Green street design for Bennekel district in Eindhoven

NARCIS (Netherlands)

Wouters, Ivo; Chen, W.; Oorschot, van B.; Smeenk, W.

2008-01-01

Green design and electronics technology can be integrated for enhancing our living environments and social interaction in the society. We present a novel design example, called the "Prachtpaal", for the Bennekel district in the city of Eindhoven, the Netherlands. The design of an interactive green

Veiligheidsbeoordeling van fietsroutes in Oud-Beijerland en Eindhoven.

NARCIS (Netherlands)

Twisk, D.A.M. & Hagenzieker, M.P.

1993-01-01

This report focuses on the behaviour of cyclists in response to infrastructural characteristics and the ensuing encounters between road users. The report describes the results of an evaluation of safety aspects with respect to two cycling routes, one in Oud-Beijerland and the other in Eindhoven. The

Eindhoven school for technological design : design education and design research

NARCIS (Netherlands)

Trum, H.M.G.J.; Oxman, R.M.; Bax, M.F.Th.

1995-01-01

Nine years after starting the two-year post-graduate programme on technological design [Ackermans and Trum, 1988], Eindhoven University of Technology (EUT) decided to enhance the development of synthesis-oriented engineering education by establishing a post-graduate school for technological design.

Quickscan QTI addendum #1 - Usability study of QTI for De Digitale Universiteit

NARCIS (Netherlands)

dr. Pierre Gorissen

2003-01-01

De Digitale Universiteit (DU) performed a quickscan to determine the usability of the IMS Question and TestInteroperability (QTI) specification as a format to store questions and tests developed for and by the consortium. The original report is available in Dutch from the website of De Digitale

Die opleiding van bedryfsielkundiges aan die universiteit van Fort Hare

Directory of Open Access Journals (Sweden)

W. Botha

1977-11-01

Full Text Available Die Departement Bedryfsielkunde aan die Universiteit van Fort Hare is 'n relatiewe jong departement en het eers in 1965 tot stand gekom. Voor hierdie datum is Bedryfsielkunde as 'n kort kursus deur die departement van suiwer Sielkunde aangebied en een van die destydse dosente, Dr. W. Backer, het die inisiatief geneem om 'n selfstandige departement van Bedryfsielkunde in die Fakulteit van Ekonomiese Wetenskappe op die been te bring.

Comfortable, healthy and intelligent buildings. Part 2. Comparison of buildings in the Netherlands and Germany; Comfortabele, gezonde en intelligente gebouwen. Deel 2. Nederlandse en Duitse gebouwen vergeleken

Energy Technology Data Exchange (ETDEWEB)

Lony, R.J.M. [Deerns raadgevende ingenieurs, Rijswijk (Netherlands); Molenaar, D.J.; Rietkerk, J.; Schuiling, D.J.B.W.; Zeiler, W. [Installatietechnologie, Technische Universiteit Eindhoven, Eindhoven (Netherlands)

2006-10-15

A comparison was made between four buildings in Germany and four buildings in the Netherlands. In part 1, published in this magazine in July-August, attention was paid to the first two comparisons. In this article the remaining two sets of buildings are compared. The basis of the comparison is the module Keyfactors, developed by the University of Reading in the UK, in which six aspects are compared: site, skin, shell, services, space plan, and stuff (e.g. furniture) [Dutch] De Technische Universiteit Eindhoven heeft een vergelijking gemaakt tussen vier Duitse en vier Nederlandse gebouwen. In het eerste artikel, dat is gepubliceerd in het juli-augustus-nurnmer van dit tijdschrift, zijn de eerste twee vergelijkingen behandeld, evenals de basis van de vergelijking. De basis voor het vergelijkingsonderzoek, is de module Keyfactors van de Universiteit van Reading. Deze module is gebaseerd op het vergelijken van gebouwen op zes aspecten (de 6 S-vergelijking). Dit zijn site (Iocatie), skin (gevel), shell (constructieopzet), services (installaties), space plan (ruimtelijke opzet) en stuff (meubilair). Gebaseerd op deze zes aspecten kan een vergelijking worden gemaakt tussen gebouwen. In het onderzoek van de TU/E zijn in totaal acht gebouwen paarsgewijs bekeken: de Hoftoren in Den Haag met de Post Tower in Bonn, her Thermostaete-gebouw in Bodegraven met de Landesvertretung in Berlijn (deze vier zijn in het eerste deel besproken), . In dit tweede en afsluitende artikel worden de laatste twee vergelijkingen beschreven het Forum-gebouw in Amsterdam met het Spherion in Dusseldorf en het Rijnlandhuis in Leiden met het Energieforum in Berlijn. De Duitse gebouwen zijn doorgaans innovatiever, maar de Nederlandse hebben een betere prijs-kwaliteitverhouding.

Comfortable, healthy and intelligent buildings. Part 1. Comparison of buildings in the Netherlands and Germany; Comfortabele, gezonde en intelligente gebouwen. Deel 1. Nederlandse en Duitse gebouwen vergeleken

Energy Technology Data Exchange (ETDEWEB)

Lony, R.J.M. [Deerns raadgevende ingenieurs, Rijswijk (Netherlands); Molenaar, D.J.; Rietkerk, J.; Schuiling, D.J.B.W.; Zeiler, W. [Installatietechnologie, Technische Universiteit Eindhoven, Eindhoven (Netherlands)

2006-07-15

A comparison was made between four buildings in Germany and four buildings in the Netherlands. In this part 1 attention is paid to the first two comparisons. In part 2, which will be published in this magazine in October the remaining two sets of buildings are compared. The basis of the comparison is the module Keyfactors, developed by the University of Reading in the UK, in which six aspects are compared: site, skin, shell, services, space plan, and stuff (e.g. furniture) [Dutch] De Technische Universiteit Eindhoven heeft een vergelijking gemaakt tussen vier Duitse en vier Nederlandse gebouwen. In dit artikel worden de eerste twee vergelijkingen behandeld, evenals de basis van de vergelijking. De basis voor het vergelijkingsonderzoek, is de module Keyfactors van de Universiteit van Reading. Deze module is gebaseerd op het vergelijken van gebouwen op zes aspecten (de 6 S-vergelijking). Dit zijn site (Iocatie), skin (gevel), shell (constructieopzet), services (installaties), space plan (ruimtelijke opzet) en stuff (meubilair). Gebaseerd op deze zes aspecten kan een vergelijking worden gemaakt tussen gebouwen. In het onderzoek van de TU/E zijn in totaal acht gebouwen paarsgewijs bekeken: de Hoftoren in Den Haag met de Post Tower in Bonn, her Thermostaete-gebouw in Bodegraven met de Landesvertretung in Berlijn (deze vier zijn in het eerste deel besproken). In het tweede en afsluitende artikel, dat wordt gepubliceerd in het oktober-nurnmer van dit tijdschrift, worden de laatste twee vergelijkingen beschreven het Forum-gebouw in Amsterdam met het Spherion in Dusseldorf en het Rijnlandhuis in Leiden met het Energieforum in Berlijn. De Duitse gebouwen zijn doorgaans innovatiever, maar de Nederlandse hebben een betere prijs-kwaliteitverhouding.

Uitdagend en waardevol

NARCIS (Netherlands)

Van Hal, J.D.M.

2008-01-01

Uitdagend en waardevol Intreerede Uitgesproken op 7 mei 2008 ter gelegenheid van de aanvaarding van het ambt van hoogleraar Sustainable Housing Transformation aan de Faculteit Bouwkunde van de Technische Universiteit Delft door Prof. Dr. Ir. J.D.M. van Hal.

The importance of cooperation and support for technology start-ups : a comparison of the Eindhoven and Darmstadt areas

NARCIS (Netherlands)

Halman, J.I.M.; Ulijn, J.M.; Vrande, van de V.J.A.; Umbach, F.; Ulijn, J.M.; Drillon, D.

2007-01-01

In Chapter 7, 'The importance of cooperation and support for technology start-ups: a comparison of the Eindhoven and Darmstadt areas', Johannes Halman, Jan Ulijn, Vareska van de Vrande and Frank Umbach show the results of a survey that was held among high-tech start-ups in the Eindhoven area ill the

Supply chain management in Zuidoost Azië

NARCIS (Netherlands)

Wouters, Marc; Wognum, P.M.

2005-01-01

Naast veel andere bedrijven uit de Westerse wereld en Japan zijn ook Nederlandse bedrijven actief in opkomende consumentenmarkten in andere delen van de wereld. Zij hebben dan te maken met leveranciers en klanten in die regio's. Studenten Technische Bedrijfskunde van de Universiteit Twente deden

HT 2011 : Proceedings of the 22nd ACM Conference on Hypertext and Hypermedia, Eindhoven, The Netherlands, June 6-9, 2011

NARCIS (Netherlands)

De Bra, P.M.E.; Gronbak, K.

2011-01-01

Foreword. It is our great pleasure to welcome you to ACM Hypertext 2011, the 22nd ACM Conference on Hypertext and Hypermedia, and to the "Land of the Innovator", the campus of the Eindhoven University of Technology, located in the "city of light" Eindhoven, the Netherlands. Hypertext is an exciting

Impenetrable infiltration: Air permeability of Dutch dwellings

Directory of Open Access Journals (Sweden)

Bram Entrop

2014-11-01

Full Text Available Het is wenselijk dat gebouwen beschikken over voldoende en de juiste mogelijkheden om te ventileren. Buiten de benodigde ventilatievoorzieningen is het echter de bedoeling een gebouw zo luchtdicht mogelijk te maken ten einde comfortklachten en onnodig energiegebruik te voorkomen. In het Bouwbesluit zijn eisen met betrekking tot de luchtdoorlatendheid – het tegenovergestelde van luchtdichtheid – opgenomen. Met betrekking tot een heel gebouw wordt in Art. 5.4 lid 1 het volgende geëist: De volgens NEN 2686 bepaalde luchtvolumestroom van het totaal aan verblijfsgebieden, toiletruimten en badruimten van een gebruiksfunctie is niet groter dan 0,2 m³/s. De Universiteit Twente en de Technische Universiteit Eindhoven hebben samen met het bouwbedrijf SelektHuis gewerkt aan de uitvoering van het onderzoek “Impenetrable Infiltration”. Dit onderzoek naar de luchtdoorlatendheid van woningen kent drie onderdelen, namelijk:  A. Een veldonderzoek waarbij luchtdichtheidsmetingen worden uitgevoerd op vrijstaande woningen om zo te bepalen tegen welke keuzemogelijkheden luchtdichtheidsmeters en uitvoerende bouwondernemingen aanlopen om de luchtvolumestroom te beïnvloeden; B. Een deskstudie waarbij rapportages van luchtdichtheidsmetingen worden bestudeerd om zo te bepalen wat de huidige stand van zaken is betreffende de luchtdichtheid van woningen; C. Een vergelijkend praktijkonderzoek naar het bepalen van de luchtdichtheid, waarbij drie partijen de luchtdichtheid van dezelfde duurzaam gebouwde vrijstaande woning zullen vaststellen. Om de veldstudie en het praktijkonderzoek uit te kunnen voeren, is de nodige apparatuur aangeschaft. Er is gebruik gemaakt van een blower door, een ventilator en een digitale manometer. Tevens is er tijdens de metingen gebruik gemaakt van twee dataloggers om de luchtdruk, binnen- en buitentemperatuur elke minuut vast te leggen. Er werd een anemometer gebruikt om de windsnelheid op locatie te bepalen. Om inzicht te krijgen waar

On the knowledge of students and professors at Eindhoven UNiversity of Technology

NARCIS (Netherlands)

Eikelder, ten H.M.M.; Meer, van der J.C.

2007-01-01

Using methods from statistical learning theory we compute the Vapnik-Chervonenkis dimension of full professors and students of the Eindhoven University of Technology. The results are surprising and disappointing. Furthermore, it is shown that during their study the students must have learned things

The physics of big sample instrumental neutron activation analysis

NARCIS (Netherlands)

Overwater, R.M.W.

1994-01-01

Proefschrift ter verkrijging van de graad van doctor aan de Technische Universiteit Delft, op gezag van de Rector Magnificus Prof.ir. K.F. Wakker, in het openbaar te verdedigen ten overstaan van een commissie, door het College van Dekanen aangewezen, op maandag 14 november 1994 te 16.00 uur.

The visual advice centre Eindhoven, an experiment in Dutch low vision care

NARCIS (Netherlands)

Neve, J.J.; Jorritsma, F.F.; Kinds, G.F.; Kooijman, A.C.; Looijestijn, P.L.; Welling, J.A.; Wildt, van der G.J.

1994-01-01

The Visual Advice Centre Eindhoven (VAC-E) provides the partially sighted with advice and prescriptions for low vision aids and illumination on the basis of an examination of their individual needs and their residual visual abilities. In the Dutch context of low vision care the V AC-E can be

Final report I-vision broadband : integral vision on broadband in the Eindhoven region

NARCIS (Netherlands)

Sadowski, B.M.; Matzat, U.; Kwaaitaal, J.J.B.

2007-01-01

De centrale onderzoeksvraag van het project I-Vision was "in welke mate hebben de verschillenden FTTH (Fibre-to-the-Home) initiatieven vanuit de gemeente een bijdrage geleverd aan de verbetering van het sociaal-economische welzijn van bewoners en bedrijven in de regio Eindhoven". Deze vraag is

A new concert hall for the city of Eindhoven : design and model tests

NARCIS (Netherlands)

Braat-Eggen, P.E.; van Luxemburg, Renz; Booy, L.G.; de Lange, P.A.

1993-01-01

A music centre containing a large (1300 seats) and a small (400 seats) concert hall has been built in the city of Eindhoven. The music centre is integrated into a larger building complex, called the ‘Heuvel-Galerie’, with shopping area (malls), recreational facilities, parking, offices and

Tech United Eindhoven RoboCup adult size humanoid team description 2012

OpenAIRE

Zutven, van, P.W.M.; van Dalen, S.J.; Assman, T.M.; Caarls, J.; Çilli, C.; Aarts, M.A.P.; Boshoven, Tom; Mironchyk, P.; Ilhan, E.; Nijmeijer, H.

2012-01-01

This document presents the 2012 Tech United Eindhoven adult size humanoid robot team from The Netherlands. The team contributes the adult-size humanoid robot TUlip. Here we present the mechanical design and kinematic structure of the robot. We introduce the walking gait and contribute a controller structure including gravity compensation. Finally, we describe the vision system, self localization and world model, which are used for the attacker and defender strategy in the humanoid robot socce...

A safer road environment for cyclists. Proefschrift Technische Universiteit Delft TUD.

NARCIS (Netherlands)

Schepers, P.

2013-01-01

This thesis focuses on the question of how the road environment (road design and network characteristics) affects road safety for cyclists through effects on risk and exposure to risk. In this thesis, the term ‘road design’ is used to denote the location level (e.g. intersection design) while the

Vertigo: Weiterbauen als Ubersetzungsarbeit Bert Dirrix: Transformation eines Laborgebaudes in die Architekturfakultat der TU Eindhoven

NARCIS (Netherlands)

Cisar, H.

2003-01-01

Vertigo: the translation of a commonplace monument. Bert Dirrix’s project to transform the former chemical laboratory building from the 19605 on the site of Eindhoven University into a faculty of architecture can justifiably be regarded as a complex translation process. The starting point was the

Integrated real time control of influent pumping station and primary settling tanks at WWTP Eindhoven

NARCIS (Netherlands)

van Daal-Rombouts, P.M.M.; de Jonge, J; Langeveld, J.G.; Clemens, F.H.L.R.

2016-01-01

This research deals with the design and implementation of an integrated control for the WWTP of Eindhoven. The control influences the operation of the primary settling tanks and influent pumping station to reduce reduce ammonia peaks in the WWTP effluent. The control takes into account the treatment

Particle induced X-ray emission for quantitative trace-element analysis using the Eindhoven cyclotron

International Nuclear Information System (INIS)

Kivits, H.

1980-01-01

Development of a multi-elemental trace analysis technique using PIXE (Particle Induced X-ray Emission), was started almost five years ago at the Eindhoven University of Technology, in the Cyclotron Applications Group of the Physics Department. The aim of the work presented is to improve the quantitative aspects of trace-element analysis with PIXE, as well as versatility, speed and simplicity. (Auth.)

Technische Planologie in beweging, naar een hoge kwaliteit in onderwijs

NARCIS (Netherlands)

Ike, P.

2008-01-01

In de oratie wordt een beeld geschetst van de ontwikkeling van de opleiding Technische Planologie en de daarmee samenhangende internationalisering. Tevens wordt het onderwijs-kwaliteitszorg-systeem zoals dat vanaf 2008 binnen de RUG zal worden opgezet nader belicht.

3rd international software language engineering conference (SLE) : pre-proceedings, October 12-13, 2010, Eindhoven, the Netherlands

NARCIS (Netherlands)

Brand, van den M.G.J.; Malloy, B.; Staab, S.

2010-01-01

We are pleased to present the proceedings of the Third International Conference on Software Language Engineering (SLE 2010). The conference will be held in Eindhoven, the Netherlands during October 12-13, 2010 and will be co-located with The Ninth International Conference on Generative Programming

Fostering sustainable energy entrepreneurship among students : the Business Oriented Technological System Analysis (BOTSA) program at Eindhoven University of Technology

NARCIS (Netherlands)

Wijnker, M.A.S.G.; Kasteren, van Han; Romijn, H.A.

2015-01-01

The Business Oriented Technological System Analysis (BOTSA) program is a new teaching and learning concept developed by Eindhoven University of Technology (the Netherlands) with participation from innovative companies in renewable energy. It is designed to stimulate sustainable entrepreneurship

Seminar series on `Technical building installations`. The example of refrigeration technology for air conditioning plants. Practice-oriented advanced training at Technische Akademie Esslingen training centre. Seminar series on `Technical building installations`; Lehrgangsreihe ``Technische Gebaeudeausruestung``. Beispiel: Kaeltetechnik in Klimaanlagen. Praxisnahe Fortbildung am Weiterbildungszentrum Technische Akademie Esslingen. Lehrgangsreihe ``Technische Gebaeudeausruestung``

Energy Technology Data Exchange (ETDEWEB)

Anon.

