pollution from Ships (MARPOL), which is concerned with the prevention of marine pollution, limits the emissions according to the regulations. In Emission Control Area (ECA) regions, which are determined by MARPOL as ECAs, the emission rates should be controlled. Direct injection (DI) diesel engines are commonly used as a prop...
Directory of Open Access Journals (Sweden)
Matías Bosch Mayol
2012-12-01
Full Text Available La agricultura de precisión utiliza herramientas modernas capaces de facilitar la obtención y análisis de datos georreferenciados. La conductividad eléctrica aparente (CEa del suelo, se obtiene con sensores remotos y está correlacionada con algunas propiedades del suelo (capacidad de almacenamiento de agua, contenido de materia orgánica, salinidad y drenaje, topografía, manejos previos y texturas entre otras. El exceso de sales puede ser perjudicial para las plantas mientras que altos contenidos de sodio intercambiable pueden provocar daños físicos y químicos en el suelo, afectando el crecimiento de los cultivos. Se seleccionaron 3 lotes con una superficie promedio de 80 ha, regados con pivote central, en el sudeste de la provincia de Buenos Aires, Argentina. En cada lote se midió la CEa georreferenciada con un sensor de medición directa. Con los datos obtenidos se confeccionaron mapas de CEa utilizando técnicas de interpolación espacial (Kriging. Los campos fueron divididos en zonas de igual rango de CEa, para tomar muestras de suelo en las que se midió humedad gravimétrica (θg, CE del extracto de saturación (CEe y cationes solubles (Na+, Ca+2 y Mg+2. Se calculó la relación de adsorción de sodio (RAS. Los datos fueron analizados estadísticamente utilizando el procedimiento PROC MIXED de SAS. Se observó variabilidad espacial de la CEa y se detectó una asociación entre la CEa y el RAS. Existe una relación significativa entre la CEa, la CEe y el contenido de sodio del suelo, diferenciándose estadísticamente los contenidos de Na+ entre las diferentes zonas de CEa de cada lote. Los sensores de medición directa de CEa son herramientas eficaces para la estimación espacial del contenido de sodio del suelo.Precision agriculture utilizes modern tools in order to obtain and analyze georreferenced data. Direct measuring sensors of soil apparent electrical conductivity (ECa are part of these modern tools and are widely used to
The Big Data Revolution: Opportunities for Chief Nurse Executives.
Remus, Sally
2016-01-01
Informatics competency adoption is a recognized issue across nursing roles in digital health practice settings. Further, it has been suggested that the health system's inability to reap the promised benefits of electronic health/patient records is, in part, a manifestation of inadequate development of informatics competency by chief nurse executives (CNEs) and other clinicians (Amendola 2008; Simpson 2013). This paper will focus on CNE informatics competency and nursing knowledge development as it pertains to the Big Data revolution. With the paper's aim of showing how CNEs armed with informatics competency can harness the full potential of Big Data offering new opportunities for nursing knowledge development in their clinical transformation roles as eHealth project sponsors. It is proposed that informatics-savvy CNEs are the new transformational leaders of the digital age who will have the advantage to successfully advocate for nurses in leading 21st-century health systems. Also, transformational CNEs armed with informatics competency will position nurses and the nursing profession to achieve its future vision, where nurses are perceived by patients and professionals alike as knowledge workers, providing the leadership essential for safe, quality care and demonstrating nursing's unique contributions to fiscal health through clinically relevant, evidence-based practices (McBride 2005b). Copyright © 2016 Longwoods Publishing.
Development of Electrochemical Processes for Aluminium-Based Coatings for Fusion Applications
Energy Technology Data Exchange (ETDEWEB)
Konys, J. [Karlsruhe Institute of Technology, Karlsruhe (Germany)
2016-12-15
Reduced activation ferritic-martensitic steels (RAFM) are envisaged in future fusion technology as structural material which will be in direct contact with a flowing liquid lead-lithium melt, serving as breeder material. Aluminium-based coatings had proven their ability to protect the structural material from corrosion attack in flowing Pb-15.7Li and to reduce tritium permeation into the coolant, significantly. Coming from scales produced by hot dipping aluminization (HDA), the development of electrochemical-based processes to produce well-defined aluminium-based coatings on RAFM steels gained increased attention in research during the last years. Two different electrochemical processes are described in this paper: The first one, referred to as ECA, is based on the electrodeposition of aluminium from volatile, metal-organic electrolytes. The other process called ECX is based on ionic liquids. All three processes exhibit specific characteristics, for example in the field of processability, control of coating thicknesses (low activation criteria) and heat treatment behavior. The aim of this article is to compare these different coating processes critically, whereby the focus is on the comparison of ECA and ECX processes. New results for ECX will be presented and occurring development needs for the future will be discussed.
Development of Electrochemical Processes for Aluminium-Based Coatings for Fusion Applications
International Nuclear Information System (INIS)
Konys, J.
2016-01-01
Reduced activation ferritic-martensitic steels (RAFM) are envisaged in future fusion technology as structural material which will be in direct contact with a flowing liquid lead-lithium melt, serving as breeder material. Aluminium-based coatings had proven their ability to protect the structural material from corrosion attack in flowing Pb-15.7Li and to reduce tritium permeation into the coolant, significantly. Coming from scales produced by hot dipping aluminization (HDA), the development of electrochemical-based processes to produce well-defined aluminium-based coatings on RAFM steels gained increased attention in research during the last years. Two different electrochemical processes are described in this paper: The first one, referred to as ECA, is based on the electrodeposition of aluminium from volatile, metal-organic electrolytes. The other process called ECX is based on ionic liquids. All three processes exhibit specific characteristics, for example in the field of processability, control of coating thicknesses (low activation criteria) and heat treatment behavior. The aim of this article is to compare these different coating processes critically, whereby the focus is on the comparison of ECA and ECX processes. New results for ECX will be presented and occurring development needs for the future will be discussed.
A full computation-relevant topological dynamics classification of elementary cellular automata.
Schüle, Martin; Stoop, Ruedi
2012-12-01
Cellular automata are both computational and dynamical systems. We give a complete classification of the dynamic behaviour of elementary cellular automata (ECA) in terms of fundamental dynamic system notions such as sensitivity and chaoticity. The "complex" ECA emerge to be sensitive, but not chaotic and not eventually weakly periodic. Based on this classification, we conjecture that elementary cellular automata capable of carrying out complex computations, such as needed for Turing-universality, are at the "edge of chaos."
Alignment by Maximization of Mutual Information
1995-06-01
me how truly valuable unconditional support can be. Students are the AI lab’s most precious resource and I benefited from discussions with Phil Agre...to analyze these problems is purely convenience. There is nothing random about these problems once the samples are drawn. One of the benefits of...To provide further intuition regarding the behavior of ECA we have run ECA, PCA, and two related procedures BCM and BINGO on the same density. BCM
Delgado-Villanueva, Kiko Alexi; Romero Gil, Inmaculada
2016-01-01
[EN] Environmental conflict analysis (henceforth ECA) has become a key factor for the viability of projects and welfare of affected populations. In this study, we propose an approach for ECA using an integrated grey clustering and entropy-weight method (The IGCEW method). The case study considered a mining project in northern Peru. Three stakeholder groups and seven criteria were identified. The data were gathered by conducting field interviews. The results revealed that for the groups urban ...
Eslami, P.; Taheri, A. Karimi
2011-01-01
A new method for production of bimetallic rods, utilizing the equal channel angular extrusion (ECAE) process has been introduced before by previous researchers, but no attempt has been made to assess the effect of different temperatures and holding times in order to achieve a diffusional bond between the mating surfaces. In present research copper sheathed aluminum rods have been ECAEed at room temperature and subsequently held at a constant ECAE pressure, at different temperatures and holdin...
DEFF Research Database (Denmark)
Li, Saiyi; Mishin, Oleg
2014-01-01
A modeling and experimental investigation has been conducted to explore the effect of processing route on texture evolution during equal channel angular extrusion (ECAE) of aluminum plate samples. It is found that although the textures in the plates develop along orientation fibers previously ide...... identified for ECAE-processed rods and bars, the main components and strength of these textures vary significantly with processing route, which may lead to considerable differences in the plastic anisotropy of the plates....
Obesity-induced vascular inflammation involves elevated arginase activity.
Yao, Lin; Bhatta, Anil; Xu, Zhimin; Chen, Jijun; Toque, Haroldo A; Chen, Yongjun; Xu, Yimin; Bagi, Zsolt; Lucas, Rudolf; Huo, Yuqing; Caldwell, Ruth B; Caldwell, R William
2017-11-01
Obesity-induced vascular dysfunction involves pathological remodeling of the visceral adipose tissue (VAT) and increased inflammation. Our previous studies showed that arginase 1 (A1) in endothelial cells (ECs) is critically involved in obesity-induced vascular dysfunction. We tested the hypothesis that EC-A1 activity also drives obesity-related VAT remodeling and inflammation. Our studies utilized wild-type and EC-A1 knockout (KO) mice made obese by high-fat/high-sucrose (HFHS) diet. HFHS diet induced increases in body weight, fasting blood glucose, and VAT expansion. This was accompanied by increased arginase activity and A1 expression in vascular ECs and increased expression of tumor necrosis factor-α (TNF-α), monocyte chemoattractant protein-1 (MCP-1), interleukin-10 (IL-10), vascular cell adhesion molecule-1 (VCAM-1), and intercellular adhesion molecule-1 (ICAM-1) mRNA and protein in both VAT and ECs. HFHS also markedly increased circulating inflammatory monocytes and VAT infiltration by inflammatory macrophages, while reducing reparative macrophages. Additionally, adipocyte size and fibrosis increased and capillary density decreased in VAT. These effects of HFHS, except for weight gain and hyperglycemia, were prevented or reduced in mice lacking EC-A1 or treated with the arginase inhibitor 2-( S )-amino-6-boronohexanoic acid (ABH). In mouse aortic ECs, exposure to high glucose (25 mM) and Na palmitate (200 μM) reduced nitric oxide production and increased A1, TNF-α, VCAM-1, ICAM-1, and MCP-1 mRNA, and monocyte adhesion. Knockout of EC-A1 or ABH prevented these effects. HFHS diet-induced VAT inflammation is mediated by EC-A1 expression/activity. Limiting arginase activity is a possible therapeutic means of controlling obesity-induced vascular and VAT inflammation.
Directory of Open Access Journals (Sweden)
Zharkikh Andrey A
2006-09-01
Full Text Available Abstract The structures of the canine, rabbit, bovine and equine EIF2AK2 genes were determined. Each of these genes has a 5' non-coding exon as well as 15 coding exons. All of the canine, bovine and equine EIF2AK2 introns have consensus donor and acceptor splice sites. In the equine EIF2AK2 gene, a unique single nucleotide polymorphism that encoded a Tyr329Cys substitution was detected. Regulatory elements predicted in the promoter region were conserved in ungulates, primates, rodents, Afrotheria (elephant and Insectifora (shrew. Western clawed frog and fugu EIF2AK2 gene sequences were detected in the USCS Genome Browser and compared to those of other vertebrate EIF2AK2 genes. A comparison of EIF2AK2 protein domains in vertebrates indicates that the kinase catalytic domains were evolutionarily more conserved than the nucleic acid-binding motifs. Nucleotide substitution rates were uniform among the vertebrate sequences with the exception of the zebrafish and goldfish EIF2AK2 genes, which showed substitution rates about 20% higher than those of other vertebrates. FISH was used to physically assign the horse and cattle genes to chromosome locations, ECA15q24–q25 and BTA11q12–15, respectively. Comparative mapping data confirmed conservation of synteny between ungulates, humans and rodents.
Metzger, Julia; Ohnesorge, Bernhard; Distl, Ottmar
2012-01-01
Equine guttural pouch tympany (GPT) is a hereditary condition affecting foals in their first months of life. Complex segregation analyses in Arabian and German warmblood horses showed the involvement of a major gene as very likely. Genome-wide linkage and association analyses including a high density marker set of single nucleotide polymorphisms (SNPs) were performed to map the genomic region harbouring the potential major gene for GPT. A total of 85 Arabian and 373 German warmblood horses were genotyped on the Illumina equine SNP50 beadchip. Non-parametric multipoint linkage analyses showed genome-wide significance on horse chromosomes (ECA) 3 for German warmblood at 16–26 Mb and 34–55 Mb and for Arabian on ECA15 at 64–65 Mb. Genome-wide association analyses confirmed the linked regions for both breeds. In Arabian, genome-wide association was detected at 64 Mb within the region with the highest linkage peak on ECA15. For German warmblood, signals for genome-wide association were close to the peak region of linkage at 52 Mb on ECA3. The odds ratio for the SNP with the highest genome-wide association was 0.12 for the Arabian. In conclusion, the refinement of the regions with the Illumina equine SNP50 beadchip is an important step to unravel the responsible mutations for GPT. PMID:22848553
Khazandi, Manouchehr; Deo, Permal; Ferro, Sergio; Venter, Henrietta; Pi, Hongfei; Crabb, Simon; Amorico, Tony; Ogunniyi, Abiodun D; Trott, Darren J
2017-12-01
The bacterial species and specific spoilage organisms associated with the Southern Australian King George Whiting (KGW) and Tasmanian Atlantic Salmon (TAS), and the efficacy of a HOCl-containing water-based sanitization product (Electro-Chemically Activated Solution, by ECAS4) in extending the shelf life of KGW and TAS fillets were evaluated. Fillets were washed with an ECAS4 solution containing either 45 ppm or 150 ppm of free chlorine and bacterial species enumerated on selective and non-selective media, followed by identification of pure isolates by 16 S rRNA gene sequencing. The dominant spoilage microbiota in KGW and TAS fillets stored at 4 ± 1 °C were Pseudomonas spp. and Shewanella spp. At either concentration, ECAS4 significantly reduced total bacterial load and specific spoilage organisms on KGW and TAS fillets (approx. 1-2 log colony-forming units) during storage and significantly extended the shelf life of the fillets by 2 and 4 days, respectively. The significant increase in shelf life and quality of fillets was corroborated by raw and cooked sensory evaluation. ECAS4 sanitization could have a significant impact on the overall food industry, translating into health and economic benefits through reduction of food spoilage bacteria and potentially, foodborne pathogens without many of the disadvantages of currently approved biocides. Copyright © 2017 Elsevier Ltd. All rights reserved.
SatCom Systems for Health and Medical Care
Diez, Hubert
2002-01-01
Convinced since 1997 that the satellite was capable of providing a real added value either autonomously or as a complement to terrestrial infrastructures, CNES (the French Space Agency) began a determined study, validation and demonstration procedure for new satellite services. At a national but also European and worldwide level, several experiments or projects have been set-up. In each of them (tele-consultations, distant education, tele-epidemiology, tele-echography, assistance to people, training and therapeutic assistance, disaster telemedicine, etc...) well suited satcoms are used. (telecommunications for broadcasting, multicasting, downloading,...- localization, positioning, - low medium and high data rate bidirectional systems,). Medical reference people are associated in each pilot projects first to define the needs but also to manage the medical validation aspects. Our aim is always to test, validate and adapt these new services to bring them into line with the users' expectations. The value added of these technologies in sustainable healthcare services are systematically demonstrated in real situations, with real users, both in terms of quality of service and of economic validity. For several projects CNES has developed typical hardware, or technical on as technical platform. The main projects and their relevant satcom systems will be presented and discussed : - Tele-consultation, - Distance learning and training, - Assistance to people, - Tele-epidemiology, - Disaster telemedicine.
T2L2 on JASON-2: First Evaluation of the Flying Model
2007-01-01
Para, J.-M. Torre R&D Metrology CNRS/GEMINI Observatoire de la Côte d’Azur Caussol, France E-mail: philippe.guillemot@cnes.fr Abstract...Laser Link” experiment T2L2 [1], under development at OCA (Observatoire de la Côte d’Azur) and CNES (Centre National d’Etudes Spatiales), France, will be...Experimental Astronomy, 7, 191-207. [2] P. Fridelance and C. Veillet, 1995, “Operation and data analysis in the LASSO experiment,” Metrologia
STS-93 Mission Specialist Tognini talks with Goldin, Ratie, and Plattard
1999-01-01
At the Shuttle Landing Facility (from left to right), STS-93 Mission Specialist Michel Tognini of France, representing the Centre National d'Etudes Spatiales (CNES), and NASA Administrator Daniel Goldin talk with Jacques Ratie, Astronaut Director, CNES, and Serge Plattard, International Relations, CNES. Landing occurred on runway 33 with main gear touchdown at 11:20:35 p.m. EDT on July 27. The mission's primary objective was to deploy the Chandra X-ray Observatory, which will allow scientists from around the world to study some of the most distant, powerful and dynamic objects in the universe. This was the 95th flight in the Space Shuttle program and the 26th for Columbia. The landing was the 19th consecutive Shuttle landing in Florida and the 12th night landing in Shuttle program history. On this mission, Eileen Collins became the first woman to serve as a Shuttle commander.
International Nuclear Information System (INIS)
Song, M.; Sun, C.; Fan, Z.; Chen, Y.; Zhu, R.; Yu, K.Y.; Hartwig, K.T.; Wang, H.; Zhang, X.
2016-01-01
Ferritic/martensitic (F/M) steels with high strength and excellent ductility are important candidate materials for the life extension of the current nuclear reactors and the design of next generation nuclear reactors. Recent studies show that equal channel angular extrusion (ECAE) was able to improve mechanical strength of ferritic T91 steels moderately. Here, we examine several strategies to further enhance the mechanical strength of T91 while maintaining its ductility. Certain thermo-mechanical treatment (TMT) processes enabled by combinations of ECAE, water quench, and tempering may lead to “ductile martensite” with exceptionally high strength in T91 steel. The evolution of microstructures and mechanical properties of T91 steel were investigated in detail, and transition carbides were identified in water quenched T91 steel. This study provides guidelines for tailoring the microstructure and mechanical properties of T91 steel via ECAE enabled TMT for an improved combination of strength and ductility.
Tang, Panpan; Chen, Fulong; Jiang, Aihui; Zhou, Wei; Wang, Hongchao; Leucci, Giovanni; de Giorgi, Lara; Sileo, Maria; Luo, Rupeng; Lasaponara, Rosa; Masini, Nicola
2018-04-01
This study presents the potential of multi-frequency electromagnetic induction (EMI) in archaeology. EMI is currently less employed for archaeological prospection with respect to other geophysical techniques. It is capable of identifying shallow subsurface relics by simultaneously measuring the apparent electrical conductivity (ECa) and apparent magnetic susceptibility (MSa). Moreover, frequency sounding is able to quantify the depths and vertical shapes of buried structures. In this study, EMI surveys with five frequencies were performed at two heritage sites with different geological conditions: Han Hangu Pass characterized by cinnamon soil and Xishan Yang by sandy loams. In the first site, high ECa values were observed with variations in depth correlated to archaeological remains. Moreover, electromagnetic anomalies related to an ancient road and five kiln caves were identified. In the second site, an ancient tomb, indicating extremely low ECa and high MSa, was discovered. Its electromagnetic properties are attributed to the cavity and ferroferric oxides.
Interaction affective et expressive. Compagnon artificiel-humain
Riviere , Jérémy
2012-01-01
The aim of this thesis is to make an Embodied Conversational Agent (ECA) sincere in order to, on one hand, improve its believability from the human's point of view, and on the other hand make it acceptable in an affective relationship between an artificial companion and a human. The first part of this work consists in creating a Multimodal Conversation Language (MCL) for an ECA, made up of Multimodal Conversation Acts (MCA) such as promise, apologise or demand. These MCA allow the agent to ap...
Focusing telescopes in nuclear astrophysics
International Nuclear Information System (INIS)
Von Ballmoos, P.; Knodlseder, R.; Sazonov, S.; Griffiths, R.; Bastie, P.; Halloin, H.; Pareschi, G.; Ramsey, B.; Jensen, C.; Buis, E.J.; Ulmer, M.; Giommi, P.; Colafrancesco, S.; Comastri, A.; Barret, D.; Leising, M.; Hernanz, M.; Smith, D.; Abrosimov, N.; Smither, B.; Ubertini, P.; Olive, J.F.; Lund, N.; Pisa, A.; Courtois, P.; Roa, D.; Harrison, F.; Pareschi, G.; Frontera, F.; Von Ballmoos, P.; Barriere, N.; Rando, N.; Borde, J.; Hinglais, E.; Cledassou, R.; Duchon, P.; Sghedoni, M.; Huet, B.; Takahashi, T.; Caroli, E.; Quadrinin, L.; Buis, E.J.; Skinner, G.; Krizmanic, J.; Pareschi, G.; Loffredo, G.; Wunderer, C.; Weidenspointner, G.; Wunderer, C.; Koechlin, L.; Bignami, G.; Von Ballmoos, P.; Tueller, J.; Andritschke, T.; Laurens, A.; Evrard, J.
2005-01-01
The objective of this workshop is to consider the next generation of instrumentation to be required within the domain of nuclear astrophysics. A small, but growing community has been pursuing various techniques for the focusing of hard X-rays and gamma-rays with the aim of achieving a factor of up to 100 improvement in sensitivity over present technologies. Balloon flight tests of both multilayer mirrors and a Laue lens have been performed and ideas abound. At present, implementation scenarios for space missions are being studied at Esa, CNES, and elsewhere. The workshop will provide a first opportunity for this new community to meet, exchange technological know-how, discuss scientific objectives and synergies, and consolidate implementation approaches within National and European Space Science programs. This document gathers the slides of all the presentations
Focusing telescopes in nuclear astrophysics
Energy Technology Data Exchange (ETDEWEB)
Von Ballmoos, P; Knodlseder, R; Sazonov, S; Griffiths, R; Bastie, P; Halloin, H; Pareschi, G; Ramsey, B; Jensen, C; Buis, E J; Ulmer, M; Giommi, P; Colafrancesco, S; Comastri, A; Barret, D; Leising, M; Hernanz, M; Smith, D; Abrosimov, N; Smither, B; Ubertini, P; Olive, J F; Lund, N; Pisa, A; Courtois, P; Roa, D; Harrison, F; Pareschi, G; Frontera, F; Von Ballmoos, P; Barriere, N; Rando, N; Borde, J; Hinglais, E; Cledassou, R; Duchon, P; Sghedoni, M; Huet, B; Takahashi, T; Caroli, E; Quadrinin, L; Buis, E J; Skinner, G; Krizmanic, J; Pareschi, G; Loffredo, G; Wunderer, C; Weidenspointner, G; Wunderer, C; Koechlin, L; Bignami, G; Von Ballmoos, P; Tueller, J; Andritschke, T; Laurens, A; Evrard, J
2005-07-01
The objective of this workshop is to consider the next generation of instrumentation to be required within the domain of nuclear astrophysics. A small, but growing community has been pursuing various techniques for the focusing of hard X-rays and gamma-rays with the aim of achieving a factor of up to 100 improvement in sensitivity over present technologies. Balloon flight tests of both multilayer mirrors and a Laue lens have been performed and ideas abound. At present, implementation scenarios for space missions are being studied at Esa, CNES, and elsewhere. The workshop will provide a first opportunity for this new community to meet, exchange technological know-how, discuss scientific objectives and synergies, and consolidate implementation approaches within National and European Space Science programs. This document gathers the slides of all the presentations.
Bernard Zappoli's contribution to the French scientific life
Prud'homme, Roger
2017-01-01
In November 2014, at the annual meeting of the research group "Fundamental and Applied Microgravity" held in Carqueiranne, France, I was asked to speak on Bernard Zappoli and his accomplishments. The following is an edited transcription of the speech delivered in his honor following his recent retirement as the Head of The Physical Science Programme at the French Space Agency (CNES). After an introduction outlining his human qualities and retirement as engineer emeritus, his career is summarized. It then details the scientific activities he has undertaken during different periods of his career at several universities, the European Society of Propulsion ("Société européenne de propulsion", SEP), and the CNES. Special attention is devoted to the research groups at the CNES/CNRS that we initiated and the management of which I had been sharing with him for several years. Allusion is made to his recent and new retiree activities.
Impact of Decontamination Therapy on Ultrasound Visualization of Ingested Pills
Directory of Open Access Journals (Sweden)
Jason Bothwell
2014-03-01
Full Text Available Introduction: Acute toxic ingestion is a common cause of morbidity and mortality. Emergency physicians (EP caring for overdose (OD patients are often required to make critical decisions with incomplete information. Point of care ultrasound (POCUS may have a role in assisting EPs manage OD patients. We evaluated the impact of different liquid adjuncts used for gastric decontamination on examiners’ ability to identify the presence of tablets using POCUS, and assessed examiners’ ability to quantify the numbers of tablets in a simulated massive OD. Methods: This prospective, blinded, pilot study was performed at an academic emergency department. Study participants were volunteer resident and staff EPs trained in POCUS. Five non-transparent, sealed bags were prepared with the following contents: 1 liter (L of water, 1 L of water with 50 regular aspirin (ASA tablets, 1 L of water with 50 enteric-coated aspirin tablets (ECA, 1 L of polyethylene glycol (PEG with 50 ECA, and 1 L of activated charcoal (AC with 50 ECA. After performing POCUS on each of the bags using a 10-5 MHz linear array transducer, participants completed a standardized questionnaire composed of the following questions: (1 Were pills present? YES/NO; (2 If tablets were identified, estimate the number (1-10, 11-25, >25. We used a single test on proportions using the binomial distribution to determine if the number of EPs who identified tablets differed from 50% chance. For those tablets identified in the different solutions, another test on proportions was used to determine whether the type of solution made a difference. Since 3 options were available, we used a probability of 33.3%. Results: Thirty-seven EPs completed the study. All (37/37 EP’s correctly identified the absence of tablets in the bag containing only water, and the presence of ECA in the bags containing water and PEG. For Part 2 of the study, most participants - 25/37 (67.5% using water, 23/37 (62.1% using PEG, and
Mechanical properties of ultra-fine grained structure formed in Al-Li alloys
International Nuclear Information System (INIS)
Adamczyk-Cieslak, B.; Lewandowska, M.; Mizera, J.; Kurzydlowski, K.J.
2004-01-01
This paper describes the mechanical properties (microhardness, yield stress) of two model Al-Li alloys by the Equal-Channel-Angular-Extrusion (ECAE) process. The applied ECAE process reduced the grain size from an initial value of ∼300 μm to a value of ∼0.7 μm leading to profound increase of plastic flow resistance. Such an increase is related to the grain size refinement and strengthening due to Li atoms in solid solution. Microhardness data confirm the Hall - Petch relation for grain sizes not available so far in Al-Li alloys. (author)
Present status of MHTGR program in USA
International Nuclear Information System (INIS)
Millunzi, A.
1990-01-01
The U.S. Department of Energy (DOE) Modular High-Temperature Gas-Cooled Reactor (MHTGR) program has produced a conceptual design which has been reviewed by the U.S. Nuclear Regulatory Commission (NRC). The results of the review were generally favorable, and the program team has now moved into the preliminary design phase. The program team consists of a nuclear island engineering (NIE) team, an energy conversion area (ECA) team, a design integration organization, and a technology development team. Utility user requirements are provided by a utility organization which also participates in design and programmatic review/evaluations. This paper will review the direction and accomplishments of each participating organization. (author)
Present status of MHTGR program in USA
International Nuclear Information System (INIS)
Rittenhouse, P.L.
1989-01-01
The U.S. Department of Energy (DOE) Modular High-Temperature Gas-Cooled Reactor (MHTGR) program has produced a conceptual design which has been reviewed by the U.S. Nuclear Regulatory Commission (NRC). The results of the review were generally favorable, and the program team has now moved into the preliminary design phase. The program team consists of a nuclear island engineering (NIE) team, an energy conversion area (ECA) team, a design integration organization, and a technology development team. Utility user requirements are provided by a utility organization which also participates in design and programmatic reviews/evaluations. This paper will review the direction and accomplishments of each participating organization. (orig.)
Owuor, Theresa O; Reid, Michaela; Reschke, Lauren; Hagemann, Ian; Greco, Suellen; Modi, Zeel; Moley, Kelle H
2018-01-01
Thirty-eight percent of US adult women are obese, meaning that more children are now born of overweight and obese mothers, leading to an increase in predisposition to several adult onset diseases. To explore this phenomenon, we developed a maternal obesity animal model by feeding mice a diet composed of high fat/ high sugar (HF/HS) and assessed both maternal diet and offspring diet on the development of endometrial cancer (ECa). We show that maternal diet by itself did not lead to ECa initiation in wildtype offspring of the C57Bl/6J mouse strain. While offspring fed a HF/HS post-weaning diet resulted in poor metabolic health and decreased uterine weight (regardless of maternal diet), it did not lead to ECa. We also investigated the effects of the maternal obesogenic diet on ECa development in a Diethylstilbestrol (DES) carcinogenesis mouse model. All mice injected with DES had reproductive tract lesions including decreased number of glands, condensed and hyalinized endometrial stroma, and fibrosis and increased collagen deposition that in some mice extended into the myometrium resulting in extensive disruption and loss of the inner and outer muscular layers. Fifty percent of DES mice that were exposed to maternal HF/HS diet developed several features indicative of the initial stages of carcinogenesis including focal glandular and atypical endometrial hyperplasia versus 0% of their Chow counterparts. There was an increase in phospho-Akt expression in DES mice exposed to maternal HF/HS diet, a regulator of persistent proliferation in the endometrium, and no difference in total Akt, phospho-PTEN and total PTEN expression. In summary, maternal HF/HS diet exposure induces endometrial hyperplasia and other precancerous phenotypes in mice treated with DES. This study suggests that maternal obesity alone is not sufficient for the development of ECa, but has an additive effect in the presence of a secondary insult such as DES.
Directory of Open Access Journals (Sweden)
Fabiano Timbó Barbosa
2009-04-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: O ensaio clínico aleatório (ECA é definido como um estudo que envolve grupos de intervenção e controle, com alocação aleatória dos participantes. O objetivo deste trabalho foi avaliar a qualidade dos artigos de ECA em anestesia publicados num determinado período. Desenho do estudo: descritivo. MÉTODO: Foi realizada busca manual dos artigos publicados na Revista Brasileira de Anestesiologia entre janeiro de 2005 e fevereiro de 2008, que tivessem características de ECA. A variável primária foi a qualidade dos ECA; as variáveis secundárias foram: encaminhamento da pesquisa para o Comitê de Ética em Pesquisa (CEP, utilização do termo de consentimento livre e esclarecido (TCLE, descrição da fonte de fomento, realização do cálculo do tamanho da amostra, número de autores, local de origem, teste estatístico utilizado, nível de significância adotado na pesquisa e classificação do tipo de estudo. Foi utilizada a escala de qualidade para avaliar a qualidade dos ECA, estatística descritiva e o cálculo do intervalo de 95% de confiança. RESULTADOS: Dos 114 artigos originais, 42 foram identificados como ECA. Destes, somente 3 (7,1% foram classificados como de boa qualidade metodológica, considerando distribuição aleatória, encobrimento duplamente encoberto, perdas e exclusões. Dos 114 artigos, 107 foram encaminhados ao CEP, 67 utilizaram TCLE, em nenhum houve descrição do fomento, em 17 houve cálculo do tamanho da amostra, o número médio de autores por artigo foi 4,49; São Paulo contribuiu com 60 publicações, o teste t de Student foi o mais utilizado (47,4%, o nível de significância de 5% foi adotado em 97 e 42 foram ECA. CONCLUSÕES: Após a busca manual, 7,1% dos ensaios clínicos aleatórios foram considerados de boa qualidade metodológica.JUSTIFICATIVA Y OBJETIVOS: El ensayo clínico aleatorio (ECA se define como un estudio que involucra a grupos de intervención y control, con la
MicroCameras and Photometers (MCP) on board the TARANIS satellite
Farges, T.; Hébert, P.; Le Mer-Dachard, F.; Ravel, K.; Gaillac, S.
2017-12-01
TARANIS (Tool for the Analysis of Radiations from lightNing and Sprites) is a CNES micro satellite. Its main objective is to study impulsive transfers of energy between the Earth atmosphere and the space environment. It will be sun-synchronous at an altitude of 700 km. It will be launched in 2019 for at least 2 years. Its payload is composed of several electromagnetic instruments in different wavelengths (from gamma-rays to radio waves including optical). TARANIS instruments are currently in calibration and qualification phase. The purpose is to present the MicroCameras and Photometers (MCP) design, to show its performances after its recent characterization and at last to discuss the scientific objectives and how we want to answer it with the MCP observations. The MicroCameras, developed by Sodern, are dedicated to the spatial description of TLEs and their parent lightning. They are able to differentiate sprite and lightning thanks to two narrow bands ([757-767 nm] and [772-782 nm]) that provide simultaneous pairs of images of an Event. Simulation results of the differentiation method will be shown. After calibration and tests, the MicroCameras are now delivered to the CNES for integration on the payload. The Photometers, developed by Bertin Technologies, will provide temporal measurements and spectral characteristics of TLEs and lightning. There are key instrument because of their capability to detect on-board TLEs and then switch all the instruments of the scientific payload in their high resolution acquisition mode. Photometers use four spectral bands in the [170-260 nm], [332-342 nm], [757-767 nm] and [600-900 nm] and have the same field of view as cameras. The on-board TLE detection algorithm remote-controlled parameters have been tuned before launch using the electronic board and simulated or real events waveforms. After calibration, the Photometers are now going through the environmental tests. They will be delivered to the CNES for integration on the
Testing in a stratospheric balloon of a semiconductor detector altimeter
International Nuclear Information System (INIS)
Gilly, L.; Jourdan, P.
1968-01-01
An altimeter containing a semiconductor detector has been operated on flight. We have used a stratospheric balloon launched from AIRE-SUR-ADOUR with the C.N.E.S. collaboration. During this assay two apparatus have been used. The first allowed to follow the balloon during its ascension and descent, the second to follow its evolution at its maximum altitude. Informations transmitted by radio and recorded on Magnetophon, have been studied after the flight. Results are identical with these given by the barometer used by the C.N.E.S. in this essay. (authors) [fr
Quantitative mapping of soil salinity in 3-d using a DUALEM-21S and EM4Soil inversion software
DEFF Research Database (Denmark)
Koganti, Triven; Triantafilis, John
2018-01-01
algorithm (EM4Soil-V302). The best LR (ECe = -11.814 + 0.043 × σ) was achieved using full solution (FS), S1 inversion algorithm and a damping factor (λ) of 0.6 which had a large coefficient of determination (R2 = 0.84). A cross-validation technique was used to validate the model and given the high accuracy...... (RMSE = 8.31 dS m-1), small bias (mean error [ME] = -0.0628 dS m-1), large R2 = 0.82 and Lin’s concordance (0.93), between measured and predicted ECe, we were well able to predict the ECe distribution at all the four depths. However, the predictions made in the topsoil (0-0.3 m) at a few locations were...... poor due to limited data availability in areas where ECa changed rapidly. In this regard, improvements in prediction can be achieved by collection of ECa in more closely spaced transects, particularly in areas where ECa varies over short spatial scales. Also, equivalent results can be achieved using...
ENHANCING EU-TAIWAN ECONOMIC COOPERATION AGREEMENT
Directory of Open Access Journals (Sweden)
Chung-hung Cho
2018-01-01
Full Text Available The EU’s 2015 new trade strategy: Trade for all: toward a more responsible trade and investment policy, highlights its key role in keeping markets open worldwide and lists the Asia-Pacific region as the priority party for signing Regional Trade Arrangements (RTAs with the EU. The new strategy allows the EU and its member states to initiate talks on economic cooperation agreement (ECA with Taiwan. This article takes the EU-Asia interregional cooperation as a case study while exploring the role of Taiwan in the region. The first section describes the shift in EU’s trade policies and the special features of the types of interregionalism between the EU and Asia. The second section explores the bilateral trade relations. The third section evaluates the opportunities and the internal and external challenges and limitations of an EU-Taiwan ECA, emphasizing the factor of mainland China. The final section provides conclusions on the influence of an EU-Taiwan ECA on the relations of EUTaiwan considering economic and non-economic factor
Energy Technology Data Exchange (ETDEWEB)
Hu, H.-J., E-mail: hhj@cqut.edu.cn [Chongqing University of Technology, Chongqing 400050 (China); PLA Chongqing Logistics Engineering College, 401311 (China); Ying, Y.-L. [Chongqing University of Technology, Chongqing 400050 (China); Ou, Z.-W. [PLA Chongqing Logistics Engineering College, 401311 (China); Wang, X.-Q. [The University of Alabama, Tuscaloosa, AL 35487 (United States)
2017-05-17
In this study, microstructure evolution, textures and mechanical properties of AZ61 magnesium alloy were investigated by optical microscopy (OM), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and tensile tests. The samples were processed by a new compound extrusion (CE) which combines direct extrusion (DE) and two steps of equal channel anger extrusion (ECAE). The results show that CE process can refine the microstructure more effectively than the DE process. The CE-fabricated samples have a weaker texture (0002), and a more fine and homogeneous microstructures, which attributes to the additional two steps of ECAE in CE process. In CE process, twin dynamic recrystallization and rotational dynamic recrystallization occurred, which enhances the refinement of the grains and weakening of the texture. In addition, the samples fabricated by CE process display a higher tensile properties (yield strength, tensile strength and elongation) with an excellent balance of strength and tensile ductility. Based on this study, severe plastic deformation (SPD) techniques combining conventional DE and two steps ECAE into a single process are feasibility to improve the mechanical properties of AZ61 Mg alloy.
International Nuclear Information System (INIS)
Korchef, Atef; Champion, Yannick; Njah, Nabil
2007-01-01
A 99.1% aluminium with initial grain size of ∼85 μm was deformed by equal channel angular (ECA) pressing. The sample undergoes an effective strain of 1.07 N by N passes through the die. The material contains a low volume fraction of Al 8 Fe 2 Si precipitates located essentially at the grain boundaries. The analysis of the X-ray diffraction peaks showed a significant broadening, which was related to grain refinement and lattice distortions. The crystallite size, calculated using the Halder-Wagner method, reached 225 nm after two passes and did not subsequently change. A decrease of the lattice parameter was also observed after ECA pressing. This is due to a partial dissolution of the precipitates. The microstructure was stable up an annealing of 200 deg. C due to the precipitates which delay the diffusion process. The annealing of the ECA pressed samples up to 400 deg. C leads to a decrease in the X-ray diffraction peaks broadening and an increase of the lattice parameter. This is due to grain growth
Analysis of whey protein hydrolysates: peptide profile and ACE inhibitory activity
Directory of Open Access Journals (Sweden)
Marialice Pinto Coelho Silvestre
2012-12-01
Full Text Available The aim of this study was to prepare enzymatic hydrolysates from whey protein concentrate with a nutritionally adequate peptide profile and the ability to inhibit angiotensin-converting enzyme (ACE activity. The effects of the type of enzyme used (pancreatin or papain, the enzyme:substrate ratio (E:S ratio=0.5:100, 1:100, 2:100 and 3:100 and the use of ultrafiltration (UF were investigated. The fractionation of peptides was performed by size-exclusion-HPLC, and the quantification of the components of the chromatographic fractions was carried out by a rapid Corrected Fraction Area method. The ACE inhibitory activity (ACE-IA was determined by Reverse Phase-HPLC. All parameters tested affected both the peptide profile and the ACE-IA. The best peptide profile was achieved for the hydrolysates obtained with papain, whereas pancreatin was more advantageous in terms of ACE-IA. The beneficial effect of using a lower E:S ratio on the peptide profile and ACE-IA was observed for both enzymes depending on the conditions used to prepare the hydrolysates. The beneficial effect of not using UF on the peptide profile was observed in some cases for pancreatin and papain. However, the absence of UF yielded greater ACE-IA only when using papain.O objetivo deste estudo foi preparar hidrolisados enzimáticos do concentrado proteico do soro de leite com perfil peptídico nutricionalmente adequado e com capacidade para inibir a atividade da enzima conversora da angiotensina (ECA. Os efeitos do tipo de enzima usado (pancreatina ou papaína, da relação enzima:substrato (E:S=0,5:100, 1:100, 2:100 e 3:100 e do uso da ultrafiltração (UF foram investigados. O fracionamento dos peptídeos foi feito por CLAE de exclusão molecular e a quantificação dos componentes das frações cromatográficas foi realizada pelo método da Área Corrigida da Fração. A atividade inibitória da ECA (AI-ECA foi determinada por CLAE de fase reversa. Todos os parâmetros testados afetaram
ELISA, a demonstrator environment for information systems architecture design
Panem, Chantal
1994-01-01
This paper describes an approach of reusability of software engineering technology in the area of ground space system design. System engineers have lots of needs similar to software developers: sharing of a common data base, capitalization of knowledge, definition of a common design process, communication between different technical domains. Moreover system designers need to simulate dynamically their system as early as possible. Software development environments, methods and tools now become operational and widely used. Their architecture is based on a unique object base, a set of common management services and they host a family of tools for each life cycle activity. In late '92, CNES decided to develop a demonstrative software environment supporting some system activities. The design of ground space data processing systems was chosen as the application domain. ELISA (Integrated Software Environment for Architectures Specification) was specified as a 'demonstrator', i.e. a sufficient basis for demonstrations, evaluation and future operational enhancements. A process with three phases was implemented: system requirements definition, design of system architectures models, and selection of physical architectures. Each phase is composed of several activities that can be performed in parallel, with the provision of Commercial Off the Shelves Tools. ELISA has been delivered to CNES in January 94, currently used for demonstrations and evaluations on real projects (e.g. SPOT4 Satellite Control Center). It is on the way of new evolutions.
Directory of Open Access Journals (Sweden)
Alison P Lee
Full Text Available The vertebrate Lhx2 is a member of the LIM homeobox family of transcription factors. It is essential for the normal development of the forebrain, eye, olfactory system and liver as well for the differentiation of lymphoid cells. However, despite the highly restricted spatio-temporal expression pattern of Lhx2, nothing is known about its transcriptional regulation. In mammals and chicken, Crb2, Dennd1a and Lhx2 constitute a conserved linkage block, while the intervening Dennd1a is lost in the fugu Lhx2 locus. To identify functional enhancers of Lhx2, we predicted conserved noncoding elements (CNEs in the human, mouse and fugu Crb2-Lhx2 loci and assayed their function in transgenic mouse at E11.5. Four of the eight CNE constructs tested functioned as tissue-specific enhancers in specific regions of the central nervous system and the dorsal root ganglia (DRG, recapitulating partial and overlapping expression patterns of Lhx2 and Crb2 genes. There was considerable overlap in the expression domains of the CNEs, which suggests that the CNEs are either redundant enhancers or regulating different genes in the locus. Using a large set of CNEs (810 CNEs associated with transcription factor-encoding genes that express predominantly in the central nervous system, we predicted four over-represented 8-mer motifs that are likely to be associated with expression in the central nervous system. Mutation of one of them in a CNE that drove reporter expression in the neural tube and DRG abolished expression in both domains indicating that this motif is essential for expression in these domains. The failure of the four functional enhancers to recapitulate the complete expression pattern of Lhx2 at E11.5 indicates that there must be other Lhx2 enhancers that are either located outside the region investigated or divergent in mammals and fishes. Other approaches such as sequence comparison between multiple mammals are required to identify and characterize such enhancers.
Heliconia cv. Golden Torch cultivated under different irrigation depths in protected environment
Directory of Open Access Journals (Sweden)
Alcilane Arnaldo Silva
2018-04-01
Full Text Available The genus Heliconia is commercially detached by the exotic appearance of the inflorescences but is susceptible to lack of moisture in the soil, being necessary the irrigation management. In this sense, the objective was to evaluate the effect of different irrigation levels on the plant growth and productive characters of Heliconia psittacorum cv. Golden Torch cultivated in vase. The experiment was conducted from March to October 2014, in a randomized blocks design. Five treatments corresponding to the different irrigation levels were used [50, 75, 100, 125 and 150% of the evaporation measured in Class A (ECA] with four replicates and two plants per replicate. The following evaluations were carried out: number of days for the emergence of the first tiller, number of days for the emergence of the first inflorescence, number of days for the inflorescence harvest, crop cycle, diameter of the flower stem, length of the flower stem, inflorescence length, plant high, number of tillers and productivity of flower stems. Chlorophyll and leaf area measurements were performed. The irrigation levels tested significantly influenced the number of days for the first inflorescence harvest, length of the flower stem and inflorescence length. The irrigation level of 150% ECA provided better results for the length of the flower stem, inflorescence length and for leaf area but without differences from 75%, 100% and 125% ECA. Thus, for the cultivation of the heliconia cv. Golden Torch in pot can be recommended the level corresponding from 75% to 150% ECA.
Gim, Jeong-An; Ayarpadikannan, Selvam; Eo, Jungwoo; Kwon, Yun-Jeong; Choi, Yuri; Lee, Hak-Kyo; Park, Kyung-Do; Yang, Young Mok; Cho, Byung-Wook; Kim, Heui-Soo
2014-08-15
Physical exercise induces gene expression changes that trigger glucose metabolism pathways in organisms. In the present study, we monitored the expression levels of LDHA (lactate dehydrogenase) and GYS1 (glycogen synthase 1) in the blood, to confirm the roles of these genes in exercise physiology. LDHA and GYS1 are related to glucose metabolism and fatigue recovery, and these processes could elicit economically important traits in racehorses. We collected blood samples from three retired thoroughbred racehorses, pre-exercise and immediately after 30 min of exercise. We extracted total RNA and small RNA (≤ 200 nucleotide-long) from the blood, and assessed the expression levels of LDHA, GYS1, and microRNAs (miRNAs), by using qRT-PCR. We showed that LDHA and GYS1 were down-regulated, whereas eca-miR-33a and miR-17 were up-regulated, after exercise. We used sequences from the 3' UTR of LDHA and GYS1, containing eca-miR-33a and miR-17 binding sites, to observe the down-regulation activity of each gene expression. We observed that the two miRNAs, namely, eca-miR-33a and miR-17, inhibited LDHA and GYS1 expression via binding to the 3' UTR sequences of each gene. Our results indicate that eca-miR-33a and miR-17 play important roles in the glucose metabolism pathway. In addition, our findings provide a basis for further investigation of the exercise metabolism of racehorses. Copyright © 2014 Elsevier B.V. All rights reserved.
Magnetogastrographic detection of gastric electrical response activity in humans
International Nuclear Information System (INIS)
Irimia, Andrei; Richards, William O; Bradshaw, L Alan
2006-01-01
The detection and characterization of gastric electrical activity has important clinical applications, including the early diagnosis of gastric diseases in humans. In mammals, this phenomenon has two important features: an electrical control activity (ECA) that manifests itself as an electric slow wave (with a frequency of 3 cycles per minute in humans) and an electrical response activity (ERA) that is characterized by spiking potentials during the plateau phase of the ECA. Whereas the ECA has been recorded in humans both invasively and non-invasively (magnetogastrography-MGG), the ERA has never been detected non-invasively in humans before. In this paper, we report on our progress towards the non-invasive detection of ERA from the human stomach using a procedure that involves the application of principal component analysis to MGG recordings, which were acquired in our case from ten normal human patients using a Superconducting QUantum Interference Device (SQUID) magnetometer. Both pre- and post-prandial recordings were acquired for each patient and 20 min of recordings (10 min of pre-prandial and 10 min of post-prandial data) were analysed for each patient. The mean percentage of ECA slow waves that were found to exhibit spikes of suspected ERA origin was 41% and 61% for pre- and post-prandial recordings, respectively, implying a 47% ERA increase post-prandially (P < 0.0001 at a 95% confidence level). The detection of ERA in humans is highly encouraging and points to the possible use of non-invasive ERA recordings as a valuable tool for the study of human gastric disorders
2010-04-22
... business management and tourism and hospitality management. Faculty participants will be required to have... involved in the social and cultural life of their local U.S. communities: For example, making presentations...; Allied Health Fields, including Nursing; Applied Engineering; Information Technology; and Media. In...
Estructuras articulares, funcionales y anatómicas en la técnica de rotura de poder en el Taekwon-do
Bulens, Marlene
2013-01-01
El objetivo de la siguiente ponencia, es examinar aspectos anatómicos-funcionales y biomecánicos necesarios para lograr un correcto gesto técnico de la muñeca y de la mano, durante el desarrollo de la técnica de rotura de poder con golpe de puño en el Taekwon-do que conlleva a una excesiva fuerza de compresión articular que resiste la muñeca y la mano además del constante ajuste de la técnica para reestablecer la estabilidad. Hay tensiones musculares producidas por los músculos del antebra...
Environmental Compliance Assessment System (ECAS).
1993-03-01
shopping malls, schools, hospitals. reli- gious buildings, factories. workshops, or tourism sites are found within 200 meters (in) of the border of the... Smm (EM&S) (14) W"Wewrm Tmooem Pl~m Svpmwvow (GAM) (16) Ekldbal adl Ca Dýu.oe (DEH) (22) Stdf Jhdle Mvomf 132) Dwoon- of R.scusv. MaUt ut (DRM
Environmental Compliance Assessment System (ECAS)
1994-02-01
a 1 h average - at ground level, 10 mg/in for an 8 h average. Verify that the concentration of ozone does not exceed 0.12 part per mil- lion ’ppm...research. "* Pest - any imect, rodent, nematode , fungus, or weed; or any other form of terestrial or aquatic plant or animal life or virus, bacterium...524-344 JUDGE 524-314-9779 STALL 524-314-34704 PARTNER 524-403 MOONEY CHEMICALS M-GARD W320 279-3014-9630 . NAUTICAL COATINGS SEA HAWK BIOCOP 44891-6 9
Environmental Compliance Assessment System (ECAS)
1993-09-01
generators -open burning/open detonation -peak shaving generators -landfills -turbines -surface impoundments -landfarw r- bioremediation Petroleum Product...greater. Methidathion All formu- All uses Restricted Residue effects lations. except on avian species. stock, safflower, and sunflower . All formu...Nursery Unclassified lations. stock. safflower, and sunflower Methomyl As sole Nondomestic Restricted. Residue effects active in- outdoor on mammalian
Environmental Studies at the Guiana Space Centre
Richard, Sandrine
2013-09-01
The Environmental Commitment of the French Space Agency at the Guiana Space Centre (CNES / CSG) specifies that the environmental protection is a major stake. Consequently, CNES participates in numerous space programs that contribute significantly to a better knowledge, management and protection of our environment at a global scale.The studies and researches that are done at CNES / CSG meet several objectives:* Assessment of safety and environmental effects and risk related to the effects overflowing due to a pollution caused by ground and flight activities* Improvement of the studies related to the knowledge of the environment (flora and fauna monitoring).* Risk assessment and management which may affect the safety of people , property, and protection of public health and environment * Verification of the compliance of the results of impact studies of launch vehicle in flight phase provided by the launch operator (Technical Regulation) with the French Safety Operational Acts.In this note, study and research programs are presented. They allow a better knowledge of the surrounding environment and of impacts caused by the industrial activities done in Guiana Space Center.
Directory of Open Access Journals (Sweden)
Cley A. S. de Freitas
2010-10-01
Full Text Available Com o objetivo de avaliar o desempenho das variáveis produtivas de três cultivares de mamoneira, a cinco níveis de irrigação por gotejamento, conduziu-se um experimento a campo, na Fazenda Experimental Vale do Curu, Pentecoste, CE. O delineamento experimental foi de blocos casualizados, em esquema fatorial 5 x 3 com três repetições, sendo cinco lâminas de irrigação (25, 50, 75, 100 e 125% da evaporação do tanque Classe "A" e três cultivares de mamoneira (IAC Guarani, Mirante 10 e BRS Paraguaçu. A cultivar IAC Guarani produziu racemos de maior comprimento e número de frutos enquanto a Mirante 10 obteve maior rendimento de racemos por planta e teor de óleo; já a BRS Paraguaçu superou as demais cultivares quanto à massa de cem sementes e potencial produtivo. O aumento da disponibilidade hídrica proporcionou aumento de todas as variáveis produtivas, nas três cultivares. Obteve-se a melhor eficiência do uso da água com o tratamento T5 (913,4 mm na cultivar BRS Paraguaçu, que resultou na produtividade de 2.872,42 kg ha-1. Os racemos secundários foram os que mais contribuíram com a produtividade total da mamoneira.The objective of the present study was to evaluate the productive characteristics of three castor bean cultivars under different levels of drip irrigation. This work was carried out at the Experimental Farm Vale do Curu, Pentecoste (CE. The experiment was conducted in randomized block design in split plots, with factorial scheme consisting of 5 irrigation levels and 3 cultivars. The levels of irrigation were based on evaporation of the Tank Class "A" - ECA (T1 = 0.25 ECA; T2 = 0.50 ECA; T3 = 0.75 ECA; T4 = 1.00 ECA; T5 = 1.25 ECA. The variables length and number of fruits per racemes were higher for the IAC Guarani, while the content of oil and number of racemes per plant were higher for the Mirante 10. However the Paraguaçu BRS stood out in comparison to other cultivars as for the mass of one hundred seeds and
Towards Reconfigurable, Separable and Hard Real-Time Hybrid Simulation and Test Systems
Quartier, F.; Delatte, B.; Joubert, M.
2009-05-01
Formation flight needs several new technologies, new disciplines, new approaches and above all, more concurrent engineering by more players. One of the problems to be addressed are more complex simulation and test systems that are easy to re-configure to include parts of the target hardware and that can provide sufficient power to handle simulation cores that are requiring one to two orders of magnitude more processing power than the current technology provides. Critical technologies that are already addressed by CNES and Spacebel are study model reuse and simulator reconfigurability (Basiles), model portability (SMP2) and the federation of several simulators using HLA. Two more critical issues are addressed in ongoing R&D work by CNES and Spacebel and are covered by this paper and concern the time engineering and management. The first issue concerns separability (characterisation, identification and handling of separable subsystems) and the consequences on practical systems. Experiments on the Pleiades operational simulator have shown that adding precise simulation of instruments such as Doris and the Star Tracker can be added without significantly impacting overall performance. Improved time analysis leads to better system understanding and testability. The second issue concerns architectures for distributed hybrid simulators systems that provide hard real-time capabilities and can react with a relative time precision and jitter that is in the 10 to 50 µsecond range using mainstream PC's and mainstream Operating Systems. This opens a way to make smaller economic hardware test systems that can be reconfigured to make large hardware test systems without restarting development. Although such systems were considered next to impossible till now, distributed hard real-time systems are getting in reach when modern but mainstream electronics are used and when processor cores can be isolated and reserved for real-time cores. This requires a complete rethinking of the
Copy-number variations involving the IHH locus are associated with syndactyly and craniosynostosis.
Klopocki, Eva; Lohan, Silke; Brancati, Francesco; Koll, Randi; Brehm, Anja; Seemann, Petra; Dathe, Katarina; Stricker, Sigmar; Hecht, Jochen; Bosse, Kristin; Betz, Regina C; Garaci, Francesco Giuseppe; Dallapiccola, Bruno; Jain, Mahim; Muenke, Maximilian; Ng, Vivian C W; Chan, Wilson; Chan, Danny; Mundlos, Stefan
2011-01-07
Indian hedgehog (IHH) is a secreted signaling molecule of the hedgehog family known to play important roles in the regulation of chondrocyte differentiation, cortical bone formation, and the development of joints. Here, we describe that copy-number variations of the IHH locus involving conserved noncoding elements (CNEs) are associated with syndactyly and craniosynostosis. These CNEs are able to drive reporter gene expression in a pattern highly similar to wild-type Ihh expression. We postulate that the observed duplications lead to a misexpression and/or overexpression of IHH and by this affect the complex regulatory signaling network during digit and skull development.
Directory of Open Access Journals (Sweden)
Mill José Geraldo
1997-01-01
Full Text Available OBJETIVO: Determinar as alterações de atividade da enzima conversora de angiotensina (ECA no coração com infarto do miocárdio (IM e comparar os efeitos do captopril e losartan em parâmetros morfológicos e funcionais de ratos com IM. MÉTODOS: O IM foi produzido em ratos Wistar por ligadura de ramos da artéria coronária esquerda. Os controles (Con foram submetidos a uma cirurgia fictícia. Animais com IM e Con foram tratados com captopril (30mg/kg/dia ou losartan (15mg/kg/dia e estudados 30 dias após, determinando-se a atividade da ECA nos ventrículos direito (VD e esquerdo (VE, as alterações hemodinâmicas e as concentrações de hidroxiprolina (OH-Pro e proteína total no VD e VE. RESULTADOS: A atividade da ECA aumentou no VD (+25% e VE (+70% após IM. A maior atividade foi observada na cicatriz fibrótica, onde atingiu cerca de 4,5 vezes a do músculo do VE que sobreviveu ao IM (420±68 vs 94±8nmoles/g/min; P<0,01. O IM determinou aumento da pressão diastólica final e hipertrofia do VD e VE. Captopril e losartan foram igualmente eficazes em atenuar a hipertrofia e o aumento da pré-carga. O captopril também atenuou o aumento de OH-Pro no VD e VE após IM. O IM reduziu a concentração de proteína principalmente no músculo de VE, efeito esse acentuado pelo captopril. CONCLUSÃO: A grande atividade da ECA na cicatriz deve produzir altas concentrações de angiotensina II (AII no sangue que drena da cicatriz. Os efeitos dos inibidores da ECA seriam decorrentes, principalmente, da redução de geração local de AII, e não de aumento de cininas, uma vez que captopril e losartan exerceram efeitos similares no remodelamento pós-infarto.
Lemos-Rodriguez, Ana M; Sreenath, Satyan B; Rawal, Rounak B; Overton, Lewis J; Farzal, Zainab; Zanation, Adam M
2017-03-01
To investigate the extent of carotid artery exposure attained, including the identification of the external carotid branches and lower cranial nerves in five sequential external approaches to the parapharyngeal space, and to provide an anatomical algorithm. Anatomical study. Six latex-injected adult cadaver heads were dissected in five consecutive approaches: transcervical approach with submandibular gland removal, posterior extension of the transcervical approach, transcervical approach with parotidectomy, parotidectomy with lateral mandibulotomy, and parotidectomy with mandibulectomy. The degree of carotid artery exposure attained, external carotid branches, and lower cranial nerves visualized was documented. The transcervical approach exposed 1.5 cm (Standard Deviation (SD) 0.5) of internal carotid artery (ICA) and 1.25 cm (SD 0.25) of external carotid artery (ECA). The superior thyroid and facial arteries and cranial nerve XII and XI were identified. The posterior extension exposed 2.9 cm (SD 0.7) of ICA and 2.7 cm (SD 1.0) of ECA. Occipital and ascending pharyngeal arteries were visualized. The transparotid approach exposed 4.0 cm (SD 1.1) of ICA and 3.98 cm (SD 1.8) of ECA. Lateral mandibulotomy exposed the internal maxillary artery, cranial nerve X, the sympathetic trunk, and 4.6 cm (SD 2.4) of ICA. Mandibulectomy allowed for complete ECA exposure, cranial nerve IX, lingual nerve, and 6.9 cm (SD 1.3) of ICA. Approaches for the parapharyngeal space must be based on anatomic and biological patient factors. This study provides a guide for the skull base surgeon for an extended approach based on the desired anatomic exposure. N/A. Laryngoscope, 127:585-591, 2017. © 2017 The American Laryngological, Rhinological and Otological Society, Inc.