1995-04-01

The advanced training on ``Technical Building Installations`` at the Technische Akademie Esslingen has been held regularly over a period of 18 years now. The training lasts several days and comprises a total of 12 courses on the subjects: ventilation and air-conditioning, stages A-D; refrigeration, stage A; refrigeration in air conditioning glants; energy concepts for buildings and industry, stages A and B; heating in old and new buildings; sanitation, stages A and B; and, sanitation in old and new buildings. In the present article the structure of the training is illustrated for the example of refrigeration in air conditioning plants. The article also discusses questions concerning the assessment of the training and its benefit to the participants. (BWI) [Deutsch] Seit nunmehr 18 Jahren wird an der Technischen Akademie Esslingen TAE die mehrtaegige Fortbildungsveranstaltung ``Technische Gebaeudeausruestung`` durchgefuehrt. Insgesamt werden in diesem gesamten Themenkomplex 12 Lehrgaenge angeboten: Raumlufttechnik, Teil A-D; Kaeltetechnik Teil A - Kaeltetechnik in Klimaanlagen, Energiekonzepte fuer Gebaeude und Industrie, Teil A und B, Heiztechnik in Neu- und Altbauten, Sanitaertechnik Teil A und B. Am Beispiel des Themenbereiches Kaeltetechnik in Klimaanlagen wird die Lehrgangsausrichtung dargestellt. Ferner werden Fragen der Lehrgangsbewertung und der Nutzen fuer die Teilnehmer diskutiert. (BWI)

Human-machine communication for educational systems design : NATO Advanced Study Institute proceedings, Eindhoven August 16-26, 1993

NARCIS (Netherlands)

Janse, M.D.; Harrington, T.L.

1994-01-01

This book contains the papers presented at the NATO Advanced Study Institute (ASI) on the Basics of Man-Machine Communication for the Design of Educational Systems, held August 16-26, 1993 in Eindhoven, The Netherlands. The ASI addressed the state of the art in the design of educational systems with

Haalbaarheidsstudie bio-afbreekbare plastic draagtasjes : technische en economische haalbaarheid en implicaties

NARCIS (Netherlands)

Oever, van den M.J.A.; Bolck, C.H.; Bos, H.L.; Molenveld, K.; Zee, van der M.; Schennink, G.G.J.

2014-01-01

Dit rapport beschrijft de resultaten van een haalbaarheidsstudie naar de technische en economische haalbaarheid en implicaties van een verbod op dunne plastic draagtasjes in Nederland, met een eventuele uitzondering voor bioplastic draagtassen. In deze korte studie staan bioplastic draagtassen

Proceedings First Workshop on Quantitative Formal Methods : theory and applications (QFM'09, Eindhoven, The Netherlands, November 3, 2009)

NARCIS (Netherlands)

Andova, S.; McIver, A.; D'Argenio, P.R.; Cuijpers, P.J.L.; Markovski, J.; Morgan, C.; Núñez, M.

2009-01-01

This volume contains the papers presented at the 1st workshop on Quantitative Formal Methods: Theory and Applications, which was held in Eindhoven on 3 November 2009 as part of the International Symposium on Formal Methods 2009. This volume contains the final versions of all contributions accepted

Snelheidscampagne 1995 in Eindhoven : resultaten van het evaluatie-onderzoek. In opdracht van Directoraat-Generaal Rijkswaterstaat, Directie Noord-Brabant.

NARCIS (Netherlands)

Oei, H.-l. & Goldenbeld, C.

1996-01-01

In 1995, a speed campaign was conducted on the main street network in the Dutch city of Eindhoven. The campaign consisted of: (a) speed enforcement using a radar and camera from an unmarked car parked alongside the road; (b) information through the press and local radio and TV station before and

Proceedings of the International Conference on Educational Data Mining (EDM) (4th, Eindhoven, the Netherlands, July 6-8, 2011)

Science.gov (United States)

Pechenizkiy, Mykola; Calders, Toon; Conati, Cristina; Ventura, Sebastian; Romero, Cristobal; Stamper, John

2011-01-01

The 4th International Conference on Educational Data Mining (EDM 2011) brings together researchers from computer science, education, psychology, psychometrics, and statistics to analyze large datasets to answer educational research questions. The conference, held in Eindhoven, The Netherlands, July 6-9, 2011, follows the three previous editions…

Network control and optimization : third Euro-NF conference, NET-COOP 2009 Eindhoven, The Netherlands, November 23-25, 2009 : proceedings

NARCIS (Netherlands)

Nunez Queija, R.; Resing, J.A.C.

2010-01-01

Preface. We are proud to present the proceedings of NET-COOP 2009, the international conference on network control and optimization, co-organized by EURANDOM/ Eindhoven University of Technology and CWI. This year’s conference at EURANDOM, held November 23–25, was the third in line after previous

List of Participants

Science.gov (United States)

2008-11-01

Mohab Abou ZeidInstitut des Hautes Études Scientifiques, Bures-sur-Yvette Ido AdamMax-Planck-Institut für Gravitationsphysik (AEI), Potsdam Henrik AdorfLeibniz Universität Hannover Mohammad Ali-AkbariIPM, Tehran Antonio Amariti Università di Milano-Bicocca Nicola Ambrosetti Université de Neuchâtel Martin Ammon Max-Planck-Institut für Physik, München Christopher AndreyÉcole Polytechnique Fédérale de Lausanne (EPFL) Laura AndrianopoliPolitecnico di Torino David AndriotLPTHE, Université UPMC Paris VI Carlo Angelantonj Università di Torino Pantelis ApostolopoulosUniversitat de les Illes Balears, Palma Gleb ArutyunovInstitute for Theoretical Physics, Utrecht University Davide AstolfiUniversità di Perugia Spyros AvramisUniversité de Neuchâtel Mirela BabalicChalmers University, Göteborg Foday BahDigicom Ioannis Bakas University of Patras Igor BandosUniversidad de Valencia Jose L F BarbonIFTE UAM/CSIC Madrid Till BargheerMax-Planck-Institut für Gravitationsphysik (AEI), Potsdam Marco Baumgartl Eidgenössische Technische Hochschule (ETH), Zürich James BedfordImperial College London Raphael BenichouLaboratoire de Physique Théorique, École Normale Supérieure, Paris Francesco Benini SISSA, Trieste Eric Bergshoeff Centre for Theoretical Physics, University of Groningen Alice BernamontiVrije Universiteit, Brussel Julia BernardLaboratoire de Physique Théorique, École Normale Supérieure, Paris Adel Bilal Laboratoire de Physique Théorique, École Normale Supérieure, Paris Marco Billo' Università di Torino Matthias Blau Université de Neuchâtel Guillaume BossardAlbert-Einstein-Institut, Golm Leonardo BriziÉcole Polytechnique Fédérale de Lausanne (EPFL) Johannes BroedelLeibniz Universität Hannover (AEI) Tom BrownQueen Mary, University of London Ilka BrunnerEidgenössische Technische Hochschule (ETH), Zürich Erling BrynjolfssonUniversity of Iceland Dmitri BykovSteklov Institute, Moscow and Trinity College, Dublin Joan CampsUniversitat de Barcelona

Vrouwen weg van techniek : waarom verlaten technisch opgeleide vrouwen de techniek?

NARCIS (Netherlands)

Sjiera de Vries; I.A. Strijker; Rabia Çoban

2015-01-01

1.1 Techniek verliest talent Verschillende branches in de technische sector kampen met een tekort aan personeel en de verwachting is dat deze tekorten ook in de komende jaren zullen blijven bestaan (ROA, 2013). Om de tekorten op te vangen wordt hard gewerkt aan het motiveren van jongeren om een

VT-NRK Toepassing bioplastics : verbeteren van de technische eigenschappen van PLA-folies

NARCIS (Netherlands)

Molenveld, K.; Schennink, G.G.J.

2009-01-01

Het doel van dit project, VT-NRK toepassing bioplastics, is het genereren en verspreiden van kennis met betrekking tot het verbeteren van de technische eigenschappen van PLA folies. De kennis is bedoeld voor de bedrijven die binnen de kunststofindustrie aangesloten zijn bij de MJA én folies

Air-cooled recirculation cooling systems. Technical and economic comparison; Luftgekuehlte Rueckkuehlsysteme. Technisch wirtschaftlicher Vergleich

Energy Technology Data Exchange (ETDEWEB)

Dierks, G. [Fa. Jaeggi/Guentner (Schweiz) AG, Trimbach (Switzerland)

2000-03-01

There are several air-cooled forced-circulation cooling systems for heat removal from refrigeration systems. Optimum solutions should not be selected on the basis of the cost factor alone; an integrative approach should be used instead. An exemplary investigation is presented. [German] Fuer die Waermeabfuhr aus kaeltetechnischen Anlagen stehen verschiedene luftgekuehlte, zwangsbelueftete Rueckkuehlsysteme zur Verfuegung. Die Auswahl des Systems ist oft von kurzfristigem Kostendenken gepraegt, was in technischer und wirtschaftlicher Hinsicht aber nicht immer der optimalen Loesung entspricht. Erst die genauere Kenntnis der verschiedenen Systeme und eine ganzheitliche Betrachtungsweise ermoeglichen die optimale Wahl fuer den einzelnen Fall. Die hier praesentierte Untersuchung wird anhand eines konkreten Falls dargestellt, wobei Preise und technische Produktdaten auf realen Anfragen beruhen. Der Autor ist um objetive Bewertung bemueht, der Leser moege aber selbst urteilen. (orig./AKF)

Ammoniakemissie-arme huisvestingssystemen voor vleeskuikens en het effect van vloerverwarming op emissie en technische resultaten

NARCIS (Netherlands)

Middelkoop, van J.H.; Harn, van J.

1995-01-01

Het Praktijkonderzoek Pluimveehouderij heeft onderzoek gedaan naar het gebruik van emissiearme stalsystemen voor vleeskuikens en het effect van het gebruik van vloerverwarming op de technische resultaten, strooiselkwaliteit en ammoniakemissie.

3rd international software language engineering conference (SLE) : pre-proceedings, October 12-13, 2010, Eindhoven, the Netherlands

OpenAIRE

Brand, van den, M.G.J.; Malloy, B.; Staab, S.

2010-01-01

We are pleased to present the proceedings of the Third International Conference on Software Language Engineering (SLE 2010). The conference will be held in Eindhoven, the Netherlands during October 12-13, 2010 and will be co-located with The Ninth International Conference on Generative Programming and Component Engineering (GPCE'10), and The Workshop on Feature-Oriented Software Development (FOSD). An important goal of SLE is to integrate the different sub-communities of the software-language...

Low-voltage CMOS operational amplifiers theory, design and implementation

CERN Document Server

Sakurai, Satoshi

1995-01-01

Low-Voltage CMOS Operational Amplifiers: Theory, Design and Implementation discusses both single and two-stage architectures. Opamps with constant-gm input stage are designed and their excellent performance over the rail-to-rail input common mode range is demonstrated. The first set of CMOS constant-gm input stages was introduced by a group from Technische Universiteit, Delft and Universiteit Twente, the Netherlands. These earlier versions of circuits are discussed, along with new circuits developed at the Ohio State University. The design, fabrication (MOSIS Tiny Chips), and characterization of the new circuits are now complete. Basic analog integrated circuit design concepts should be understood in order to fully appreciate the work presented. However, the topics are presented in a logical order and the circuits are explained in great detail, so that Low-Voltage CMOS Operational Amplifiers can be read and enjoyed by those without much experience in analog circuit design. It is an invaluable reference boo...

Präparation spezieller Biokatalysatoren für die chemisch-technische Nutzung zur Bereitstellung von Aromaten und chiralen α-Hydroxyketonen

OpenAIRE

Bieler, Nora Christiane

2011-01-01

Teil 1 Bereitstellung der Biokatalysatoren LAC, LiP und MnP für deren chemisch-technische Nutzung Die drei Oxidoreduktasen Laccase (LAC), Lignin- und Manganperoxidase (Li- und MnP) aus Weißfäulepilzen sind technisch sehr interessant, da sie unter Anderem Lignin abbauen können. Vor allem deren zeitaufwändige Produktion in den ligninolytischen Organismen limitiert jedoch industrielle Anwendungen. Daher wurden Möglichkeiten zur Bereitstellung dieser Biokatalysatoren überprüft. So war es Ziel, di...

Technische universiteiten en duurzame ontwikkeling in Afrika : Een interfacultair studenten onderzoeksproject voor het 33e lustrumsymposium van de Technische Universiteit Delft

NARCIS (Netherlands)

Duijvestein, C.A.J.; de Vries, G.; Bos, M.; Cozijnse, K.; Findlater, J.W.; Fremouw, M.; Jonkman, J.; Oijevaar, K.; Peters, S.; van Rattinghe, K.; Sack-van Straaten, K.; De Vries, G.; Wessels, R.

2007-01-01

In 2007, Delft University of Technology celebrates its 165th birthday. This unique occasion is celebrated with several activities revolving around the subject "Sustainable Solutions, with a focus on Africa". For the interdisciplinary course "Technical Universities and Sustainable development of

An introduction to Randell Mills' Grand Unified Theory of Classical Physics (GUT-CP) : an Eindhoven University of Technology Honors Program 2007-2008 research project

NARCIS (Netherlands)

van der Heijden, E.H.M.; van der Heijden, M.A.; Roosmalen, van J.; Verdonschot, S.; Kroesen, G.M.W.; Nijdam, S.

2008-01-01

This document represents the results of a year of research as part of the Honors Program of Eindhoven University of Technology. We heard about Randell L. Mills abandoning Quantum Mechanics and proposing an alternative theory. This sounded interesting enough to contact Gerrit M.W. Kroesen whose group

Informatische Modellbildung als Dimension einer künstlerisch-technisch konzipierten Medienbildung

Directory of Open Access Journals (Sweden)

Daniela Reimann

2017-04-01

Full Text Available Heute sind nicht nur diverse gestaltungsbezogene Disziplinen gefragt, sich aktiv mit der Digitalisierung von Information und ihren Potentialen und Nebenwirkungen für Bildungsprozesse auseinander zu setzen. In Deutschland haben sich Technikdidaktik und informatische Bildung getrennt von Medienpädagogik und Mediendidaktik entwickelt und wurden entsprechend unabhängig voneinander betrieben. Dies gilt auch für die Ästhetische Bildung, die informatisch-technische Inhalte kaum je curricular in die Auseinandersetzung mit digitaler Medienkultur integriert hat, schon gar nicht systematisch. Im diesem Artikel wird, ausgehend vom Stand der Forschung (zur Integration informatischer Inhalte in die Medienbildung und den identifizierten Grundproblemen der Medienbildung zwecks Kompensation der Defizite, ein auf Gestaltung basierter Ansatz präsentiert, kontextualisiert und diskutiert, der Technikverständnis in ein Konzept integrierter Medienbildung einbezieht, dies als Bildungsziel im Sinne eines ganzheitlichen Verständnisses von Welt begreift und daher disziplinüberschreitend angelegt ist. Der Ansatz geht über technokratische Vorstellungen einer Technikdidaktik hinaus, die Medientechnologien isoliert von lebensbedeutsamen, ästhetisch-künstlerisch gestalteten Kontexten betrachtet und vermittelt. Im didaktischen Konzept werden die Grundlagen informatischer Modellbildung als relevante Teilbereiche einer zeitgemässen, am Subjekt orientierten, gleichermassen ästhetisch-künstlerisch und technisch-informatisch geprägten Medienbildung aufgewiesen, ihre pädagogischen Vorläufer, Forschungsprojekte und Nachbardisziplinen benannt sowie Ausblicke für eine zeitgemässe Medienbildung gegeben.

Risk factors for lower extremity injuries among half marathon and marathon runners of the Lage Landen Marathon Eindhoven 2012 : A prospective cohort study in the Netherlands

NARCIS (Netherlands)

Poppel van, D.; de Koning, J; Verhagen, Arianne P; Scholten-Peeters, G G M

To determine risk factors for running injuries during the Lage Landen Marathon Eindhoven 2012. Prospective cohort study. Population-based study. This study included 943 runners. Running injuries after the Lage Landen Marathon. Sociodemographic and training-related factors as well as lifestyle

De bijdrage van Direct Manipulations Enviroments aan de ontwikkeling van technische geletterdheid in de basisschool

NARCIS (Netherlands)

Slangen, L.A.M.P.; Keulen, van Hanno; Jochems, W.M.G.; Keulen, van H.; Walma van der Molen, J.

2009-01-01

Om goed te kunnen participeren in de huidige maatschappij moeten mensen in zekere mate 'technische geletterd' zijn. Dat wil zeggen: ze moeten inzicht en enige interesse hebben in de rol en impact van wetenschap en techniek, een basisniveau aan (gebruiks)kennis en vaardigheid in de praktische

The Eindhoven laparoscopic cholecystectomy training course--improving operating room performance using virtual reality training: results from the first E.A.E.S. accredited virtual reality trainings curriculum

NARCIS (Netherlands)

Schijven, M. P.; Jakimowicz, J. J.; Broeders, I. A. M. J.; Tseng, L. N. L.

2005-01-01

BACKGROUND: This study was undertaken to investigate operating room performance of surgical residents, after participating in the Eindhoven virtual reality laparoscopic cholecystectomy training course. This course is the first formal surgical resident trainings course, using a variety of

List of Participants

Science.gov (United States)

2007-11-01

Mohab Abou ZeidVrije Universiteit, Brussel Joke AdamKatholieke Universiteit Leuven Nikolas AkerblomMax-Planck-Institut für Physik, München Luis Fernando Alday Utrecht University Stelios Alexandris University of Patras Antonio Amariti Università di Milano-Bicocca Nicola Ambrosetti Université de Neuchâtel Pascal Anastasopoulos Università di Roma Tor Vergata Laura Andrianopoli Enrico Fermi Center Carlo Angelantonj Università di Torino Lilia Anguelova Queen Mary, University of London Daniel AreanUniversidade de Santiago de Compostela Gleb ArutyunovUtrecht University Spyros Avramis NTU Athens—University of Patras Ioannis Bakas University of Patras Subrata Bal Dublin Institute for Advanced Studies Igor Bandos Valencia University Jessica Barrett University of Iceland Marco Baumgartl Eidgenössische Technische Hochschule, Zürich Jacopo Bechi Università di Firenze James Bedford Queen Mary, University of London Jorge Bellorin Universidad Autonoma de Madrid Francesco Benini SISSA, Trieste Eric Bergshoeff Centre for Theoretical Physics, University of Groningen Gaetano BertoldiUniversity of Wales, Swansea Adel Bilal Laboratoire de Physique Théorique, École Normale Superieure, Paris Matthias Blau Université de Neuchâtel Johannes BroedelUniversität Hannover Felix Brümmer Universität Heidelberg Julio Cesar Bueno de Andrade São Paulo State University—UNESP Cliff Burgess McMaster University Agostino Butti Laboratoire de Physique Théorique, École Normale Superieure, Paris Marco Caldarelli Universitat de Barcelona Pablo G Camara Centre de Physique Théorique, École Polytechnique, Palaiseau Joan Camps Universitat de Barcelona Felipe Canoura FernandezUniversidade de Santiago de Compostela Luigi Cappiello Università di Napoli Federico II Luca Carlevaro École Polytechnique, Palaiseau Roberto Casero Centre de Physique Théorique, École Polytechnique, Palaiseau Claudio Caviezel Max-Planck-Institut für Physik, München Alessio Celi Universitat de Barcelona Anna

Het effect van grondontsmetting en organische bemesting op het bouwplan in de Veenkolonien : een technisch-economische analyse

NARCIS (Netherlands)

Groenwold, J.G.