Equal channel angular extrusion of ultra-high molecular weight polyethylene
Energy Technology Data Exchange (ETDEWEB)
Reinitz, Steven D., E-mail: Steven.D.Reinitz.TH@Dartmouth.edu; Engler, Alexander J.; Carlson, Evan M.; Van Citters, Douglas W.
2016-10-01
Ultra-high molecular weight polyethylene (UHMWPE), a common bearing surface in total joint arthroplasty, is subject to material property tradeoffs associated with conventional processing techniques. For orthopaedic applications, radiation-induced cross-linking is used to enhance the wear resistance of the material, but cross-linking also restricts relative chain movement in the amorphous regions and hence decreases toughness. Equal Channel Angular Extrusion (ECAE) is proposed as a novel mechanism by which entanglements can be introduced to the polymer bulk during consolidation, with the aim of imparting the same tribological benefits of conventional processing without complete inhibition of chain motion. ECAE processing at temperatures near the crystalline melt for UHMWPE produces (1) increased entanglements compared to control materials; (2) increasing entanglements with increasing temperature; and (3) mechanical properties between values for untreated polyethylene and for cross-linked polyethylene. These results support additional research in ECAE-processed UHMWPE for joint arthroplasty applications. - Highlights: • A new processing method for ultra-high molecular weight polyethylene is introduced. • The process produces a highly entangled polyethylene material. • Entanglements are hypothesized to enhance the wear resistance of polyethylene. • This process eliminates the trade-off between mechanical and wear properties.
Directory of Open Access Journals (Sweden)
Ali Jahangard
2010-09-01
Full Text Available The purpose of the study was to formulate a model to predict the performance of Iranian high school third-graders on the End of the Course Achievement (ECA tests through their performance on the vocabulary tests, which were administered throughout the course. To meet this end, thirty two learners – aging seventeen to nineteen, all male – participated in the study which took nine months to complete. Their linguistic abilities were approximately at Intermediate-Mid level according to the ACTFL proficiency guidelines (1998. The sampling procedure was the intact group method. 333 lexical items were taught to the learners in the decontextualized paired-associate
translation method. The classes were held two hours a week in a nine-month course of time. Six sets of vocabulary tests were administered and every learner’s average was calculated. The learners’ scores on the ECA tests and their average scores on the vocabulary tests were analyzed through the regression analysis procedure to derive a model that could reliably predict the learners’ ECA scores through their average performance on the vocabulary scores. The analysis yielded the following
formula: (AVERAGE VOCABULARY × 0.713 + 2.871± [3.1].
Zhu, Qing; Riley, William J; Tang, Jinyun
2017-04-01
Terrestrial plants assimilate anthropogenic CO 2 through photosynthesis and synthesizing new tissues. However, sustaining these processes requires plants to compete with microbes for soil nutrients, which therefore calls for an appropriate understanding and modeling of nutrient competition mechanisms in Earth System Models (ESMs). Here, we survey existing plant-microbe competition theories and their implementations in ESMs. We found no consensus regarding the representation of nutrient competition and that observational and theoretical support for current implementations are weak. To reconcile this situation, we applied the Equilibrium Chemistry Approximation (ECA) theory to plant-microbe nitrogen competition in a detailed grassland 15 N tracer study and found that competition theories in current ESMs fail to capture observed patterns and the ECA prediction simplifies the complex nature of nutrient competition and quantitatively matches the 15 N observations. Since plant carbon dynamics are strongly modulated by soil nutrient acquisition, we conclude that (1) predicted nutrient limitation effects on terrestrial carbon accumulation by existing ESMs may be biased and (2) our ECA-based approach may improve predictions by mechanistically representing plant-microbe nutrient competition. © 2016 by the Ecological Society of America.
Anti-tumor activities of a novel chlorin derivative for photodynamic therapy in vitro and in vivo
Directory of Open Access Journals (Sweden)
Li-Jun Zhang
2015-01-01
Full Text Available In this study, a novel photosensitizer meso-tetra (3-pyrrolidinomethyl-4-methoxyphenyl chlorin (TPMC was reported. It displays a characteristic long wavelength absorption peak at 656 nm and it shows a singlet oxygen quantum yield of 0.48. After light irradiation with 650 nm laser, it can kill Eca-109 and SMMC-7721 cells in vitro (25 mW/cm2, 1.2 to 3.6 J/cm2 and destroy Eca-109 tumor in nude mice (50 mW/cm2, 90 J/cm2. It has the perspective to be developed as a new anti-tumor drug in photodynamic therapy (PDT photodiagnosis, and deserves further investigation.
EUSO-BALLOON a pathfinder for detecting UHECR's from the edge of space
Directory of Open Access Journals (Sweden)
Scotti V.
2013-06-01
Full Text Available EUSO-Balloon has been conceived as a pathfinder mission for JEM-EUSO, to perform an end-to-end test of the subsystems and components, and to prove the global detection chain while improving our knowledge of the atmospheric and terrestrial UV background. Through a series of stratospheric balloon flights performed by the French Space Agency CNES, EUSO-BALLOON will serve as an evolutive test-bench for all the key technologies of JEM-EUSO. EUSO-Balloon also has the potential to detect Extensive Air Showers from above, marking a key milestone in the development of UHECR science, and paving the way for any future large scale, space-based UHECR observatory.
Evaluation and significance of hyperchromatic crowded groups (HCG in liquid-based paps
Directory of Open Access Journals (Sweden)
Chivukula Mamatha
2007-01-01
Full Text Available Abstract Objective Hyperchromatic crowded groups (HCG, a term first introduced into the cytology literature by DeMay in 1995, are commonly observed in Pap tests and may rarely be associated with serious but difficult to interpret lesions. In this study, we specifically defined HCG as dark crowded cell groups with more than 15 cells which can be identified at 10× screening magnification. Methods We evaluated consecutive liquid-based (Surepath Pap tests from 601 women (age 17–74 years, mean age 29.4 yrs and observed HCG in 477 cases. In all 477 HCG cases, Pap tests were found to be satisfactory and to contain an endocervical sample. HCG were easily detectible at 10× screening magnification (size up to 400 um, mean 239.5 um and ranged from 1 to 50 (mean 19.5 per Pap slide. Results HCG predominantly represented 3-Dimensional groups of endocervical cells with some nuclear overlap (379/477 – 79%, reactive endocervical cells with relatively prominent nucleoli and some nuclear crowding (29/477 – 6%, clusters of inflammatory cells (25/477 – 5.2%, parabasal cells (22/477 – 4.6%, endometrial cells (1/477 – 0.2%. Epithelial cell abnormalities (ECA were present in only 21 of 477 cases (4.6%. 18 of 21 women with HCG-associated ECA were less than 40 years old; only 3 were =/> 40 years. HCG-associated final abnormal Pap test interpretations were as follows: ASCUS (6/21 – 28%, LSIL (12/21 – 57%, ASC-H (2/21 – 9.5%, and HSIL/CIN2-3 (3/21 – 14%. The association of HCG with ECA was statistically significant (p = 0.0174. chi-square test. In patients with ECA, biopsy results were available in 10 cases, and 4 cases of biopsy-proven CIN2/3 were detected. Among these four cases, HCG in the Pap tests, in retrospect represented the lesional high grade cells in three cases (one HSIL case and two ASC-H cases. Interestingly, none of the 124 cases without HCG were found to have an epithelial cell abnormality. Conclusion We conclude: a. HCG are observed
Directory of Open Access Journals (Sweden)
Miris Dikmen
2006-06-01
Full Text Available Stroke is a multifactorial disease in which genetic factors play an important role. This study was carried out to determine angiotensin-converting enzyme (ACE gene polymorphism in Turkish acute stroke patients and to establish whether there is an association of angiotensin-converting enzyme gene I/D polymorphism with clinical parameters. In this study 185 patients and 50 controls were recruited. We have investigated the association among the allelic distribution of the insertion/deletion (I/D polymorphism of the ACE gene identified by polymerase chain reaction. Distribution of ACE gene I/D genotypes and allele frequencies in patients were not significantly different from controls. D allele frequencies were 57.8% in patients versus 53.0% in controls and I allele 42.2% versus 47% respectively. History of hypertension, stroke, renal, heart and vessel diseases incidence and age, gender, systolic-diastolic blood pressures and creatinine levels were significantly high in patients. But these results and ACE activities had no significant differences among the ACE genotypes in patients and controls. Our results suggest that the ACE gene polymorphism is not associated with the pathogenesis of stroke in Turkish stroke patients.O acidente vascular cerebral (AVC é doença multifatorial em que fatores genéticos desempenham papel importante. Este estudo foi desenvolvido para verificar o polimorfismo do gene da enzima conversora da angiotensina (ECA em pacientes turcos com AVC agudo e estabelecer se existe associação do gene I/D da ECA com parâmetros clínicos. O estudo foi realizado com 185 pacientes e 50 controles. A associação entre a distribuição alélica da inserção / deleção (I/D do polimorfismo do gene da ECA foi estudada pela reação em cadeia da polimerase. A distribuição dos genótipos I/D do gene da ECA e suas freqüências não apresentaram significância estatística quando comparados os pacientes e controles. As freqüências dos
Zhang, Zhongying; Fang, Xianghua; Hua, Yang; Liu, Beibei; Ji, Xunming; Tang, Zhe; Wang, Chunxiu; Guan, Shaochen; Wu, Xiaoguang; Liu, Hongjun; Gu, Xiang
2016-05-01
To examine the individual effect of elevated homocysteine and its combined effect with hypertension on early carotid artery atherosclerosis (ECAS). We recruited 1257 subjects from a community-based population in Beijing, China, aged 55 years and older. The definition of hyperhomocysteinemia was referred to as the presence of homocysteine concentrations greater than 15 µmol/L. Carotid intima-media thickness (CIMT), plaque, the sum of plaque thickness (plaque score, PS), and plaque location in common carotid artery were established by ultrasonography. The presence of increased CIMT (≥1.0 mm) and plaque was defined as ECAS. Age, sex, smoking, alcohol drinking, physical activity, total cholesterol, glucose, estimated glomerular filtration rate, hypoglycemic therapy, and lipid-lowering therapy were adjusted by logistic regression analysis. After adjustments for all potential confounders, the risks of presence of plaque, bilateral plaque, and high PS were significantly higher in the group with hyperhomocysteinemia as compared with reference group (the normal homocysteine and normotensive). The odds ratios (ORs) were 1.56 for presence of plaque (95% CI 1.05-2.33), 1.80 for bilateral plaque (95% CI 1.08-2.99), and 1.90 for high PS (95% CI 1.09-3.30), respectively. The group with both hyperhomocysteinemia and hypertension manifested the highest ORs of ECAS. The fully adjusted ORs were 1.67 for increased CIMT (95% CI 1.15-2.42), 2.48 for bilateral plaques (95% CI 1.54-3.99), and 2.69 for high PS (95% CI 1.61-4.47), correspondingly. Elevated homocysteine had a mild-to-moderate independent effect on ECAS. Combined with hypertension, hyperhomocysteinemia might increase the strength of the above-mentioned effects. Copyright © 2016 National Stroke Association. Published by Elsevier Inc. All rights reserved.
Sivrikoz, Emre; Timirci-Kahraman, Özlem; Ergen, Arzu; Zeybek, Ümit; Aksoy, Murat; Yanar, Fatih; İsbir, Turgay; Kurtoğlu, Mehmet
2015-01-01
The purpose of this study was to investigate the gene expression levels of elastin and fibulin-5 according to differences between carotid plaque regions and to correlate it with clinical features of plaque destabilization. The study included 44 endarterectomy specimens available from operated symptomatic carotid artery stenoses. The specimens were separated according to anatomic location: internal carotid artery (ICA), external carotid artery (ECA) and common carotid artery (CCA), and then stored in liquid nitrogen. The amounts of cDNA for elastin and fibulin-5 were determined by Quantitative real-time PCR (Q-RT-PCR). Target gene copy numbers were normalized using hypoxanthine-guanine phosphoribosyltransferase (HPRT1) gene. The delta-delta CT method was applied for relative quantification. Q-RT-PCR data showed that relative fibulin-5 gene expression was increased in ICA plaque regions when compared to CCA regions but not reaching significance (p=0.061). At the same time, no differences were observed in elastin mRNA level between different anatomic plaque regions (p>0.05). Moreover, elastin and fibulin-5 mRNA expression and clinical parameters were compared in ICA plaques versus CCA and ECA regions, respectively. Up-regulation of elastin and fibulin-5 mRNA levels in ICA were strongly correlated with family history of cardiovascular disease when compared to CCA (p<0.05). Up-regulation of fibulin-5 in ICA was significantly associated with diabetes, and elevated triglycerides and very low density lipoprotein (VLDL) when compared to ECA (p<0.05). The clinical significance is the differences between the proximal and distal regions of the lesion, associated with the ICA, CCA and ECA respectively, with increased fibulin-5 in the ICA region. Copyright © 2015 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.
The anti-esophageal cancer cell activity by a novel tyrosine/phosphoinositide kinase inhibitor PP121
Energy Technology Data Exchange (ETDEWEB)
Peng, Yi; Zhou, Yajuan [Department of Radiation and Medical Oncology, Hubei Key Laboratory of Tumor Biological Behaviors, Zhongnan Hospital of Wuhan University, Wuhan 430071 (China); Department of Radiation Oncology, Hubei Cancer Hospital, Wuhan 430071 (China); Cheng, Long [Department of Interventional Radiology, the Second Affiliated Hospital of Soochow University, Soochow University, Suzhou 215001 (China); Hu, Desheng; Zhou, Xiaoyi; Wang, Zhaohua [Department of Radiation Oncology, Hubei Cancer Hospital, Wuhan 430071 (China); Xie, Conghua, E-mail: chxie_65@hotmail.com [Department of Radiation and Medical Oncology, Hubei Key Laboratory of Tumor Biological Behaviors, Zhongnan Hospital of Wuhan University, Wuhan 430071 (China); Zhou, Fuxiang, E-mail: ZhouFuxiangwuhan@126.com [Department of Radiation and Medical Oncology, Hubei Key Laboratory of Tumor Biological Behaviors, Zhongnan Hospital of Wuhan University, Wuhan 430071 (China)
2015-09-11
Here we explored the potential effect of PP121, a novel dual inhibitor of tyrosine and phosphoinositide kinases, against human esophageal cancer cells. We showed that PP121 exerted potent cytotoxic effect in primary (patient-derived) and established (Eca-109, TE-1 and TE-3 lines) esophageal cancer cells, possibly through activating caspase-3-dependnent apoptosis. PP121 was, however, non-cytotoxic to the normal human esophageal epithelial cells (EECs). At the molecular level, we showed that PP121 blocked Akt-mTOR (mammalian target of rapamycin) activation in esophageal cancer cells, which was restored by introducing a constitutively-active Akt (CA-Akt). Yet, CA-Akt only partly inhibited cytotoxicity by PP121 in Eca-109 cells. Importantly, we showed that PP121 inhibited nuclear factor kappa B (NFκB) signaling activation in esophageal cancer cells, which appeared independent of Akt-mTOR blockage. In vivo, oral administration of PP121 remarkably inhibited Eca-109 xenograft growth in nude mice, and significantly improved mice survival. Further, the immunohistochemistry (IHC) and Western blot assays analyzing xenografted tumors showed that PP121 inhibited Akt-mTOR and NFκB activations in vivo. Together, we demonstrate that PP121 potently inhibits esophageal cancer cells in vitro and in vivo, possibly through concurrently inhibiting Akt-mTOR and NFκB signalings. - Highlights: • PP121 is cytotoxic against primary and established esophageal cancer cells. • PP121 induces caspase-3-dependnent apoptosis in esophageal cancer cells. • PP121 blocks Akt-mTOR activation in esophageal cancer cells. • PP121 inhibits NFκB activation, independent of Akt-mTOR blockage. • PP121 inhibits Eca-109 xenograft growth and Akt-mTOR/NFκB activation in vivo.
Lessons Learned from Analyses of the Improved TOW Vehicle with Implications for Future Systems
1990-01-01
on ECA on the ITV. This research was de - signed to identify the source of the discrepancy between the ECA and other source data, and to determine ways...not to prevent the transfer of bad ideas (and MANPRINT costs ) from system to system, but to facilitate the transfer of good ideas (and MANPRINT savings...AVERAGE PP 1 2 1.50 4 5 4.00 2.33 TIpo 1 1 1.00 2 5 2.00 1.33 FR 3 4 3.50 4 5 4.00 3.67 TLD 1 1 1.00 2 5 2.00 1.33 TT 1 1 1.00 2 5 2.00 1.33 DR 1 5
Antiviral activity of Ecasol against feline calicivirus, a surrogate of human norovirus
Directory of Open Access Journals (Sweden)
Yogesh Chander
2012-12-01
Full Text Available Summary: Human norovirus (NoV is a major cause of acute gastroenteritis in closed settings such as hospitals, hotels and cruise ships. The virus survives on inanimate surfaces for extended periods of time, and environmental contamination has been implicated in its transmission. The disinfection of contaminated areas is important in controlling the spread of NoV infections. Neutral solutions of electrochemically activated (ECA-anolyte have been shown to be powerful disinfectants against a broad range of bacterial pathogens. The active chemical ingredient is hypochlorous acid (HOCl, which is registered as an approved food contact surface sanitizer in the United States by the Environmental Protection Agency, pursuant to 40 CFR 180.940. We evaluated the antiviral activity of Ecasol (an ECA-anolyte against feline calicivirus (FCV, a surrogate of NoV. FCV dried on plastic surfaces was exposed to Ecasol for 1, 2, or 5 min. After exposure to Ecasol, the virus titers were compared with untreated controls to determine the virus inactivation efficacy after different contact times. Ecasol was found to decrease the FCV titer by >5 log10 within 1 min of contact, indicating its suitability for inactivation of NoV on surfaces. Keywords: Ecasol, ECA-anolyte, Trustwater, Electrochemical activation, Norovirus, Feline calicivirus, Fomites
Towards a Collision-Free WLAN: Dynamic Parameter Adjustment in CSMA/E2CA
Directory of Open Access Journals (Sweden)
Bellalta Boris
2011-01-01
Full Text Available Carrier sense multiple access with enhanced collision avoidance (CSMA/ECA is a distributed MAC protocol that allows collision-free access to the medium in WLANs. The only difference between CSMA/ECA and the well-known CSMA/CA is that the former uses a deterministic backoff after successful transmissions. Collision-free operation is reached after a transient state during which some collisions may occur. This paper shows that the duration of the transient state can be shortened by appropriately setting the contention parameters. Standard absorbing Markov chain theory is used to describe the behaviour of the system in the transient state and to predict the expected number of slots to reach the collision-free operation. The paper also introduces CSMA/E2CA, in which a deterministic backoff is used two consecutive times after a successful transmission. CSMA/E2CA converges quicker to collision-free operation and delivers higher performance than CSMA/ECA, specially in harsh wireless scenarios with high frame-error rates. The last part of the paper addresses scenarios with a large number of contenders. We suggest dynamic parameter adjustment techniques to accommodate a varying (and potentially high number of contenders. The effectiveness of these adjustments in preventing collisions is validated by means of simulation.
Testing Times for the Implementation of Curriculum Change
Directory of Open Access Journals (Sweden)
Judy Smeed
2015-04-01
Full Text Available School curriculum change processes have traditionally been managed internally. However, in Queensland, Australia, as a response to the current high-stakes accountability regime, more and more principals are outsourcing this work to external change agents (ECAs. In 2009, one of the authors (a university lecturer and ECA developed a curriculum change model (the Controlled Rapid Approach to Curriculum Change [CRACC], specifically outlining the involvement of an ECA in the initiation phase of a school’s curriculum change process. The purpose of this article is to extend the CRACC model by unpacking the implementation phase, drawing on data from a pilot study of a single school. Interview responses revealed that during the implementation phase, teachers wanted to be kept informed of the wider educational context, use data to constantly track students, relate pedagogical practices to testing practices, share information between departments and professional levels, and own whole school performance. It is suggested that the findings would be transferable to other school settings and internal leadership of curriculum change. The article also strikes a chord of concern: Do the responses from teachers operating under thecurrent accountability regime live their professional lives within this corporate and globalized ideology whether they want to or not?
Treasure Your Exceptions: An Interview with 2017 George Beadle Award Recipient Susan A. Gerbi.
Gerbi, Susan A
2017-12-01
THE Genetics Society of America's (GSA) George W. Beadle Award honors individuals who have made outstanding contributions to the community of genetics researchers and who exemplify the qualities of its namesake. The 2017 recipient is Susan A. Gerbi, who has been a prominent leader and advocate for the scientific community. In the course of her research on DNA replication, Gerbi helped develop the method of Replication Initiation Point (RIP) mapping to map replication origins at the nucleotide level, improving resolution by two orders of magnitude. RIP mapping also provides the basis for the now popular use of λ-exonuclease to enrich nascent DNA to map replication origins genome-wide. Gerbi's second area of research on ribosomal RNA revealed a conserved core secondary structure, as well as conserved nucleotide elements (CNEs). Some CNEs are universally conserved, while other CNEs are conserved in all eukaryotes but not in archaea or bacteria, suggesting a eukaryotic function. Intriguingly, the majority of the eukaryotic-specific CNEs line the tunnel of the large ribosomal subunit through which the nascent polypeptide exits. Gerbi has promoted the fly Sciara coprophila as a model organism ever since she used its enormous polytene chromosomes to help develop the method of in situ hybridization during her Ph.D. research in Joe Gall's laboratory. The Gerbi laboratory maintains the Sciara International Stock Center and manages its future, actively spreading Sciara stocks to other laboratories. Gerbi has also served in many leadership roles, working on issues of science policy, women in science, scientific training, and career preparation. This is an abridged version of the interview. The full interview is available on the Genes to Genomes blog, at genestogenomes.org/gerbi. Copyright © 2017 by the Genetics Society of America.
Precision orbit determination performance for CryoSat-2
Schrama, Ernst
2018-01-01
In this paper we discuss our efforts to perform precision orbit determination (POD) of CryoSat-2 which depends on Doppler and satellite laser ranging tracking data. A dynamic orbit model is set-up and the residuals between the model and the tracking data is evaluated. The average r.m.s. of the 10 s averaged Doppler tracking pass residuals is approximately 0.39 mm/s; and the average of the laser tracking pass residuals becomes 1.42 cm. There are a number of other tests to verify the quality of the orbit solution, we compare our computed orbits against three independent external trajectories provided by the CNES. The CNES products are part of the CryoSat-2 products distributed by ESA. The radial differences of our solution relative to the CNES precision orbits shows an average r.m.s. of 1.25 cm between Jun-2010 and Apr-2017. The SIRAL altimeter crossover difference statistics demonstrate that the quality of our orbit solution is comparable to that of the POE solution computed by the CNES. In this paper we will discuss three important changes in our POD activities that have brought the orbit performance to this level. The improvements concern the way we implement temporal gravity accelerations observed by GRACE; the implementation of ITRF2014 coordinates and velocities for the DORIS beacons and the SLR tracking sites. We also discuss an adjustment of the SLR retroreflector position within the satellite reference frame. An unexpected result is that we find a systematic difference between the median of the 10 s Doppler tracking residuals which displays a statistically significant pattern in the South Atlantic Anomaly (SSA) area where the median of the velocity residuals varies in the range of -0.15 to +0.15 mm/s.
2D Sub-Pixel Disparity Measurement Using QPEC / Medicis
Directory of Open Access Journals (Sweden)
M. Cournet
2016-06-01
Full Text Available In the frame of its earth observation missions, CNES created a library called QPEC, and one of its launcher called Medicis. QPEC / Medicis is a sub-pixel two-dimensional stereo matching algorithm that works on an image pair. This tool is a block matching algorithm, which means that it is based on a local method. Moreover it does not regularize the results found. It proposes several matching costs, such as the Zero mean Normalised Cross-Correlation or statistical measures (the Mutual Information being one of them, and different match validation flags. QPEC / Medicis is able to compute a two-dimensional dense disparity map with a subpixel precision. Hence, it is more versatile than disparity estimation methods found in computer vision literature, which often assume an epipolar geometry. CNES uses Medicis, among other applications, during the in-orbit image quality commissioning of earth observation satellites. For instance the Pléiades-HR 1A & 1B and the Sentinel-2 geometric calibrations are based on this block matching algorithm. Over the years, it has become a common tool in ground segments for in-flight monitoring purposes. For these two kinds of applications, the two-dimensional search and the local sub-pixel measure without regularization can be essential. This tool is also used to generate automatic digital elevation models, for which it was not initially dedicated. This paper deals with the QPEC / Medicis algorithm. It also presents some of its CNES applications (in-orbit commissioning, in flight monitoring or digital elevation model generation. Medicis software is distributed outside the CNES as well. This paper finally describes some of these external applications using Medicis, such as ground displacement measurement, or intra-oral scanner in the dental domain.
Simulation of Telescope Detectivity for Geo Survey and Tracking
Richard, P.
2014-09-01
As the number of space debris on Earths Orbit increases steadily, the need to survey, track and catalogue them becomes of key importance. In this context, CNES has been using the TAROT Telescopes (Rapid Telescopes for Transient Objects owned and operated by CNRS) for several years to conduct studies about space surveillance and tracking. Today, two testbeds of services using the TAROT telescopes are running every night: one for GEO situational awareness and the second for debris tracking. Additionally to the CNES research activity on space surveillance and tracking domain, an operational collision avoidance service for LEO and GEO satellites is in place at CNES for several years. This service named CAESAR (Conjunction Analysis and Evaluation: Alerts and Recommendations) is used by CNES as well as by external customers. As the optical debris tracking testbed based on TAROT telescopes is the first step toward an operational provider of GEO measures that could be used by CAESAR, simulations have been done to help choosing the sites and types of telescopes that could be added in the GEO survey and debris tracking telescope network. One of the distinctive characteristics of the optical observation of space debris compared to traditional astronomic observation is the need to observe objects at low elevations. The two mains reasons for this are the need to observe the GEO belt from non-equatorial sites and the need to observe debris at longitudes far from the telescope longitude. This paper presents the results of simulations of the detectivity for GEO debris of various telescopes and sites, based on models of the GEO belt, the atmosphere and the instruments. One of the conclusions is that clever detection of faint streaks and spread sources by image processing is one of the major keys to improve the detection of debris on the GEO belt.
Preop endovascular embolization in juvenile nasal angiofibroma management
Directory of Open Access Journals (Sweden)
M. V. Nersesyan
2018-01-01
Full Text Available Introduction. Juvenile nasal angiofibroma (JNA is an aggressively expanding fibro-vascular benign tumor, which occurs in male adolescents. Surgical management of JNA is considered as one of the most difficult in rhinology, because it very often has accompanied with profuse, streaming bleeding. Endovascular embolization has successfully used for reducing the operative blood loss since 2000th. Nevertheless, there is no consensus in the literature about its expediently using because of complications, which may occur.Objective is to evaluate the effectiveness of selective angiography and endovascular embolization in reducing bleeding when removal of JNA of different stages.Materials and methods. In the N.N. Burdenko National Medical Research Center of Neurosurgery 134 patients with JNA had been treated surgically.Results. 110 patients with JNA, who underwent embolization, managed to perform total, subtotal or partial devascularization of the tumor. Total devascularization was achieved in JNA blood supply variant only from the external carotid artery (ECA system from 1 or 2 sides (in primary patients or in patients who had not previously been embolized (n = 39; subtotal devascularization, if the blood supply was carried out from the ECA system, internal carotid artery (ICA on the 1 side (n = 52 and partial, if there was blood supply from the ECA and significant from the ICA system from 2 sides (in patients with relapse after previous embolization with microspirals or the ECA ligations from 1 or 2 sides, as well as with giant JNA (n = 19. Since the vast majority of patients admitted to our clinic were previously operated on, and JNA blood supply in relapses was more pronounced, we performed the comparison of the degree of tumor devascularization depending on its blood supply in primary patients and patients with relapse. It turned out, as could be expected, that with the primary JNA often managed to execute a total devascularization than with JNA
Nicol, Patrick; Fleury, Joel; Le Naour, Claire; Bernard, Frédéric
2017-11-01
IASI (Infrared Atmospheric Sounding Interferometer) is an infrared atmospheric sounder. It will provide meteorologist and scientific community with atmospheric spectra. The instrument is composed of a Fourier transform spectrometer and an associated infrared imager. The presentation will describe the spectrometer detection chain architecture, composed by three different detectors cooled in a passive cryo-cooler (so called CBS : Cold Box Subsystem) and associated analog electronics up to digital conversion. It will mainly focus on design choices with regards to environment constraints, implemented technologies, and associated performances. CNES is leading the IASI program in collaboration with EUMETSAT. The instrument Prime is ALCATEL SPACE responsible, notably, of the detection chain architecture. SAGEM SA provides the detector package (so called CAU : Cold Acquisition Unit).
Worldwide Environmental Compliance Assessment System (ECAS)
1993-03-01
may greater, it was flushed prior to disposal with a solvent containing less be disposed of as munici- than 50 ppm PCB. ( 1X2X3 ) pal solid waste if...material or proper warning signs and fences are installed and maintained as follows: ( 1X2X3 ) - warning signs are displayed at all entrances at intervals...greater than ,4 pC/L. ( 1X2X3 ) and 3 structures if the ini- tial phase measurement of Priority 1 structures indi- cated radon concentra- tions greater
Environmental Compliance Assessment System (USA ECAS)
1991-09-01
ing. _"d’iliza kin, mid S u,, (T)VIMSEC (13)..ng r.., Pan, and svi,,a (0P&) (14) w-atcwaa- raman Plnt .... mso ( ... ~O (15) l.and managemnt .nom...sulfate 100 7786-81-4 Nickel 10,000" 100 x 7440-02-0 Nicotine sulfate 100/10,000 65-30-5 Nicotine 100 100 P075 54-11-5 Nitric acid 1,000 1000 x 7697-37-2...facilities, or features (b) surface or subsurface artifact concentrations or scatters (c) whole or fragmentary tools, implements, containers, weapons and
Conduction cooled compact laser for chemcam instrument
Faure, B.; Saccoccio, M.; Maurice, S.; Durand, E.; Derycke, C.
2017-11-01
A new conduction cooled compact laser for Laser Induced Breakdown Spectroscopy (LIBS) on Mars is presented. The laser provides pulses with energy higher than 30mJ at 1μm of wavelength with a good spatial quality. Three development prototypes of this laser have been built and functional and environmental tests have been done. Then, the Qualification and Flight models have been developed and delivered. A spare model is now developed. This laser will be mounted on the ChemCam Instrument of the NASA mission MSL 2009. ChemCam Instrument is developed in collaboration between France (CESR and CNES) and USA (LANL). The goal of this Instrument is to study the chemical composition of Martian rocks. A laser source (subject of this presentation) emits a pulse which is focused by a telescope. It creates a luminous plasma on the rock; the light of this plasma is then analysed by three spectrometers to obtain information on the composition of the rock. The laser source is developed by the French company Thales Laser, with a technical support from CNES and CESR. This development is funded by CNES. The laser is compact, designed to work in burst mode. It doesn't require any active cooling.
Photon technology. Hard photon technology; Photon technology. Hard photon gijutsu
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
Research results of hard photon technology have been summarized as a part of novel technology development highly utilizing the quantum nature of photon. Hard photon technology refers to photon beam technologies which use photon in the 0.1 to 200 nm wavelength region. Hard photon has not been used in industry due to the lack of suitable photon sources and optical devices. However, hard photon in this wavelength region is expected to bring about innovations in such areas as ultrafine processing and material synthesis due to its atom selective reaction, inner shell excitation reaction, and spatially high resolution. Then, technological themes and possibility have been surveyed. Although there are principle proposes and their verification of individual technologies for the technologies of hard photon generation, regulation and utilization, they are still far from the practical applications. For the photon source technology, the laser diode pumped driver laser technology, laser plasma photon source technology, synchrotron radiation photon source technology, and vacuum ultraviolet photon source technology are presented. For the optical device technology, the multi-layer film technology for beam mirrors and the non-spherical lens processing technology are introduced. Also are described the reduction lithography technology, hard photon excitation process, and methods of analysis and measurement. 430 refs., 165 figs., 23 tabs.
40 CFR 80.503-80.509 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel General Information §§ 80.503-80.509 [Reserved] ...
ORF Alignment: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available osamine -2-epimerase; synthesis of enterobacterial ... common antigen (ECA) [Escherichia coli K12] ... ... ... gb|AAT48211.1| UDP-N-acetyl glucosamine -2-epimerase; ... synthesis of enterobacterial commo
National Aeronautics and Space Administration — The Doppler Orbitography by Radiopositioning Integrated on Satellite (DORIS) was developed by the Centre National d'Etudes Spatiales (CNES) with cooperation from...
National Aeronautics and Space Administration — The Doppler Orbitography by Radiopositioning Integrated on Satellite (DORIS) was developed by the Centre National d'Etudes Spatiales (CNES) with cooperation from...
A REDUÇÃO DA MAIORIDADE PENAL E A REALIDADE NÃO ENFRENTADA
Directory of Open Access Journals (Sweden)
Lucas Ferreira Furlan
2016-03-01
Full Text Available In this article we presented a study on the current situation surrounding the debate about reducing the legal age in Brazil. Initially it was built a survey about the role of penalties, was later analyzed the current punishments designed smaller in our country as well as the structural problems that have prevented full implementation of ECA the cases it hears, then did an analysis in comparative law regarding the reduction of criminal responsibility, then the study of its unconstitutionality. At the end we present a small change in ECA as a solution to juvenile offenders of high dangerousness, we demonstrate how investments in education are the best alternative to solve the problems and we end with our conclusions on the matter.
Atli, K. C.; Karaman, I.; Noebe, R. D.; Garg, A.; Chumlyakov, Y. I.; Kireeva, I. V.
2011-01-01
A Ti(49.5)Ni25Pd25Sc(0.5) high-temperature shape memory alloy is thermomechanically processed to obtain enhanced shape-memory characteristics: in particular, dimensional stability upon repeated thermal cycles under constant loads. This is accomplished using severe plastic deformation via equal channel angular extrusion (ECAE) and post-processing annealing heat treatments. The results of the thermomechanical experiments reveal that the processed materials display enhanced shape memory response, exhibiting higher recoverable transformation and reduced irrecoverable strain levels upon thermal cycling compared with the unprocessed material. This improvement is attributed to the increased strength and resistance of the material against defect generation upon phase transformation as a result of the microstructural refinement due to the ECAE process, as supported by the electron microscopy observations.
Design, Synthesis and Cytotoxic Activities of Novel Aliphatic Amino-Substituted Flavonoids
Directory of Open Access Journals (Sweden)
Guannan Liu
2013-11-01
Full Text Available A series of flavonoids 9a–f, 13b, 13d, 13e and 14a–f bearing diverse aliphatic amino moieties were designed, synthesized and evaluated for their cytotoxic activities against the ECA-109, A-549, HL-60, and PC-3 cancer cell lines. Most of the compounds exhibited moderate to good activities. The structure-activity relationships were studied, revealing that the chalcone skeleton is the most preferable for cytotoxic activities. Chalcone 9d was the most promising compound due to its high potency against the examined cancer cell lines (its IC50 values against ECA-109, A549, HL-60 and PC-3 cells were 1.0, 1.5, 0.96 and 3.9 μM, respectively.
Infrared detectors for Earth observation
Barnes, K.; Davis, R. P.; Knowles, P.; Shorrocks, N.
2016-05-01
IASI (Infrared Atmospheric Sounding Interferometer), developed by CNES and launched since 2006 on the Metop satellites, is established as a major source of data for atmospheric science and weather prediction. The next generation - IASI NG - is a French national contribution to the Eumetsat Polar System Second Generation on board of the Metop second generation satellites and is under development by Airbus Defence and Space for CNES. The mission aim is to achieve twice the performance of the original IASI instrument in terms of sensitivity and spectral resolution. In turn, this places very demanding requirements on the infrared detectors for the new instrument. Selex ES in Southampton has been selected for the development of the infrared detector set for the IASI-NG instruments. The wide spectral range, 3.6 to 15.5 microns, is covered in four bands, each served by a dedicated detector design, with a common 4 x 4 array format of 1.3 mm square macropixels. Three of the bands up to 8.7 microns employ photovoltaic MCT (mercury cadmium telluride) technology and the very long wave band employs photoconductive MCT, in common with the approach taken between Airbus and Selex ES for the SEVIRI instrument on Second Generation Meteosat. For the photovoltaic detectors, the MCT crystal growth of heterojunction photodiodes is by the MOVPE technique (metal organic vapour phase epitaxy). Novel approaches have been taken to hardening the photovoltaic macropixels against localised crystal defects, and integrating transimpedance amplifiers for each macropixel into a full-custom silicon read out chip, which incorporates radiation hard design.
ORF Alignment: NC_002695 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available yl-D-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacterial common antigen (ECA); ... ... ... UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacter...-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacterial com
ORF Alignment: NC_004337 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available yl-D-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacterial common antigen (ECA); ... ... ... UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacter...-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacterial com
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent
ORF Alignment: NC_004741 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available yl-D-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacterial common antigen (ECA); ... ... ... UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacter...-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacterial com
ORF Alignment: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available yl-D-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacterial common antigen (ECA); ... ... ... UDP-N-acetyl-D-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacter...-mannosaminuronic acid dehydrogenase; ... synthesis of enterobacterial com
40 CFR 80.562-80.569 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Other Hardship Provisions §§ 80.562-80.569 [Reserved] Labeling...
ORF Sequence: NC_000913 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR
Directory of Open Access Journals (Sweden)
Trinidad Delgado-Ruiz
2016-03-01
Full Text Available Antecedentes y Objetivos. La extremidad superior es el área más frecuentemente afectada en las quemaduras eléctricas de alto voltaje, con una alta tasa de amputaciones, síndromes compartimentales y defectos de partes blandas que precisan cobertura. La literatura en cuanto a la cirugía reconstructiva de la mano con quemaduras eléctricas es escasa, pero es fundamental en la fase aguda establecer un plan quirúrgico y una cobertura estable de estos frecuentes defectos en mano y muñeca. Pacientes y Método. Empleamos el colgajo fasciocutáneo dorsal ulnar en 3 pacientes con defectos cutáneos en muñeca secundarios a quemaduras eléctricas de alto voltaje, durante la fase aguda de estas lesiones. Resultados. Obtuvimos en todos los casos una cobertura estable y de alta calidad y sin registrar complicaciones relacionadas con el colgajo o con la zona donante. Conclusiones. Debido a la constancia de su pedículo, la rapidez y seguridad de su disección y la preservación de ambos ejes arteriales, el colgajo fasciocutáneo dorsal ulnar es una herramienta de primer uso en la cobertura de los defectos de la mano y de la muñeca tras quemaduras eléctricas de alto voltaje.
Photon technology. Laser process technology; Photon technology. Laser process gijutsu
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
For developing laser process technology by interaction between substance and photon, the present state, system, R and D issues and proposal of such technology were summarized. Development of the photon technology aims at the modification of bonding conditions of substances by quantum energy of photon, and the new process technology for generating ultra- high temperature and pressure fields by concentrating photon on a minute region. Photon technology contributes to not only the conventional mechanical and thermal forming and removal machining but also function added machining (photon machining) in quantum level and new machining technology ranging from macro- to micro-machining, creating a new industrial field. This technology extends various fields from the basis of physics and chemistry to new bonding technology. Development of a compact high-quality high-power high-efficiency photon source, and advanced photon transmission technology are necessary. The basic explication of an unsolved physicochemical phenomenon related to photon and substance, and development of related application technologies are essential. 328 refs., 147 figs., 13 tabs.
40 CFR 80.537-80.539 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Temporary Compliance Option §§ 80.537-80.539 [Reserved] Geographic Phase...
40 CFR 80.575-80.579 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Labeling Requirements §§ 80.575-80.579 [Reserved] Sampling and Testing ...
40 CFR 80.556-80.559 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Small Refiner Hardship Provisions §§ 80.556-80.559 [Reserved] Other...
40 CFR 80.514-80.519 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel General Information §§ 80.514-80.519 [Reserved] Motor Vehicle Diesel...
40 CFR 80.587-80.589 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Sampling and Testing §§ 80.587-80.589 [Reserved] Recordkeeping and...
40 CFR 80.528-80.529 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Motor Vehicle Diesel Fuel Standards and Requirements §§ 80.528-80.529...
40 CFR 80.541-80.549 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Geographic Phase-in Provisions §§ 80.541-80.549 [Reserved] Small Refiner...
Computing by Temporal Order: Asynchronous Cellular Automata
Directory of Open Access Journals (Sweden)
Michael Vielhaber
2012-08-01
Full Text Available Our concern is the behaviour of the elementary cellular automata with state set 0,1 over the cell set Z/nZ (one-dimensional finite wrap-around case, under all possible update rules (asynchronicity. Over the torus Z/nZ (n<= 11,we will see that the ECA with Wolfram rule 57 maps any v in F_2^n to any w in F_2^n, varying the update rule. We furthermore show that all even (element of the alternating group bijective functions on the set F_2^n = 0,...,2^n-1, can be computed by ECA57, by iterating it a sufficient number of times with varying update rules, at least for n <= 10. We characterize the non-bijective functions computable by asynchronous rules.
AN IMPLEMENTATION OF EIS-SVM CLASSIFIER USING RESEARCH ARTICLES FOR TEXT CLASSIFICATION
Directory of Open Access Journals (Sweden)
B Ramesh
2016-04-01
Full Text Available Automatic text classification is a prominent research topic in text mining. The text pre-processing is a major role in text classifier. The efficiency of pre-processing techniques is increasing the performance of text classifier. In this paper, we are implementing ECAS stemmer, Efficient Instance Selection and Pre-computed Kernel Support Vector Machine for text classification using recent research articles. We are using better pre-processing techniques such as ECAS stemmer to find root word, Efficient Instance Selection for dimensionality reduction of text data and Pre-computed Kernel Support Vector Machine for classification of selected instances. In this experiments were performed on 750 research articles with three classes such as engineering article, medical articles and educational articles. The EIS-SVM classifier provides better performance in real-time research articles classification.
DEFF Research Database (Denmark)
Cochet, C.; Fernandes, E.O.; Jantunen, M.
ECA-IAQ (European Collaborative Action, Urban Air, Indoor Environment and Human Exposure), 2006. Strategies to determine and control the contributions of indoor air pollution to total inhalation exposure (STRATEX), Report No 25. EUR 22503 EN. Luxembourg: Office for Official Publications...... of the European Communities It is now well established that indoor air pollution contributes significantly to the global burden of disease of the population. Therefore, the knowledge of this contribution is essential in view of risk assessment and management. The ECA STRATEX report collates the respective...... information and describes the strategies to determine population exposure to indoor air pollutants. Its major goal is to emphasise the importance of the contribution of indoor air to total air exposure. Taking this contribution into account is a prerequisite for sound risk assessment of air pollution...
Extraction of lithium ion from alkaline aqueous media by a liquid surfactant membrane
International Nuclear Information System (INIS)
Kinugasa, Takumi; Ono, Yuri; Kawamura, Yuko; Watanabe, Kunio; Takeuchi, Hiroshi.
1995-01-01
Extraction of lithium ion from aqueous alkaline media by a liquid surfactant membrane was performed using a mixture of LIX54 and TOPO as the extractant. Stripping of lithium from the kerosene solution to the acid solution was suppressed with increasing content of polyamine (ECA) surfactant. The extraction rate of lithium by the liquid membrane could be interpreted taking account of an interfacial resistance due to ECA. It was confirmed that swelling of the (W/O) emulsion drops by water permeation through the liquid membrane is evaluated in terms of a change in osmotic pressure gradient between the external and internal aqueous phases during the lithium extraction. In the present operation, the extraction ratio of Li + from the external feed and the uptake into the internal phase reached as high as 95%. (author)
International Nuclear Information System (INIS)
Halvorsen, T.; Battrick, B.; Rowley, C.
1978-06-01
The document contains 75 papers presented at the fourth symposium held within the framework of the ESA programme advisory committee on the special project concerning the launching of sounding rockets (PAC), which took place at Ajaccio, Corsica, from 24-29 April 1978. The symposium, organised jointly by the PAC and the Centre national d'etudes spaciales (CNES), was divided into 8 sessions embracing, respectively, a review of the national programmes, magnetospheric physics, launch range presentations, middle-atmosphere physics, astrophysic, material sciences, subsatellites and technology, as relevant to souding-rocket and balloon research. Working groups formed during the symposium formulated proposals to the PAC for new or intensified studies based on coordination of other experiments with EISCAT, optical experiments in connection with range and other experiment, middle-atmosphere programme experiments, and subsatellite experiments
The LAM space active optics facility
Engel, C.; Ferrari, M.; Hugot, E.; Escolle, C.; Bonnefois, A.; Bernot, M.; Bret-Dibat, T.; Carlavan, M.; Falzon, F.; Fusco, T.; Laubier, D.; Liotard, A.; Michau, V.; Mugnier, L.
2017-11-01
The next generation of large lightweight space telescopes will require the use of active optics systems to enhance the performance and increase the spatial resolution. Since almost 10 years now, LAM, CNES, THALES and ONERA conjugate their experience and efforts for the development of space active optics through the validation of key technological building blocks: correcting devices, metrology components and control strategies. This article presents the work done so far on active correcting mirrors and wave front sensing, as well as all the facilities implemented. The last part of this paper focuses on the merging of the MADRAS and RASCASSE test-set up. This unique combination will provide to the active optics community an automated, flexible and versatile facility able to feed and characterise space active optics components.
Voices of chief nursing executives informing a doctor of nursing practice program.
Embree, Jennifer L; Meek, Julie; Ebright, Patricia
The purpose of this article is to describe the business case framework used to guide doctor of nursing practice (DNP) program enhancements and to discuss methods used to gain chief nurse executives' (CNEs) perspectives for desired curricular and experiential content for doctor of nursing practice nurses in health care system executive roles. Principal results of CNE interview responses were closely aligned to the knowledge, skills and/or attitudes identified by the national leadership organizations. Major conclusions of this article are that curriculum change should include increased emphasis on leadership, implementation science, and translation of evidence into practice methods. Business, information and technology management, policy, and health care law content would also need to be re-balanced to facilitate DNP graduates' health care system level practice. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Teresa Flórez-Peña
2010-08-01
Full Text Available El objetivo de la investigación fue determinar los factores de calidad presentes en las facultades de Derecho colombianas que han obtenido alto rendimiento en cinco aplicaciones consecutivas del examen de calidad de la educación superior (ECAES. A partir de tres criterios de selección se configuró la población, que se categorizó en tres auditorios: profesores, estudiantes y directivos, a los que se aplicó un instrumento tipo encuesta y una entrevista individual semiestructurada. Se realizó un análisis cualitativo de los instrumentos, según frecuencia y amplitud de respuesta. Entre los principales hallazgos se destaca que uno de los factores más relacionados con los buenos resultados en la facultades estudiadas es el alto nivel académico y pedagógico de los profesores, que se refleja en los modos como desarrollan sus clases, en su mayoría de tipo magistral y de análisis de jurisprudencia. Y como factor no relacionado se encontró, entre otros, el tamaño de la facultad y el número de estudiantes que presenta al examen ECAES.O objetivo deste trabalho foi determinar os fatores de qualidade presentes em faculdades de direito colombianas com alta performance em cinco aplicações sucessivas do exame de qualidade do ensino superior (ECAES. A população foi constituída com base em três critérios de seleção: alunos, professores e gestores, aos quais foi aplicado um questionário e uma entrevista individual semi-estruturada. Foi realizada uma análise qualitativa dos instrumentos, de acordo com a freqüência e amplitude da resposta. Entre os principais resultados destacaram que um dos fatores associados com bons resultados em todas as escolas estudadas é o elevado nível acadêmico e pedagógico dos professores, refletido na maneira de desenvolver as suas aulas, de tipo magistral e análise do caso. Como fator não-relacionado foi encontrado, entre outros, o tamanho da faculdade e o número de alunos que apresentam o teste ECAES
Directory of Open Access Journals (Sweden)
Durán-García Martín Enrique
2014-07-01
Full Text Available Currently the transfer of chemical technology is a process that contributes to the technology policy of a country, an industry or an organization in general chemistry. This process requires the application of clear criteria for the proper development of the complex interrelations in the transfer of chemical technology. A group of criteria that are present, are those related to environmental technology which intrinsically define the technology and its impact to the environment. Therefore, the transfer of chemical technology requires technological-environmental criteria defining, in conjunction with other criteria, an adequate process for the selection, acquisition and incorporation of technology in a holistic perspective, so it provides feasible solutions the chemical industry in pursuit of their goals. Then the criterion becomes a benchmark for assessing an appropriate technology transfer process. We performed a theoretical analysis of the technological and environmental criteria, proposing thirty-six (36 technological-environmental criteria interrelated under a systemic approach in the process of transfer of chemical technology, focused on a methodological cycle first run, based primarily on the research-action method. Future research is expected to make a refinement of the criteria from the formulation and validation of metrics so that necessary adjustments are made to optimize the process of transfer of chemical technology.
1,1,2-Trichloroethane (TCE); Final Enforceable Consent Agreement and Testing Consent Order
EPA has issued an enforceable consent agreement (ECA) with The Dow Chemical Company; Vulcan Materials Company; Occidental Chemical Corp; Oxy Vinyls, LP; Georgia Gulf Corp; Westlake Chemical Corp; PPG, Borden Chemicals & Plastics, and Formosa Plastics.
ORF Sequence: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent
ORF Sequence: NC_002655 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA
Morgantown Energy Technology Center, technology summary
International Nuclear Information System (INIS)
1994-06-01
This document has been prepared by the DOE Environmental Management (EM) Office of Technology Development (OTD) to highlight its research, development, demonstration, testing, and evaluation activities funded through the Morgantown Energy Technology Center (METC). Technologies and processes described have the potential to enhance DOE's cleanup and waste management efforts, as well as improve US industry's competitiveness in global environmental markets. METC's R ampersand D programs are focused on commercialization of technologies that will be carried out in the private sector. META has solicited two PRDAs for EM. The first, in the area of groundwater and soil technologies, resulted in twenty-one contact awards to private sector and university technology developers. The second PRDA solicited novel decontamination and decommissioning technologies and resulted in eighteen contract awards. In addition to the PRDAs, METC solicited the first EM ROA in 1993. The ROA solicited research in a broad range of EM-related topics including in situ remediation, characterization, sensors, and monitoring technologies, efficient separation technologies, mixed waste treatment technologies, and robotics. This document describes these technology development activities
Energy Technology Data Exchange (ETDEWEB)
NONE
2001-03-01
This project is aimed at construction of the intellectual infrastructures for biotechnologies, in order to accelerate development of the Japanese technologies and activate their application to industries. Described herein are the FY 1999 results. These infrastructures are for functional analysis of protein which will be one of the key issues in genome analysis, and collection and analysis of biological information. This project includes a total of 9 research and development themes for four research categories: frequency analysis of gene expression (development of the gene expression profile database system for functional analysis of human genome, and analysis of the gene expression and protein functions by the ECA chip technology), function analysis by the biological model (high-performance analysis by the bio-project, database system for drug metabolizing enzymes, analysis of gene functions using mutant mice, and simple genome function analysis of murine individuals using the RNAi effect), protein expression (function validation of unknown human genes based on the useful biological model, and protein function analysis using multi-purpose destination vectors), and protein function prediction by the information science method. (NEDO)
Resistance to Erwinia spp. in potato (Solanum tuberosum L.)
Allefs, S.
1995-01-01
Blackleg is a disease of potato, Solanum tuberosum , which is caused by the bacteria Erwinia carotovora subsp. carotovora ( Ecc ), E.c. subsp. atroseptica ( Eca ) or
Technology round and management of technology
International Nuclear Information System (INIS)
Park, Yong Tae
1994-04-01
This book deals with beginning of technology round with background of it, change of scientific technique paradigm with economy, management and policy, change of international political environment globalization of technical and economic environment, formation of strategic alliance, intensifying regionalism, new GATT system, UR and technology round, new international technique regulation and technology round of OECD, feature and meaning of technology round, assignment and scientific technique of Korea, past and present of scientific technology in Korea, correspondence for technology round.
Directory of Open Access Journals (Sweden)
Ionel BOSTAN
2010-06-01
Full Text Available The European Court of Accounts (ECA is the European Union’s institution, established by treaty, with thepurpose to make the audit of the EU funds. As an external auditor of the European Union, it contributes to improvingthe financial management of the Union, and acts as an independent defender of the financial interests of the Union’scitizens. The ECA provides with audit services, by which it evaluates the collection and use of the EU funds. Also, itexamines if the financial operations were correctly recorded and presented, if they were made respecting the law andthe regulations and managed with respect to the principles of economy, efficacy and efficiency. The ECA makes knownthe results of the audits in clear, relevant and objective reports and gives reports regarding various aspects of financialmanagement, The Court publishes the results of its audit activities in three types of reports: the annual reports,presenting the results of the financial audit activities as insurance declarations concerning the general budget and theEuropean Development Funds. These reports are presented together in the month of November, with the specificannual reports, which present the results of the financial audits made concerning the agencies and organizations of theCommunities. The special reports, reserved for the results of certain performance audits and conformity audits, may bepublished at any time of the year. The present paper analyzes exactly this latter category of reports, made by theinstitution in the recent annual financial statements.
Dittrich, Peter
2018-02-01
The organic code concept and its operationalization by molecular codes have been introduced to study the semiotic nature of living systems. This contribution develops further the idea that the semantic capacity of a physical medium can be measured by assessing its ability to implement a code as a contingent mapping. For demonstration and evaluation, the approach is applied to a formal medium: elementary cellular automata (ECA). The semantic capacity is measured by counting the number of ways codes can be implemented. Additionally, a link to information theory is established by taking multivariate mutual information for quantifying contingency. It is shown how ECAs differ in their semantic capacities, how this is related to various ECA classifications, and how this depends on how a meaning is defined. Interestingly, if the meaning should persist for a certain while, the highest semantic capacity is found in CAs with apparently simple behavior, i.e., the fixed-point and two-cycle class. Synergy as a predictor for a CA's ability to implement codes can only be used if context implementing codes are common. For large context spaces with sparse coding contexts synergy is a weak predictor. Concluding, the approach presented here can distinguish CA-like systems with respect to their ability to implement contingent mappings. Applying this to physical systems appears straight forward and might lead to a novel physical property indicating how suitable a physical medium is to implement a semiotic system. Copyright © 2017 Elsevier B.V. All rights reserved.
SEDHI: a new generation of detection electronics for earth observation satellites
Dantes, Didier; Neveu, Claude; Biffi, Jean-Marc; Devilliers, Christophe; Andre, Serge
2017-11-01
Future earth observation optical systems will be more and more demanding in terms of ground sampling distance, swath width, number of spectral bands, duty cycle. Existing architectures of focal planes and video processing electronics are hardly compatible with these new requirements: electronic functions are split in several units, and video processing is limited to frequencies around 5 MHz in order to fulfil the radiometric requirements expected for high performance image quality systems. This frequency limitation induces a high number of video chains operated in parallel to process the huge amount of pixels at focal plane output, and leads to unacceptable mass and power consumption budgets. Furthermore, splitting the detection electronics functions into several units (at least one for the focal plane and proximity electronics, and one for the video processing functions) does not optimise the production costs : specific development efforts must be performed on critical analogue electronics at each equipment level and operations of assembly, integration and tests are duplicated at equipment and subsystem levels. Alcatel Space Industries has proposed to CNES a new concept of highly integrated detection electronics (SEDHI), and is developing for CNES a breadboard which will allow to confirm its potentialities. This paper presents the trade-off study which have been performed before selection of this new concept and summarises the main advantages and drawbacks of each possible architecture. The electrical, mechanical and thermal aspects of the SEDHI concept are described, including the basic technologies : ASIC for phase shift of detector clocks, ASIC for video processing, hybrids, microchip module... The adaptability to a large amount of missions and optical instruments is also discussed.
Proceedings of the 20th International Symposium on Space Flight Dynamics
Woodard, Mark (Editor); Stengle, Tom (Editor)
2007-01-01
Topics include: Measuring Image Navigation and Registration Performance at the 3-Sigma Level Using Platinum Quality Landmarks; Flight Dynamics Performances of the MetOp A Satellite during the First Months of Operations; Visual Navigation - SARE Mission; Determining a Method of Enabling and Disabling the Integral Torque in the SDO Science and Inertial Mode Controllers; Guaranteeing Pointing Performance of the SDO Sun-Pointing Controllers in Light of Nonlinear Effects; SDO Delta H Mode Design and Analysis; Observing Mode Attitude Controller for the Lunar Reconnaissance Orbiter; Broken-Plane Maneuver Applications for Earth to Mars Trajectories; ExoMars Mission Analysis and Design - Launch, Cruise and Arrival Analyses; Mars Reconnaissance Orbiter Aerobraking Daily Operations and Collision Avoidance; Mars Reconnaissance Orbiter Interplanetary Cruise Navigation; Motion Parameters Determination of the SC and Phobos in the Project Phobos-Grunt; GRAS NRT Precise Orbit Determination: Operational Experience; Orbit Determination of LEO Satellites for a Single Pass through a Radar: Comparison of Methods; Orbit Determination System for Low Earth Orbit Satellites; Precise Orbit Determination for ALOS; Anti-Collision Function Design and Performances of the CNES Formation Flying Experiment on the PRISMA Mission; CNES Approaching Guidance Experiment within FFIORD; Maneuver Recovery Analysis for the Magnetospheric Multiscale Mission; SIMBOL-X: A Formation Flying Mission on HEO for Exploring the Universe; Spaceborne Autonomous and Ground Based Relative Orbit Control for the TerraSAR-X/TanDEM-X Formation; First In-Orbit Experience of TerraSAR-X Flight Dynamics Operations; Automated Target Planning for FUSE Using the SOVA Algorithm; Space Technology 5 Post-Launch Ground Attitude Estimation Experience; Standardizing Navigation Data: A Status Update; and A Study into the Method of Precise Orbit Determination of a HEO Orbiter by GPS and Accelerometer.
Leveraging the BPEL Event Model to Support QoS-aware Process Execution
Zaid, Farid; Berbner, Rainer; Steinmetz, Ralf
Business processes executed using compositions of distributed Web Services are susceptible to different fault types. The Web Services Business Process Execution Language (BPEL) is widely used to execute such processes. While BPEL provides fault handling mechanisms to handle functional faults like invalid message types, it still lacks a flexible native mechanism to handle non-functional exceptions associated with violations of QoS levels that are typically specified in a governing Service Level Agreement (SLA), In this paper, we present an approach to complement BPEL's fault handling, where expected QoS levels and necessary recovery actions are specified declaratively in form of Event-Condition-Action (ECA) rules. Our main contribution is leveraging BPEL's standard event model which we use as an event space for the created ECA rules. We validate our approach by an extension to an open source BPEL engine.