1990-01-01

In dit deelonderzoek van het project "Veranderingen in de Veenkoloniale Akkerbouw" wordt aandacht besteed aan de technische en economische gevolgen van vermindering van grondontsmetting in de aardappelteelt en de haalbaarheid van dierlijke mest en groenbemesters. Berekeningen zijn uitgevoerd met en

3D pilot. Eindrapport werkgroep technische specificaties voor de opbouw van de 3D IMGeo-CityGML

NARCIS (Netherlands)

Blaauboer, J.; Goos, J.; Ledoux, H.; Penninga, F.; Reuvers, M.; Stoter, J.E.; Vosselman, M.G.

2012-01-01

Deze notitie is de eindrapportage van Activiteit 3 van de zes 3D Pilot NL Fase II activiteiten: Technische specificaties bestekteksten voor de opbouw van IMGeo-CityGML. De 3D Pilot is een initiatief van het Kadaster, Geonovum, de Nederlandse Commissie voor Geodesie en het Ministerie van

New frontiers in Combinatorial and High-Throughput Materials and Polymer Research: 3rd DPI workshop on automated synthesis and high-throughput experimentation in Polymer and Materials Research at the Eindhoven University of Technology

NARCIS (Netherlands)

Adams, N.; Schubert, U.S.

2005-01-01

The Third International Workshop on Combinatorial and High-Throughput Materials and Polymer Research, sponsored and organized by the Dutch Polymer Institute (DPI), took place at the Eindhoven University of Technol., The Netherlands, on May 26 - 27, 2004. The workshop's purpose is two-fold: its

Market segmentation end-consumers of domotica and technical control of behavior. Management summary; Marktsegmentatie eindgebruikers domotica en technische gedragssturing. Management samenvatting

Energy Technology Data Exchange (ETDEWEB)

Peeck, V.; Verheggen, P.P.; Schreurs, J.P.; Van Amersfoort, I.I. [Motivaction, Amsterdam (Netherlands)

2001-07-01

A qualitative and a quantitative study on the title subject were carried out. The quantitative study is based on the third measurement of the multi-client study in which attention is paid to attitudes (and use) of energy en the interest for domotica. The results are correlated with different types of communities. In the qualitative study attention is paid to motives to purchase domotica applications. [Dutch] Het programma DEMOS heeft in 2001 een aantal strategische studies uitgezet die elk een aspect van domotica en technische gedragsturing nader analyseren. In deze studie wordt specifiek gekeken naar de attitude van verschillende deelsegmenten consumenten inzake energie en de potentieale interesse voor domotica en technische gedragsturing, teneinde energiebesparing te realiseren. Motivaction heeft de studie, die bestaat uit een kwantitatieve en kwalitatieve fase, uitgevoerd. Voor het kwantitatieve deel is gebruik gemaakt van het multiclientonderzoek Socioconsult; gegevens daaruit op het gebied van energie en domotica zijn gekoppeld aan woonbelevingsgroepen. Vervolgens is een aantal domotica concepten voorgelegd aan en getoetst bij individuele consumenten in vier aparte groepsessies.

Beleving van de verkeersonveiligheid voor en na de invoering van verkeersmaatregelen. Resultaten van een enquete in het kader van het Demonstratieproject Herindeling en herinrichting van stedelijke gebieden (in de gemeenten Eindhoven en Rijswijk). Deel I: Hoofdrapport. Deel II: Tabellen.

NARCIS (Netherlands)

Kraay, J.H.

1984-01-01

In the municipalities of Eindhoven and Rijswijk, two residential areas, each with a surface of about one hundred hectares, three packages of infrastructural measures were carried out whereby these residential areas were separated into more obvious traffic zones and residential zones. In this

Gasification of biomass - principles and technical alternatives; Vergasung von Biomassen - Prinzipien und technische Moeglichkeiten

Energy Technology Data Exchange (ETDEWEB)

Klose, E [Technische Univ. Bergakademie, Freiberg (Germany)

1997-12-31

The technical principles of gasification are outlined, and a number of biomass gasification processes are presented and compared with the coal gasification process. On the basis of the knowledge gained in coal gasification, it will be easy to carry out the development work still required on small-scale biomass gasification systems in cooperation with the gas users. (orig) [Deutsch] Das technische Prinzip derVergasung und verschiedene Verfahrensweisen bei der Vergasung von Biomasse werden vorgestellt und mit der Kohlevergasung verglichen. Auf der Grundlage der technischen Erkenntnisse bei der Kohlevergasung einschliesslich der vor- und nachgeschalteten Prozessstufen sind die noch notwendigen verfahrens- und apparatetechnischen Entwicklungsarbeiten fuer vorwiegend kleine Anlagen in Zusammenarbeit mit den Gasnutzern durchfuehrbar. (orig)

Gasification of biomass - principles and technical alternatives; Vergasung von Biomassen - Prinzipien und technische Moeglichkeiten

Energy Technology Data Exchange (ETDEWEB)

Klose, E. [Technische Univ. Bergakademie, Freiberg (Germany)

1996-12-31

The technical principles of gasification are outlined, and a number of biomass gasification processes are presented and compared with the coal gasification process. On the basis of the knowledge gained in coal gasification, it will be easy to carry out the development work still required on small-scale biomass gasification systems in cooperation with the gas users. (orig) [Deutsch] Das technische Prinzip derVergasung und verschiedene Verfahrensweisen bei der Vergasung von Biomasse werden vorgestellt und mit der Kohlevergasung verglichen. Auf der Grundlage der technischen Erkenntnisse bei der Kohlevergasung einschliesslich der vor- und nachgeschalteten Prozessstufen sind die noch notwendigen verfahrens- und apparatetechnischen Entwicklungsarbeiten fuer vorwiegend kleine Anlagen in Zusammenarbeit mit den Gasnutzern durchfuehrbar. (orig)

Late effects of mining operations. Technical and legal aspects. Conference; Spaetfolgen des Bergbaus. Technische und rechtliche Fragen. Tagung

Energy Technology Data Exchange (ETDEWEB)

Liese, F. (comp.)

2000-07-01

The problem of late effects of mining was reviewed. Solutions were found which may be interesting to other countries as well. [German] Spaetfolgen des Bergbaus - ein sowohl technisch als auch rechtlich hochbrisantes Phaenomen: Bergwerksstandorte wurden aufgegeben, andere Oberflaechennutzungsformen machten sich auf diesem Gelaende breit. Dort koennen auch noch lange nach Einstellung des Bergbaus Schaeden eintreten. Welche technischen Ursachen haben sie? Diese Problematik wird anhand der Situation in Deutschland untersucht. Die Loesungsansaetze koennen aber auch fuer andere Laender fruchtbar gemacht werden. (orig.)

Experiences with a technically oriented plant management system; Erfahrungen mit einem technisch orientierten Betriebs-Management-System

Energy Technology Data Exchange (ETDEWEB)

Haffmann, E. [GiS Gesellschaft fuer integrierte Systemplanung mbH, Erlangen (Germany)

2000-07-01

This contribution first deals with the duality of mercantile and technical plant management systems. The following aspects are considered: reasons for and history of this duality; different approaches taken by mercantile and technical plant management systems; differences in the standardisability of mercantile and technical tasks. Dissolution of the duality through coordinated interplay. The author then goes on to explain the most important components of technically oriented maintenance management. These include the collection of technical plant data (with maintenance-relevant data and relations); the establishment of recurring tasks, the commissioning method (involving occupational safety, packaging and evaluation), compilation of manuals, reporting and accompanying plant documentation. The following tools are useful for DP-assisted maintenance: depiction of organisational and operational structures (authorisation system + IBFS application); workflow systems; modelling (data and object models); navigators; form and dialogue generators; integration of external software (project planning, CAD and Office); interface to mercantile systems. Some highlights of the C/S-IBFS were demonstrated in practice at the symposium. [German] Das Referat behandelt zunaechst die Dualitaet von kaufmaennischen und technischen Betriebs-Management-Systemen anhand folgender Aspekte: - Gruende und Historie dieser Dualitaet, - unterschiedliche Loesungsansaetze von kaufmaennischen und technischen Betriebs-Management-Systemen, - unterschiedliche Standardisierbarkeit von kaufmaennischen und technischen Aufgabenstellungen, - Aufloesung der Dualitaet durch koordniertes Zusammenwirken. Sodann werden wichtige Bausteine eines technisch orientierten Instandhaltungs-Managements erlaeutert. Dazu gehoeren die technische Anlagenerfassung (mit instandhaltungsrelevanten Daten und Relationen), die Einrichtung wiederkehrender Aufgaben, das Arbeitsauftragsverfahren (mit Arbeitssicherheit, Paketierung und

Duties of the Physikalisch-Technische Bundesanstalt (PTB) in connection with radioactive waste safeguarding and ultimate storage

International Nuclear Information System (INIS)

Roethemeyer, H.

1977-01-01

An outline of the history and duties of the Physikalisch-Technische Bundesanstalt (PTB) is to illustrate that the new duties of the PTB in connection with radioactive substance safeguarding and ultimate storage fit in very well with the range of duties of the PTB. The organisatory and technical accomplishment of these duties in cooperation with a building and operating company and with industry is explained. The department of the PTB for the 'safeguarding and ultimate storage of radioactive wastes' has an examining, appraising and licensing function in connection with construction, operation and shutdown of safety facilities. Methods for the safeguarding and ultimate storage of all the radioactive wastes in the Federal Republic of Germany are described. (HS) [de

On the computer control of the Eindhoven A.V.F. cyclotron

International Nuclear Information System (INIS)

Heusden, G.C.L. van

1976-01-01

In this thesis, the design and the results are described of the computerized control system of the Eindhoven AVF cyclotron and the beam guiding system. The beam diagnostic equipment is reviewed. At 13 radii in the cyclotron fase, probes are installed to measure the HF-phase angle of the accelerated particles. At an internal beam current of 10 μA the accuracy is, depending on the method used, 0.5deg or 0.06deg; at an interval current of 50 nA, the accuracy is 9deg and 1deg respectively. At an external beam current of more than 30 nA a decrease of the extraction efficiency, due to erroneous parameter settings, still can be measured. The accuracy of the determination of the position and width of the external beam equals 0.2 mm for beam currents larger than 30 nA. The emittance of the external beam can be determined at a number of locations in the beam guiding system with an accuracy of about 5%. In chapter 3 the data handling system is described consisting of a CAMAC system and a PDP-9 computer. The coupling between the CAMAC system and the PDP-9 is briefly discussed. Further, the software performing the various control tasks is given. The control schemes used are given along with a geometrical treatment of the least squares method. Thus a good inside can be obtained concerning the control parameters to be used. The results of the control system are given in chapter 5. The HF-phase angle of the accelerated particles can be kept within 1deg of the desired value at all radii. The extraction efficiency can be kept within 1% of the maximum value. In chapter 6, preliminary results are given on HF-phase selection, using radial and axial selecting slits. Further an acial deflection system is described which selects one out of 28 beam pulses. The axial phase selection slits together with the deflection system are used to obtain single turn extraction

Fostering Sustainable Energy Entrepreneurship among Students: The Business Oriented Technological System Analysis (BOTSA Program at Eindhoven University of Technology

Directory of Open Access Journals (Sweden)

Mara Wijnker

2015-06-01

Full Text Available The Business Oriented Technological System Analysis (BOTSA program is a new teaching and learning concept developed by Eindhoven University of Technology (the Netherlands with participation from innovative companies in renewable energy. It is designed to stimulate sustainable entrepreneurship among engineering students in this field. The program combines the placement of students in companies to study and contribute to the development and incubation of sustainable energy innovations, with a curriculum at the university designed to support these internships from a scientific perspective. The teaching method assists students in developing a broad system view that enables them to analyze the potential of, and bottlenecks to promising innovations from a realistic business perspective. This empowers students to identify those techno-economic aspects that are critical to innovation success, and advise the entrepreneurs about these aspects. Experience indicates that teachers, students, and entrepreneurs find BOTSA a valuable way of coaching, learning and working. Theoretical support for this method is found in system analysis originating in evolutionary innovation theory in combination with concepts of entrepreneurship, business model generation and sustainable/green innovation.

Measuring instruments of the Physikalisch-Technische Bundesanstalt for realization of the units of the dosimetric quantities standard ion dose, photon-equivalent dose and air-kerma

International Nuclear Information System (INIS)

Engelke, B.A.; Oetzmann, W.; Struppek, G.

1988-08-01

The realization of the units of the dosimetric quantities exposure, air-kerma and photon-equivalent dose is an important task of the Physikalisch-Technische Bundesanstalt. The report describes the measuring instruments and other technical equipment as well as the determination of the numerous corrections needed. All data and correction factors required for the realization of the units mentioned above are given in many diagrams and tables. (orig.) [de

Comprehensive understanding of mole concept subject matter according to the tetrahedral chemistry education (empirical study on the first-year chemistry students of Technische Universität Dresden)

Science.gov (United States)

Prabowo, D. W.; Mulyani, S.; van Pée, K.-H.; Indriyanti, N. Y.

2018-05-01

This research aims to apprehend: (1) the shape of tetrahedral chemistry education which is called the future of chemistry education, (2) comprehensive understanding of chemistry first-year students of Technische Universität Dresden according to the chemistry education’s tetrahedral shape on mole concept subject matter. This research used quantitative and qualitative; paper and pencil test and interview. The former was conducted in the form of test containing objective test instrument. The results of this study are (1) learning based on tetrahedral shape of chemistry education put the chemical substance (macroscopic), symbolic representation (symbol), and its process (molecular) in the context of human beings (human element) by integrating content and context, without emphasis on one thing and weaken another, (2) first-year chemistry students of Technische Universität Dresden have comprehensively understood the mole concept associated with the context of everyday life, whereby students are able to find out macroscopic information from statements that are contextual to human life and then by using symbols and formulas are able to comprehend the molecular components as well as to interpret and analyse problems effectively.

Measurement of extrapolation curves for the secondary pattern of beta radiation Nr. 86 calibrated in rapidity of absorbed dose for tissue equivalent by the Physikalisch Technische Bundesanstalt; Medicion de curvas de extrapolacion para el patron secundario de radiacion beta Nr. 86 calibrado en rapidez de dosis absorbida para tejido equivalente por el Physikalisch Technische Bundesanstalt

Energy Technology Data Exchange (ETDEWEB)

Alvarez R, J.T

1988-10-15

The following report has as objective to present the obtained results of measuring - with a camera of extrapolation of variable electrodes (CE) - the dose speed absorbed in equivalent fabric given by the group of sources of the secondary pattern of radiation Beta Nr. 86, (PSB), and to compare this results with those presented by the calibration certificates that accompany the PSB extended by the primary laboratory Physikalisch Technische Bundesanstalt, (PTB), of the R.F.A. as well as the uncertainties associated to the measure process. (Author)

Measurement of extrapolation curves for the secondary pattern of beta radiation Nr. 86 calibrated in rapidity of absorbed dose for tissue equivalent by the Physikalisch Technische Bundesanstalt

International Nuclear Information System (INIS)

Alvarez R, J.T.

1988-10-01

The following report has as objective to present the obtained results of measuring - with a camera of extrapolation of variable electrodes (CE) - the dose speed absorbed in equivalent fabric given by the group of sources of the secondary pattern of radiation Beta Nr. 86, (PSB), and to compare this results with those presented by the calibration certificates that accompany the PSB extended by the primary laboratory Physikalisch Technische Bundesanstalt, (PTB), of the R.F.A. as well as the uncertainties associated to the measure process. (Author)

Erkundungen im Spannungsfeld von Pädagogik, Spielspass und technischer Machbarkeit. Gedanken zur Konzeption und Entwicklung spielbasierter digitaler Lernumgebung

Directory of Open Access Journals (Sweden)

Florian Berger

2009-02-01

Full Text Available Computerspiele sind heute aus der digitalen Medienwelt nicht mehr wegzudenken. Ihre rasante technische Entwicklung sowie ihre hohe Akzeptanz in der Jugendkultur werfen Fragen nach pädagogischer Verwertbarkeit dieses Mediums auf. Auf diesem Gebiet besteht Forschungsbedarf: Für den Einsatz aktueller Spielkonzepte als Lehrmittel existieren keine fundierten Theorien oder Konzepte. Der schöpferische Umgang mit Spielen durch Anwender («Emergent Gameplay» bietet hier durch sein hohes Motivationspotential einen vielversprechenden Ansatz. Die oft wenig beachtete Rolle der digitalen Spielen zugrunde liegenden Softwaretechnik sollte stärkere Berücksichtigung finden: Es existiert einerseits ein für die Akzeptanz beim Anwender notwendiges Minimum, andererseits ist der Einsatz des aktuellen technischen «state of the art» für die Umsetzung pädagogischer und didaktischer Ambitionen durch seine enormen Anforderungen wenig zielführend. Im Ergebnis sind Idee und Spielspass das Mass auch für Anwendungen des Game Based Learn­ing.

The Compilation of Multilingual Concept Literacy Glossaries at the University of Cape Town: A Lexicographical Function Theoretical Approach Die samestelling van veeltaligekonsep-geletterheidswoordelyste by die Universiteit van Kaapstad: 'n Leksikografiesefunksieteoretiese benadering.

Directory of Open Access Journals (Sweden)

Dion Nkomo

2012-01-01

Full Text Available

This article proposes a lexicographical approach to the compilation of multilingual concept literacy glossaries which may play a very important role in supporting students at institutions of higher education. In order to support concept literacy, especially for students for whom English is not the native language, a number of universities in South Africa are compiling multilingual glossaries through which the use of languages other than English may be employed as auxiliary media. Terminologies in languages other than English are developed by translating English terms or coining new terms in these languages to exploit the native language competence of most students. The glossary project at the University of Cape Town (UCT which was conceived under the auspices of the Multilingualism Education Project (MEP is discussed. It is shown that the UCT glossaries are compiled using methods consistent with those employed in modern lexicography or proffered in lexicographical theory. The lexicographical function theory is specifically used to account for the glossaries and their production. It is suggested that modern lexicography can provide useful guidance for the production of glossaries, given that the earliest glossaries constitute the humble beginnings of lexicography.