A SEGURANÇA QUE NÃO É PARA TODOS: DISCURSOS SOBRE VIOLÊNCIA E SEGURANÇA PÚBLICA
Directory of Open Access Journals (Sweden)
ANGELA CORRÊA FERREIRA BAALBAKI
2016-09-01
Full Text Available Guided by the materialism-oriented theoretical background of Discourse Analysis, we have analyzed two different materials whose theme is the urban violence. Those clippings consist of comments posted at the G1 news portal on the death of the boy named Ryan, victim of a stray bullet, and excerpts of the text called ECA do B, written by Eliane Brum and published in the online newspaper El País-Brasil, which configured as a parody of the Child and Adolescent Statute (ECA – Estatuto da criança e do adolescente. Through the analysis of those clippings, we sought to understand how the renderings of violence and public security make sense and have their meanings circulating in the social space when the subject victims of urban violence are adolescents and black and poor children.
Durán-García Martín Enrique
2014-01-01
Currently the transfer of chemical technology is a process that contributes to the technology policy of a country, an industry or an organization in general chemistry. This process requires the application of clear criteria for the proper development of the complex interrelations in the transfer of chemical technology. A group of criteria that are present, are those related to environmental technology which intrinsically define the technology and its impact to the environment. Therefore, the ...
How Technology Teachers Understand Technological Knowledge
Norström, Per
2014-01-01
Swedish technology teachers' views of technological knowledge are examined through a written survey and a series of interviews. The study indicates that technology teachers' understandings of what constitutes technological knowledge and how it is justified vary considerably. The philosophical discussions on the topic are unknown to them. This lack…
Sequencing of Escherichia coli that cause persistent and transient Mastitis
The genomes of two strains of Escherichia coli that cause bovine mastitis were sequenced. These strains are known to be associated with persistent and transient mastitis: strain ECA-B causes a transient infection, and ECC-M leads to a persistent infection....
WEMPE, JB; TAMMELING, EP; KOETER, GH; HAKANSSON, L; VENGE, P; POSTMA, DS
1992-01-01
The effects of the inhaled corticosteroid budesonide and the oral long-acting beta-agonist bambuterol on circadian variation of blood eosinophil numbers, serum levels of eosinophil cationic protein (ECP), serum eosinophil chemotactic activity (ECA), and serum neutrophil chemotactic activity (NCA)
Management zones for various crops have been delineated using NDVI (Normalized Difference Vegetation Index), apparent bulk soil electrical conductivity (ECa - Veris), and yield data; however, estimations of uncertainty for these data layers are equally important considerations. The objective of this...
Environmental Compliance Assessment System (ECAS) - Japan Settlement
1993-12-01
substancies (se defiitidons) were released. Wa relas into die ( 1X2X3 ) cavirwiment of specific substances from a soo Verify tha the following actions were...perfonmed.: ( 1X2X3 ) and smouke emitting (ecu- ity, die izntallation has ee measure w res taken mtl Pwp h isiinspecific dud=e and may de- =!Maon took weares...Storage and Handling 2-12 through 2-14 ( 1X2X3 )(4)(5) Signs 2-15 (1)(2)(4) Worker Protection 2-16 and 2-17 (2X3) Releases 2-18 (1)(2) *CONTACT/LOCATION
Orientation correlations in aluminium deformed by ECAE
DEFF Research Database (Denmark)
Bowen, Jacob R.; Mishin, Oleg; Prangnell, P.B.
2002-01-01
Distributions of boundary misorientations measured in an Al–0.13%Mg alloy, processed by equal channel angular extrusion to a von Mises effective strain of 10, have been compared to misorientation distributions generated from a random mix of orientations present in the microstructure. A significan...
Environmental Compliance Assessment System (ECAS) - Oregon Supplement
1994-04-01
all Federal requirements for exporting ping waste outside of the hazardous waste. United States must meet exporting requirements Verify that the...generator notifies the Department of Environmental Qual- (OAR 340-102-050). ity, Hazardous Waste Section. of the intent to export hazardous waste. MANIFESTS...20% G. USEPA Reg. No. 3125-324 amaze 15%. USEPA Reg. No. 3125-323 lindane all formulations commercial ornamentals, avocados , pecans, livestock
Picot, N.; Boy, F.; Desjonqueres, J.
2012-12-01
Like CryoSat, Sentinel3 embarks a doppler altimeter. While there is a long experience of LRM processing, SAR nadir looking data are new and will need in depth validation. Thanks to CryoSat data, the processing of SAR data can be experienced in orbit. The continuity to current altimeter data set (based on LRM acquisitions) has also to be analysed with details. A Cryosat Processing Prototype (C2P) has been developed on CNES side to prepare the CNES SAR ocean retracking study. this prototype allows to process SAR data in order to generate LRM like echoes on ground. Those CryoSat ocean products are routinely processed on CNES side and ingested in the SALP/DUACS system. CryoSat data have proved to be very accurate and very valuable for the ocean user community in the past monthes. For example, it has allowed to largely reduce the impact of the lost of the ESA ENVISAT mission as well as the long non availability of Jason-1 data. This paper will describe the system set up in place early 2012 to feed CryoSat data in the SALP/DUACS products and will present the routine data analysis . C2P CryoSat products will be compared with DUACS SLA estimates and a specific focus will be given over high latitudes knowing that CryoSat is the oinly mission providing sea surface estimates over latitudes above 66 degrees since the lost of the ESA ENVISAT mission.
Directory of Open Access Journals (Sweden)
Wang R
2018-05-01
Full Text Available Rui Wang,1,* Yang Li,2,* Xu-Dong Huai,3 Qing-Xuan Zheng,1 Wei Wang,1 Hui-Jing Li,4 Qi-Yong Huai1 1Marine College, Shandong University, Weihai, China; 2Zhong Yuan Academy of Biological Medicine, Liaocheng People’s Hospital/Affiliated Liaocheng Hospital, Taishan Medical University, Liaocheng, China; 3School of Chemistry and Molecular Engineering, Qingdao University of Science and Technology, Qingdao, China; 4School of Marine Science and Technology, Harbin Institute of Technology at Weihai, Weihai, China *These authors contributed equally to this work Background: The structural modification of natural products with the aim to improve the anticancer activity is a popular current research direction. The pentacyclic triterpenoid compounds oleanolic acid (OA and glycyrrhetinic acid (GA are distributed widely in nature. Methods: In this study, various oleanolic acids and glycyrrhetinic acids were designed and synthesized by using the combination principle. The in vitro anticancer activities of new OA and GA derivatives were tested by the 3-(4, 5-dimethylthiazol-2-yl-2, 5-diphenyltetrazolium bromide (MTT method with SGC-7901 (gastric cancer, MCF-7 (breast cancer, Eca-109 (esophageal cancer, HeLa (cervical cancer, Hep-G2 (hepatoma cancer and HSF (normal human skin fibroblast cells. Results and conclusion: The screening results showed that the compound 3m presented the highest inhibitory activities against SGC-7901, MCF-7 and Eca-109 cell lines with IC50 values of 7.57±0.64 µM, 5.51±0.41 µM and 5.03±0.56 µM, respectively. In addition, this compound also showed effective inhibition of Hep-G2 cells with an IC50 value of 4.11±0.73 µM. Moreover, compound 5b showed the strongest inhibitory activity against Hep-G2 cells with an IC50 value of 3.74±0.18 µM and compound 3l showed strong selective inhibition of the HeLa cells with the lowest IC50 value of 4.32±0.89 µM. A series of pharmacology experiments indicated that compound 5b could induce Hep-G2
Appropriate Technology as Indian Technology.
Barry, Tom
1979-01-01
Describes the mounting enthusiasm of Indian communities for appropriate technology as an inexpensive means of providing much needed energy and job opportunities. Describes the development of several appropriate technology projects, and the goals and activities of groups involved in utilizing low scale solar technology for economic development on…
International Nuclear Information System (INIS)
Liu Sheng; Shi Haibin; Hu Weixing; Zu Qingquan; Lu Shanshan; Xu Xiaoquan; Sun Lei; Li Linsun
2011-01-01
Objective: To compare the differences of cerebrovascular structure and brain tissue volume between beagle and mongrel dogs by using angiography and MR scanning. Methods: A total of 40 dogs, including 20 beagle dogs (beagle group) and 20 mongrel dogs (mongrel group), were enrolled in this study. Under general anesthesia, all dogs were examined with cerebral angiography and MR scanning. The cerebrovascular structure was evaluated with angiography via selective catheterization of aortic arch, bilateral external cerebral arteries (ECA), maxillary arteries, internal cerebral arteries (ICA) and vertebral arteries separately. The diameters of the ICA, middle cerebral artery (MCA), rostral cerebral artery (RCA), the anastomosis channel ICA and ECA, and basilar artery (BA) were measured at the similar point of each dog. Meanwhile the volumes of the brain tissue were calculated in coronal T2 view of MR scanning. The statistical analysis was performed among the weight of dogs, the diameter of arteries and the volume of brain tissue. The differences in the diameters and brain tissue volume were compared between the two groups. Results: No obvious variations in the cerebrovascular structure and brain tissue volume were found in these dogs. One mongrel dog was excluded from this study because of the severe stenosis of ICA. The mean weight of 20 beagle dogs and 19 mongrel dogs was (12.81±1.29) kg and (12.85±1.12) kg, respectively. The diameters of the ICA, MCA, RCA, the anastomosis channel between ICA and ECA and BA in beagle group were (1.26±0.07) mm, (0.90±0.05) mm, (0.58±0.07) mm, (0.55±0.07) mm and (0.95±0.06) mm, respectively. These parameters in mongrel group were (1.27±0.07) mm, (0.92±0.05) mm, (0.59±0.06) mm, (0.67±0.07) mm and (0.94±0.05) mm, respectively. The volume of brain in two groups was (76232.33±5018.51) mm 3 and (71863.96±4626.87) mm 3 , respectively. There were no obvious correlation among the body weight, the cerebrovascular diameters and brain
Euso-Balloon: A pathfinder mission for the JEM-EUSO experiment
Energy Technology Data Exchange (ETDEWEB)
Osteria, Giuseppe, E-mail: osteria@na.infn.it [Istituto Nazionale di Fisica Nucleare Sezione di Napoli, Naples (Italy); Scotti, Valentina [Istituto Nazionale di Fisica Nucleare Sezione di Napoli, Naples (Italy); Università di Napoli Federico II, Dipartimento di Fisica, Naples (Italy)
2013-12-21
EUSO-Balloon is a pathfinder mission for JEM-EUSO, the near-UV telescope proposed to be installed on board the ISS in 2017. The main objective of this pathfinder mission is to perform a full scale end-to-end test of all the key technologies and instrumentation of JEM-EUSO detectors and to prove the entire detection chain. EUSO-Balloon will measure the atmospheric and terrestrial UV background components, in different observational modes, fundamental for the development of the simulations. Through a series of flights performed by the French Space Agency CNES, EUSO-Balloon also has the potential to detect Extensive Air Showers (EAS) from above. EUSO-Balloon will be mounted in an unpressurized gondola of a stratospheric balloon. We will describe the instrument and the electronic system which performs instrument control and data management in such a critical environment.
Technology strategy for gas technologies; Technology Target Areas; TTA8 Gas Technology
Energy Technology Data Exchange (ETDEWEB)
2008-07-01
TTA8 - Gas technologies points out the various routes Norway can follow to capitalise on the vast resources of natural gas that will be produced in the years to come by developing a strong technology and competence platform. A broad view is taken for the value creation having as basis the continued gas export from NCS to Europe, but also a strong focus on development of gas resources in other parts of the world. The latter can also be seen as part of international positioning for upstream resources and does also include involvements in projects, and export of technology and products. The TTA has structured the analysis into 3 main areas: Gas transport and processing (pipeline, LNG, other); Gas conversion to fuels, chemicals and materials; CO{sub 2} management. In this report, for each of these areas, scenarios based on a gap analysis are presented. One of the key goals has been to identify pacing and emerging technologies for the next 20 years. Based on this, technologies have been mapped according to importance for future competitiveness and technology ambitions. This also includes primary funding responsibilities (public and/or industry). The road map below reflects the key issues in the proposed strategy. The base level of the figure explains areas that will have to be pursued to maintain Norway's role as a key gas and gas technology provider. The second layer represents near term options and possibilities with a reasonable risk profile that could further enhance the Norwegian position given the resources and drive to further develop this industry. As the top layer we have selected some of our 'dreams', what we may achieve if a progressive approach is followed with a strongly innovation based policy. It is acknowledged by the TTA that Norway cannot be a leading technology player in all aspects of the gas value chain. For some technologies we should be an active player and developer, whilst for other technologies we should become a competent buyer and user. This
Technology strategy for gas technologies; Technology Target Areas; TTA8 Gas Technology
Energy Technology Data Exchange (ETDEWEB)
2008-07-01
TTA8 - Gas technologies points out the various routes Norway can follow to capitalise on the vast resources of natural gas that will be produced in the years to come by developing a strong technology and competence platform. A broad view is taken for the value creation having as basis the continued gas export from NCS to Europe, but also a strong focus on development of gas resources in other parts of the world. The latter can also be seen as part of international positioning for upstream resources and does also include involvements in projects, and export of technology and products. The TTA has structured the analysis into 3 main areas: Gas transport and processing (pipeline, LNG, other); Gas conversion to fuels, chemicals and materials; CO{sub 2} management. In this report, for each of these areas, scenarios based on a gap analysis are presented. One of the key goals has been to identify pacing and emerging technologies for the next 20 years. Based on this, technologies have been mapped according to importance for future competitiveness and technology ambitions. This also includes primary funding responsibilities (public and/or industry). The road map below reflects the key issues in the proposed strategy. The base level of the figure explains areas that will have to be pursued to maintain Norway's role as a key gas and gas technology provider. The second layer represents near term options and possibilities with a reasonable risk profile that could further enhance the Norwegian position given the resources and drive to further develop this industry. As the top layer we have selected some of our 'dreams', what we may achieve if a progressive approach is followed with a strongly innovation based policy. It is acknowledged by the TTA that Norway cannot be a leading technology player in all aspects of the gas value chain. For some technologies we should be an active player and developer, whilst for other technologies we should become a competent buyer
Soft rot erwiniae: from genes to genomes.
Toth, Ian K; Bell, Kenneth S; Holeva, Maria C; Birch, Paul R J
2003-01-01
SUMMARY The soft rot erwiniae, Erwinia carotovora ssp. atroseptica (Eca), E. carotovora ssp. carotovora (Ecc) and E. chrysanthemi (Ech) are major bacterial pathogens of potato and other crops world-wide. We currently understand much about how these bacteria attack plants and protect themselves against plant defences. However, the processes underlying the establishment of infection, differences in host range and their ability to survive when not causing disease, largely remain a mystery. This review will focus on our current knowledge of pathogenesis in these organisms and discuss how modern genomic approaches, including complete genome sequencing of Eca and Ech, may open the door to a new understanding of the potential subtlety and complexity of soft rot erwiniae and their interactions with plants. The soft rot erwiniae are members of the Enterobacteriaceae, along with other plant pathogens such as Erwinia amylovora and human pathogens such as Escherichia coli, Salmonella spp. and Yersinia spp. Although the genus name Erwinia is most often used to describe the group, an alternative genus name Pectobacterium was recently proposed for the soft rot species. Ech mainly affects crops and other plants in tropical and subtropical regions and has a wide host range that includes potato and the important model host African violet (Saintpaulia ionantha). Ecc affects crops and other plants in subtropical and temperate regions and has probably the widest host range, which also includes potato. Eca, on the other hand, has a host range limited almost exclusively to potato in temperate regions only. Disease symptoms: Soft rot erwiniae cause general tissue maceration, termed soft rot disease, through the production of plant cell wall degrading enzymes. Environmental factors such as temperature, low oxygen concentration and free water play an essential role in disease development. On potato, and possibly other plants, disease symptoms may differ, e.g. blackleg disease is associated
International Nuclear Information System (INIS)
Taga, Masataka; Shiraishi, Kazunori; Shimura, Tsutomu; Uematsu, Norio; Kato, Tomohisa; Niwa, Ohtsura; Nishimune, Yoshitake; Aizawa, Shinichi; Oshimura, Mitsuo
2000-01-01
The effect of caffeine was studied on the radioresponses of undifferentiated mouse embryonal carcinoma cells (EC cells) with or without the functional p53. The radioresponses studied included radiosensitivity, the activation of p53, apoptosis with characteristic DNA ladder formation and cell cycle progression. An undifferentiated mouse EC cell line, ECA2, and a newly established p53-deficient EC cell line, p53δ, were used in the present study. The status of the p53 gene did not significantly affect the colony survivals of undifferentiated EC cells to X-rays and UV. Although a post-irradiation treatment with caffeine sensitized both lines to X-rays marginally, the sensitization was prominent for UV regardless of the p53 status of the cells. The activation of a p53 responsible lacZ reporter construct was observed in stably transfected ECA2 cells after X-ray and UV irradiations. Caffeine suppressed the X-ray induced activation of the lacZ reporter, while it drastically enhanced the activation after UV irradiation. X-rays and UV readily triggered the apoptosis of ECA2 cells with the characteristic DNA ladder. Although UV-induced DNA ladder formation was enhanced by caffeine, that induced by X-rays was unaffected. Therefore, the effects of caffeine on the p53-dependent radioresponses were found to be agent specific: suppression for the X-ray induced and augmentation for the UV induced. In contrast to p53-proficient ECA2 cells, smear-like DNA degradation was observed for irradiated p53δ cells, suggesting the presence of a mode of cell death without DNA ladder formation. UV induction of the smear-like DNA degradation was enhanced in the presence of caffeine. Regardless of the state of the p53 gene, G1/S arrest was not observed in X-ray and UV irradiated EC cells. X-rays induced G2/M arrest in both lines, which was abrogated by caffeine, while G2/M arrest after UV was unaffected by a caffeine treatment. These results indicate that the radioresponses of undifferentiated
International Nuclear Information System (INIS)
Greil, Oliver; Kleinschmidt, Thomas; Weiss, Wolfgang; Wolf, Oliver; Heider, Peter; Schaffner, Silvio; Gianotti, Marc; Schmid, Thomas; Liepsch, Dieter; Berger, Hermann
2005-01-01
Purpose. To study the influence of a newly developed membrane stent design on flow patterns in a physiologic carotid artery model. Methods. Three different stents were positioned in silicone models of the carotid artery: a stainless steel stent (Wall-stent), a nitinol stent (SelfX), and a nitinol stent with a semipermeable membrane (MembraX). To increase the contact area of the membrane with the vessel wall, another MembranX model was modified at the outflow tract. The membrane consists of a biocompatible silicone-polyurethane copolymer (Elast-Eon) with a pore size of 100 μm. All stents were deployed across the bifurcation and the external carotid artery origin. Flow velocity measurements were performed with laser Doppler anemometry (LDA), using pulsatile flow conditions (Re = 220; flow 0.39 l/min; flow rate ratio ICA:ECA = 70:30) in hemodynamically relevant cross-sections. The hemodynamic changes were analyzed by comparing velocity fluctuations of corresponding flow profiles. Results. The flow rate ratio ICA:ECA shifted significantly from 70/30 to 73.9/26.1 in the MembraX and remained nearly unchanged in the SelfX and Wallstent. There were no changes in the flow patterns at the inflow proximal to the stents. In the stent no relevant changes were found in the SelfX. In the Wallstent the separation zone shifted from the orifice of the ICA to the distal end of the stent. Four millimeters distal to the SelfX and the Wallstent the flow profile returned to normal. In the MembraX an increase in the central slipstreams was found with creation of a flow separation distal to the stent. With a modification of the membrane this flow separation vanished. In the ECA flow disturbances were seen at the inner wall distal to the stent struts in the SelfX and the Wallstent. With the MembraX a calming of flow could be observed in the ECA with a slight loss of flow volume. Conclusions. Stent placement across the carotid artery bifurcation induces alterations of the physiologic flow
Directory of Open Access Journals (Sweden)
RABELLO Renato Rocha
2001-01-01
Full Text Available INTRODUÇÃO: A bandagem do tronco pulmonar (TP tem sido aplicada para treinamento do ventrículo esquerdo (VE em pacientes portadores de transposição das grandes artérias (TGA com septo íntegro. Este procedimento, além de apresentar alta morbi-mortalidade, pode ocasionar alterações da função ventricular a longo prazo. Com o objetivo de analisar a hipertrofia aguda do ventrículo direito (VD, foi implantado um cateter balão no TP de seis cabritos jovens. MATERIAL E MÉTODOS: A sobrecarga sistólica foi aplicada através de insuflações progressivas do balão, durante 96 horas. Esta hipertrofia foi acompanhada por medidas hemodinâmicas diárias, através de cateteres implantados na aorta, VD e TP, além de ecocardiogramas seriados a cada 24 horas, com medidas das espessuras do septo interventricular e dos ventrículos. Ao final das 96 horas, os animais foram mortos para remoção dos corações. Os ventrículos e o septo foram pesados separadamente. Foram colhidas biópsias musculares de cada câmara para análise da atividade da enzima conversora da angiotensina (ECA. Oito cabritos (idade e peso semelhantes foram utilizados como controle para os pesos dos ventrículos e para a atividade da ECA. RESULTADOS: Observou-se um aumento do gradiente VD/TP (p=0,001, com conseqüente aumento da razão VD/VE (p=0,005 durante o tempo de sobrecarga sistólica. Ao fim do protocolo, a parede livre do VD apresentou aumento de espessura (p=0,002 e, conseqüentemente, um aumento do peso indexado (p=0,002. A análise da atividade da ECA revelou aumento somente no músculo do VD hipertrofiado (p=0,002. CONCLUSÃO: O cateter balão foi eficiente em induzir a hipertrofia aguda do VD através do protocolo utilizado. Conseqüentemente, um aumento expressivo da atividade da ECA está associado ao processo de hipertrofia miocárdica induzida por sobrecarga pressórica.
Calcium content and high calcium adaptation of plants in karst areas of southwestern Hunan, China
Directory of Open Access Journals (Sweden)
X. Wei
2018-05-01
Full Text Available Rocky desertification is a major ecological problem of land degradation in karst areas. In these areas, the high soil calcium (Ca content has become an important environmental factor that can affect the restoration of vegetation. Consequently, the screening of plant species that can adapt to high Ca soil environments is a critical step in vegetation restoration. In this study, three grades of rocky desertification sample areas were selected in karst areas of southwestern Hunan, China (LRD: light rocky desertification; MRD: moderate rocky desertification; and IRD: intense rocky desertification. Each grade of these sample areas had three sample plots in different slope positions, each of which had four small quadrats (one in rocky-side areas, three in non-rocky-side areas. We measured the Ca content of leaves, branches, and roots from 41 plant species, as well as soil total Ca (TCa and exchangeable Ca (ECa at depths of 0–15, 15–30, and 30–45 cm in each small quadrat. The results showed that the soil Ca2+ content in rocky-side areas was significantly higher than that in non-rocky-side areas (p < 0.05. The mean soil TCa and ECa content increased gradually along with the grade of rocky desertification, in the order IRD > MRD > LRD. For all plant functional groups, the plant Ca content of aboveground parts was significantly higher than that of the belowground parts (p < 0.05. The soil ECa content had significant effects on plant Ca content of the belowground parts but had no significant effects on plant Ca content of the aboveground parts. Of the 41 plant species that were sampled, 17 were found to be dominant (important value > 1. The differences in Ca2+ content between the aboveground and belowground parts of the 17 dominant species were calculated, and their correlations with soil ECa content were analyzed. The results showed that these 17 species can be divided into three categories: Ca-indifferent plants, high
Energy Technology Data Exchange (ETDEWEB)
Taga, Masataka; Shiraishi, Kazunori; Shimura, Tsutomu; Uematsu, Norio; Kato, Tomohisa; Niwa, Ohtsura [Kyoto Univ. (Japan). Radiation Biology Center; Nishimune, Yoshitake; Aizawa, Shinichi; Oshimura, Mitsuo
2000-09-01
The effect of caffeine was studied on the radioresponses of undifferentiated mouse embryonal carcinoma cells (EC cells) with or without the functional p53. The radioresponses studied included radiosensitivity, the activation of p53, apoptosis with characteristic DNA ladder formation and cell cycle progression. An undifferentiated mouse EC cell line, ECA2, and a newly established p53-deficient EC cell line, p53{delta}, were used in the present study. The status of the p53 gene did not significantly affect the colony survivals of undifferentiated EC cells to X-rays and UV. Although a post-irradiation treatment with caffeine sensitized both lines to X-rays marginally, the sensitization was prominent for UV regardless of the p53 status of the cells. The activation of a p53 responsible lacZ reporter construct was observed in stably transfected ECA2 cells after X-ray and UV irradiations. Caffeine suppressed the X-ray induced activation of the lacZ reporter, while it drastically enhanced the activation after UV irradiation. X-rays and UV readily triggered the apoptosis of ECA2 cells with the characteristic DNA ladder. Although UV-induced DNA ladder formation was enhanced by caffeine, that induced by X-rays was unaffected. Therefore, the effects of caffeine on the p53-dependent radioresponses were found to be agent specific: suppression for the X-ray induced and augmentation for the UV induced. In contrast to p53-proficient ECA2 cells, smear-like DNA degradation was observed for irradiated p53{delta} cells, suggesting the presence of a mode of cell death without DNA ladder formation. UV induction of the smear-like DNA degradation was enhanced in the presence of caffeine. Regardless of the state of the p53 gene, G1/S arrest was not observed in X-ray and UV irradiated EC cells. X-rays induced G2/M arrest in both lines, which was abrogated by caffeine, while G2/M arrest after UV was unaffected by a caffeine treatment. These results indicate that the radioresponses of
Directory of Open Access Journals (Sweden)
Kelte Resende Arantes
2009-04-01
Full Text Available Visando reduzir o período de recuperação das lavouras após a recepa, neste trabalho objetivou-se avaliar a influência de diferentes lâminas de irrigação e do parcelamento da adubação sobre o crescimento do cafeeiro. Foram utilizadas quatro diferentes lâminas de irrigação (0, 40, 80 e 120% da ECA-Precipitação e três parcelamentos da adubação com N e K (quatro, oito e 12 vezes. O experimento foi conduzido no Sul de Minas Gerais, com o cafeeiro (Coffea arabica cv. Topázio MG-1190, plantado no espaçamento de 1,8 x 0,7 m e recepado 65 meses após o plantio. O delineamentoexperimental utilizado foi em blocos casualizados com parcelas subdivididas. Os parâmetros avaliados foram altura da planta, diâmetro do ramo ortotrópico, número de internódios e diâmetro da copa. O crescimento do cafeeiro foi influenciado pela irrigação, mas não foi influenciado pelo parcelamento da adubação. A lâmina de 120% do saldo do balanço ECA - P proporcionou maior crescimento.In order to reduce the recovery period of the orchard coffeeafter pruning, this work was carried out with the objective of evaluating the influence of different irrigation depths and splitting of N and K with fertirrigation on the growth of coffee plants. The experiment was carried out in southern Minas Gerais State with coffeaarabica cv. Topázio MG-1190 implanted with 1.8 x 0.7 m spacing. Irrigations corresponded to 0, 40, 80 and 120% of the evaporation from a Class A pan – precipitation (ECA-P and N and K split in 4, 8 and 12 applications. A randomized block design with four replicationswas used. Plant height, diameter of orthotropic branches, number of internodes and crown diameter were evaluated. The fertilizer splitting was found not to provide any increase in growth of the coffee plant. The depth of 120%*ECA-P provided the greatest growth ofcoffee plants when compared to others.
2011-03-22
...: Kennedy Center (KC) Cultural Visitors Program participants conducted by ECA from 2005 through 2009... of Educational and Cultural Affairs, Office of Policy and Evaluation, Evaluation Division: Sports & Culture Evaluation Kennedy Center Visitors Survey, OMB Control Number 1405-xxxx ACTION: Notice of request...
40 CFR 80.603 - What are the pre-compliance reporting requirements for NRLM diesel fuel?
2010-07-01
... requirements for NRLM diesel fuel? 80.603 Section 80.603 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Recordkeeping and Reporting...
32 CFR 651.4 - Responsibilities.
2010-07-01
... Environmental Compliance Assessment System (ECAS), Installation Status Report (ISR), or other mechanisms. (2... EPA. (v) State agencies charged with protection of the environment, natural resources, and fish and...) Review Army policies, including AR 200-1 (Environmental Protection and Enhancement), AR 200-3 (Natural...
Relationship between cotton yield and soil electrical conductivity, topography, and landsat imagery
Understanding spatial and temporal variability in crop yield is a prerequisite to implementing site-specific management of crop inputs. Apparent soil electrical conductivity (ECa), soil brightness, and topography are easily obtained data that can explain yield variability. The objectives of this stu...
Adolescência, infração e serviço social
Directory of Open Access Journals (Sweden)
Jaqueline Lago
2011-04-01
Full Text Available O objetivo deste artigo foi o de analisar uma pequena faceta da adolescência em face da sua responsabilização perante o Estatuto da Criança e do Adolescente (ECA pela prática de atos infracionais. O trabalho contempla uma abordagem sobre as medidas socioeducativas, em especial sobre a internação de adolescentes e discute temas relevantes, tais como: o ato infracional, a educação, o Serviço Social, o ECA e os aspectos constitucionais pertinentes. Discorre-se, também, sobre a importância do processo socioeducativo nas Unidades de internação e sobre o papel do profissional de Serviço Social neste contexto. O trabalho foi realizado através de pesquisa teórico-bibliográfica e documental, sendo utilizado o método hipotético-dedutivo.
Engineering critical assessment of PETROBRAS Camarupim pipeline
Energy Technology Data Exchange (ETDEWEB)
Gordon, J.R. [Microalloying International, Houston, TX (United States); Gatlin, R.W. [Global Industries, Rio de Janeiro, RJ (Brazil); Zumpano Junior, P.; Kaspary, T. [PETROBRAS S.A., Rio de Janeiro, RJ (Brazil)
2009-12-19
This paper presents details of an Engineering Critical Assessment (ECA) performed to develop girth weld flaw acceptance criteria for the PETROBRAS Camarupim Pipeline which was installed in Espirito Santo Basin, ES, offshore Brazil in May 2008 by Global Industries. The pipeline was constructed using 24-inch diameter API Grade X65 pipe with wall thicknesses of 0.875-inch (22.2 mm) and 1.00 inch (25.4 mm). Although the Camarupim pipeline will initially transport sweet gas there is the potential for mildly sour service operation in mid to late life. To assess the effect of sour service on the material toughness properties a series of slow strain rate fracture toughness tests were performed in a Project representative sour service environment. In addition the results of sour service fatigue crack growth tests were analyzed to develop a conservative sour service fatigue crack growth law for the ECA analysis. (author)
Directory of Open Access Journals (Sweden)
Jeffrey Stewart Morrow
2017-06-01
Full Text Available Siem Reap, Cambodia’s tourism growth has been remarkable. Since most tourists are native English speakers, tourist industry (TI employees need high levels of English communication ability (ECA to handle tasks effectively, but data in Cambodia has been difficult to find. To fill this gap, the author wanted to collect employees’ general and English education information during interviews in six TI related businesses, to assess their ECA, and to statistically examine interactions of English variables with income. The author created an English assessment test loosely based on the Common European Framework of Reference for Languages (CEFR. Statistical analysis found direct positive influence from English ability on income. Findings also showed that employees who have advanced levels of English ability earn USD200 per month, double the salary of garment workers. This type of research can be used profitably over the Internet in many research situations.
Living technology: exploiting life's principles in technology.
Bedau, Mark A; McCaskill, John S; Packard, Norman H; Rasmussen, Steen
2010-01-01
The concept of living technology-that is, technology that is based on the powerful core features of life-is explained and illustrated with examples from artificial life software, reconfigurable and evolvable hardware, autonomously self-reproducing robots, chemical protocells, and hybrid electronic-chemical systems. We define primary (secondary) living technology according as key material components and core systems are not (are) derived from living organisms. Primary living technology is currently emerging, distinctive, and potentially powerful, motivating this review. We trace living technology's connections with artificial life (soft, hard, and wet), synthetic biology (top-down and bottom-up), and the convergence of nano-, bio-, information, and cognitive (NBIC) technologies. We end with a brief look at the social and ethical questions generated by the prospect of living technology.
Radiological Diagnosis and Management of Epistaxis
Energy Technology Data Exchange (ETDEWEB)
Krajina, Antonín, E-mail: antonin.krajina@fnhk.cz [University Hospital Hradec Kralove and Medical Faculty of Charles University, Department of Radiology (Czech Republic); Chrobok, Viktor, E-mail: viktor.chrobok@fnhk.cz [University Hospital Hradec Kralove and Medical Faculty of Charles University, Department of Otorhinolaryngology and Head and Neck Surgery (Czech Republic)
2013-11-15
The majority of episodes of spontaneous posterior epistaxis treated with embolisation are idiopathic in nature. The angiographic findings are typically normal. Specific angiographic signs are rare and may include the following: a tumour blush, telangiectasia, aneurysm, and/or extravasation. Selective internal carotid artery (ICA) angiography may show rare causes of epistaxis, such as traumatic or mycotic aneurysms, which require different treatment approaches. Complete bilateral selective external and internal carotid angiograms are essential to evaluation. The images should be analysed for detection of central retinal blush in the external carotid artery (ECA) and anastomoses between the branches of the ECA and ICA. Monocular blindness and stroke are two of the most severe complications. Embolisation aims to decrease flow to the bleeding nasal mucosa while avoiding necrosis of the nasal skin and palate mucosa. Embolisation is routinely performed with a microcatheter positioned in the internal maxillary artery distal to the origin of the meningeal arteries. A guiding catheter should be placed in the proximal portion of the ECA to avoid vasospasm. Embolisation with microparticles is halted when the peripheral branches of the sphenopalatine artery are occluded. The use of coils is not recommended because recurrent epistaxis may occur due to proximal embolization; moreover, the option of repeat distal embolisation is lost. The success rate of embolisation therapy (accounting for late recurrence of bleeding) varies between 71 and 94 %. Results from endoscopic surgery are quite comparable. When epistaxis is refractory to nasal packing or endoscopic surgery, embolisation is the treatment of choice in some centres.
Heat stress redistributes blood flow in arteries of the brain during dynamic exercise.
Sato, Kohei; Oue, Anna; Yoneya, Marina; Sadamoto, Tomoko; Ogoh, Shigehiko
2016-04-01
We hypothesized that heat stress would decrease anterior and posterior cerebral blood flow (CBF) during exercise, and the reduction in anterior CBF would be partly associated with large increase in extracranial blood flow (BF). Nine subjects performed 40 min of semirecumbent cycling at 60% of the peak oxygen uptake in hot (35°C; Heat) and thermoneutral environments (25°C; Control). We evaluated BF and conductance (COND) in the external carotid artery (ECA), internal carotid artery (ICA), and vertebral artery (VA) using ultrasonography. During the Heat condition, ICA and VA BF were significantly increased 10 min after the start of exercise (P Heat. Compared with the Control, either BF or COND of ICA and VA at the end of Heat tended to be lower, but not significantly. In contrast, ECA BF and COND at the end of Heat were both higher than levels in the Control condition (P Heat, a reduction in ICA BF appears to be associated with a decline in end-tidal CO2 tension (r = 0.84), whereas VA BF appears to be affected by a change in cardiac output (r = 0.87). In addition, a change in ECA BF during Heat was negatively correlated with a change in ICA BF (r = -0.75). Heat stress resulted in modification of the vascular response of head and brain arteries to exercise, which resulted in an alteration in the distribution of cardiac output. Moreover, a hyperthermia-induced increase in extracranial BF might compromise anterior CBF during exercise with heat stress. Copyright © 2016 the American Physiological Society.
Directory of Open Access Journals (Sweden)
Mark A Lum
Full Text Available To evaluate the ability of IA MR perfusion to characterize meningioma blood supply.Studies were performed in a suite comprised of an x-ray angiography unit and 1.5T MR scanner that permitted intraprocedural patient movement between the imaging modalities. Patients underwent intra-arterial (IA and intravenous (IV T2* dynamic susceptibility MR perfusion immediately prior to meningioma embolization. Regional tumor arterial supply was characterized by digital subtraction angiography and classified as external carotid artery (ECA dural, internal carotid artery (ICA dural, or pial. MR perfusion data regions of interest (ROIs were analyzed in regions with different vascular supply to extract peak height, full-width at half-maximum (FWHM, relative cerebral blood flow (rCBF, relative cerebral blood volume (rCBV, and mean transit time (MTT. Linear mixed modeling was used to identify perfusion curve parameter differences for each ROI for IA and IV MR imaging techniques. IA vs. IV perfusion parameters were also directly compared for each ROI using linear mixed modeling.18 ROIs were analyzed in 12 patients. Arterial supply was identified as ECA dural (n = 11, ICA dural (n = 4, or pial (n = 3. FWHM, rCBV, and rCBF showed statistically significant differences between ROIs for IA MR perfusion. Peak Height and FWHM showed statistically significant differences between ROIs for IV MR perfusion. RCBV and MTT were significantly lower for IA perfusion in the Dural ECA compared to IV perfusion. Relative CBF in IA MR was found to be significantly higher in the Dural ICA region and MTT significantly lower compared to IV perfusion.
Ma, Hongru; Li, Zhuo; Tian, Xun; Yan, Shaocun; Li, Zhe; Guo, Xuhong; Ma, Yanqing; Ma, Lei
2018-03-01
Silver dendrites were prepared by a facile replacement reaction between silver nitrate and zinc microparticles of 20 μm in size. The influence of reactant molar ratio, reaction solution volume, silver nitrate concentration, and reaction time on the morphology of dendrites was investigated systematically. It was found that uniform tree-like silver structures are synthesized under the optimal conditions. Their structure can be described as a trunk, symmetrical branches, and leaves, which length scales of 5-10, 1-2 μm, and 100-300 nm, respectively. All features were systematically characterized by scanning electron microscopy, transmission electron microscopy (TEM), high-resolution TEM, and x-ray powder diffraction. A hybrid fillers system using silver flakes and dendrites as electrically conductive adhesives (ECAs) exhibited excellent overall performance. This good conductivity can be attributed mainly to the synergy between the silver microflakes (5-20 μm sized irregular sheet structures) and dendrites, allowing more conductive pathways to be formed between the fillers. In order to further optimize the overall electrical conductivity, various mixtures of silver microflakes and silver dendrites were tested in ECAs, with results indicating that the highest conductivity was shown when the amounts of silver microflakes, silver dendrites and the polymer matrix were 69.4 wt.% (20.82 vol.%), 0.6 wt.% (0.18 vol.%), and 30.0 wt.% (79.00 vol.%), respectively. The corresponding mass ratio of silver flakes to silver dendrites was 347:3. The resistivity of ECAs reached as low as 1.7 × 10-4 Ω cm.
Characterization of volumetric flow rate waveforms at the carotid bifurcations of older adults
International Nuclear Information System (INIS)
Hoi, Yiemeng; Xie, Yuanyuan J; Steinman, David A; Wasserman, Bruce A; Najjar, Samer S; Lakatta, Edward G; Ferruci, Luigi; Gerstenblith, Gary
2010-01-01
While it is widely appreciated that volumetric blood flow rate (VFR) dynamics change with age, there has been no detailed characterization of the typical shape of carotid bifurcation VFR waveforms of older adults. Toward this end, retrospectively gated phase contrast magnetic resonance imaging was used to measure time-resolved VFR waveforms proximal and distal to the carotid bifurcations of 94 older adults (age 68 ± 8 years) with little or no carotid artery disease, recruited from the BLSA cohort of the VALIDATE study of factors in vascular aging. Timings and amplitudes of well-defined feature points from these waveforms were extracted automatically and averaged to produce representative common, internal and external carotid artery (CCA, ICA and ECA) waveform shapes. Relative to young adults, waveforms from older adults were found to exhibit a significantly augmented secondary peak during late systole, resulting in significantly higher resistance index (RI) and flow augmentation index (FAI). Cycle-averaged VFR at the CCA, ICA and ECA were 389 ± 74, 245 ± 61 and 125 ± 49 mL min −1 , respectively, reflecting a significant cycle-averaged outflow deficit of 5%, which peaked at around 10% during systole. A small but significant mean delay of 13 ms between arrivals of ICA versus CCA/ECA peak VFR suggested differential compliance of these vessels. Sex and age differences in waveform shape were also noted. The characteristic waveforms presented here may serve as a convenient baseline for studies of VFR waveform dynamics or as suitable boundary conditions for models of blood flow in the carotid arteries of older adults
Radiological Diagnosis and Management of Epistaxis
International Nuclear Information System (INIS)
Krajina, Antonín; Chrobok, Viktor
2014-01-01
The majority of episodes of spontaneous posterior epistaxis treated with embolisation are idiopathic in nature. The angiographic findings are typically normal. Specific angiographic signs are rare and may include the following: a tumour blush, telangiectasia, aneurysm, and/or extravasation. Selective internal carotid artery (ICA) angiography may show rare causes of epistaxis, such as traumatic or mycotic aneurysms, which require different treatment approaches. Complete bilateral selective external and internal carotid angiograms are essential to evaluation. The images should be analysed for detection of central retinal blush in the external carotid artery (ECA) and anastomoses between the branches of the ECA and ICA. Monocular blindness and stroke are two of the most severe complications. Embolisation aims to decrease flow to the bleeding nasal mucosa while avoiding necrosis of the nasal skin and palate mucosa. Embolisation is routinely performed with a microcatheter positioned in the internal maxillary artery distal to the origin of the meningeal arteries. A guiding catheter should be placed in the proximal portion of the ECA to avoid vasospasm. Embolisation with microparticles is halted when the peripheral branches of the sphenopalatine artery are occluded. The use of coils is not recommended because recurrent epistaxis may occur due to proximal embolization; moreover, the option of repeat distal embolisation is lost. The success rate of embolisation therapy (accounting for late recurrence of bleeding) varies between 71 and 94 %. Results from endoscopic surgery are quite comparable. When epistaxis is refractory to nasal packing or endoscopic surgery, embolisation is the treatment of choice in some centres
Husarik, Daniela B; Gupta, Rajan T; Ringe, Kristina I; Boll, Daniel T; Merkle, Elmar M
2011-12-01
To assess the enhancement pattern of focal confluent fibrosis (FCF) on contrast-enhanced hepatic magnetic resonance imaging (MRI) using hepatocyte-specific (Gd-EOB-DTPA) and extracellular (ECA) gadolinium-based contrast agents in patients with primary sclerosing cholangitis (PSC). After institutional review board approval, 10 patients with PSC (6 male, 4 female; 33-61 years) with 13 FCF were included in this retrospective study. All patients had a Gd-EOB-DTPA-enhanced liver MRI exam, and a comparison ECA-enhanced MRI. On each T1-weighted dynamic dataset, the signal intensity (SI) of FCF and the surrounding liver as well as the paraspinal muscle (M) were measured. In the Gd-EOB-DTPA group, hepatocyte phase images were also included. SI FCF/SI M, SI liver/SI M, and [(SI liver - SI FCF)/SI liver] were compared between the different contrast agents for each dynamic phase using the paired Student's t-test. There was no significant difference in SI FCF/SI M in all imaging phases. SI liver/SI M was significantly higher for the Gd-EOB-DTPA group in the delayed phase (P DTPA group, mean [(SI liver - SI FCF)/SI liver] were as follows (values for ECA group in parentheses): unenhanced phase: 0.26 (0.26); arterial phase: 0.01 (-0.31); portal venous phase (PVP): -0.05 (-0.26); delayed phase (DP): 0.14 (-0.54); and hepatocyte phase: 0.26. Differences were significant for the DP (P DTPA-enhanced images. Copyright © 2011 AUR. Published by Elsevier Inc. All rights reserved.
Technology Transfer: Marketing Tomorrow's Technology
Tcheng, Erene
1995-01-01
The globalization of the economy and the end of the Cold War have triggered many changes in the traditional practices of U.S. industry. To effectively apply the resources available to the United States, the federal government has firmly advocated a policy of technology transfer between private industry and government labs, in this case the National Aeronautics and Space Administration (NASA). NASA Administrator Daniel Goldin is a strong proponent of this policy and has organized technology transfer or commercialization programs at each of the NASA field centers. Here at Langley Research Center, the Technology Applications Group (TAG) is responsible for facilitating the transfer of Langley developed research and technology to U.S. industry. Entering the program, I had many objectives for my summer research with TAG. Certainly, I wanted to gain a more thorough understanding of the concept of technology transfer and Langley's implementation of a system to promote it to both the Langley community and the community at large. Also, I hoped to become more familiar with Langley's research capabilities and technology inventory available to the public. More specifically, I wanted to learn about the technology transfer process at Langley. Because my mentor is a member of Materials and Manufacturing marketing sector of the Technology Transfer Team, another overriding objective for my research was to take advantage of his work and experience in materials research to learn about the Advanced Materials Research agency wide and help market these developments to private industry. Through the various projects I have been assigned to work on in TAG, I have successfully satisfied the majority of these objectives. Work on the Problem Statement Process for TAG as well as the development of the Advanced Materials Research Brochure have provided me with the opportunity to learn about the technology transfer process from the outside looking in and the inside looking out. Because TAG covers
Thales SESO's hollow and massive corner cube solutions
Fappani, Denis; Dahan, Déborah; Costes, Vincent; Luitot, Clément
2017-11-01
For Space Activities, more and more Corner Cubes, used as solution for retro reflection of light (telemetry and positioning), are emerging worldwide in different projects. Depending on the application, they can be massive or hollow Corner Cubes. For corners as well as for any kind of space optics, it usual that use of light/lightened components is always a baseline for purpose of mass reduction payloads. But other parameters, such as the system stability under severe environment, are also major issues, especially for the corner cube systems which require generally very tight angular accuracies. For the particular case of the hollow corner cube, an alternative solution to the usual cementing of the 3 reflective surfaces, has been developed with success in collaboration with CNES to guarantee a better stability and fulfill the weight requirements.. Another important parameter is the dihedral angles that have a great influence on the wavefront error. Two technologies can be considered, either a Corner Cubes array assembled in a very stable housing, or the irreversible adherence technology used for assembling the three parts of a cube. This latter technology enables in particular not having to use cement. The poster will point out the conceptual design, the manufacturing and control key-aspects of such corner cube assemblies as well as the technologies used for their assembling.
Applications of aerospace technology in industry. A technology transfer profile: Food technology
Murray, D. M.
1971-01-01
Food processing and preservation technologies are reviewed, expected technological advances are considered including processing and market factors. NASA contributions to food technology and nutrition are presented with examples of transfer from NASA to industry.
40 CFR 80.521 - What are the standards and identification requirements for diesel fuel additives?
2010-07-01
... Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Motor... consumer in diesel motor vehicles or nonroad diesel engines. [69 FR 39171, June 29, 2004] ... identification requirements for diesel fuel additives? 80.521 Section 80.521 Protection of Environment...
InterProScan Result: DC542598 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available DC542598 DC542598_2_ORF1 06AFB093ECA81E59 PANTHER PTHR11824 VOLTAGE-DEPENDENT CALCI...UM CHANNEL BETA SUBUNIT 9.9e-74 T IPR000584 Voltage-dependent calcium channel, L-type, beta subunit Molecular Function: volt
2011-03-22
... and Cultural Affairs, Office of Policy and Evaluation, Evaluation Division: Sports & Culture... collection clearance will allow ECA/P/V as part of their larger Sports and Culture Evaluation to conduct a... of Educational and Cultural Affairs, Office of Policy and Evaluation, Evaluation Division: Sports...
2011-03-22
... Cultural Affairs, Office of Policy and Evaluation, Evaluation Division: Sports & Culture Evaluation IWP... collection clearance will allow ECA/P/V as part of their larger Sports and Culture Evaluation to conduct a... of Educational and Cultural Affairs, Office of Policy and Evaluation, Evaluation Division: Sports...
Rasche, F; Velvis, H; Zachow, C; Berg, G; Van Elsas, JD; Sessitsch, A
1. Blackleg and soft rot disease of potatoes Solanum tuberosum L., mainly caused by the bacterial pathogen Erwinia carotovora ssp. atrospetica (Eca), lead to enormous yield losses world-wide. Genetically modified (GM) potatoes producing anti-bacterial agents, such as cecropin/attacin and T4
Rasche, F.; Velvis, H.; Zachow, C.; Berg, G.; Elsas, van J.D.; Sessitsch, A.
2006-01-01
1. Blackleg and soft rot disease of potatoes Solanum tuberosum L., mainly caused by the bacterial pathogen Erwinia carotovora ssp. atrospetica (Eca), lead to enormous yield losses world-wide. Genetically modified (GM) potatoes producing anti-bacterial agents, such as cecropin/attacin and T4
Variations in Gesturing and Speech by GESTYLE
Noot, Han; Ruttkay, Z.M.
2005-01-01
Humans tend to attribute human qualities to computers. It is expected that people, when using their natural communicational skills, can perform cognitive tasks with computers in a more enjoyable and effective way. For these reasons, human-like embodied conversational agents (ECAs) as components of
Albrecht, M.; Duelli, P.; Obrist, M.K.; Müller, C.; Schüpbach, B.; Kleijn, D.; Schmid, B.
2010-01-01
An important goal of ecological compensation areas (ECAs) is to increase biodiversity in adjacent intensively managed farmland and the agricultural landscape at large. We tested whether this goal can be achieved in the case of the agri-environmental restoration scheme implemented for Swiss grassland
Inversion of soil electrical conductivity data to estimate layered soil properties
CBulk apparent soil electrical conductivity (ECa) sensors respond to multiple soil properties, including clay content, water content, and salt content (i.e., salinity). They provide a single sensor value for an entire soil profile down to a sensor-dependent measurement depth, weighted by a nonlinear...
Financing energy projects in Africa
International Nuclear Information System (INIS)
Godier, Kevin; Marks, Jon
1999-12-01
Contains Executive Summary and Chapters on: Overview of financing trends in Africa; Multilateral support - Bedrock of Africa's first generation energy projects; ECA insurance and financing; Bilateral development finance; Offshore commercial bank lending; Local commercial bank finance; Capital markets; Legal ramifications ; Risk factors; Conclusions. (Author)
DEFF Research Database (Denmark)
Zare, Ehsan; Huang, Jingyi; Koganti, Triven
2017-01-01
(ECe), and in 3-dimensions around a water storage reservoir in an irrigated field near Bourke, New South Wales, Australia. A quasi-3d electromagnetic conductivity image (EMCI) or model of the true electrical conductivity (sigma) was developed using 133 apparent electrical conductivity (ECa...
1981-01-01
The streamer chamber of UA5, which had been operating at the ISR until Easter, was installed in its platform, in ECA4 alongside the UA2 detector and in September was moved into the beam (this photo). See Annual Report 1981 p. 128.
Thermally activated technologies: Technology Roadmap
Energy Technology Data Exchange (ETDEWEB)
None, None
2003-05-01
The purpose of this Technology Roadmap is to outline a set of actions for government and industry to develop thermally activated technologies for converting America’s wasted heat resources into a reservoir of pollution-free energy for electric power, heating, cooling, refrigeration, and humidity control. Fuel flexibility is important. The actions also cover thermally activated technologies that use fossil fuels, biomass, and ultimately hydrogen, along with waste heat.
Aparicio, Virginia; Zamora, Martin; Barbera, Agustin; Castro Franco, Mauricio; Domenech, Marisa; De Geronimo, Eduardo; Costa, Jose Luis
2017-04-01
The industrial model of agriculture, defined here by its capital intensity and dependence on massive inputs like seeds, fertilizer, and pesticides, is reducing soil organic matter and increasing the inefficiency in agrochemical used. Ecological impacts of industrial agriculture include pollution by pesticides, soil organic matter loss and soil degradation, among many others, with the consequent human health risks. Many of the negative effects of industrial agriculture are remote from fields and farms. The impacts of industrial agriculture on the environment, public health, and rural communities make it an unsustainable way to grow our food over the long term. An alternative approach to the industrial agriculture is the agroecology which has shown promising success on the ground and is actually the only way to ensure that all people have access to sufficient, healthful food. Farming systems designed and managed according to ecological principles can meet the food needs of society while addressing these pressing environmental and social issues. Our concept of agroecological transition is based on increasing resource use efficiency (e.g. fertilizer, pesticides and water), recycling waste or byproducts of one subsystem in another and applying sound? agricultural practices or precision-agriculture technologies. The objective of this work was to compare two production systems: a) industrial agriculture, b) agroecological transition with respect to the impact on the glyphosate load and the organic matter content in the soil and its distribution in depth. The study sites were two field of 15 ha each located at Barrow Experimental Station (38°19´S, 60°15´W). Soil ECa mapping was carried out and the complete experimental area was divided in three ECa classes with similar soil characteristics. Therefore, soil sampling was carried out by zones, based on three ECa classes at each production systems. Soil samples were taken at 0-2, 2-5, 5-10, 10-20, 20-30 and 30-40 cm depth
Energy Technology Data Exchange (ETDEWEB)
Hughes, K.R.; Moore, N.L.
1994-09-01
The U.S. Department of Energy (DOE) Office of Industrial Technology`s (OIT`s) Technology Benefits Recording System (TBRS) was developed by Pacific Northwest Laboratory (PNL). The TBRS is used to organize and maintain records of the benefits accrued from the use of technologies developed with the assistance of OIT. OIT has had a sustained emphasis on technology deployment. While individual program managers have specific technology deployment goals for each of their ongoing programs, the Office has also established a separate Technology Deployment Division whose mission is to assist program managers and research and development partners commercialize technologies. As part of this effort, the Technology Deployment Division developed an energy-tracking task which has been performed by PNL since 1977. The goal of the energy-tracking task is to accurately assess the energy savings impact of OIT-developed technologies. In previous years, information on OIT-sponsored technologies existed in a variety of forms--first as a hardcopy, then electronically in several spreadsheet formats that existed in multiple software programs. The TBRS was created in 1993 for OIT and was based on information collected in all previous years from numerous industrial contacts, vendors, and plants that have installed OIT-sponsored technologies. The TBRS contains information on technologies commercialized between 1977 and the present, as well as information on emerging technologies in the late development/early commercialization stage of the technology life cycle. For each technology, details on the number of units sold and the energy saved are available on a year-by-year basis. Information regarding environmental benefits, productivity and competitiveness benefits, or impact that the technology may have had on employment is also available.
Space Transportation Technology Workshop: Propulsion Research and Technology
2000-01-01
This viewgraph presentation gives an overview of the Space Transportation Technology Workshop topics, including Propulsion Research and Technology (PR&T) project level organization, FY 2001 - 2006 project roadmap, points of contact, foundation technologies, auxiliary propulsion technology, PR&T Low Cost Turbo Rocket, and PR&T advanced reusable technologies RBCC test bed.
AVISO+, the new reference web portal for altimetry
Rosmorduc, Vinca; Bronner, Emilie; Guinle, Thierry; Maheu, Caroline; Morrow, Rosemary; Nino, Fernando; Birol, Florence
2014-05-01
AVISO is the showcase of CNES activities in altimetry. Indeed, the altimetric products processed by the SALP service from CNES (Service d'Altimetrie et de Localisation Precise) are disseminated via AVISO portal since 1995. In recent years, AVISO became a reference in the international oceanographic and altimetry communities, with more than 5,000 registered users in 2013. In 2014 AVISO is enlarging its applications outside the purely ocean-oriented ones, thus becoming AVISO + (www.aviso.altimetry.fr). The portal opens to new applications such as hydrology / coastal / ice. Moreover, it merges with the CTOH (French Observation Service dedicated to satellite altimetry studies) website to provide users with operational as well as demonstration products and expertise in a unique website. We present here all the novelties - new look, new functionnalities, new products, new data access service… hoping to see you soon on our brand-new altimetry portal, www.aviso.altimetry.fr!
Emerging environmental technologies and environmental technology policy
Clarke, Leon Edward
This dissertation explores the role and design of environmental technology policy when environmental innovation is embodied in emerging environmental technologies such as photovoltaic cells or fuel cells. The dissertation consists of three individual studies, all of which use a simplified, general model industry between an emerging environmental technology and an entrenched, more-polluting technology. It clarifies the situations in which environmental technology policy can achieve high welfare and those in which it cannot; and it separates the possible situations an emerging environmental technology might face into four scenarios, each with its own technology policy recommendations. The second study attempts to clarify which of two factors is having a larger limiting effect on private investment in photovoltaics: the failure to internalize the environmental costs of fossil fuel electricity generation or a broad set of innovation market failures that apply to innovation irrespective of environmental concerns. The study indicates that innovation market failures are probably having a significantly larger impact than incomplete internalization. The third study explores the effectiveness of adoption subsidies at encouraging private-sector innovation. The conclusion is that adoption subsidies probably have only a limited effect on long-term, private-sector research. Two important general conclusions of the dissertation are (1) that optimal technology policy should begin with technology-push measures and end with demand-pull measures; and (2) that the technological response to internalization instruments, such as emissions taxes, may be highly nonlinear.
International Nuclear Information System (INIS)
Lee, In Sik
2002-03-01
This book is introduction of nano technology, which describes what nano technology is, alpha and omega of nano technology, the future of Korean nano technology and human being's future and nano technology. The contents of this book are nano period is coming, a engine of creation, what is molecular engineering, a huge nano technology, technique on making small things, nano materials with exorbitant possibility, the key of nano world the most desirable nano technology in bio industry, nano development plan of government, the direction of development for nano technology and children of heart.