Hierdie artikel stel 'n leksikografiese benadering tot die samestelling van meertaligekonsep-geletterheidswoordelyste voor wat 'n baie belangrike rol kan speel by die ondersteuning van studente by instellings vir hoër onderwys. Om konsepgeletterdheid te ondersteun, veral vir studente vir wie Engels nie die moedertaal is nie, stel 'n aantal universiteite in Suid-Afrika meertalige woordelyste saam waardeur die gebruik van ander tale as Engels as hulpmedia aangewend kan word. Terminologieë in ander tale as Engels word ontwikkel deur Engelse terme te vertaal of nuwe terme in hierdie tale te skep om die moedertaalvaardigheid van die meeste

Interpretation of SO2 dry deposition measurements made in Portugal and Spain within the framework of SREMP

NARCIS (Netherlands)

Erisman JW; LLO

1996-01-01

Het RIVM heeft deelgenomen aan het internationale project SREMP (Surface Resistance Emergency Measurement Program), tezamen met de Universiteit van Aveiro, Portugal ; de Universiteit Politecnica uit Madrid, Spanje ; de Universiteit Paul Sabatier de Toulouse, Frankrijk ; Joint Research Center,

Requirements of the Physikalisch-Technische Bundesanstalt (PTB) for therapy dosemeters with ionization chambers submitted for calibration and approval

International Nuclear Information System (INIS)

Anon.

1983-01-01

Therapy dosemeters are subject to calibration as from January 1, 1983 according to section 3 of the second ordinance concerning the obligation to calibrate measuring instruments (in the version of the ordinance concerning the amendment of the second and third ordinance about the obligation to calibrate measuring instruments of December 21, 1979, Federal Gazette I p 2347). Section 4 subsection 2 of this ordinance determines a transitional period until December 31, 1985. In this transitional period those therapy dosemeters may be used without calibration which were already in use on January 1, 1983. The requirements of the PTB correspond to the established rules of technology. They specify and complete the provisions of the standardization regulations and establish terms and conditions of the test. They passed the general assembly of the Physikalisch-Technische Bundesanstalt concerning calibration and measurement of 1982. The requirements of the PTB stipulate the admissible limits for effects of numerous influencing factors and other properties of the equipment and tolerances of calibration and handling. (orig.) [de

Techno-economic accompanying research the national competition ''Bioenergy Regions''. Final report funding measure 2009-2012; Technisch-oekonomische Begleitforschung des Bundeswettbewerbes ''Bioenergie-Regionen''. Endbericht Foerdermassnahme 2009-2012

Energy Technology Data Exchange (ETDEWEB)

Bohnet, Sebastian; Haak, Falko; Gawor, Marek [DBFZ Deutsches Biomasseforschungszentrum gemeinnuetzige GmbH, Leipzig (Germany); Thraen, Daniela [DBFZ Deutsches Biomasseforschungszentrum gemeinnuetzige GmbH, Leipzig (Germany); Helmholtz-Zentrum fuer Umweltforschung (UFZ), Leipzig (Germany)

2015-07-01

This final report describes the results of the techno-economic accompanying research of the competition of bioenergy regions. The competition was realized as a three-year funding project of the Federal Ministry of Food, Agriculture and Consumer Protection (BMELV), wherein the DBFZ analyzed the bioenergy development in the project regions and effects for regional development. The aim of the techno-economic accompanying research was to evaluate the project regions regarding the use of bioenergy. To this end, the bioenergy plants and supply chains of bioenergy as well as the raw materials used were the focus of investigations. Hereby the comparison between the regions and classification of the national average should be made possible. It was also necessary to be able to make statements about the climate protection contribution of funding the project. Not least the DBFZ supported the office of competition and the regions in answering technical-economic issues. The report is divided into a theoretical part A and the result Part B. After a summary of the results (chapter 1) and a brief overview of important and higher-level indicators (Chapter 2) the background and objectives of the competition are in Part A, first presented (Chapter 3). This is followed by Chapter 4 of the explanation of the methodological approach. Part B contains the results of the accompanying research project. The individual chapters are based respectively on the specific questions or thematic blocks of techno-economic accompanying research (Section 5-8). The final chapter 9 takes a brief look at the second funding phase from 2012 to 2015. [German] Der vorliegende Endbericht beschreibt die Ergebnisse der technisch-oekonomischen Begleitforschung zum Wettbewerb Bioenergie-Regionen. Der Wettbewerb wurde als dreijaehriges Foerdervorhaben des Bundesministeriums fuer Ernaehrung, Landwirtschaft und Verbraucherschutz (BMELV) realisiert, bei dem das DBFZ die Bioenergieentwicklung in den Projektregionen sowie

Was ein Wort bedeutet, kann ein Satz nicht sagen: Zur Bedeutung der Terminologiearbeit für die Technische Kommunikation und das Fachtextübersetzen

Directory of Open Access Journals (Sweden)

Klaus-Dirk Schmitz

2010-05-01

Full Text Available Einleitung: Dieser Beitrag geht von einem Zitat des österreichisch-britischen Philosophen Ludwig Wittgenstein aus und bezeiht sich auf seine Aussagen über Wörter und Sätze. Zielsetzung: Analyse und Diskussion der Relevanz von WittgensteinsAussage für die Terminologiearbeit in der Technischen Kommunikation und beim Fachübersetzen. Methode: Kritische Analyse und Betrachtung. Ergebnis: Neben den terminologischen Grundbegriffen Begriff, Benennung und Gegenstand werden vor allem die Definition als Begriffsbeschreibung sowie die Kriterien zur Bildung von Benennungen untersucht. Schlussfolgerung: Das Zitat von Wittgenstein lässt viele Interpretationen zu. Für die Technische Kommunikation und das Fachübersetzen muss aber die Definition (Satz den Begriff hinter der Benennung (Wort erklären. Idealerweise ist aber die Benennung so transparent, dass dadurch schon die Begriffsklärung erfolgt.

Risk factors for lower extremity injuries among half marathon and marathon runners of the Lage Landen Marathon Eindhoven 2012: A prospective cohort study in the Netherlands.

Science.gov (United States)

van Poppel, D; de Koning, J; Verhagen, A P; Scholten-Peeters, G G M

2016-02-01

To determine risk factors for running injuries during the Lage Landen Marathon Eindhoven 2012. Prospective cohort study. Population-based study. This study included 943 runners. Running injuries after the Lage Landen Marathon. Sociodemographic and training-related factors as well as lifestyle factors were considered as potential risk factors and assessed in a questionnaire 1 month before the running event. The association between potential risk factors and injuries was determined, per running distance separately, using univariate and multivariate logistic regression analysis. In total, 154 respondents sustained a running injury. Among the marathon runners, in the univariate model, body mass index ≥ 26 kg/m(2), ≤ 5 years of running experience, and often performing interval training, were significantly associated with running injuries, whereas in the multivariate model only ≤ 5 years of running experience and not performing interval training on a regular basis were significantly associated with running injuries. Among marathon runners, no multivariate model could be created because of the low number of injuries and participants. This study indicates that interval training on a regular basis may be recommended to marathon runners to reduce the risk of injury. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

Essay review: Een eeuw op zijn kop

Directory of Open Access Journals (Sweden)

Ad Maas

2015-02-01

Full Text Available Beschouwing naar aanleiding van de publicatie van (1 Andreas Weber, Hybrid ambitions. Science, governance, and empire (Leiden: Leiden University Press 2012. xi+263 pp., ISBN: 978-90-8728-1663, € 49,95; (2 Martin P.M. Weiss, The masses and the muses. A history of Teylers Museum in the nineteenth century (Dissertatie: Universiteit Leiden 2013. ix+332 pp.; (3 Hieke Huistra, Preparations on the move. The Leiden anatomical collections in the nineteenth century (Dissertatie: Universiteit Leiden 2013. ix+163 pp.; (4 P.A.J. Caljé, Student, universiteit en samenleving. De Groningse universiteit in de negentiende eeuw (Hilversum: Verloren 2009. 631 pp., ISBN: 978-90-6550-978-9, € 49,-.

Selection of compressors and drives for natural gas storage and transport - technical and economic aspects; Auswahl von Verdichtern und Antriebsmaschinen fuer die Erdgasspeicherung und den Erdgastransport - technische und wirtschaftliche Aspekte

Energy Technology Data Exchange (ETDEWEB)

Heyer, F.; Wieke, S. [Heyer und Wieke Engineering, Muenchen (Germany)

1998-12-31

Selection of the proper compressor/drive combination is indispensable for optimizing natural gas storage. The contribution presents a comparison of the available systems. (orig.) [Deutsch] Fuer die Verdichtung von Erdgas fuer die Erdgasspeicherung und den Erdgastransport ist die Auswahl der fuer den jeweiligen Anwendungsfall geeigneten Verdichter-Antriebskombination eine wesentliche Voraussetzung fuer einen technisch und wirtschaftlich optimalen Betrieb. Unter Beruecksichtigung des Marktes werden die Varianten (Verdichter-Antriebskombinationen) definiert und in einem technischen Vergleich Vor- und Nachteile der einzelnen Alternativen gegenuebergestellt und bewertet. Die Einhaltung der Betriebsanforderungen und der Anforderungen der TA-Luft und TA-Laerm, der Wirkungsgrad, die Zuverlaessigkeit und Verfuegbarkeit muessen einer besonders intensiven Pruefung und Beurteilung unterzogen werden. Das Ergebnis der vergleichenden Bewertung der Varianten kann eine neue Definition der Varianten oder der Anforderungen notwendig machen. (orig.)

Creating continuous smart city innovations

NARCIS (Netherlands)

Brock, K.M.; Voncken, R.; den Ouden, P.H.

2016-01-01

The Netherlands, and especially Eindhoven, features in the top of most entrepreneurial, technology, and innovation rankings worldwide. Not only are its companies and universities successful in innovation, but also the municipality of Eindhoven can be seen as an exemplar for other cities. The

Extensivering van de begeleiding door het inzetten van peer- en self-assessment in IMTO

NARCIS (Netherlands)

Joosten-ten Brinke, Desirée

2011-01-01

Joosten-ten Brinke, D. (2011). Extensivering van de begeleiding door het inzetten van peer- en self-Assessment in IMTO. In E. Bakker, W. Giesbertz, J. von Grumbkow, & T. Houtmans (Red.), Ontwikkeling van de onderzoekscompetentie aan de Open Universiteit (pp. 121-128). Heerlen: Open universiteit.

Optimized energy recovery in line with balancing of an ATES

NARCIS (Netherlands)

Behi, M.; Mirmohammadi, S.A.; Suma, A.B.; Palm, B.E.

2014-01-01

The present study explores the potential imbalance problem of the Aquifer Thermal Energy Storage (ATES) system at the Eindhoven University of Technology (TU/e) campus, Eindhoven. This ATES is one of the largest European aquifer thermal energy storage systems, and has a seasonal imbalance problem.

Full scale measurement of wind induced pressures : 1 configuration of wind induced pressures

NARCIS (Netherlands)

Geurts, C.P.W.; Wijen, H.L.M.

1994-01-01

A research project 10 the spectral characteristics of wind induced pressures is in progress in Eindhoven. This project includes both wind tunnel and full scale measurements. Wind induced pressures are measured in full scale at the main building of Eindhoven University of Technology. This paper

Modelation and simulation of technical systems. An introduction close to practice; Modellierung und Simulation technischer Systeme. Eine praxisnahe Einfuehrung

Energy Technology Data Exchange (ETDEWEB)

Nollau, Reiner [HAWK Hochschule fuer Angewandte Wissenschaft und Kunst - FH Hildesheim/Holzminden/Goettingen, Goettingen (Germany). Fakultaet Naturwissenschaften und Technik

2009-07-01

There is a growing trend towards using calculation programmes to design and optimise technical systems. Such programmes simulate the systems' dynamic behaviour on the basis of mathematical models. This book first presents the methods used for model identification and model description. A widely applicable basic algorithm has been derived by means of these methods. Creating an overview block diagram of the system under study constitutes an important step of model development. The methods elaborated by the author are applied to numerous examples ordered in a sequence of growing complexity and hence difficulty. The examples each end with calculations on the model's behaviour, the results of which the reader can verify. Using the applied basic algorithm as a basis the reader can efficiently examine other systems not addressed in the book. [German] Technische Systeme werden immer staerker mit Hilfe von Rechnerprogrammen entworfen und optimiert. Die Programme simulieren das dynamische Verhalten der Systeme auf der Basis von mathematischen Modellen. In diesem Buch wird zunaechst die Methodik der Modellermittlung und -beschreibung dargelegt, aus welcher ein breit anwendbarer Grundalgorithmus abgeleitet worden ist. Eine wichtige Stufe der Modellentwicklung ist das Gesamt-Blockschaltbild des untersuchten Systems. Die vom Autor erarbeitete Methodik wird auf zahlreiche Beispiele wachsender Komplexitaet und damit wachsenden Schwierigkeitsgrades angewendet. Diese Beispiele enden mit Berechnungen des Verhaltens dieser Modelle, deren Ergebnisse der Leser nachpruefen kann. Der Leser kann auf der Grundlage des angewendeten Grundalgorithmus zielstrebig andere, im Buch nicht behandelte, Systeme untersuchen. (orig.)

Magnetic resonance imaging of pulmonary perfusion. Technical requirements and diagnostic impact; MRT der Lungenperfusion. Technische Voraussetzungen und diagnostischer Stellenwert

Energy Technology Data Exchange (ETDEWEB)

Attenberger, U.I.; Buesing, K.; Schoenberg, S.O.; Fink, C. [Klinikum Mannheim der Universitaet Heidelberg, Institut fuer Klinische Radiologie und Nuklearmedizin, Universitaetsmedizin Mannheim, Mannheim (Germany); Ingrisch, M.; Reiser, M. [Klinikum der Ludwig-Maximilians-Universitaet Muenchen, Institut fuer Klinische Radiologie, Campus Grosshadern, Muenchen (Germany)

2009-08-15

With technical improvements in gradient hardware and the implementation of innovative k-space sampling techniques, such as parallel imaging, the feasibility of pulmonary perfusion MRI could be demonstrated in several studies. Dynamic contrast-enhanced 3D gradient echo sequences as used for time-resolved MR angiography have been established as the preferred pulse sequences for lung perfusion MRI. With these techniques perfusion of the entire lung can be visualized with a sufficiently high temporal and spatial resolution. In several trials in patients with acute pulmonary embolism, pulmonary hypertension and airway diseases, the clinical benefit and good correlation with perfusion scintigraphy have been demonstrated. The following review article describes the technical prerequisites, current post-processing techniques and the clinical indications for MR pulmonary perfusion imaging using MRI. (orig.) [German] Mit der Verfuegbarkeit leistungsfaehiger Gradientensysteme und schneller k-Raum-Akquisitionstechniken wie der parallelen Bildgebung konnten verschiedene Studien die Machbarkeit der Lungenperfusionsbildgebung in der MRT zeigen. In der Praxis haben sich dynamische kontrastverstaerkte 3D-Gradientenechosequenzen, wie sie fuer zeitaufgeloeste MR-Angiographien verwendet werden, fuer die Bildgebung der Lungenperfusion etabliert. Hiermit ist es moeglich, die Perfusion der gesamten Lunge mit ausreichend hoher zeitlicher und raeumlicher Aufloesung zu visualisieren. In mehren klinischen Studien konnte bei Patienten mit Lungenembolie, pulmonaler Hypertonie sowie Erkrankungen der Atemwege und des Lungenparenchyms der klinische Nutzen der Lungenperfusions-MRT und die gute Uebereinstimmung mit der Lungenperfusionsszintigraphie nachgewiesen werden. Der folgende Uebersichtsartikel beschreibt die technische Durchfuehrung, Bildnachverarbeitung und die klinischen Anwendungsgebiete der MRT zur Untersuchung der Lungenperfusion. (orig.)

Falende Universiteit: Voer voor Methodologen.

NARCIS (Netherlands)

Verschuren, P.J.M.

2002-01-01

Universities do not come up to a growing demand for practice oriented research and for students trained in this type of activity. Existing methodology mainly is theory oriented. We in large part miss methodology for producing prescriptive knowledge, for a holistic approach and for design oriented

Decontamination of burn wounds using a cold atmospheric pressure plasma jet

NARCIS (Netherlands)

van Gils, Koen; Hofmann, S.; Boekema, B.K.H.L.; Bruggeman, P.J.

2012-01-01

Decontamination of burn wounds using a cold atmospheric pressure plasma jet C.A.J. van Gils, S. Hofmann, B. Boekema and P. Bruggeman Eindhoven University of Technology, Department of Applied Physics, group EPG, P.O. Box 513, 5600 MB Eindhoven In the treatment of burn wounds bacterial infections are

Estimates of genetic parameters and genetic trend for fur traits in a ...

African Journals Online (AJOL)

Ph.D.-tesis, Universiteit van. Stellenbosch. VAN NlEKERK, AJ.A., 1972. 'n Studie van teeltprobleme by. Karakoelskape met spesiale verwysing na die Niemollerkudde. D.Sc.(Agric)-tesis, Universiteit van die 0. V.S., Bloemfontein. VAN NlEKERK, AJ.A., SCHOEMAN, SJ. & NEL, J.A., 1968. Oorerflikhede van en genetiese ...

Talking about end-of-life care in a timely manner

NARCIS (Netherlands)

Smeenk, Frank W. J. M.; Schrijver, Laurien A; van Bavel, Hennie C. J.; van de Laar, Eric F. J.

2017-01-01

In 2014, a group of physicians of the Catharina Hospital in Eindhoven (The Netherlands) started a project called “Talking about end-of-life care in a timely manner”. Just like others in the country, the Eindhoven group noticed that regularly, very frail elderly people were admitted to hospital in

Motion Control with Vision

NARCIS (Netherlands)

Ir. Dick van Schenk Brill; Ir Peter Boots

2001-01-01

This paper describes the work that is done by a group of I3 students at Philips CFT in Eindhoven, Netherlands. I3 is an initiative of Fontys University of Professional Education also located in Eindhoven. The work focuses on the use of computer vision in motion control. Experiments are done with

COST 288: Nanoscale and Ultrafast Photonics. Action Identification Data

Science.gov (United States)

2008-08-01

heterodyne measurements (WG2-approved by MC) 10. June 20-July 1, 2005 -Dr. Angel Valle (Spanish) (Instituto de Fisica de Cantabria, Santander...modulation in VCSELs - A. Valle (Instituto de Fisica de Cantabria, Spain), K. Panajotov (Vrije Universiteit Brussel) and M. Sciamanna (LMOPS CNRS UMR...A. Valle (Instituto de Fisica de Cantabria, Spain), has performed a STSM in collaboration with K. Panajotov (Vrije Universiteit Brussel) and with

Perspektief

Directory of Open Access Journals (Sweden)

W.N. Coetzee

1970-03-01

Full Text Available Dit was ’n gelukkige keuse van die komitee vir interfakultêre lesings om 'n slag die teleskoop om te draai en die universiteit self in oënskou te neem. In die lesings wat in hierdie uitgawe gepubliseer word kom ’n hele paar nuwe beskouings na vore en word die universiteit ten regte in die branding van die lewe geplaas.

Predictive Policing in an Endangered Species Context: Combating Rhino Poaching in the Kruger National Park

CSIR Research Space (South Africa)

Koen, Hildegarde S

2017-02-01

Full Text Available KONTEKS: BESTRYDING VAN RENOSTERSTROPERY IN DIE KRUGER WILDTUIN deur Hildegarde Suzanne Koen Promotor(s): Dr. JP de Villiers & Dr. Henk Roodt Departement: Elektriese, Elektroniese en Rekenaar-Ingenieurswese Universiteit: Universiteit van Pretoria Graad...: Philosophiae Doctor (Elektronies) Sleutelwoorde: Renosterstroping, bedoelingskatting, gedeelde bewustheid, kausale netwerke Ongeveer drie renosters word daagliks in Suid-Afrika gestroop. Renosterstroping is ’n ernstige probleem wat nie net die renosterbevolking...

Spatial Planning and High-tech Development A comparative study of Eindhoven city-region, the Netherlands and Hsinchu City-region, Taiwan

Directory of Open Access Journals (Sweden)

Wei-Ju Huang

2013-08-01

Full Text Available High-tech development—which lies at the very heart of the processes of economic growth—has been recognised by many developed and developing countries as a strategic instrument to enhance and sustain their competitiveness in the global economic network. Although the concept of high-tech development differs between countries, many share the underlying assumption that the core of high-tech development is to create a sound environment where innovation thrives. This ideology implies a definite spatial dimension. As a result, various spatial strategies have been formulated and implemented to support high-tech development. This has had intentional and unintentional effects on the economy, society and space. Numerous studies have been devoted to exploring, analysing and theorising this global phenomenon. However, there has been less attention given to the role spatial planning may play in the process of high-tech development and to the factors that shape the spatial planning approaches to high-tech development in a particular place. The major objectives of this research are to advance the knowledge of the role of spatial planning in the process of high-tech development, and to establish an analytical framework that helps reveal the major institutional factors that shape spatial planning mechanisms for dealing with the spatial issues of high-tech development in different places. This contributes to the field of high-tech spatial policies transfer and lesson-drawing. In order to explore the major factors that shape the practices of spatial planning in hightech development, a comparative approach is applied in this research. The Eindhoven city-region in the Netherlands and the Hsinchu city-region in Taiwan are selected as case study areas. Both city-regions can be recognised as success stories of high-tech development not only on a national scale but also on a global scale, despite the fact that they apply different approaches. In the Eindhoven city

Technical and economic practicability of novel flywheel mass storage systems in electricity supply networks; Technisch-wirtschaftliche Realisierbarkeit von neuartigen Schwungmassenspeicher-Systemen (SMSS) in elektrischen Netzen

Energy Technology Data Exchange (ETDEWEB)

Bornemann, H J; Baeumer, U; Kaiser, A; Gruener, A; Gutt, H J; Hampel, R; Heyder, B; Kleimaier, M; Radtke, U; Sachse, H; Schlechter, V; Schrepfer, W; Worlitz, F

1998-12-31

Efficient storage of electrical energy is an increasing need. New developments in high-power electronics, high-strength materials and magnetic bearings have made efficient reliable flywheel mass storage systems in the range of 1-5 MfW/50-150 kWh conceivable. According to a first assessment, these systems may provide energy to the supply grid in a range of seconds and thus ensure frequency maintenance and compensation of short interruptions. The authors present first results of a preliminary study preparatory to a feasibility study on the technical and economic practicability of flywheel mass storage systems. (orig.) [Deutsch] Das Thema effiziente Speicherung von elektrischer Energie gewinnt immer mehr an Bedeutung. Durch neuere Entwicklungen in der Leistungselektronik und bei der Herstellung hochfester Werkstoffe sowie durch Fortschritte bei der Entwicklung von beruehrungsfreien Lagern im Bereich der aktiven Magnetlager (AML) und insbesondere supraleitenden Magnetlager (SML) sind effiziente und sichere Schwungmassenspeicher-Systeme (SMSS) bis in die Bereiche 1-5 MW/50-150 kWh denkbar. Nach einer ersten Einschaetzung eignen sich solche Anlagen, um im Sekundenbereich Energie in das Netz abzugeben und somit zur Frequenzstuetzung und zur Kompensation von Kurzunterbrechungen beizutragen. Praesentiert werden erste Ergebnisse einer Untersuchung zur Vorbereitung einer Machbarkeitsstudie ueber die technisch-wirtschaftliche Realisierbarkeit von Schwungmassenspeicher-Systemen. (orig.)

Loopbaanbeplanningspraktyke binne 'n universiteitskonteks

Directory of Open Access Journals (Sweden)

G. A. Smith

1990-06-01

Opsomming Die uitdagings wat die nastrewing van hoer doelwitte aan die Universiteit stel, noodsaak die noukeurige beplanning en uitvoering van toepaslike mensekragontwikkelingsaksies. In hierdie artikel word die belangrikheid van hierdie aksies ter ondersteuning van gestelde strategiee in oenskou geneem. Huidige mensekragbeplanningspraktyke word aan die hand van 'n model geevalueer ten einde die waarde van die praktyke ter bereiking van die Universiteit se gestelde doelwitte en missie te bepaal.

8 October 2013 - Rolex Director- General G. Marini in the ATLAS Control Room with CERN Director-General R. Heuer and ATLAS Collaboration Senior Physicist C. Rembser; visiting the ATLAS experimental cavern at LHC Point 1. Were also present from the Directorate: S. Lettow, Director for Administration and General Infrastructure; from the ATLAS Collaboration: Technische Universitaet Dortmund (DE) J. Jentzsch and SLAC National Accelerator Laboratory (US) G. Piacquadio.

CERN Multimedia

Anna Pantelia

2013-01-01

8 October 2013 - Rolex Director- General G. Marini in the ATLAS Control Room with CERN Director-General R. Heuer and ATLAS Collaboration Senior Physicist C. Rembser; visiting the ATLAS experimental cavern at LHC Point 1. Were also present from the Directorate: S. Lettow, Director for Administration and General Infrastructure; from the ATLAS Collaboration: Technische Universitaet Dortmund (DE) J. Jentzsch and SLAC National Accelerator Laboratory (US) G. Piacquadio.

Biology, Management and Utilization of Common Reed Pharagnites australis.

Science.gov (United States)

1987-02-01

Vrije Universiteit Waterways Experiment Staticn Department of Ecology and Ecotoxicology Environmental Laboratory P.O. Box 7161 P.O. Box 631 1007 MC...Madelijn van der Werff Vrije Universiteit Department of Ecology and Ecotoxicology Amsterdam and John W. Simmers and Stratford H. Kay Waterways...lowing and cutting 67 5.2.4. Active regulation of the water table 68 5.5. Nature conservation 68 5.4. Reed cultivation 69 Z.4. 1. Reed harvest 69 6

PREFACE: 31st European Physical Society Conference on Plasma Physics

Science.gov (United States)

Dendy, Richard

2004-12-01

Universiteit Eindhoven, Netherlands Dr Martin Lampe Naval Research Laboratory, Washington DC, USA Dr Jo Lister Centre de Recherches en Physique des Plasmas, Lausanne, Switzerland Dr Paola Mantica Istituto di Fisica del Plasma, Milan, Italy Professor Tito Mendonca Instituto Superior Tecnico, Lisbon, Portugal Dr Patrick Mora École Polytechnique, Palaiseau, France Professor Lennart Stenflo Umeå Universitet, Sweden Professor Paul Thomas CEA Cadarache, Saint-Paul-lez-Durance, France Professor Friedrich Wagner Max-Planck-Institut fr Plasmaphysik, Garching, Germany Professor Hannspeter Winter Technische Universität Wien, Austria

Test results on two thermionic converters with cermet emitters

International Nuclear Information System (INIS)

Saunders, M.; Danielson, L.; Huffman, F.

1983-01-01

An emitter made of a directionally solidified Mo-Al 2 O 3 , Cr 2 O 3 eutectic was provided by Eindhoven University of Technology in Eindhoven, The Netherlands. Although the high temperature braze cycle used in bonding this electrode to the emitter substrate destroyed its characteristic needle microstructure, the converter gave good performance. Apparently, chemical species evaporated from the emitter onto the collector provided a low collector work function. The resulting low barrier indices suggest that this surface is a promising emitter

Dual vehicle - Development, construction and testing of a dual vehicle for passenger transport on roads and railways. Final report; Zweiwegefahrzeug - Entwicklung, Bau und Erprobung eines Zweiwegefahrzeuges zur Personenbefoerderung Strasse/Schiene. Abschlussbericht

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

This feasibility study investigated a prototype dual vehicle for railways and roads. Technical problems, acceptance specifications, legal and economic aspects were gone into. [German] Zielstellung fuer das Vorhaben war die Untersuchung ausgewaehlter technischer Fragestellungen hinsichtlich der Machbarkeit der Entwicklung und Erprobung eines Prototypes fuer ein Zweiwegefahrzeug fuer den Personenverkehr, das fuer den Einsatz auf der Schiene und der Strasse vorgesehen und dafuer entsprechend technisch ausgestattet ist. Damit erbringt das Vorhaben technisch-konstruktive Loesungsansaetze fuer ein vollstaendig neues Fahrzeuggrundkonzept und traegt hinsichtlich eines solchen zukuenftigen Fahrzeugtyps - zur Klaerung technischer Fragen (statische Zusammenbauuntersuchungen, geometrische und massliche Bedingungen sowie Konzipierung, Leistungsanforderungen der Komponenten, Konzept fuer Ein- und Ausspuren sowie fuer Ein- und Ausstieg), - zur Pruefung der technischen Zulassungsfaehigkeit des Fahrzeuges, - zur Klaerung von Rechtsfragen fuer die Sicherung des Betriebes des Fahrzeuges - sowie zum Nachweis des wirtschaftlicheren Betriebes des Fahrzeuges bei. Das Vorhaben unterbreitet unter Beruecksichtigung sicherheitstechnischer, gesetzlicher und wirtschaftlicher Rahmenbedingungen Loesungsvorschlaege fuer die konstruktive Konzipierung des Fahrgestells und ein technisches Konzept fuer das Ein- und Ausspuren fuer einen neuen Fahrzeugtyp, der sowohl fuer die Strassenbenutzung als auch fuer den Schienenverkehr zugelassen ist. (orig.)

Energy Efficiency Plan 2009-2012; Energie Efficiency Plan 2009-2012

Energy Technology Data Exchange (ETDEWEB)

Meulen, M.M.W. (ed.)

2009-02-15

The aim of the Energy Efficiency Plan is to give an overview of the energy conservation plans of the Eindhoven University of Technology in Eindhoven, Netherlands, which must result in efficient use of energy conform the long-range agreements between businesses, industry and organizations and the Dutch government to improve energy efficiency (MJA3) [Dutch] Het doel van het EEP (Energie Efficiency Plan) is het in beeld brengen van de energiebesparingsplannen die leiden tot een efficienter gebruik van energie conform de MJA-3 afspraak (de derde Meerjaren Afspraak)

2015 Laser Diagnostics in Combustion Gordon Research Conference and Gordon Research Seminar

Science.gov (United States)

2015-10-20

Lewis College Poster Presenter Registered Pareja Restrepo, Jhon Alexander Technische Universitaet Darmstadt Poster Presenter Registered...Registered O’Hagan, Seamus K University of Oxford Poster Presenter Registered Pareja Restrepo, Jhon Alexander Technische Universitaet Darmstadt

Specification of a technically justified limiting value for sulphur concentrations in heating oil in order to enhance the use of high-efficiency boiler technology in oil heating systems; Ermittlung eines technisch begruendeten Grenzwertes fuer Schwefelgehalte im Heizoel zur Foerderung des Einsatzes von Brennwerttechnologie in Oelheizungsanlagen

Energy Technology Data Exchange (ETDEWEB)

Bellingen, E.-M.; Kuechen, C. [Institut fuer Wirtschaftliche Oelheizung e.V., Hamburg (Germany); Haase, F.; Wilckens, H. [Deutsche Shell AG, Hamburg (Germany); Sinnen, H.D. [VEBA AG, Duesseldorf (Germany)

2002-04-01

Different oil condensing boilers, which were available on the German market, have been investigated in order to determine the relevant limit for sulphur content in domestic heating oil. Up to now, the condensate from oil condensing boilers has to be neutralized in many cases due to local legislation. The composition of the condensates from oil boilers came out to be similar to the condensate from gas condensing boilers, as long as the sulphur content of heating oil is below 100 mg/kg. As the neutralization of condensate from gas condensing boilers is usually not required up to 200 kW-boilers, there should be no technical reason for neutralization, as long as the sulphur content is below 100 mg/kg. However, boiler manufactures are convinced, that only if the sulphur content is as low as 50 mg/kg, it will be possible to develop reliable oil condensing boilers for a reasonable price. Calculations of the total energy consumption came to the result, that primary energy can be saved. The increase of efficiency on the boiler side has more influence than the energy needed for desulphurization. (orig.) [German] Zur Bestimmung eines technisch begruendeten Schwefelgrenzwertes fuer ein neues 'schwefelarmes' Heizoel EL wurden Untersuchungen mit Heizoelen unterschiedlichen Schwefelgehaltes an verschiedenen auf dem Markt verfuegbaren Oelbrennwertgeraeten durchgefuehrt. Zur Zeit wird durch das ATV Arbeitsblatt A-251 eine Neutralisation von Kondensaten aus Oelbrennwertanlagen gefordert. Die Untersuchungen zeigen, dass bei Schwefelgehalten unter 100 mg/kg die Kondensate aehnliche Zusammensetzungen aufweisen wie Kondensate aus Gasbrennwertgeraeten. Die Voraussetzung fuer eine Befreiung von der Neutralisationsverpflichtung bei der Verwendung dieser Brennstoffe ist damit aus technischer Sicht gegeben. Fuer die Entwicklung von neuen, kompakten und preiswerten Oelbrennwertgeraeten wird von der Heizgeraeteindustrie ein Schwefelgehalt von max. 50 mg/kg fuer notwendig gehalten

Investigation and modelling of fuel utilisation in the zone near the burner of technical combustion systems. Final report; Untersuchung und Modellierung der Brennstoffumsetzung im Brennernahbereich technischer Verbrennungssysteme. Abschlussbericht

Energy Technology Data Exchange (ETDEWEB)

Kremer, H.; Wirtz, S.

1999-06-01

Optimisation and development of technical combustion systems in order to generate energy efficiently and reduce pollution is an ever-increasing challenge. Mathematical and numerical simulations play a very important role in this context. This project was dedicated to the implementation and improvement of mathematical models and subsequent verification of the modelling concepts. Verification used data measured by the university department for combined cyle turbines. The focal point of interest was the reaction zone near the burner. Further points of interest: development and improvement of models for two-phase effects, fuel consumption and turbulence interaction as well as further development of the methods of numerical simulation. Simulating the combustion chamber of the combined cycle turbines was prioritised.(orig.) [German] Die Optimierung und Weiterentwicklung technischer Verbrennungssysteme mit dem Ziel einer moeglichst effizienten und schadstoffarmen Energiebereitstellung stellt eine staendig wachsende Herausforderung dar. Bei der technologischen Umsetzung dieses Ziels kommt der mathematisch-numerischen Simulation eine immer groessere Bedeutung zu. In diesem Projekt sollte die Implementierung und Verbesserung von mathematischen Modellierungsansaetzen sowie die anschliessende Verifikation der Modellierungskonzepte anhand der Messdaten des Lehrstuhls fuer Dampf- und Gasturbinen (LDuG) durchgefuehrt werden. Der Schwerpunkt lag in der brennernahen Reaktionszone. Konkrete Arbeitsschwerpunkte waren die Weiterentwicklung und Verbesserung der Modellansaetze fuer Zweiphaseneffekte, Brennstoffumsatz und Turbulenzinteraktion sowie die Weiterentwicklung der Methodik der numerischen Simulation. Dabei stand die Simulation der Brennkammer des LDuG im Vordergrund. (orig.)

Effects of humic substances on the migration of radionuclides: Complexation of actinides with humic substances. (6th progress report, project summary). Period covered: January 1994 - July 1994

International Nuclear Information System (INIS)

Czerwinski, K.R.; Rhee, D.S.; Scherbaum, F.; Buckau, G.; Kim, J.I.; Moulin, V.; Tits, J.; Laszak, I.; Moulin, C.; Decambox, P.; Ruty, O. de; Marquardt, C.; Franz, C.; Herrmann, G.; Trautmann, N.; Dierckx, A.; Vancluysen, J.; Maes, A.; Bidoglio, G.; Eliet, V.; Grenthe, I.

1995-03-01

The goal of the research project is to examine the complexation behaviour of actinide ions with humic substances and thermodynamically describe the binding based upon a simple complexation model. This program is a continuation of the activities of the colloid and complexation group (COCO) in the second phase of the EC-MIRAGE project. A number of different experimental methods are used to determine speciation. The metal ions examined are the trivalent lanthanides, UO 2 2+ , NpO 2 + , Am 3+ , and Cm 3+ . The project is divided into three tasks: Task 1: complexation reactions of actinide ions with well characterized reference and site-specific humic and fulvic acids, Task 2: complexation reactions with major cations in natural groundwaters; Task 3: validation of the complexation data in natural aquatic systems by comparison of calculation with spectroscopic experiment. Five European community laboratories participated in the program: Technische Universitaet Muenchen, Commissariat a l'Energie Atomique Fontenay-Aux-Roses and Saclay, Universitaet Mainz, Katolieke Universiteit Leuven, and Joint Research Centre, Ispra. The evaluated stability constants are similar for all laboratories when the same humic substance complexation model is applied. Humic acid is shown to reduce NpO 2 + to Np 4+ , while no reduction of UO 2 2+ is observed. Temperature effects are seen on the Np humate complex. Competition is observed between NpO 2 + and Ca 2+ , but not between the trivalent lanthanides and Ca 2+ . No influence of humic acid purification on the evaluated stability constants is seen. Using the evaluated constants, calculations are conducted for natural water systems which indicate the trivalent actinide humate complex to be an important species. (orig.)