The high resolution optical instruments for the Pleiades HR Earth observation satellites
Gaudin-Delrieu, Catherine; Lamard, Jean-Luc; Cheroutre, Philippe; Bailly, Bruno; Dhuicq, Pierre; Puig, Olivier
2017-11-01
Coming after the SPOT satellites series, PLEIADESHR is a CNES optical high resolution satellite dedicated to Earth observation, part of a larger optical and radar multi-sensors system, ORFEO, which is developed in cooperation between France and Italy for dual Civilian and Defense use. The development of the two PLEIADES-HR cameras was entrusted by CNES to Thales Alenia Space. This new generation of instrument represents a breakthrough in comparison with the previous SPOT instruments owing to a significant step in on-ground resolution, which approaches the capabilities of aerial photography. The PLEIADES-HR instrument program benefits from Thales Alenia Space long and successful heritage in Earth observation from space. The proposed solution benefits from an extensive use of existing products, Cannes Space Optics Centre facilities, unique in Europe, dedicated to High Resolution instruments. The optical camera provides wide field panchromatic images supplemented by 4 multispectral channels with narrow spectral bands. The optical concept is based on a four mirrors Korsch telescope. Crucial improvements in detector technology, optical fabrication and electronics make it possible for the PLEIADES-HR instrument to achieve the image quality requirements while respecting the drastic limitations of mass and volume imposed by the satellite agility needs and small launchers compatibility. The two flight telescopes were integrated, aligned and tested. After the integration phase, the alignment, mainly based on interferometric measurements in vacuum chamber, was successfully achieved within high accuracy requirements. The wave front measurements show outstanding performances, confirmed, after the integration of the PFM Detection Unit, by MTF measurements on the Proto-Flight Model Instrument. Delivery of the proto flight model occurred mi-2008. The FM2 Instrument delivery is planned Q2-2009. The first optical satellite launch of the PLEIADES-HR constellation is foreseen
Yerdelen-Damar, Sevda; Boz, Yezdan; Aydın-Günbatar, Sevgi
2017-08-01
This study examined the relations of preservice science teachers' attitudes towards technology use, technology ownership, technology competencies, and experiences to their self-efficacy beliefs about technological pedagogical content knowledge (TPACK). The present study also investigated interrelations among preservice teachers' attitudes towards technology use, technology ownership, technology competencies, and experiences. The participants of study were 665 elementary preservice science teachers (467 females, 198 males) from 7 colleges in Turkey. The proposed model based on educational technology literature was tested using structural equation modeling. The model testing results revealed that preservice teachers' technology competencies and experiences mediated the relation of technology ownership to their TPACK self efficacy beliefs. The direct relation of their possession of technology to their TPACK self efficacy beliefs was insignificant while the indirect relation through their technology competencies and experiences was significant. The results also indicated there were significant direct effects of preservice teachers' attitudes towards technology use, technology competencies, and experiences on their TPACK self efficacy beliefs.
2010-07-01
... requirements apply to importers who transport motor vehicle diesel fuel, NRLM diesel fuel, or ECA marine fuel... (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel... alternative sampling and testing requirements apply to importers who transport motor vehicle diesel fuel, NRLM...
2010-07-01
... Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Violation... California diesel fuel redesignates it as motor vehicle diesel meeting the 15 ppm sulfur standard; and (vi) The terminal includes the volumes of California diesel fuel redesignated as motor vehicle diesel fuel...
40 CFR 80.552 - What compliance options are available to motor vehicle diesel fuel small refiners?
2010-07-01
... to motor vehicle diesel fuel small refiners? 80.552 Section 80.552 Protection of Environment... Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Small Refiner Hardship Provisions § 80.552 What compliance options are available to motor vehicle diesel fuel...
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false [Reserved] 80.605 Section 80.605 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA...
2010-07-01
... ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Violation Provisions § 80.616 What are the enforcement exemptions for California diesel distributed within... for California diesel distributed within the State of California? 80.616 Section 80.616 Protection of...
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false [Reserved] 80.609 Section 80.609 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA...
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false [Reserved] 80.534 Section 80.534 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA...
2010-07-01
... PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Labeling Requirements § 80.572 What labeling requirements... retailers and wholesale purchaser-consumers of NR and NRLM diesel fuel and heating oil beginning June 1...
A tomato ER-type Ca2+-ATPase, LCA1, has a low thapsigargin-sensitivity and can transport manganese
DEFF Research Database (Denmark)
Johnson, Neil A.; Liu, F; Weeks, P. D.
2008-01-01
and directly via in vitro ATP hydrolysis. We found LCA1 to be approximately 300-fold less sensitive to thapsigargin than animal SERCAs, whereas ECA1 was thapsigargin-resistant. LCA1 showed typical pharmacological sensitivities to cyclopiazonic acid, vanadate, and eosin, consistent with it being a P...
Hall, L. O.; Soderstrom, T.; Ahlqvist, J.; Nilsson, T.
2011-01-01
This article is about collaborative learning with educational computer-assisted simulation (ECAS) in health care education. Previous research on training with a radiological virtual reality simulator has indicated positive effects on learning when compared to a more conventional alternative. Drawing upon the field of Computer-Supported…
Publications | Page 626 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Results 6251 - 6260 of 6341 ... Supermarket supply chain for fresh fruits and vegetables : opportunities and challenges for small farmers (open access) ... lessons arising from our attempts to operationalise the INRM [integrated natural resources management] approach over the last 6 years in East and Central Africa (ECA).
Simulating Peer Support for Victims of Cyberbullying
Van der Zwaan, J.M.; Dignum, M.V.; Jonker, C.M.
2010-01-01
This paper proposes a design for an Embodied Conversational Agent (ECA) that empowers victims of cyberbullying by simulating peer support. The anti-cyberbullying buddy helps a child to cope with negative emotions due to a cyberbullying incident and it shows the child how to deal with future
Photon technology. Laser processing technology; Photon technology. Laser process gijutsu
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
Survey has been conducted to develop laser processing technology utilizing the interaction between substance and photon. This is a part of the leading research on photon technology development. The photon technology development is aimed at novel technology development highly utilizing the quantum nature of photons. In the field of laser processing, high quality photons are used as tools, special functions of atoms and molecules will be discovered, and processing for functional fabrication (photon machining) will be established. A role of laser processing in industries has become significant, which is currently spreading not only into cutting and welding of materials and scalpels but also into such a special field as ultrafine processing of materials. The spreading is sometimes obstructed due to the difficulty of procurement of suitable machines and materials, and the increase of cost. The purpose of this study is to develop the optimal laser technology, to elucidate the interaction between substance and photon, and to develop the laser system and the transmission and regulation systems which realize the optimal conditions. 387 refs., 115 figs., 25 tabs.
Photon technology. Hard photon technology; Photon technology. Hard photon gijutsu
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-03-01
For the application of photon to industrial technologies, in particular, a hard photon technology was surveyed which uses photon beams of 0.1-200nm in wavelength. Its features such as selective atom reaction, dense inner shell excitation and spacial high resolution by quantum energy are expected to provide innovative techniques for various field such as fine machining, material synthesis and advanced inspection technology. This wavelength region has been hardly utilized for industrial fields because of poor development of suitable photon sources and optical devices. The developmental meaning, usable time and issue of a hard photon reduction lithography were surveyed as lithography in ultra-fine region below 0.1{mu}m. On hard photon analysis/evaluation technology, the industrial use of analysis, measurement and evaluation technologies by micro-beam was viewed, and optimum photon sources and optical systems were surveyed. Prediction of surface and surface layer modification by inner shell excitation, the future trend of this process and development of a vacuum ultraviolet light source were also surveyed. 383 refs., 153 figs., 17 tabs.
Environmental technology foresight : New horizons for technology management
Den Hond, Frank; Groenewegen, Peter
1996-01-01
Decision-making in corporate technology management and government technology policy is increasingly influenced by the environmental impact of technologies. Technology foresight (TF) and environmental impact assessment (EIA) are analyzed with regard to the roles they can play in developing long-term
International Nuclear Information System (INIS)
Brockbank, B.R.
1995-03-01
In the past two years, public and private efforts to promote development and deployment of innovative environmental technologies have shifted from the analysis of barriers to the implementation of a variety of initiatives aimed at surmounting those barriers. Particular attention has been directed at (1) streamlining fragmented technology acceptance processes within and among the states, and (2) alleviating disincentives, created by inadequate or unverified technology cost and performance data, for users and regulators to choose innovative technologies. Market fragmentation currently imposes significant cost burdens on technology developers and inhibits the investment of private capital in environmental technology companies. Among the responses to these problems are state and federal technology certification/validation programs, efforts to standardize cost/performance data reporting, and initiatives aimed at promoting interstate cooperation in technology testing and evaluation. This paper reviews the current status of these initiatives, identifies critical challenges to their success, and recommends strategies for addressing those challenges
Technology and ecological economics. Promethean technology, Pandorian potential
Energy Technology Data Exchange (ETDEWEB)
Small, Bruce [AgResearch Ltd., Private Bag 3123, Hamilton (New Zealand); Jollands, Nigel [New Zealand Centre for Ecological Economics, Massey University and Landcare Research Ltd, Private Bag 11052, Palmerston North (New Zealand)
2006-03-15
In considering social, economic and ecological impacts of new technologies it is essential to start from an understanding of human nature. This paper explores this issue drawing out some implications for ecological and neoclassical economics. The paper presents two key arguments. First, we argue that there is a growing tension between our evolved human nature and social structures and our emerging technological prowess. Modern technologies give us increasing power to manipulate the very axes of nature: space, time, energy, matter, and life. Technologies are now so powerful they give us abilities our ancestors would consider godlike. The question is posed: Are humans ready to wield the power of the gods? We have the knowledge, but do we have the wisdom? The myth of Prometheus and Pandora is considered as a metaphor for the interaction between technology, nature and universal aspects of human nature developed over eons of evolution. Second, we argue that even a 'technologically optimistic' scenario (employed by some economists) may not actually deliver Utopian outcomes. With technological advancement and diffusion there is a 'technological trickle down effect' whereby potent technologies, once available only to governments and powerful elites, become available to greater numbers of groups and individuals. The more accessible a technology, the more likely its social and ecological impacts will be shaped by the full range and extremes of human nature. These issues have implications for the development and regulation of Promethean technologies such as nuclear energy, genetic engineering and nanotechnology; technologies with unprecedented power and reach through nature. Development and diffusion of such technologies may also have implications for the ethics of the social structure of society. (author)
DEFF Research Database (Denmark)
Renard, Jean-Baptiste; Berthet, Gwenaël; Catoire, Valéry
2010-01-01
The study of the Transient Luminous Events (TLE) and of the Terrestrial Gamma-ray Flashes (TGF) will be performed soon by the satellite instruments TARANIS (CNES) and ASIM (ESA, onboard the International Space Station). In complement to these measurements, observations are proposed to be conducte...
Trends and new challenges in journalism research in Brazil
Directory of Open Access Journals (Sweden)
Sônia Virgínia Moreira
2005-12-01
Full Text Available The first part of this article is a cross section analysis of Brazilian communication research produced by postgraduate level (doctor and master programs of the Journalism Department, School of Communication and Art (ECA of the São Paulo State University (USP, Brazil, between 1989 and the beginning of 2004. ECA/USP is one of the most ancient and in infuential school of journalism inBrazil. An analysis of its production may reveal an illustration of journalism research in the country. In the first three decades of ECA’s existence, the field of journalism studies accounted for around 22% of the School’s production of theses and dissertations. The second part of the article presents some data – mostly quantitative and partially qualitative – based on a content analysis of the journal Revista Brasileira de Ciências da Comunicação. The period considered ranges from January 2000 to December 2004 (five years, ten issues.
Pang, A. L.; Ismail, H.; Abu Bakar, A.
2018-02-01
Linear low-density polyethylene (LLDPE)/poly (vinyl alcohol) (PVOH) filled with untreated kenaf (UT-KNF) and eco-friendly coupling agent (ECA)-treated kenaf (ECAT-KNF) were prepared using ThermoHaake internal mixer, respectively. Filler loadings of UT-KNF and ECAT-KNF used in this study are 10 and 40 parts per hundred parts of resin (phr). The effect of ECA on tensile properties and water absorption of LLDPE/PVOH/KNF composites were investigated. Field emission scanning electron microscopy (FESEM) analysis was applied to visualize filler-matrix adhesion. The results indicate LLDPE/PVOH/ECAT-KNF composites possess higher tensile strength and tensile modulus, but lower elongation at break compared to LLDPE/PVOH/UT-KNF composites. The morphological studies of tensile fractured surfaces using FESEM support the increment in tensile properties of LLDPE/PVOH/ECAT-KNF composites. Nevertheless, LLDPE/PVOH/UT-KNF composites reveal higher water absorption compared to LLDPE/PVOH/ECAT-KNF composites.
Directory of Open Access Journals (Sweden)
Gursoy Sonnur
2009-07-01
Full Text Available Abstract Background Ethyl-2-cyanoacrylate (ECA is a tissue adhesive material applied to close superficial wounds. The aim of this study was to explore the benefits of cyanoacrylates in the emergency department in children with current application with regard to cost-effectiveness, satisfaction and long follow up. Findings Patients were treated after assignment of the consent with an explanation by the relatives in a tertiary emergency department (ED, 2007. The evaluation was based on different superficial wound repairs due to blunt trauma within a 2-hour time period ( A total of 9 patients were evaluated and followed for 6 months. Except for one, all children were treated without any serious complications. ECA was cost-effective, time-saving, and provided successful repair satisfaction by a blinded plastic surgeon and patient/parents. Conclusion This report displayed the pediatric effective use of cyanoacrylates, even in non- traditional repairs in the emergency departments.
Using proximal soil sensors and fuzzy classification for mapping Amazonian Dark Earths
Directory of Open Access Journals (Sweden)
Mats Söderström
2013-12-01
Full Text Available We tested if hand-carried field proximal soil sensing (PSS can be used to map the distribution of anthropogenic Amazonian Dark Earths (ADE. ADE soils are rich in archaeological artefacts, nutrients, organic matter and carbon in the very stable form of pyrogenic carbon, also referred to as black carbon or biochar. To test the capacity of PSS to detect signature ADE properties we measured electrical conductivity (ECa, magnetic susceptibility (MSa and gamma ray data by transect sampling and compared these readings, using fuzzy classification, with datasets on chemical soil properties from a 28 ha large study area located on the Belterra Plateau of the Lower Amazon in northern Brazil. Results indicate that ECa and MSa measurements were good indicators of ADE signatures, but that the gamma radiation sensor was less useful in the deeply weathered soils. PSS and fuzzy classification can be used for rapid field mapping of ADE for both agricultural and archaeological purposes.
350 MW(t) MHTGR preassembly and modularization
International Nuclear Information System (INIS)
Venkatesh, M.C.; Jones, G.; Dilling, D.A.; Parker, W.J.
1991-05-01
The Modular High Temperature Gas Cooled Reactor (MHTGR) provides a safe and economical nuclear power option for the world's electrical generation needs by the turn of the century. The proposed MHTGR plant is composed of four 350 MW(t) prismatic core reactor modules, coupled to a 2(2 x 1) turbine generator producing a net plant electrical output of 538 MW(e). Each of the four reactor module is located in a below-ground level concrete silo, and consists of a reactor vessel and a steam generator vessel interconnected by a cross duct vessel. The modules, along with the service buildings, are contained within a Nuclear Island (NI). The turbine generators and power generation facilities are in the non-nuclear Energy Conversion Area (ECA). The MHTGR design reduces cost and improves schedule by maximizing shop fabrication, minimizing field fit up of the Reactor Internals components and modularizing the NI ampersand ECA facilities. 3 refs., 6 figs., 2 tabs
International Nuclear Information System (INIS)
Xue Yunjing; Gao Peiyi; Lin Yan
2007-01-01
Objective: To investigate flow patterns at carotid bifurcation in vivo by combining computational fluid dynamics (CFD)and MR angiography imaging. Methods: Seven subjects underwent contrast-enhanced MR angiography of carotid artery in Siemens 3.0 T MR. Flow patterns of the carotid artery bifurcation were calculated and visualized by combining MR vascular imaging post-processing and CFD. Results: The flow patterns of the carotid bifurcations in 7 subjects were varied with different phases of a cardiac cycle. The turbulent flow and back flow occurred at bifurcation and proximal of internal carotid artery (ICA) and external carotid artery (ECA), their occurrence and conformation were varied with different phase of a cardiac cycle. The turbulent flow and back flow faded out quickly when the blood flow to the distal of ICA and ECA. Conclusion: CFD combined with MR angiography can be utilized to visualize the cyclical change of flow patterns of carotid bifurcation with different phases of a cardiac cycle. (authors)
Learning the „Look-at-you-go” Moment in Corporate Governance Negotiation Techniques
Directory of Open Access Journals (Sweden)
Clara VOLINTIRU
2015-06-01
Full Text Available This article explores in an interdisciplinary manner the way concepts are learned or internalized, depending on the varying means of transmission, as well as on the sequencing in which the information is transmitted. In this sense, we build on the constructivist methodology framework in assessing concept acquisition in academic disciplines, at an advanced level. We also present the evolution of certain negotiation techniques, from traditional setting, to less predictable ones. This assessment is compared to a specific Pop Culture case study in which we find an expressive representation of negotiation techniques. Our methodology employs both focus groups and experimental design to test the relative positioning of theoretical concept acquisition (TCA as opposed to expressive concept-acquisition (ECA. Our findings suggest that while expressive concept acquisition (ECA via popular culture representations enhances the students understanding of negotiation techniques, this can only happen in circumstances in which a theoretical concept acquisition (TCA is pre-existent.
Science-Technology-Society or Technology-Society-Science? Insights from an Ancient Technology
Lee, Yeung Chung
2010-01-01
Current approaches to science-technology-society (STS) education focus primarily on the controversial socio-scientific issues that arise from the application of science in modern technology. This paper argues for an interdisciplinary approach to STS education that embraces science, technology, history, and social and cultural studies. By employing…
Technological economics: innovation, project management, and technology transfer
Energy Technology Data Exchange (ETDEWEB)
Bradbury, F R
1981-06-01
The relationship between economics and technology, as well as their interaction in production, productivity, project management, and in technology transfer processes are reviewed. Over the last two decades there has been an increasing interest by economists in the technologist's view of technical change and its mechanisms. The author looks at the zone between technology and economics, the technological economics, and discusses the theory of innovation recently sketched out by Nelson and Winter. The relevance to project management and technology transfer of contemporary writing by economists leads to the view that there are welcome signs of a convergence of the conceptual models now emerging and the practical problems of technology management and movement. Economists now seem more willing to come to terms with technology than technologists with economics. The economic significance of the multitudes of technically unglamorous activities in development work is seriously neglected as a result of over-emphasis on the spectacular technological break. If economic elegance were to be admitted to the criteria of success, one might get a significant improvement in the engineering of technological change. 29 references, 4 figure.
DEFF Research Database (Denmark)
Tanner, Anne Nygaard
and applied knowledge in firms, universities, research institutes etc., and 2) the existence of risk-taking actors who are willing and capable of implementing and exploiting radical technologies. This paper focuses on the former. Where evolutionary economics have been occupied by accumulation of knowledge......Despite the consent of the fundamental role technological change plays for economic growth, it seems that little attention has been paid to how new technologies come into being. In particular, an understanding of the spatial and dynamic processes driving the emergence of radical technology...... is lacking. This paper seeks to fill out this research gap by bridging the school of evolutionary economics and the school of economic geography. Following Dosi (1988) two factors are in particular important for technological change in emerging technological paradigms: 1) accumulation of scientific...
Focus on Technologies: Worry or Technology?
Directory of Open Access Journals (Sweden)
Saulius Kanišauskas
2015-10-01
Full Text Available The paper analyses different attitudes towards technologies in contemporary philosophical discourses. It points out that classical notion of technology formulated by Martin Heidegger seems to be more and more often questioned and even forgotten. As a result, it is being replaced by the theory of determinism, according to which the change of technologies determines the changes in social systems, the human being including. This happens this way and not vice versa. Nowadays technē, or “technika” (in English: technology is mostly understood in the instrumental meaning or in the meaning of power. It is considered to be a powerful means, tool or mechanism to influence, change, control and manipulate human consciousness and human feelings. Despite the fact that technologies have already been tamed, the problem of huge responsibility for using and developing them arises. It is questioned whether the increasing society’s attention to modern technologies is not a particular “technology” of the postmodern capitalism to manipulate social consciousness. In parallel with “yes” answer to this question, Albert Borgmann’s idea that the causes of technological development have an ontological dimension, i.e. the causes are rooted in the nature of human beings themselves and their desire to adore own creativity, is discussed. Thus, it becomes necessary to probe deeper into the nature of creativity.
A balloon-borne prototype for demonstrating the concept of JEM-EUSO
von Ballmoos, P.; Santangelo, A.; Adams, J. H.; Barrillon, P.; Bayer, J.; Bertaina, M.; Cafagna, F.; Casolino, M.; Dagoret, S.; Danto, P.; Distratis, G.; Dupieux, M.; Ebersoldt, A.; Ebisuzaki, T.; Evrard, J.; Gorodetzky, Ph.; Haungs, A.; Jung, A.; Kawasaki, Y.; Medina-Tanco, G.; Mot, B.; Osteria, G.; Parizot, E.; Park, I. H.; Picozza, P.; Prévôt, G.; Prieto, H.; Ricci, M.; Rodríguez Frías, M. D.; Roudil, G.; Scotti, V.; Szabelski, J.; Takizawa, Y.; Tusno, K.
2014-05-01
EUSO-BALLOON has been conceived as a pathfinder for JEM-EUSO, a mission concept for a space-borne wide-field telescope monitoring the Earth's nighttime atmosphere with the objective of recording the ultraviolet light from tracks initiated by ultra-high energy cosmic rays. Through a series of stratospheric balloon flights performed by the French Space Agency CNES, EUSO-BALLOON will serve as a test-bench for the key technologies of JEM-EUSO. EUSO-BALLOON shall perform an end-to-end test of all subsystems and components, and prove the global detection chain while improving our knowledge of the atmospheric and terrestrial ultraviolet background. The balloon-instrument also has the potential to detect for the first time UV-light generated by atmospheric air-shower from above, marking a milestone in the development of UHECR science, and paving the way for any future large scale, space-based ultra-high energy cosmic ray observatory.
[Electrogastrography and gastric emptying in non organic dyspepsia].
López Gastón, A R; López De Luise, G A; Sarmiento, A
1996-01-01
Electrogastrography allows to determinate the dominant frequency of gastric E.C.A. (electrical control activity). The aim was to investigate the gastric E.C.A. in a population of patients suffering from non-organic dispepsia (N.O.D.). Eighteen controls (9 males, 9 females, mean age 46.4 years old, SEM 3.72, range 24-72) and 52 dyspeptic patients (18 males, 34 females, mean age 54.19 years old, SEM 2.38, range 17-86) were studied. Two skin surface electrodes Ag-2ClAg were placed on epigastric area following a probabilistic antral axe. Reference electrode was placed on the right quadrant skin. In 5 patients, recordings with needle and cutaneous electrode were compared. Analogic waves were filtered, digitalized and processed. Signals were analyzed using F.F.T. (Fast Fourier Transformated) Only the predominant frequency in each block was considered, and percentage of total abnormalities on total recording time lesser than 2 c.p.m. or more than 4 c.p.m. was accepted. Recording were taken in fast time during 30 minutes, and 30 minutes after a meal containing 230 Cal. Running spectral analysis with F.F.T. In 43 non-selected patients the gastric emptying time of a mixed meal marked with 99 Tc in the solid phase was studied. 60.45% showed delayed gastric emptying. Mean of fast E.C.A. was 2.99 c.p.m. in controls, Vs 3.34 c.p.m. in dispeptic patients (p > 0.001). In the post-prandial period, mean of E.C.A. was 3.53 c.p.m. in N.O.D., and these differences were not significatives ("t", NS). 22% of controls showed isolated periods of tachygastria, but never more than 8% of the total recording time. It was seen seven six and forty five percent of arrhythmias were observed (71.15% tachygastria, 4.76% bradygastria, and 19.23% mixed) during post prandial recording in N.O.D. 48% of tachygastrias were between the range 30-60% of the time recording. Ninety six and one percent of patients with abnormal gastric emptying had gastric arrhythmias (0.05 > p > 0.02) Vs 50% in patients with
The technology vicinity: a location based view on technology
Steenhuis, H.J.; de Bruijn, E.J.; Kocaoglu, D.F.; Anderson, T.R.
2001-01-01
The issue of technology transfer has been viewed from many different perspectives. In this case the focus is on the process of (production) technology transfer. One of the difficulties in studying international technology transfer is the definition of technology. The many technology definitions that
Art technologies as possible propulsars in technological innovation
DEFF Research Database (Denmark)
Jørgensen, Lars Botin
2003-01-01
kind. This discussion, of general character, constitutes the initial part of this paper. Then it briefly looks into the final terms of the papertitle and try to relate to the diffuse and discussed technological innovation. Both aspects – art and technology and technological innovation – will be dealt...... with from a historical/hermeneutic and social constructivist point of view, as the paper moves from a general principal level to a more specific, exemplary level, where three different art technologies are presented as possible propulsars in technological innovation.......Art and technology has, as the German philosopher Martin Heidegger points out, the same etymological root. A thorough investigation of the relationship between art and technology will show how this same root has manifested itself in different times and spaces bringing results of the most variegated...
Philosophy of Technology Assumptions in Educational Technology Leadership
Webster, Mark David
2017-01-01
A qualitative study using grounded theory methods was conducted to (a) examine what philosophy of technology assumptions are present in the thinking of K-12 technology leaders, (b) investigate how the assumptions may influence technology decision making, and (c) explore whether technological determinist assumptions are present. Subjects involved…
Relations between the technological standards and technological appropriation
Directory of Open Access Journals (Sweden)
Carlos Alberto PRADO GUERRERO
2010-06-01
Full Text Available The objective of this study is to analyze the educational practices of using Blackboard in blended learning environments with students of higher education to understand the relationship between technological appropriation and standards of educational technology. To achieve that goal, the following research question was raised: ¿To what extent are the standards of education technology with the appropriation of technology in blended learning environments in higher education related? The contextual framework of this work includes the following topics: the institution, teaching, teachers and students. The design methodology that was used is of a correlation type. Correlations were carried out to determine the frequency and level in the technological standards as well as the appropriation of technology. In the comparison of the results obtained by the students, the teachers and the platform; we found that students in the school study showed a high degree of technology ownership and this was the same for the performance shown on the technological standards. It was established that teachers play a key role in developing the technological appropriation of students and performance in technology standards.
Emerging Technological Risk Underpinning the Risk of Technology Innovation
Anderson, Stuart
2012-01-01
Classes of socio-technical hazards allow a characterization of the risk in technology innovation and clarify the mechanisms underpinning emergent technological risk. Emerging Technological Risk provides an interdisciplinary account of risk in socio-technical systems including hazards which highlight: · How technological risk crosses organizational boundaries, · How technological trajectories and evolution develop from resolving tensions emerging between social aspects of organisations and technologies and · How social behaviour shapes, and is shaped by, technology. Addressing an audience from a range of academic and professional backgrounds, Emerging Technological Risk is a key source for those who wish to benefit from a detail and methodical exposure to multiple perspectives on technological risk. By providing a synthesis of recent work on risk that captures the complex mechanisms that characterize the emergence of risk in technology innovation, Emerging Tec...
Hydrogen technologies and the technology learning curve
International Nuclear Information System (INIS)
Rogner, H.-H.
1998-01-01
On their bumpy road to commercialization, hydrogen production, delivery and conversion technologies not only require dedicated research, development and demonstration efforts, but also protected niche markets and early adopters. While niche markets utilize the unique technological properties of hydrogen, adopters exhibit a willingness to pay a premium for hydrogen fueled energy services. The concept of the technology learning curve is applied to estimate the capital requirements associated with the commercialization process of several hydrogen technologies. (author)
The technology vicinity: a location based view on technology
Steenhuis, H.J.; de Bruijn, E.J.; Kocaoglu, D.F.; Anderson, T.R.
2001-01-01
The issue of technology transfer has been viewed from many different perspectives. In this case the focus is on the process of (production) technology transfer. One of the difficulties in studying international technology transfer is the definition of technology. The many technology definitions that exist are either too ‘loosely’ formulated or they require thorough expert knowledge. This results in difficulties with measuring technology and comparing different studies meaningfully. This study...
77 FR 2472 - Great Lakes Steamship Repower Incentive Program
2012-01-18
... Confidential Business Information (CBI) or other information whose disclosure is restricted by statute. Do not... Rules'' section of today's Federal Register, we are publishing a separate document that will serve as... allow the use of residual fuel in the replacement diesel engines that exceeds the global and ECA sulfur...
77 FR 2497 - Great Lakes Steamship Repower Incentive Program
2012-01-18
... allow the use of residual fuel in the replacement diesel engines that exceeds the global and ECA sulfur... changes, see the direct final rule EPA has published in the ``Rules and Regulations'' section of today's... substantial number of small entities. Small entities include small businesses, small organizations, and small...
Resolving the African Development Sclerosis: Two Strategies, No ...
African Journals Online (AJOL)
User
2011-05-20
May 20, 2011 ... Commission for Africa (ECA) and the Organization of African Unity (OAU) ... The Lagos Plan of Action for the Economic Development of Africa, .... change and committed itself to an essential continuation of the status quo in ..... monopoly capitalism than poor countries (Brown and Cummings, 1984: 124).
The Effect of Emotional Feedback on Behavioral Intention to Use Computer Based Assessment
Terzis, Vasileios; Moridis, Christos N.; Economides, Anastasios A.
2012-01-01
This study introduces emotional feedback as a construct in an acceptance model. It explores the effect of emotional feedback on behavioral intention to use Computer Based Assessment (CBA). A female Embodied Conversational Agent (ECA) with empathetic encouragement behavior was displayed as emotional feedback. More specifically, this research aims…
40 CFR 80.525 - What requirements apply to kerosene blenders?
2010-07-01
... PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Motor Vehicle Diesel Fuel Standards and Requirements § 80... means any refiner who produces NRLM or motor vehicle diesel fuel by adding kerosene to NRLM or motor...
40 CFR 80.610 - What acts are prohibited under the diesel fuel sulfur program?
2010-07-01
... AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel... supply, store or transport motor vehicle diesel fuel, NRLM diesel fuel, ECA marine fuel or heating oil... transport any diesel fuel for use in motor vehicle or nonroad engines that contains greater than 0.10...