Regiolect verankerd

Directory of Open Access Journals (Sweden)

Max Wilting

2014-12-01

Full Text Available Consolidating Regiolect. A survey of dialect and regiolect use by adolescents in the Eindhoven area This study is a survey of dialect use, accent strength, knowledge and use of lexical dialect items, and attitude among adolescents in the Eindhoven area, an urbanized area in the Dutch province of North-Brabant. Regiolects tend to emerge and take over the functions of dialects in large parts of Europe, including the Netherlands, especially in urbanized areas. The basic research hypothesis of this study is that respondents report regiolect use more often than dialect use. Data of 259 respondents have been gathered. The age varied from 12 to 18, education ranged from VMBO (lower secondary professional education to VWO (pre university education and all respondents lived in either Eindhoven or surrounding places, defining the urbanized area of Eindhoven. For analyses, respondents have been divided in three age groups, three education groups and two language groups. Analyses of the data suggest that Standard Dutch is the preferred variety in every domain of language use, but a substantial number of respondents reported to be able to speak regiolect or dialect. Many dialect items were unknown to our respondents, but regiolect items were reported to be widely used, even by respondents who claimed to be using Standard Dutch exclusively. Accordingly, respondents generally had a positive attitude towards both Brabantic language varieties and the culture of Brabant. Adolescents, even when coming from outside of the province of Brabant, have an obvious sense of belonging to Brabant, as signalled by their widespread use of the Brabantic regiolect.

Effectiviteit van een klassieke Crew Resource Management training in de Intensive Care: een gecontroleerde studie.

NARCIS (Netherlands)

Kemper, P.F.; Bruijne, M. de; Dyck, C. van; So, K.L.; Tangkau, P.; Wagner, C.

2013-01-01

Achtergrond: Er is een toenemende bewustwording dat onbedoelde zorg gerelateerde schade in de gezondheidszorg vaker voortvloeit uit problemen met niet-technische vaardigheden, dan door een gebrek in technische, of klinische, vaardigheden. Dit is vooral van belang in de Intensive Care (IC), waar

Functional description of PreSRM v1.3. Technical manual for use of PreSRM (Preprocessor Standard Calculation Methods); Functionele omschrijving PreSRM v1.3. Technische handleiding voor gebruik van PreSRM (Preprocessor Standaard RekenMethoden)

Energy Technology Data Exchange (ETDEWEB)

Vermeulen, A.T. [ECN Environment and Energy Engineering, Petten (Netherlands)

2013-07-15

The PreSRM software library is prescribed in The Netherlands by the government to be used in the dispersion modeling of air pollution when evaluating air quality guidelines in outside air. The code is maintained by ECN and needs to be updated annually. This technical manual describes the use of PreSRM by programmers and documents the update for the current year 2013, including all updated meteorological and air quality background information for the year 2012 [Dutch] PreSRM is een software bibliotheek voor rekenmodellen gebruikt bij de beoordeling van luchtkwaliteit. In Nederland schrijft de Regeling Beoordeling Luchtkwaliteit (RBL) voor onder welke condities welke rekenmethodes gebruikt moeten worden om aan de luchtkwaliteitsnormen te toetsen. In de RBL worden drie Standaard RekenMethodes (SRM's) beschreven. Tevens wordt daarin vastgesteld welke invoergegevens gebruikt moeten worden voor emissies, achtergrondconcentraties, meteorologie en terreinruwheid. Deze gegevens worden jaarlijks geactualiseerd. Dit rapport is een technische handleiding voor de programmeurs en ontwikkelaars van de implementaties van standaard rekenmethoden en systeembeheerders van gebruikers en beschrijft aanpassingen in de huidige versie van de bibliotheek.

Surface modifications of silica nanoparticles are crucial for their inert versus proinflammatory and immunomodulatory properties

Directory of Open Access Journals (Sweden)

Marzaioli V

2014-06-01

Full Text Available Viviana Marzaioli,1 Juan Antonio Aguilar-Pimente,1,2 Ingrid Weichenmeier,1 Georg Luxenhofer,3 Martin Wiemann,4 Robert Landsiedel,5 Wendel Wohlleben,5 Stefanie Eiden,6 Martin Mempel,7 Heidrun Behrendt,1 Carsten Schmidt-Weber,1 Jan Gutermuth,1,8 Francesca Alessandrini1 1Center of Allergy and Environment (ZAUM, Technische Universität and Helmholtz Zentrum München, Member of the German Center for Lung Research (DZL, Munich, Germany; 2Department of Dermatology and Allergy Biederstein, Technische Universität München (TUM and German Mouse Clinic, Helmholtz Zentrum München, German Research Center for Environmental Health, Munich-Neuherberg, Germany, 3Institute of Developmental Genetics, Helmholtz Zentrum München, Neuherberg, Germany; 4IBE R&D gGmbH, Münster, Germany; 5BASF, Ludwigshafen, Germany; 6Bayer Technology Services, Leverkusen, Germany; 7Department of Dermatology, Venereology and Allergology, Universitätsmedizin Göttingen (UMG, Göttingen, Germany; 8Department of Dermatology, Vrije Universiteit Brussel, Brussels, Belgium Background: Silica (SiO2 nanoparticles (NPs are widely used in diverse industrial and biomedical applications. Their applicability depends on surface modifications, which can limit potential health problems. Objective: To assess the potential impact of SiO2 NP exposure and NPs chemical modifications in allergic airway inflammation. Methods: Mice were sensitized by five repetitive intraperitoneal injections of ovalbumin/aluminum hydroxide (1 µg over 42 days, then intratracheally instilled with plain or modified SiO2 NPs (50 µg/mouse, and subsequently aerosol challenged for 20 minutes with ovalbumin. One or 5 days later, allergic inflammation was evaluated by cell differentiation of bronchoalveolar lavage fluid, lung function and gene expression and histopathology, as well as electron and confocal microscopy of pulmonary tissue. Results: Plain SiO2 NPs induced proinflammatory and immunomodulatory effects in vivo

Reflection amplifiers in self-regulated learning

NARCIS (Netherlands)

Verpoorten, Dominique

2012-01-01

Verpoorten, D. (2012). Reflection amplifiers in self-regulated learning. Doctoral thesis. November, 9, 2012, Heerlen, The Netherlands: Open Universiteit (CELSTEC). Datawyse / Universitaire Pers Maastricht.

Presentatie: Professional development of university teachers

NARCIS (Netherlands)

Ebrecht, Diny

2012-01-01

Ebrecht, D. (2012, 4 juni). Professional development of university teachers. Presentatie bijeenkomst UOC-vertegenwoordigers in het kader van Erasmusuitwisseling, Heerlen, Nederland: Open Universiteit, L&C.

Toward Self-Regulated Learning in Vocational Education: Difficulties and Opportunities

NARCIS (Netherlands)

Jossberger, Helen

2011-01-01

Jossberger, H. (2011). Toward Self-Regulated Learning in Vocational Education: Difficulties and Opportunities. Doctoral Thesis. June, 24, 2011, Heerlen, The Netherlands: Open Universiteit in the Netherlands.

Studio 1:1

Index Scriptorium Estoniae

2011-01-01

Projekteerimis- ja disainistuudiost STUDIO 1:1 (Eindhoven), mis tegeleb avaliku ruumi loomise ja selle kasutamise kujundamisega. Projektidest "Linnulinn - linn lindude segakogukonna jaoks" ja ICT kogemuskeskus "De Verdieping"

Solarthermie 2000. Sub-programme 2: Solar thermal demonstration projects in public buildings in East Germany - Scientific and technical studies accompanying construction and operation of solar thermal demonstration plants in the states of south western Germany. Final report; Solarthermie 2000. Teilprogramm 2: Solarthermische Demonstrationsanlagen fuer oeffentliche Gebaeude mit Schwerpunkt in den neuen Bundeslaendern - Wissenschaftlich-technische Begleitung der solarthermischen Demonstrationsanlagen in den suedwestlichen Bundeslaendern. Abschlussbericht

Energy Technology Data Exchange (ETDEWEB)

Bollin, E.; Himmelsbach, S.; Klingenberger, U.M.

2002-06-01

Exemplary solar thermal power systems with a minimum collector surfaces of 100 square metres are presented, improved and optimized. Their competitive strength is to be improved by reducing the specific system cost and raising the specific useful power generation. [German] Im Programm 'Solarthermie-2000' Teilprogramm 2 soll anhand von Beispielloesungen fuer groessere solarthermische Anlagen mit einer Mindestkollektorflaeche von 100 m{sup 2} an unterschiedlich genutzten Gebaeuden nachgewiesen werden, dass im Bereich der thermischen Solarenergienutzung technisch gute Loesungen zur Verfuegung gestellt werden koennen. Diese Systemloesungen sollen weiter verbessert und angepasst werden. Zugleich soll erreicht werden, dass die wirtschaftliche Konkurrenzfaehigkeit gesteigert wird, indem durch Reduzierung der spezifischen Systemkosten und Erhoehung des spezifischen Nutzenergieertrages die solaren Nutzwaermekosten gesenkt werden. (orig.)

Effectief leren van multimedia

NARCIS (Netherlands)

Kester, Liesbeth

2013-01-01

Kester, L. (2012, March). Effectief leren van multimedia [Effective learning from multimedia]. Keynote presented at a miniconference Learning Sciences of the Open University of the Netherlands, Eindhoven, the Netherlands.

Risicoleerlingen bij technisch lezen

NARCIS (Netherlands)

Houtveen, A.A.M.; Mijs, T.J.E.; Vernooy, C.G.T.; Grift, W.J.C. van der; Koekebacker, E.

2003-01-01

Dit project laat zien, dat verbetering van leesprestaties haalbaar is. Men zou de vraag kunnen stellen of die verbetering stand houdt, ook als de begeleiding ophoudt. Om daar zicht op te krijgen is evaluatieonderzoek noodzakelijk. Vaak worden er door de overheid geen financiën beschikbaar gesteld

Stenting und technische Stentumgebung

Science.gov (United States)

Hoffstetter, Marc; Pfeifer, Stefan; Schratzenstaller, Thomas; Wintermantel, Erich

In hoch entwickelten Industrieländern stehen laut Weltgesundheitsorganisation (WHO) Herz-Kreislauf-Erkrankungen und speziell die Koronare Herzkrankheit (KHK) an erster Stelle der Todesursachen. In Deutschland betrug die Zahl der erfassten, an KHK erkrankten Personen ohne Berücksichtigung der Dunkelziffer allein im Jahre 2001 über 473.000. Die KHK war im Jahre 2003 mit 92.673 erfassten Todesfällen immer noch die häufigste Todesursache, obgleich in Deutschland die Häufigkeit der Koronarinterventionen zur Behandlung der KHK zwischen 1984 und 2003 um fast das 80fache von 2.809 auf 221.867 Eingriffe pro Jahr gestiegen ist [1]. Neben der hohen Zahl an Todesfällen haben die betroffenen Personen durch chronische Schmerzen und eingeschränkte körperliche Leistungsfähigkeit zusätzlich eine starke Beeinträchtigung der Lebensqualität [2].In Folge dessen wird die erkrankte Person häufig zum Pflegefall was neben den gesundheitlichen Aspekten auch eine sozioökonomische Komponente in Form der fehlenden Arbeitskraft und den auftretenden Pflegekosten nach sich zieht. Die Kosten für die Behandlung der KHK in Deutschland beliefen sich im Jahre 2002 laut Statistischem Bundesamt auf rund 6,9 Mrd. €. Verglichen mit ähnlichen Zahlen der USA dürfte sich der entstandene Schaden für die deutsche Volkswirtschaft im zwei- bis dreistelligen Milliardenbereich bewegen [3].

Beyond Weber and Straight Cucumbers : bureaucratic politics in the EU

NARCIS (Netherlands)

Vanhoonacker, S.M.R.L.

2009-01-01

Oratie uitgesproken ter gelegenheid van de aanvaarding van het ambt van bijzonder hoogleraar ‘Administrative Governance in the EU’ aan de Faculteit der Cultuur- en Maatschappijwetenschappen van de Universiteit Maastricht

Analysis and Assessment of Computer-Supported Collaborative Learning Conversations

NARCIS (Netherlands)

Trausan-Matu, Stefan

2008-01-01

Trausan-Matu, S. (2008). Analysis and Assessment of Computer-Supported Collaborative Learning Conversations. Workshop presentation at the symposium Learning networks for professional. November, 14, 2008, Heerlen, Nederland: Open Universiteit Nederland.

Becoming a Teacher Educator: De inductie van beginnende lerarenopleiders

NARCIS (Netherlands)

Van der Klink, Marcel

2010-01-01

Van der Klink, M. (2010, 12 November). Becoming a Teacher Educator: De inductie van beginnende lerarenopleiders. Presentatie gehouden op de studiedag van de Velon op de Universiteit Utrecht, Utrecht, Nederland.

Visual problem solving and self-regulation in training air traffic control

NARCIS (Netherlands)

Van Meeuwen, Ludo

2013-01-01

Van Meeuwen, L. W. (2013). Visual problem solving and self-regulation in training air traffic control (Unpublished doctoral dissertation). Centre for Learning Sciences and Technologies, Open Universiteit, Heerlen, The Netherlands.

Visual Problem Solving and Self‐regulation in Training Air Traffic Control

NARCIS (Netherlands)

Meeuwen van, Ludo

2015-01-01

Van Meeuwen, L. W. (2013). Visual problem solving and self-regulation in training air traffic control (Unpublished doctoral dissertation). Centre for Learning Sciences and Technologies, Open Universiteit, Heerlen, The Netherlands.

CHP biomass gasifier for the Zwarts Gerbera Nursery. Technical and economic feasibility; Biomassavergasser-WKK voor Gerberakwekerij Zwarts. Technische inpassing en economische haalbaarheid

Energy Technology Data Exchange (ETDEWEB)

Peeters, S.; Hart, A. [Energy Matters, Driebergen (Netherlands)

2011-10-15

ook relatieve vochtigheid en CO2. Een 'representatieve' tuinder of een tuinder met een 'gemiddelde' energiebehoefte is daarom moeilijk vast te stellen. Voor elke situatie geldt een eigen economische rentabiliteit. De uitkomsten van deze studie kunnen daarom niet zonder meer worden overgenomen voor andere projecten. Technisch is er veel mogelijk, zo blijkt uit de ingediende offertes. Van de zestien leveranciers bieden er drie een vergasser met warmtekrachtkoppeling (WKK) aan die, onder bepaalde randvoorwaarden, naast hout tevens laagwaardige reststromen aankan. Het voordeel van laagwaardige reststromen zoals bermgras, riet en miscanthus is een gunstigere prijs ten opzichte van hout. Een lage biomassaprijs heeft een positief effect op de exploitatiekosten, en daarmee op de economische rentabiliteit van de relatief kostbare installaties. De investering voor een complete vergasserWKK-installatie ligt 5 tot 10 keer hoger dan die voor een gangbare gasWKK-installatie. Ook het CO2 -gebruik heeft invloed op de economische rentabiliteit. De inkoop van CO2 is een kostbare aangelegenheid. Onderzocht is of er zowel technisch als economisch beschikbare CO2 -winning uit rookgas mogelijk is. Hiervoor zijn twee CO2 -winninginstallaties bekeken: die van Procede en Knook. Voor een vergasser-WKK-installatie met relatief klein vermogen (tot 800 kWe) is CO2-winning volgens zowel Procede als Knook economisch niet rendabel. CO2 -inkoop of -opwekking middels de bestaande aardgasgestookte ketel ligt daarom meer voor de hand. Uit de technisch-economische haalbaarheidsstudie blijkt dat door de relatief hoge investerings- en onderhoudskosten, investeren in een vergasserWKK-installatie niet rendabel is. CO2 -behoefte en de onzekerheid van de biomassaprijzen spelen daarbij parten. Maar met subsidie op duurzame energieproductie (SDE+) en subsidies op investering zoals MEI en EIA ontstaat een ander beeld. Uitgaande van de goedkopere 800 kWe installaties, een SDE+ vergoeding van 90

Architecture of Smart Mobility, towards an architectural language for new, smart concepts of mobility

NARCIS (Netherlands)

Wesemael, van P.J.V.; Ziegler, F.H.J.; Bosman, J.

2014-01-01

In Built Environment 2013-2014 presenteert de faculteit Built Environment/Bouwkunde van de TU Eindhoven een keuze uit de beste afstudeerprojecten, becommentarieerd door deskundigen van binnen en buiten de faculteiten.

Physikalisch-Technische Bundesanstalt (PTB). Annual report 2016; Physikalisch-Technische Bundesanstalt (PTB). Jahresbericht 2016

Energy Technology Data Exchange (ETDEWEB)

NONE

2017-03-15

The following topics are dealt with: Quality management, legal metrology, technology transfer, technical cooperation, mechanics and acoustics, chemical physics and explosion protection, optics, manufacturing measurement techniques, ionizing radiation, temperature and synchrotron radiation, medical physics and metrological information techniques. (HSI)

Physikalisch-Technische Bundesanstalt (PTB). Annual report 2015; Physikalisch-Technische Bundesanstalt (PTB). Jahresbericht 2015

Energy Technology Data Exchange (ETDEWEB)

NONE

2016-03-15

''PTB's central mission and the demands it places on itself are to make available an innovative metrological infrastructure at the highest international level in Germany to promote Germany's export-oriented high-tech economy, to meet the demands of a complex society and to support science that is operating at the cutting edge worldwide.'' This is what is stated in the ''Agreement on Objectives'' for the years from 2015 to 2019 between the Federal Ministry for Economic Affairs and Energy (Bundesministerium fuer Wirtschaft und Energie - BMWi) and PTB, which was signed on 12 January 2016 by State Secretary Machnig and me. Both this agreement and the newly developed ''Work and research program 2015 to 2017'' thus clearly define PTB's medium-term guidelines focusing on ''Innovation and industry'', ''Energy and the environment'', ''Humans and health'', ''Legal and international metrology'' as well as ''The new System of Units''.

Technical and economical optimization of wood gasification in a circulating fluidized bed. Final report; Technische und wirtschaftliche Optimierung der Vergasung von Holz in der zirkulierenden Wirbelschicht. Abschlussbericht

Energy Technology Data Exchange (ETDEWEB)

Ising, M.; Unger, C.; Heunemann, F.; Dinkelbach, L.

2002-12-01

Prozessautomatisierung und das Verbesserungspotenzial hinsichtlich Abgasemissionen am Motor. Darueber hinaus wurde eine detaillierte vergleichende betriebswirtschaftliche Bewertung des Verfahrens vorgenommen. Dabei stellte sich das neue technische Verfahren positiver als etablierte Techniken dar. (orig.)

Mobile and pervasive media for personalized learning

NARCIS (Netherlands)

Kalz, Marco

2013-01-01

Kalz, M. (2013, 18 April). Mobile and pervasive media for personalized learning. Presentation provided during a workshop for visitors from Lithuania, Learning Media Lab, Heerlen, The Netherlands: Open Universiteit in the Netherlands.

Learning Networks for Professional Development & Lifelong Learning

NARCIS (Netherlands)

Sloep, Peter

2009-01-01

Sloep, P. B. (2009). Learning Networks for Professional Development & Lifelong Learning. Presentation at a NeLLL seminar with Etienne Wenger held at the Open Universiteit Nederland. September, 10, 2009, Heerlen, The Netherlands.

Bloedzuigers in pluimveestallen

NARCIS (Netherlands)

Mul, M.F.; Mullens, B.A.; Koenraadt, C.J.M.

2009-01-01

Wageningen UR en Universiteit Amsterdam werken aan mogelijke maatregelen tegen de vogelmijt, Dermanyssus gallinae, in Nederlandse legpluimveestallen. Ook is uitbreiding van een ander vogelmijt-type gesignaleerd: de noordelijke vogelmijt, of Ornithonyssus sylviarum

De kloof tussen wetenschap en praktijk dichten Carel hulshof

NARCIS (Netherlands)

Putten, D. van

2011-01-01

Carel Hulshof is per 1 mei 2011 benoemd tot bijzonder hoogleraar Arbeids- en Bedrijfsgeneeskunde aan de Universiteit van Amsterdam bij het Coronel Instituut voor Arbeid en Gezondheid van het Academisch Medisch Centrum.

TeSLA e-assessment workshop

NARCIS (Netherlands)

Janssen, José

2016-01-01

Presentatie ten behoeve van de e-assessment workshop voor docenten van de Open Universiteit Nederland betrokken in de eerste TeSLA pilot. Topics: toetsfraude, toetsdesign, technologie voor authenticatie en verificatie van auteurschap.

Mobile Learning: Creation, delivery and evaluation of eBooks

NARCIS (Netherlands)

Kalz, Marco; Ternier, Stefaan

2012-01-01

Kalz, M., & Ternier, S. (2012, 10 December). Mobile Learning: Creation, delivery and evaluation of eBooks. Workshop for TPG Academy and a South African Delegation, Heerlen, The Netherlands: Open Universiteit in the Netherlands.

ARLearn and StreetLearn software for virtual reality and augmented reality multi user learning games

NARCIS (Netherlands)

Ternier, Stefaan; Klemke, Roland

2012-01-01

Ternier, S., & Klemke, R. (2011). ARLearn and StreetLearn software for virtual reality and augmented reality multi user learning games (Version 1.0) [Software Documentation]. Heerlen, The Netherlands: Open Universiteit in the Netherlands.

ARLearn and StreetLearn software for virtual reality and augmented reality multi user learning games

NARCIS (Netherlands)

Ternier, Stefaan; Klemke, Roland

2012-01-01

Ternier, S., & Klemke, R. (2011). ARLearn and StreetLearn software for virtual reality and augmented reality multi user learning games (Version 1.0) [Computer software]. Heerlen, The Netherlands: Open Universiteit in the Netherlands.

'n Vertalende vakwoordeboek van politieke terme

African Journals Online (AJOL)

Buro van die WAT

Political and Related Terminology in Southern African Languages (CEPTSA) in .... king van die Randse Afrikaanse Universiteit en is in sy Departement .... difaqane {displacement of population caused by wars — eg those by Shaka}.

Balans in beweging

NARCIS (Netherlands)

F.W.G. Leebeek (Frank)

2010-01-01

textabstractRede, Rede uitgesproken bij de aanvaarding van het ambt van bijzonder hoogleraar met als leeropdracht hemostase en trombose aan het Erasmus MC, faculteit van de Erasmus Universiteit Rotterdam op 5 februari 2010

Conference report for nuclear fusion phenomena in ionized gases

International Nuclear Information System (INIS)

Porkolab, M.

1975-10-01

A summary of the Conference on Phenomena in Ionized Gases, held in Eindhoven, The Netherlands, is given. In particular, the format of the conference and the content of the review papers are summarized

Braziliaans geweld

NARCIS (Netherlands)

Dijkhuizen, A.A.

2009-01-01

Column van Aalt Dijkhuizen, voorzitter van de Raad van Bestuur van Wageningen Universiteit & Researchcentrum over het European Food & Agribusiness Seminar (EFAS). Één van de tien cases was Brasil Foods, een enorm bedrijf.

Erwin van Loo, ‘Eenige wakkere jongens’. Nederlandse oorlogsvliegers in de Britse luchtstrijdkrachten, 1940-1945

Directory of Open Access Journals (Sweden)

Marc Dierikx

2016-11-01

Full Text Available Erwin van Loo, ‘Eenige wakkere jongens’. Nederlandse oorlogsvliegers in de Britse luchtstrijdkrachten, 1940-1945 (Proefschrift Universiteit van Amsterdam 2013; Amsterdam: Boom, 2013, 515 pp., isbn 978 94 6105 926 0.

Bacterie beschermt zalmeitje tegen schimmel (interview met I. de Bruijn en Y. Liu)

NARCIS (Netherlands)

Ramaker, R.; Bruijn, de I.; Liu, Y.

2014-01-01

Een bacterie die leeft op zalmeitjes, beschermt zijn gastheer tegen een schadelijke schimmelsoort. Dit ontdekten ecologen van Wageningen Universiteit en het NIOO. De vinding moet ervoor zorgen dat minder eitjes sterven tijdens de zalmkweek.

The curriculum success of business administration education programs

NARCIS (Netherlands)

Bijker, Monique; Van der Klink, Marcel; Boshuizen, Els

2012-01-01

Bijker, M. M., Van der Klink, M. R., & Boshuizen, H. P. A. (2011, 8 September). The curriculum success of business administration education programs. Presentation for the visit of KU Leuven, Open Universiteit, Heerlen, The Netherlands.

COalitions in COOperation Networks (COCOON): Social Network Analysis and Game Theory to Enhance Cooperation Networks

NARCIS (Netherlands)

Sie, Rory

2012-01-01

Sie, R. L. L. (2012). COalitions in COOperation Networks (COCOON): Social Network Analysis and Game Theory to Enhance Cooperation Networks (Unpublished doctoral dissertation). September, 28, 2012, Open Universiteit in the Netherlands (CELSTEC), Heerlen, The Netherlands.

Coordination Approaches for Complex Software Systems

NARCIS (Netherlands)

Bosse, T.; Hoogendoorn, M.; Treur, J.

2006-01-01

This document presents the results of a collaboration between the Vrije Universiteit Amsterdam, Department of Artificial Intelligence and Force Vision to investigate coordination approaches for complex software systems. The project was funded by Force Vision.

TeSLA e-assessment workshop pilot 2

OpenAIRE

Janssen, José

2017-01-01

Presentatie ten behoeve van de e-assessment workshop voor docenten van de Open Universiteit Nederland betrokken in de tweede TeSLA pilot. Topics: toetsfraude, toetsdesign, technologie voor authenticatie en verificatie van auteurschap, TeSLA instrument.

light-weight digital signature algorithm for wireless sensor networks

Indian Academy of Sciences (India)

M LAVANYA

2017-09-14

Sep 14, 2017 ... WSN applications do not even consider the security aspects because of the heavy ...... security scheme in wireless sensor networks with mobile sinks. IEEE Trans. ... security protocols. PhD Thesis, Eindhoven University of.

Towards iTunes U and Youtube.edu

NARCIS (Netherlands)

Specht, Marcus

2011-01-01

Specht, M. (2010, 22 November). Towards iTunes U and Youtube.edu. Training and Presentation given at training event for Open Universiteit IPO group. Heerlen, The Netherlands: Open University of the Netherlands, CELSTEC, Learning Media Lab.

From useful to beloved - the relationship of man's animal

NARCIS (Netherlands)

Stassen, E.N.

2006-01-01

Samenvatting van de oratie 'Van bruikbaar tot dierbaar : over de relatie mens dier' van prof. dr. Elsbeth Stassen, hoogleraar Dier en Samenleving aan Wageningen Universiteit, over de complexe en dynamische wereld van de mens-dier-relatie

Onweerlegbaar Bewijs? Over het Belang en de Waarde van empirisch Onderzoek voor Financierings- en Beleggingsvraagstukken

NARCIS (Netherlands)

M.J.C.M. Verbeek (Marno)

2002-01-01

textabstractRede, in verkorte vorm uitgesproken bij de aanvaarding van het ambt van hoogleraar Ondernemingsfinanciering aan de Faculteit der Bedrijfskunde en de Faculteit der Economische Wetenschappen van de Erasmus Universiteit Rotterdam op vrijdag 21 juni 2002

TeSLA workshop betrouwbaar toetsen op afstand

NARCIS (Netherlands)

Brouns, Francis; Janssen, José

2017-01-01

Presentatie ten behoeve van workshop betrouwbaar toetsen op afstand voor docenten van de Open Universiteit Nederland betrokken in de derde TeSLA pilot. Topics: toetsfraude, toetsdesign, technologie voor authenticatie en verificatie van auteurschap, TeSLA instrumenten.

Adriaan van Veldhuizen, De partij. Over het politieke leven in de vroege S.D.A.P.

Directory of Open Access Journals (Sweden)

Dirk Jan Wolffram

2016-11-01

Full Text Available Adriaan van Veldhuizen, De partij. Over het politieke leven in de vroege S.D.A.P. (Dissertatie Universiteit Leiden 2015; Amsterdam: Prometheus/Bert Bakker, 2015, 375 pp., isbn 978 90 3513 857 5.

Stochastic Control Theory, Nonlinear Structural Mechanics and Applied Combinatorics

Science.gov (United States)

1989-05-12

More specifically: (") x 3 PAS and Steiner triple systems; (") x 4 PAS and Steiner triple systems which can be nested; and (’) x 5 PAS and Steiner ...am Rudolf Wille CONCEPTUAL SCALING Technische Hochschule Darmstadt Abstract: Scaling of empirical data uses formal patterns to lead to a better...of Arizona Jan 18 - 22 Wille, Rudolf Technische Hochschule Darmstadt Jan 17 - 23 21 APPLICATIONS OF COMBINATORICS AND GRAPH THEORY TO THE BIOLOGICAL

Vol 37 2009 Art 4.pub

African Journals Online (AJOL)

user

Staatsdrukker. W YNGAARD, DAC. 2002. Evaluating the provision of low cost housing in the context of developmental Lo- cal Government: The case of Wesbank. Magister- tesis. Stellenbosch. Universiteit van Stellenbosch. Holistiese behuisingsevalueringsmodel: Instrument vir ontwikkelingpraktisyns in laekostebehuising.

Politiekennis in gebruik. Een onderzoek naar het gebruik van het Politie Kennis Net

NARCIS (Netherlands)

Bakker, G.D.; Gellevij, M.R.M.; de Hoog, Robert; Kooken, J.P.; Krommendijk, M.

2006-01-01

I. Bakker, M. Gellevij, R. de Hoog, J. Kooken , M. Krommendijk (IPIT, Instituut voor Maatschappelijke Veiligheidsvraagstukken en vakgroep Instructietechnologie, faculteit Gedragswetenschappen, Universiteit Twente) P&W Verkenningen, Politie en Wetenschap, Apeldoorn ISBN: 90-78764-02-3 AbstractHet

Gertruida M. du Plooy. 500 Communication Concepts. English I Afri ...

African Journals Online (AJOL)

vanger/s by ander universiteite genoem, kinestiek word ook kinetika genoem, marketing package marketing mix, voorsevraag leidende vraag, reklame advertering, organisatoriese kommunikasie / kultuur / netwerke organisasiekommunikasie / -kul- tuur / -netwerke. Nie een van hierdie altematiewe benaminge kom voor nie.

Hoe leer je iemand effectief te leren?

NARCIS (Netherlands)

Kester, Liesbeth; Koper, Rob; Gijselaers, Jérôme; Bahreini, Kiavash; De Vries, Fred; Wetzels, Sandra; Kirschner, Paul A.; Berkhout, Jeroen; Storm, Jeroen

2012-01-01

Kester, L., Koper, R., Gijselaers, J., Bahreini, K., De Vries, F., Berkhout, J., & Storm, J. (2012, 30 maart). Hoe leer je iemand effectief te leren? Masterclass in de OpenU community. Open universiteit, Heerlen, Nederland. Beschikbaar op

Hoe verloopt identiteit-verificatie van online studenten?

NARCIS (Netherlands)

Janssen, José

2018-01-01

Presentatie over identiteit verificatie van online studenten tijdens een werkbezoek van NUFFIC (https://www.nuffic.nl/) aan de Open Universiteit. Topics: identiteit verificatie, vormen van authenticatie, online toetsen, toetsfraude, TeSLA instrumenten voor authenticatie en verificatie van

African customer is Sun King. Enormous market for solar energy in the Third World

International Nuclear Information System (INIS)

Malsch, I.

2001-01-01

A brief overview is given in the enormous market for solar energy in Africa. Special attention is paid to one of the leaders in the market for solar energy: Free Energy Europe in Eindhoven, Netherlands. 3 refs

IMAQE-Food verbetert efficiency

NARCIS (Netherlands)

Spiegel, van der M.

2004-01-01

'Effectiviteit van de kwaliteitszorg bij de voedingsmiddelenproductie'. Op dat onderwerp promoveerde dr.ir. Marjolein van der Spiegel, onderzoeker bij de leerstoelgroep Productontwerpen en Kwaliteitskunde aan Wageningen Universiteit. Zij ontwierp daarvoor het IMAQE - Food (spreek uit 'I make food')

Hoe verloopt identiteit-verificatie van online studenten?

OpenAIRE

Janssen, José

2018-01-01

Presentatie over identiteit verificatie van online studenten tijdens een werkbezoek van NUFFIC (https://www.nuffic.nl/) aan de Open Universiteit. Topics: identiteit verificatie, vormen van authenticatie, online toetsen, toetsfraude, TeSLA instrumenten voor authenticatie en verificatie van auteurschap.

Verwaarding reststroom uienbewerking

NARCIS (Netherlands)

Meeusen-van Onna, M.J.G.; Schroot, J.H.; Mulder, W.J.; Elbersen, H.W.

2008-01-01

In opdracht van ZUVER heeft Wageningen Universiteit en Research Centre de mogelijkheden bekeken voor verwaarding van de reststroom die bij de uienbewerking vrijkomt. Tijdens het uienbewerkingsproces komt een continue reststroom vrij. Deze reststroom bedraagt voor alle uienbewerkingsbedrijven tezamen

Bergen aan Zee heeft baat bij extra kustbescherming

NARCIS (Netherlands)

van Dam, R.M.; Dohmen-Janssen, C.M.; van der Biezen, S.C.

2007-01-01

De Nederlandse kust heeft een aantal verstedelijkte buitendijkse gebieden met grote sociaal-economische waarde. In een recent afstudeeronderzoek (Civiele Techniek, Universiteit Twente) is met een nieuwe methode van risicoberekening bekeken of extra investeringen in de kustbescherming rendabel zijn.

Introducing IT-Based environmental simulation courses at Slovak technical universities

NARCIS (Netherlands)

Hensen, J.L.M.; Hraska, J.; Mallory-Hill, S.M.; Rabenseifer, F.; Maldonado, E.; Yannas, Y.

1998-01-01

Since the 1995/96 academic year, four Slovak universities (Slovak Technical University Bratislava, Technical University Kosice, Slovak Agricultural University Nitra and Technical University Zvolen) in cooperation with two EU universities (University of Strathclyde Glasgow and Eindhoven University of

Preparing students towards the complexity of today’s practice : start-up in a multidisciplinary assignment

NARCIS (Netherlands)

Moonen, S.P.G.; Veeger, T.T.

2015-01-01

Education in the Department of the Built Environment (Eindhoven University of Technology) aims to prepare students for multidisciplinary design teams. The Bachelor program offers a broad range incorporating essentials of urbanism, architecture, structure, building physics, real estate, construction,

An embedded CAN controller for a vehicle networking course project

NARCIS (Netherlands)

Breaban, G.D.; Koedam, M.L.P.J.; Voeten, J.P.M.; Goossens, K.G.W.

2016-01-01

The automotive industry advances quickly, with new functionalities continuously being introducted. The Eindhoven University of Technology's Bachelor Automotive Programme prepares students for the subsequent Master education, for industry, and research. In this paper we present the infrastructure and

Heidebeheer en fauna : verslag veldwerkplaats Droog Zandlandschap Strabrechtse Heide, 4 juni 2009

NARCIS (Netherlands)

Smits, J.; Siepel, H.

2009-01-01

De Strabrechtse Heide is een 1500 hectare groot heidegebied ten zuidoosten van Eindhoven. Het is een zeer gevarieerd gebied met onder andere hoogteverschillen, waterpartijen, zandverstuivingen, Calluna (dopheide) en akkercomplexen. Het gebied is grotendeels in eigendom van Staatsbosbeheer sinds

Kwaliteit van geo-informatie in kabels en leidingen

NARCIS (Netherlands)

Oort, van P.A.J.

2004-01-01

Gebrekkige informatie over de ligging van kabels en leidingen leidt tot een verhoogde kans op beschadigingen. Een kosten-baten-analyse zou kunnen bijdragen aan het gerichter aanpakken van de oorzaken van schade. Een analyse vanuit Wageningen Universiteit (aio onderzoek)

Zicht op dierlijke biologische ketens

NARCIS (Netherlands)

Meeusen-van Onna, M.J.G.; Wijnands, J.H.M.; Kijlstra, A.; Boekhoff, M.

2005-01-01

De studie vormt een onderdeel van het project 'Visies op biologische landbouw: een systeemanalyse'. Dit project is gefinancierd door Wageningen Universiteit en Researchcentrum uit middelen voor Strategische Expertise Ontwikkeling. In dit project worden mensbeelden onderscheiden om de visies te

Van strijdtonelen en luchtkastelen. Gedachten en observaties over de rol van communicatie bij innovatie in het publieke domein

NARCIS (Netherlands)

Leeuwis, C.

2003-01-01

In een bewerkte versie van de inaugurele rede, die de auteur heeft uitgesproken bij de aanvaarding van het ambt van hoogleraar Communicatie en Innovatie Studies aan Wageningen Universiteit, volgt een schets van de veranderingen in het denken over communicatie

Computer-Aided Engineering Education at the K.U. Leuven.

Science.gov (United States)

Snoeys, R.; Gobin, R.

1987-01-01

Describes some recent initiatives and developments in the computer-aided design program in the engineering faculty of the Katholieke Universiteit Leuven (Belgium). Provides a survey of the engineering curriculum, the computer facilities, and the main software packages available. (TW)

Anticipation in supply chain operations planning

NARCIS (Netherlands)

Jansen, M.M.

2012-01-01

Complex production and distribution networks are governed by implicit or explicit hierarchical decision making processes. This thesis contributes to the understanding of such hierarchical decision making processes. Our starting point is the Eindhoven Framework for Production and Inventory Control.