2010-07-01
... Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel... requirements for refiners and importers of NRLM diesel fuel? 80.604 Section 80.604 Protection of Environment... importers of NRLM diesel fuel? Beginning with the annual compliance period that begins June 1, 2007, or the...
40 CFR 80.618-80.619 - [Reserved
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Violation Provisions §§ 80.618-80.619 [Reserved] Provisions for Foreign Refiners and Importers for Motor Vehicle Diesel Fuel Subject to a Temporary Compliance Option or Hardship...
2010-07-01
... in the motor vehicle diesel fuel and diesel fuel additive distribution systems? 80.592 Section 80.592... FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA... the motor vehicle diesel fuel and diesel fuel additive distribution systems? (a) Records that must be...
2010-07-01
... (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Labeling Requirements § 80.573 What labeling requirements apply to... retailers and wholesale purchaser-consumers of NRLM diesel fuel and heating oil beginning June 1, 2012? 80...
40 CFR 80.520 - What are the standards and dye requirements for motor vehicle diesel fuel?
2010-07-01
... requirements for motor vehicle diesel fuel? 80.520 Section 80.520 Protection of Environment ENVIRONMENTAL... Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Motor Vehicle Diesel Fuel Standards and Requirements § 80.520 What are the standards and dye requirements for motor vehicle diesel...
40 CFR 80.597 - What are the registration requirements?
2010-07-01
... PROGRAMS (CONTINUED) REGULATION OF FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Recordkeeping and Reporting Requirements § 80.597 What are...) Registration for motor vehicle diesel fuel. Refiners having any refinery that is subject to a sulfur standard...
2010-07-01
... to motor vehicle diesel fuel downstream of the refinery or importer? 80.524 Section 80.524 Protection... FUELS AND FUEL ADDITIVES Motor Vehicle Diesel Fuel; Nonroad, Locomotive, and Marine Diesel Fuel; and ECA Marine Fuel Motor Vehicle Diesel Fuel Standards and Requirements § 80.524 What sulfur content standard...
2011-09-29
... Implementation (POGI) document for additional formatting and technical requirements. IV.3c. All federal award... guidelines and formatting instructions. IV.3f. Application Deadline and Methods of Submission: Application Deadline Date: 11/24/2011. Reference Number: ECA/A/E/EUR-12-04. Methods of Submission: Electronic and Hard...
A Test of the Relationship between Reading Ability & Standardized Biology Assessment Scores
Allen, Denise A.
2014-01-01
Little empirical evidence suggested that independent reading abilities of students enrolled in biology predicted their performance on the Biology I Graduation End-of-Course Assessment (ECA). An archival study was conducted at one Indiana urban public high school in Indianapolis, Indiana, by examining existing educational assessment data to test…
Constructive Technology Assessmentand Technology Dynamics. The Case of Clean Technologies
Schot, Johan
1992-01-01
A synthesis of neo-Schumpeterian evolutionary, sociological, and historical coevolution ary models could be used for constructive technology assessment, aimed at the active management of the process of technological change. This article proposes a synthetic quasi-evolutionary model, in which
Technology assessment of thermal treatment technologies using ORWARE
International Nuclear Information System (INIS)
Assefa, G.; Eriksson, O.; Frostell, B.
2005-01-01
A technology assessment of thermal treatment technologies for wastes was performed in the form of scenarios of chains of technologies. The Swedish assessment tool, ORWARE, was used for the assessment. The scenarios of chains of thermal technologies assessed were gasification with catalytic combustion, gasification with flame combustion, incineration and landfilling. The landfilling scenario was used as a reference for comparison. The technologies were assessed from ecological and economic points of view. The results are presented in terms of global warming potential, acidification potential, eutrophication potential, consumption of primary energy carriers and welfare costs. From the simulations, gasification followed by catalytic combustion with energy recovery in a combined cycle appeared to be the most competitive technology from an ecological point of view. On the other hand, this alternative was more expensive than incineration. A sensitivity analysis was done regarding electricity prices to show which technology wins at what value of the unit price of electricity (SEK/kW h). Within this study, it was possible to make a comparison both between a combined cycle and a Rankine cycle (a system pair) and at the same time between flame combustion and catalytic combustion (a technology pair). To use gasification just as a treatment technology is not more appealing than incineration, but the possibility of combining gasification with a combined cycle is attractive in terms of electricity production. This research was done in connection with an empirical R and D work on both gasification of waste and catalytic combustion of the gasified waste at the Division of Chemical Technology, Royal Institute of Technology (KTH), Sweden
Technology Games: Using Wittgenstein for Understanding and Evaluating Technology.
Coeckelbergh, Mark
2017-08-15
In the philosophy of technology after the empirical turn, little attention has been paid to language and its relation to technology. In this programmatic and explorative paper, it is proposed to use the later Wittgenstein, not only to pay more attention to language use in philosophy of technology, but also to rethink technology itself-at least technology in its aspect of tool, technology-in-use. This is done by outlining a working account of Wittgenstein's view of language (as articulated mainly in the Investigations) and by then applying that account to technology-turning around Wittgenstein's metaphor of the toolbox. Using Wittgenstein's concepts of language games and form of life and coining the term 'technology games', the paper proposes and argues for a use-oriented, holistic, transcendental, social, and historical approach to technology which is empirically but also normatively sensitive, and which takes into account implicit knowledge and know-how. It gives examples of interaction with social robots to support the relevance of this project for understanding and evaluating today's technologies, makes comparisons with authors in philosophy of technology such as Winner and Ihde, and sketches the contours of a phenomenology and hermeneutics of technology use that may help us to understand but also to gain a more critical relation to specific uses of concrete technologies in everyday contexts. Ultimately, given the holism argued for, it also promises a more critical relation to the games and forms of life technologies are embedded in-to the ways we do things.
Dickin, Katherine L.; Dollahite, Jamie S.; Habicht, Jean-Pierre
2010-01-01
Objective: To investigate how paraprofessional Community Nutrition Educators' (CNEs') perceptions of work context relate to job satisfaction and intention to leave the position. Design: Cross-sectional statewide survey of program personnel. Setting: Expanded Food and Nutrition Education Program (EFNEP) sites (n = 32) serving low- income families…
Clean coal technologies in Japan: technological innovation in the coal industry
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-12-15
This brochure reviews the history clean coal technologies (CCT) in Japan and systematically describes the present state of CCT insofar. The brochure contains three parts. Part 1. CCT classifications; Part 2. CCT overview; and Part 3. Future outlook for CCT. The main section is part 2 which includes 1) technologies for coal resources development; 2) coal-fired power generation technologies - combustion technologies and gasification technologies; 3) iron making and general industry technologies; 4) multi-purpose coal utilization technologies - liquefaction technologies, pyrolysis technologies, powdering, fluidization, and co-utilisation technologies, and de-ashing and reforming technologies; 5) Environmental protection technologies - CO{sub 2} recovery technologies; flue gas treatment and gas cleaning technologies, and technologies to effectively use coal has; 6) basic technologies for advanced coal utilization; and 7) co-production systems.
Technology Matters - When new technology reshape innovation
DEFF Research Database (Denmark)
Edwards, Kasper; Pedersen, Jørgen Lindgaard
2004-01-01
Management of innovation is an important issue for firms and being good at this may be the deciding difference between death and survival. This paper ar-gues, based on 12 case studies, that new technology influence the innovative ca-pability of firms and disturbingly the process appears...... not to be managed in the sense that aims, instruments and resources are unclear. It is observed that new technology is adopted with a limited scope and fo-cus – often to solve a particular technical problem e.g. the quality of specifica-tion are too low. For a single reason a new technology is introduced within...... the firm, which over time becomes a source of innovation. However, through adoption of this new technology firms engage in a mu-tual learning and forming process where the firm learn by using the new technol-ogy. When learning, the firm and the new technology is mutually formed as the firm tries to adopt...
Subjective Technology Adaptivity Predicts Technology Use in Old Age.
Kamin, Stefan T; Lang, Frieder R; Beyer, Anja
2017-01-01
To date, not much is known about the psychological and motivational factors underlying technology use in late life. What are the interindividual determinants that lead older adults to invest in using technological innovations despite the age-related physiological changes that impose challenges on behavioral plasticity in everyday life? This research explores interindividual differences in subjective technology adaptivity - a general technology-related motivational resource that accounts for technology use in late life. More specifically, we investigate the influence of this factor relative to demographic characteristics, personality traits, and functional limitations in a longitudinal sample of community-dwelling older adults. We report results from a paper-and-pencil survey with 136 older adults between 59 and 92 years of age (mean = 71.4, SD = 7.4). Of those participants, 77 participated in a 2-year follow-up. We assessed self-reports of technology use, subjective technology adaptivity, functional limitations, and the personality traits openness to new experiences and neuroticism. Higher levels of subjective technology adaptivity were associated with technology use at the first measurement as well as increased use over the course of 2 years. Subjective technology adaptivity is a significant predictor of technology use in old age. Our findings contribute to improving the understanding of interindividual differences when using technological innovation in late life. Moreover, our findings have implications in the context of user involvement and may contribute to the successful development of innovative technology for older adults. © 2017 S. Karger AG, Basel.
Imaging of Dual Ophthalmic Arteries: Identification of the Central Retinal Artery
Directory of Open Access Journals (Sweden)
Louise Louw
2014-01-01
Full Text Available Identification of the origin of the central retinal artery (CRA is imperative in tailoring angiographic studies to resolve a given clinical problem. A case with dual ophthalmic arteries (OAs, characterized by different origins and distinct branching patterns, is documented for training purposes. Pre-clinical diagnosis of a 9-year-old child who presented with a sharp wire in the left-side eyeball was primarily corneal laceration. For imaging, a selected six-vessel angiographic study with the transfemoral approach was performed. Embolization was not required and the wire could be successfully removed. Right-side OA anatomy was normal, while left-side dual OAs with external carotid artery (ECA and internal carotid artery (ICA origins were seen. The case presented with a left-side meningo-ophthalmic artery (M-OA anomaly via the ECA, marked by a middle meningeal artery (MMA (origin: Maxillary artery; course: Through foramen spinosum with normal branches (i.e. anterior and posterior branches, and an OA variant (course: Through superior orbital fissure with a distinct orbital branching pattern. A smaller OA (origin: ICA; course: Through optic foramen with a distinct ocular branching pattern presented with the central retinal artery (CRA. The presence of the dual OAs and the M-OA anomaly can be explained by disturbed evolutionary changes of the primitive OA and stapedial artery during development. The surgical interventionist must be aware of dual OAs and M-OA anomalies with branching pattern variations on retinal supply, because of dangerous extracranial-intracranial anastomotic connections. It is of clinical significance that the origin of the CRA from the ICA or ECA must be determined to avoid complications to the vision.
[Prevalence of carotid artery stenosis in nonagenarians: Survey in a primary care hospital].
Bohlender, J; Nussberger, J; Ménard, J; Bohlender, B
2017-06-01
Carotid artery stenosis increases with age and may cause brain ischemia if arterial hypotension occurs. We performed a monocentric pilot study to investigate its prevalence in the very elderly and to assess its potential influence on blood pressure (BP) goals during antihypertensive treatment. All patients≥90 years of a primary care medical ward were prospectively included over 15 months. Ultrasound exams of the precerebral arteries were offered to all elderly patients for routine evaluation of their cardiovascular risk. Frequencies of stenosed common, internal and external carotid arteries (CCA, ICA, ECA) were analyzed together with clinical BP and antihypertensive therapy. Patients with circulatory shock and readmissions were excluded. Sixty-three patients aged 92±3 years (78% female) hospitalized for a median of 11 days were included. On admission, 76% were on antihypertensive drugs vs. 86% at discharge. Mean admission BP was 149/77 vs. 129/72mmHg at discharge; systolic BP<140mmHg 36% vs 64% (P<0.05). Mean intima-media thickness (ACC, right/left) was 8.7/9.4mm. Prevalence of plaque or stenosis<60% was: CCA 19.0%, ICA 19.0%, ECA 31.7%, bulb 74.6%; of stenosis≥60%: CCA 0%, ICA 7.9%, ECA 19.0%, ICA bilateral 1.6% (unilateral occlusion 3.1%, no bilateral). Coincidence of systolic BP<120mmHg and ACI stenosis≥60% had a probability of 1-2%. Concerning the risk of brain ischemia due to carotid artery stenosis, a BP goal<140mmHg should be safe for most nonagenarians. If individual BP goals are lower, searching for significant stenosis by ultrasound may be useful. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Delavault, Stéphanie; Prieur, Pascal; Liénart, Thomas; Robert, Alain; Guidotti, Pierre-Yves
2018-04-01
Microscope is a CNES-ESA-ONERA-CNRS-OCA-DLR-ZARM mission dedicated to the test of the Equivalence Principle with an improved accuracy of 10-15. The 300 kg drag-free microsatellite was launched on April 25th 2016 into a 710 km dawndusk sun-synchronous orbit for a 2-year mission. To comply with stringent requirements, the drag-free and attitude control system (DFACS) involves the scientific accelerometer as main sensor and a set of 8 cold gas proportional thrusters. Once in mission mode, within the CNES drag-free expertise center (CECT) the DFACS team provides several services to the system and to the scientific mission center: cold gas monitoring and management, `Attitude' ancillary data, DFACS expertise ancillary data. For this purpose, expertise tools have been implemented in the CECT, using the flexibility and efficiency of Matlab™ utilities. This paper presents the role of the CECT within the mission and details the expertise activities of the DFACS team illustrated with some typical in flight results.
ATTITUDE ASSESSMENT USING PLEIADES-HR CAPABILITIES
Directory of Open Access Journals (Sweden)
J. M. Delevit
2012-07-01
Full Text Available Since SPOT1, the French national space centre (CNES has worked on improving the geometry of Earth observation spacecrafts. The accuracy of sensor calibration is one of the main key points for any Earth observation application such as orthorectification, DEM generation or surface change detection. For the last twenty years CNES has developed two families of methods: absolute methods and relative methods. These methods are used to characterize a pushbroom acquisition along the detector line and the time line. By this way, the viewing directions are measured and the residual of the spacecraft’s attitude angles (not restituted by the Attitude and Orbit Control System is estimated. This information can complete the geometric model of all the scenes acquired by the instrument and is used in all geometric applications. This paper presents new attitude assessment methods taking advantage of the capabilities of Pléiades-HR in terms of agility and focal plane arrangement – panchromatic band and multispectral (MS bands.
Risk Assessment During the Final Phase of an Uncontrolled Re-Entry
Gaudel, A.; Hourtolle, C.; Goester, J. F.; Fuentes, N.
2013-09-01
As French National Space Agency, CNES is empowered to monitor compliance with technical regulations of the French Space Operation Act, FSOA, and to take all necessary measures to ensure the safety of people, property, public health and environment for all space operations involving French responsibility at international level.Therefore, CNES developed ELECTRA that calculates the risk for ground population involved in three types of events: rocket launching, controlled re-entry and uncontrolled re-entry. For the first two cases, ELECTRA takes into account degraded cases due to a premature stop of propulsion.Major evolutions were implemented recently on ELECTRA to meet new users' requirements, like the risk assessment during the final phase of uncontrolled re-entry, that can be combined with the computed risk for each country involved by impacts.The purpose of this paper is to provide an overview of the ELECTRA method and main functionalities, and then to highlight these recent improvements.
Civitani, Marta; Djalal, Sophie; Chipaux, Remi
2009-08-01
In a X-ray telescope in formation flight configuration, the optics and the focal-plane detectors reside in two different spacecraft. The dynamics of the detector spacecraft (DSC) with respect to the mirror spacecraft (MSC, carrying the mirrors of the telescope) changes continuously the arrival positions of the photons on the detectors. In this paper we analyze this issue for the case of the SIMBOL-X hard X-ray mission, extensively studied by CNES and ASI until 2009 spring. Due to the existing gaps between pixels and between detector modules, the dynamics of the system may produce a relevant photometric effect. The aim of this work is to present the optimization study of the control-law algorithm with respect to the detector's geometry. As the photometric effect may vary depending upon position of the source image on the detector, the analysis-carried out using the simuLOS (INAF, CNES, CEA) simulation tool-is extended over the entire SIMBOL-X field of view.
Towards a laboratory breadboard for PEGASE, the DARWIN pathfinder
Cassaing, F.; Le Duigou, J.-M.; Sorrente, B.; Fleury, B.; Gorius, N.; Brachet, F.; Buisset, C.; Ollivier, M.; Hénault, F.; Mourard, D.; Rabbia, Y.; Delpech, M.; Guidotti, P.-Y.; Léger, A.; Barillot, M.; Rouan, D.; Rousset, G.
2017-11-01
PEGASE, a spaceborne mission proposed to the CNES, is a 2-aperture interferometer for nulling and interferometric imaging. PEGASE is composed of 3 free-flying satellites (2 siderostats and 1 beam combiner) with baselines from 50 to 500 m. The goals of PEGASE are the spectroscopy of hot Jupiter (Pegasides) and brown dwarves, the exploration of the inner part of protoplanetary disks and the validation in real space conditions of nulling and visibility interferometry with formation flying. During a phase-0 study performed in 2005 at CNES, ONERA and in the laboratories, the critical subsystems of the optical payload have been investigated and a preliminary system integration has been performed. These subsystems are mostly the broadband (2.5-5 μm) nuller and the cophasing system (visible) dedicated to the real-time control of the OPD/tip/tilt inside the payload. A laboratory breadboard of the payload is under definition and should be built in 2007.
The spotted gar genome illuminates vertebrate evolution and facilitates human-to-teleost comparisons
Braasch, Ingo; Gehrke, Andrew R.; Smith, Jeramiah J.; Kawasaki, Kazuhiko; Manousaki, Tereza; Pasquier, Jeremy; Amores, Angel; Desvignes, Thomas; Batzel, Peter; Catchen, Julian; Berlin, Aaron M.; Campbell, Michael S.; Barrell, Daniel; Martin, Kyle J.; Mulley, John F.; Ravi, Vydianathan; Lee, Alison P.; Nakamura, Tetsuya; Chalopin, Domitille; Fan, Shaohua; Wcisel, Dustin; Cañestro, Cristian; Sydes, Jason; Beaudry, Felix E. G.; Sun, Yi; Hertel, Jana; Beam, Michael J.; Fasold, Mario; Ishiyama, Mikio; Johnson, Jeremy; Kehr, Steffi; Lara, Marcia; Letaw, John H.; Litman, Gary W.; Litman, Ronda T.; Mikami, Masato; Ota, Tatsuya; Saha, Nil Ratan; Williams, Louise; Stadler, Peter F.; Wang, Han; Taylor, John S.; Fontenot, Quenton; Ferrara, Allyse; Searle, Stephen M. J.; Aken, Bronwen; Yandell, Mark; Schneider, Igor; Yoder, Jeffrey A.; Volff, Jean-Nicolas; Meyer, Axel; Amemiya, Chris T.; Venkatesh, Byrappa; Holland, Peter W. H.; Guiguen, Yann; Bobe, Julien; Shubin, Neil H.; Di Palma, Federica; Alföldi, Jessica; Lindblad-Toh, Kerstin; Postlethwait, John H.
2016-01-01
To connect human biology to fish biomedical models, we sequenced the genome of spotted gar (Lepisosteus oculatus), whose lineage diverged from teleosts before the teleost genome duplication (TGD). The slowly evolving gar genome conserved in content and size many entire chromosomes from bony vertebrate ancestors. Gar bridges teleosts to tetrapods by illuminating the evolution of immunity, mineralization, and development (e.g., Hox, ParaHox, and miRNA genes). Numerous conserved non-coding elements (CNEs, often cis-regulatory) undetectable in direct human-teleost comparisons become apparent using gar: functional studies uncovered conserved roles of such cryptic CNEs, facilitating annotation of sequences identified in human genome-wide association studies. Transcriptomic analyses revealed that the sum of expression domains and levels from duplicated teleost genes often approximate patterns and levels of gar genes, consistent with subfunctionalization. The gar genome provides a resource for understanding evolution after genome duplication, the origin of vertebrate genomes, and the function of human regulatory sequences. PMID:26950095
The spotted gar genome illuminates vertebrate evolution and facilitates human-teleost comparisons.
Braasch, Ingo; Gehrke, Andrew R; Smith, Jeramiah J; Kawasaki, Kazuhiko; Manousaki, Tereza; Pasquier, Jeremy; Amores, Angel; Desvignes, Thomas; Batzel, Peter; Catchen, Julian; Berlin, Aaron M; Campbell, Michael S; Barrell, Daniel; Martin, Kyle J; Mulley, John F; Ravi, Vydianathan; Lee, Alison P; Nakamura, Tetsuya; Chalopin, Domitille; Fan, Shaohua; Wcisel, Dustin; Cañestro, Cristian; Sydes, Jason; Beaudry, Felix E G; Sun, Yi; Hertel, Jana; Beam, Michael J; Fasold, Mario; Ishiyama, Mikio; Johnson, Jeremy; Kehr, Steffi; Lara, Marcia; Letaw, John H; Litman, Gary W; Litman, Ronda T; Mikami, Masato; Ota, Tatsuya; Saha, Nil Ratan; Williams, Louise; Stadler, Peter F; Wang, Han; Taylor, John S; Fontenot, Quenton; Ferrara, Allyse; Searle, Stephen M J; Aken, Bronwen; Yandell, Mark; Schneider, Igor; Yoder, Jeffrey A; Volff, Jean-Nicolas; Meyer, Axel; Amemiya, Chris T; Venkatesh, Byrappa; Holland, Peter W H; Guiguen, Yann; Bobe, Julien; Shubin, Neil H; Di Palma, Federica; Alföldi, Jessica; Lindblad-Toh, Kerstin; Postlethwait, John H
2016-04-01
To connect human biology to fish biomedical models, we sequenced the genome of spotted gar (Lepisosteus oculatus), whose lineage diverged from teleosts before teleost genome duplication (TGD). The slowly evolving gar genome has conserved in content and size many entire chromosomes from bony vertebrate ancestors. Gar bridges teleosts to tetrapods by illuminating the evolution of immunity, mineralization and development (mediated, for example, by Hox, ParaHox and microRNA genes). Numerous conserved noncoding elements (CNEs; often cis regulatory) undetectable in direct human-teleost comparisons become apparent using gar: functional studies uncovered conserved roles for such cryptic CNEs, facilitating annotation of sequences identified in human genome-wide association studies. Transcriptomic analyses showed that the sums of expression domains and expression levels for duplicated teleost genes often approximate the patterns and levels of expression for gar genes, consistent with subfunctionalization. The gar genome provides a resource for understanding evolution after genome duplication, the origin of vertebrate genomes and the function of human regulatory sequences.
DEFF Research Database (Denmark)
2010-01-01
This book is aimed at anyone who is interested in learning more about living technology, whether coming from business, the government, policy centers, academia, or anywhere else. Its purpose is to help people to learn what living technology is, what it might develop into, and how it might impact...... our lives. The phrase 'living technology' was coined to refer to technology that is alive as well as technology that is useful because it shares the fundamental properties of living systems. In particular, the invention of this phrase was called for to describe the trend of our technology becoming...... increasingly life-like or literally alive. Still, the phrase has different interpretations depending on how one views what life is. This book presents nineteen perspectives on living technology. Taken together, the interviews convey the collective wisdom on living technology's power and promise, as well as its...
Farm scale application of EMI and FDR sensors to measuring and mapping soil water content
Rallo, Giovanni; Provenzano, Giuseppe
2017-04-01
Soil water content (SWC) controls most water exchange processes within and between the soil-plants-atmosphere continuum and can therefore be considered as a practical variable for irrigation farmer choices. A better knowledge of spatial SWC patterns could improve farmer's awareness about critical crop water status conditions and enhance their capacity to characterize their behavior at the field or farm scale. However, accurate soil moisture measurement across spatial and temporal scales is still a challenging task and, specifically at intermediate spatial (0.1-100 ha) and temporal (minutes to days) scales, a data gap remains that limits our understanding over reliability of the SWC spatial measurements and its practical applicability in irrigation scheduling. In this work we compare the integrated EM38 (Geonics Ltd. Canada) response, collected at different sensor positions above ground to that obtained by integrating the depth profile of volumetric SWC measured with Diviner 2000 (Sentek) in conjunction with the depth response function of the EM38 when operated in both horizontal and vertical dipole configurations. On a 1.0-ha Olive grove site in Sicliy (Italy), 200 data points were collected before and after irrigation or precipitation events following a systematic sampling grid with focused measurements around the tree. Inside two different zone of the field, characterized from different soil physical properties, two Diviner 2000 access tube (1.2 m) were installed and used for the EM38 calibration. After calibration, the work aimed to propose the combined use of the FDR and EMI sensors to measuring and mapping root zone soil water content. We found strong correlations (R2 = 0.66) between Diviner 2000 SWC averaged to a depth of 1.2 m and ECa from an EM38 held in the vertical mode above the soil surface. The site-specific relationship between FDR-based SWC and ECa was linear for the purposes of estimating SWC over the explored range of ECa monitored at field levels
Directory of Open Access Journals (Sweden)
Olívia S. N. Santos
2012-08-01
Full Text Available Neste trabalho se estudaram o desenvolvimento e o estado nutricional de helicônias irrigadas com água residuária tratada de origem doméstica associada a fertilizantes químicos (NPK. O experimento foi conduzido em casa de vegetação na qual se utilizaram plantas de helicônia Golden Adrian. O experimento foi instalado no esquema fatorial 5 x 3 + 1 constituídos de cinco níveis de lâmina de água aplicada (equivalente a 60, 80, 100, 120 e 140% da evaporação do tanque classe A ECA, três tipos de água (água residuária (AR, água pluvial (AP e mistura de 50% de AR + 50% de AP e testemunha (solo sem adubação e recebendo 100% da ECA de água pluvial. O delineamento experimental utilizado foi blocos ao acaso, com cinco repetições. A utilização de AR e as lâminas maiores proporcionaram acréscimo nos parâmetros de crescimento avaliados. Os teores de macronutrientes presentes nas folhas das plantas irrigadas com AR se comportaram de forma semelhante às plantas que receberam AP. O uso de AR e AP resultou em acréscimo de teores de micronutrientes nas folhas, principalmente Fe e Mn, acima dos teores recomendados para a cultura.In this study the growth and nutritional status of helicônias irrigated with treated wastewater of domestic origin associated with chemical fertilizers (NPK was studied. The experiment was conducted in a greenhouse utilizing plants of helicônia Golden Adrian. The experiment was installed in 5 x 3 + 1 factorial scheme consisting of five depths of irrigation water (equivalent to 60, 80, 100, 120 and 140% of class A pan evaporation - ECA, three types of water (wastewater (AR, rainwater (AP and a mixture of 50% AR + 50% AP and control (soil without fertilizer and receiving rainwater corresponding to 100% ECA. The experimental design was in randomized blocks with five repetitions. The use of AR and larger depths of irrigation provided increases in evaluated parameters of growth. The levels of macronutrients in the
International Nuclear Information System (INIS)
Williams, C.V.; Burford, T.D.
1996-08-01
Sandia National Laboratories Environmental Restoration Technologies Department is developing environmental restoration technologies through funding form the US Department of Energy's (DOE's) Office of Science and Technology. Initially, this technology development has been through the Mixed Waste Landfill Integrated Demonstration (MWLID). It is currently being developed through the Contaminant Plume containment and Remediation Focus Area, the Landfill Stabilization Focus Area, and the Characterization, Monitoring, and Sensor Cross-Cutting Program. This Technology Integration Project (TIP) was responsible for transferring MWLID-developed technologies for routine use by environmental restoration groups throughout the DOE complex and commercializing these technologies to the private sector. The MWLID's technology transfer/commercialization successes were achieved by involving private industry in development, demonstration, and technology transfer/commercialization activities; gathering and disseminating information about MWLID activities and technologies; and promoting stakeholder and regulatory involvement. From FY91 through FY95, 30 Technical Task Plans (TTPs) were funded. From these TTPs, the MWLID can claim 15 technology transfer/commercialization successes. Another seven technology transfer/commercialization successes are expected. With the changeover to the focus areas, the TIP continued the technology transfer/commercialization efforts begun under the MWLID
Energy Technology Data Exchange (ETDEWEB)
Williams, C.V.; Burford, T.D. [Sandia National Labs., Albuquerque, NM (United States). Environmental Restoration Technologies; Allen, C.A. [Tech Reps, Inc., Albuquerque, NM (United States)
1996-08-01
Sandia National Laboratories Environmental Restoration Technologies Department is developing environmental restoration technologies through funding form the US Department of Energy`s (DOE`s) Office of Science and Technology. Initially, this technology development has been through the Mixed Waste Landfill Integrated Demonstration (MWLID). It is currently being developed through the Contaminant Plume containment and Remediation Focus Area, the Landfill Stabilization Focus Area, and the Characterization, Monitoring, and Sensor Cross-Cutting Program. This Technology Integration Project (TIP) was responsible for transferring MWLID-developed technologies for routine use by environmental restoration groups throughout the DOE complex and commercializing these technologies to the private sector. The MWLID`s technology transfer/commercialization successes were achieved by involving private industry in development, demonstration, and technology transfer/commercialization activities; gathering and disseminating information about MWLID activities and technologies; and promoting stakeholder and regulatory involvement. From FY91 through FY95, 30 Technical Task Plans (TTPs) were funded. From these TTPs, the MWLID can claim 15 technology transfer/commercialization successes. Another seven technology transfer/commercialization successes are expected. With the changeover to the focus areas, the TIP continued the technology transfer/commercialization efforts begun under the MWLID.