Process mining software repositories: do developers work as expected?

NARCIS (Netherlands)

Poncin, W.; Serebrenik, A.; Brand, van den M.G.J.

2012-01-01

Modern software development commonly makes use of a multitude of software repositories. How can these help us to understand the on-going development process? Researchers of Eindhoven University of Technology design new methods revealing how software has been developed.

Technical description of the test section SUCOT to investigate a water/steam two-phase flow; Technische Beschreibung der Testanlage SUCOT zur Untersuchung Wasser/Wasserdampf Zweiphasenstroemung

Energy Technology Data Exchange (ETDEWEB)

Daubner, M.; Janssens-Maenhout, G.; Knebel, J.U.

2002-02-01

Within the POOLTHY Project of the European Union (Euratom Fourth Framework Programme contract FJ4J-CT95-0003) an active/passive concept (SUCO-Programme) was investigated which controls the heat removal after a potential core melt-down accident in an evolutionary light water reactor by spreading and stabilising the core melt in the reactor sump and flooding the melt with sump water from above. The experiments were performed in the test facility SUCOT which was designed and erected at the Institute for Nuclear and Energy Technologies (IKET). The report gives an overview on the SUCO-Programme and the scaling analysis, which was applied to design the test facility SUCOT. A detailed technical description of the test facility SUCOT is given, in which the natural circulation driven two-phase flow within the reactor sump and relevant phenomena such as flow boiling, disperse bubbly flow with and without mass transfer, and geysering are investigated. The major components of the test facility, the three-loop system and the instrumentation are described. Finally, a perspective for future application of the gained knowledge is given. (orig.) [German] Im Rahmen des POOLTHY Projekts der Europaeischen Union (Euratom Fourth Framework Programme Kennzeichen FJ4J-CT95-0003) wurde ein aktiv/passives Konzept (SUCO-Programm) zur Beherrschung der Nachwaermeabfuhr nach einem potenziellen Kernschmelzunfall in einem evolutionaeren Leichtwasserreaktor untersucht. Das Konzept sieht eine stabile Ausbreitung der Kernschmelze im Reaktorsumpf und deren Kuehlung von oben mit Sumpfwasser vor. Die experimentellen Arbeiten wurden in der dafuer entwickelten und am Institut fuer Kern- und Energietechnik (IKET) gebauten Testanlage SUCOT durchgefuehrt. Der Bericht gibt einen Ueberblick ueber das SUCO-Programm und die Aehnlichkeitsskalierung, die zur Auslegung der Testanlage SUCOT verwendet wurde. Es wird eine detaillierte technische Beschreibung der Testanlage SUCOT gegeben, die zur Untersuchung der durch

Learning Networks: connecting people, organizations, autonomous agents and learning resources to establish the emergence of effective lifelong learning

NARCIS (Netherlands)

Koper, Rob; Sloep, Peter

2003-01-01

Koper, E.J.R., Sloep, P.B. (2002) Learning Networks connecting people, organizations, autonomous agents and learning resources to establish the emergence of effective lifelong learning. RTD Programma into Learning Technologies 2003-2008. More is different… Heerlen, Nederland: Open Universiteit

‘Eerlijk zullen we alles delen’: wat is er eigenlijk mis met economische ongelijkheid?

NARCIS (Netherlands)

A. Jolink (Albert)

2014-01-01

markdownabstract__Abstract__ Rede, uitgesproken bij de openbare aanvaarding van het ambt van bijzonder hoogleraar Geschiedenis van het Economisch Denken bij de afdeling Geschiedenis van de Erasmus School of History, Culture and Communication van de Erasmus Universiteit Rotterdam op vrijdag 17

Schone Handen: als de ene hand de andere wast

NARCIS (Netherlands)

C.H.J. van Eijck (Casper)

2010-01-01

textabstractRede, in verkorte vorm uitgesproken ter gelegenheid van het aanvaarden van het ambt van bijzonder hoogleraar met als leeropdracht Chirurgie met specifieke aandacht voor het pancreas, aan het Erasmus MC, faculteit van de Erasmus Universiteit Rotterdam op 25 juni 2010

die relevansie van taalwetenskap in spraak- en taal terapie

African Journals Online (AJOL)

Ondene van Dulm

Departement Spraak-Taal-Gehoorterapie, Universiteit. Stellenbosch. Buitendag, M.M. 1993. Afrikaanse Reseptiewe Woordeskattoets. Raad vir. Geesteswetenskaplike Navorsing. Bus, A.G. and M.H. van Ijzendoorn. 1997. Affective dimension of mother-infant picturebook reading. Journal of School Psychology 35(1): 47-60.

Zicht op de plantaardige biologische keten

NARCIS (Netherlands)

Wijnands, J.H.M.; Meeusen-van Onna, M.J.G.; Hoorweg, M.J.; Kik, C.; Rossing, W.A.H.; Scholten, O.M.

2005-01-01

De studie vormt een onderdeel van het project 'Visies op biologische landbouw: een systeem analyse'. Dit project is gefinancierd door Wageningen Universiteit en Researchcentrum uit middelen voor Strategische Expertise Ontwikkeling. In dit project worden mensbeelden onderscheiden om de visies te

Assessment of a GM-crop impact on soil systems using the DNA barcode-based tool for nematode community analysis

NARCIS (Netherlands)

Vonk JA; Mulder C; Vervoort MTW; Brolsma KM; Posthuma L; de Goede RGM; LER

2012-01-01

Het RIVM heeft met de Universiteit Wageningen (WUR) een nieuwe techniek ontwikkeld waarmee de kwaliteit van de bodem nauwkeuriger kan worden vastgesteld, de zogeheten nematode DNA-barcode tool. Deze moleculaire methode levert sneller gedetailleerdere informatie over verstoringen van een goede

Naar publiek rapporteren over scholen : juridische aspecten

NARCIS (Netherlands)

Deli, D.E.J.A.

2000-01-01

Het project beoogde na te gaan in hoeverre het publiek rapporteren van gegevens omtrent verschillende aspecten van de scholen noodzakelijk en verantwoord is om scholen op hun kwaliteit te kunnen vergelijken. Het desbetreffende onderzoek, uitgevoerd door een onderzoeksteam van de Universiteit

Virtual Netherlands : Geo-visualizations for interactive spatial planning and decision-making: From Wow to impact. Definition study.

NARCIS (Netherlands)

Riedijk, van A.; Velde, van de R.J.; Pleizier, I.D.; Hoogerwerf, T.C.; Lammeren, van R.J.A.; Baltussen, W.H.M.; Jansen, J.; Wynia, P.; Uum, van J.H.; Wilgenburg, van R.

2006-01-01

Dit onderzoekt maakt deel uit van het project virtueel Nederland. Het uitgangspunt van deze studie is: de ruimtelijke planning van Nederland levert betere resultaten op, als gebruik gemaakt wordt van ruimtelijke verbeelding, zoals google earth die biedt, waarin samenwerken: Vrije Universiteit,

David van der Linden, Experiencing Exile: Huguenot Refugees in the Dutch Republic 1680-1700

Directory of Open Access Journals (Sweden)

Matthew Glozier

2016-04-01

Full Text Available David van der Linden, Experiencing Exile: Huguenot Refugees in the Dutch Republic 1680-1700 (PhD Universiteit Utrecht 2013; Politics and Culture in Europe, 1650-1750; Farnham: Ashgate, 2015, xx + 289 pp., ISBN 978 14 7242 927 8.

Pluralisme in de natuurwetenschap

NARCIS (Netherlands)

Dieks, D.G.B.J.

2008-01-01

Het zal in de jaren tachtig zijn geweest dat me werd gevraagd een cursus algemene wetenschapsfilosofie voor natuurkundestudenten te organiseren. Na een studie theoretische fysica was ik via enige omzwervingen terechtgekomen bij de vakgroep Grondslagen der Natuurkunde aan de Universiteit Utrecht,

Onderzoek Location Based Marketing: Mobile = location = effect

NARCIS (Netherlands)

Gisbergen, M.S. van; Huhn, A.E.; Khan, V.J.; Ketelaar, P.E.

2011-01-01

Onderzoekers van de NHTV (Internationaa Hoger Onderwijs Breda, Radboud Universiteit, DVJ Insights en Popai Benelux lieten consumenten in een virtuele supermarkt advertenties via de smartphone ontvangen wanneer men langs het geadverteerde product liep. De uitkomsten laten zien dat 'location based

How does feedback and peer feedback affect collaborative writing in a virtual learning environment?

NARCIS (Netherlands)

Guasch, Teresa; Espasa, Anna; Alvarez, Ibis; Kirschner, Paul A.

2011-01-01

Guasch, T., Espasa, A., Alvarez, I., & Kirschner, P. A. (2011, 31 May). How does feedback and peer feedback affect collaborative writing in a virtual learning environment? Presentation at a Learning & Cognition meeting, Open Universiteit in the Netherlands, Heerlen, The Netherlands.

The development of youth business as the direction of new innovative regional economy formation

NARCIS (Netherlands)

V. Chugunova; S. Pryadko; O. Lomovtseva

2013-01-01

Artikel geschreven door een Russische student. Drie Russische studenten zijn samen met 2 docenten in november 2013 op bezoek geweest bij de Hanzehogeschool in het kader van internationalisering. Gepubliceerd op verzoek van de Russische universiteit (Belgorod University). "According to the submitted

Het veranderende gezicht van reumatoïde artritis

NARCIS (Netherlands)

Helm-van, van der Mil A.H.M.

2016-01-01

Oratie uitgesproken door Prof.dr. A.H.M. Van der Helm-van Mil bij de aanvaarding van het ambt van hoogleraar op het gebied van Reumatologie, in het bijzonder Vroege Artritis aan de Universiteit Leiden op vrijdag 14 oktober 2016

Efficient process migration in the EMPS multiprocessor system

NARCIS (Netherlands)

van Dijk, G.J.W.; Gils, van M.J.

1992-01-01

The process migration facility in the Eindhoven multiprocessor system (EMPS) is presented. In the EMPS system, mailboxes are used for interprocess communication. These mailboxes provide transparency of location for communicating processes. The major advantages of mailbox communication in the EMPS

Authentic assessment For autonomous learning

NARCIS (Netherlands)

Vinke, A.A.; Hummels, C.C.M.

2010-01-01

Industrial Design at Eindhoven University of Technology focuses on designing intelligent systems, products and related services for societal transformation. Our holistic and integrative approach to learning clearly shows in the end-ofterm assessments. Students are not assessed at the level of

Localizing Design/Designing Location: Creative Cities in the Low Countries

NARCIS (Netherlands)

Gimeno Martinez, J.C.; Ozorio de Almeida Meroz, J.; Serulus, K.

2013-01-01

Through a constructivist approach, the formative processes creating an association between location and creativity are analysed, focusing on the establishment of three narratives of urban creativity: Antwerp, Brussels and Eindhoven. Each case study positions the city in its cultural and economic

Gerontechnology in higher engineering education

NARCIS (Netherlands)

Rietsema, J.; Graafmans, J.; Taipale, V.; Charness, N.

1998-01-01

This paper is based on experiences with designing an educational programme on gerontechnology at Eindhoven University of Technology (TUE) and designing and developing various international gerontechnology courses. There are two major goals for education in gerontechnology: (1) creation of a

Industrial canal waterfronts in The Netherlands : transforming the canal zones of B5

NARCIS (Netherlands)

Curulli, G.I.

2012-01-01

Industrial Canal Waterfronts in The Netherlands provides a comprehensive presentation of the characteristics and challenges of five interconnected and dismissed industrial canal zones located in the Dutch Brabant cities of Eindhoven, Breda, Tilburg, s’-Hertogenbosch and Helmond (B5). Through the

An intuitive interface for building management and planning

NARCIS (Netherlands)

Vries, de B.; Buma, S.A.; Jessurun, A.J.

2006-01-01

Building management and planning professionals utilize database systems for administrative support, but these systems are inadequate for conveying architectural plans. In this article we describe the so-called Virtual Maquette that was developed at the Eindhoven University of Technology for the

Learning about the educational uses of the internet by producing an educational web site in an interdisciplinary and virtual team

NARCIS (Netherlands)

Taconis, R.; Verhoef, N.; Bakx, A.W.E.A.; Dehing, A.J.M.

2003-01-01

The 'ICT-2000' project at the University Teacher Training Department for Science and Technology (TULO) at Eindhoven University of Technology, Netherlands, puts student teachers to work in a productivelearning task. Student teachers at different TULO locations cooperate in an interdisciplinary team

A deterministic model for the planning of microcellular mobile radio communication systems

NARCIS (Netherlands)

Klaassen, M.G.J.J.; Mawira, A.

1994-01-01

A ray model for field strength prediction for the planning of microcellular mobile radio communication systems is presented. The software developed at Eindhoven University of Technology for LMSS has been adapted for application in microcellular mobile radio communication systems. The adaption

Identifying user preferences for a digital educational solution for young seniors with diabetes

NARCIS (Netherlands)

van der Molen, P.; Maas, A.H.; Chen, W.; van Pul, C.; Cottaar, E.J.E.; van Riel, N.A.W.; Hilbers, P.A.J.; Haak, H.R.

2017-01-01

The Eindhoven Diabetes Education Simulator project was initiated to develop an educational solution that helps diabetes patients understand and learn more about their diabetes. This article describes the identification of user preferences for the development of such solutions. Young seniors (aged

Identifying User Preferences for a Digital Educational Solution for Young Seniors With Diabetes

NARCIS (Netherlands)

van der Molen, Pieta; Maas, Anne H.; Chen, Wei; van Pul, Carola; Cottaar, Eduardus J. E.; van Riel, Natal A. W.; Hilbers, Peter A. J.; Haak, Harm R.

2017-01-01

The Eindhoven Diabetes Education Simulator project was initiated to develop an educational solution that helps diabetes patients understand and learn more about their diabetes. This article describes the identification of user preferences for the development of such solutions. Young seniors (aged

Gedifferentieerde Risicobeoordeling Technisch-wetenschappelijke mogelijkheden

NARCIS (Netherlands)

Linders JBHJ; Brouwer WWM; CSR

1999-01-01

This document contains an overview of the technical and scientific possibilities for performing a tailored assessment of the environmental risks in the registration of pesticides in the Netherlands. Various components of this environmental assessment were analyzed to show to what extent, for

Thermodynamik grundlagen und technische anwendungen

CERN Document Server

Baehr, Hans Dieter

2009-01-01

Für die aktualisierte 14. Auflage des bewährten Lehrbuchs der Technischen Thermodynamik wurde das Kapitel über Wärmekraftanlagen gründlich bearbeitet und durch einen Abschnitt zur Energiewandlung ergänzt: Die Energiebedarfsstruktur von Deutschland wird erläutert, und die möglichen Energiewandlungspfade werden diskutiert. Schwerpunkt des Buches ist die ausführliche und auch dem Anfänger verständliche Darstellung der Grundlagen der Thermodynamik mit der sorgfältigen Einführung der thermodynamischen Begriffe und den fundamentalen Bilanzgleichungen für Energie, Entropie und Exergie. Die thermodynamischen Eigenschaften reiner Fluide und fluider Gemische werden eingehend erläutert. Darauf aufbauend wird die Thermodynamik der Gemische und der chemischen Reaktionen entwickelt. Auch die thermodynamischen Aspekte wichtiger energie- und verfahrenstechnischer Anwendungen werden praxisnah behandelt: - Strömungs- und Arbeitsprozesse, - thermische Stofftrennverfahren, - Verbrennungsprozesse und Verbrennungsk...

Het wezen van de schilderkunst volgens Leonardo da Vinci : over de verhouding tussen kunsttheorie en de praktijk van de schilder in de Renaissance

NARCIS (Netherlands)

Kwakkelstein, M.W.|info:eu-repo/dai/nl/74032615

2011-01-01

Op 19 oktober houdt prof. dr. Michael Kwakkelstein zijn oratie aan de Universiteit Utrecht over de verhouding tussen kunsttheorie en -praktijk bij Leonardo da Vinci. Kwakkelstein stelt dat Leonardo’s schilderkunst niet altijd beantwoordt aan de criteria voor goede schilderkunst die de grote

ATLAS OF EUROPEAN VALUES

NARCIS (Netherlands)

M Ed Uwe Krause

2008-01-01

Uwe Krause: Atlas of Eurpean Values De Atlas of European Values is een samenwerkingsproject met bijbehorende website van de Universiteit van Tilburg en Fontys Lerarenopleiding in Tilburg, waarbij de wetenschappelijke data van de European Values Study (EVS) voor het onderwijs toegankelijk worden

Adverteren op Instagram, wat werkt?

NARCIS (Netherlands)

Heijting, D.; Ketelaar, P.E.

2017-01-01

Welke vorm van adverteren werkt op Instagram? In het afstudeeronderzoek van Dionne Heijting, uitgevoerd aan de Radboud Universiteit Nijmegen, staan twee soorten advertenties centraal. Hoe onderscheiden ze zich van elkaar? En leiden ze tot posititeve gevolgen voor het aangeprezen merk of product?

Virtueel trainen met RescueSim : Onderzoek naar ervaringen en leereffecten in het project Samen Voorbereid Veilig (SVV)

NARCIS (Netherlands)

Houtkamp, J.M.

2014-01-01

Van 2007 tot 2012 hebben onderzoekers van het GATE (GAme research for Training and Entertainment)-project van de Universiteit Utrecht verscheidene onderzoeksprojecten uitgevoerd met de trainingssoftware RescueSim, ontwikkeld door VSTEP BV en Risk Management Control. Centraal stond de vraag hoe een

South African law and policy regulating learner absenteeism

African Journals Online (AJOL)

Packard Bell

Department of Psychology of Education, College of Education, University of ... Keywords: ecosystemic theory; learner absenteeism; management approach; South African law and policy ..... learners, but can also be cultural and systemic ..... tesis. Pretoria, Suid-Afrika: Universiteit van Suid-. Afrika. Beskikbaar te .... Phd thesis.

Introduction: Towards a new architectonic critique

NARCIS (Netherlands)

Buijs, G.J.; Jongeneel, R.

2013-01-01

8-9 January 2013 at the Vrije Universiteit Amsterdam, a seminar took place bringing together people from various parts of the world, various disciplines, and various academic and non-academic professions — philosophers, economists, theologians, historians, social scientists as well as bankers,

Game based learning for computer science education

NARCIS (Netherlands)

Schmitz, Birgit; Czauderna, André; Klemke, Roland; Specht, Marcus

2011-01-01

Schmitz, B., Czauderna, A., Klemke, R., & Specht, M. (2011). Game based learning for computer science education. In G. van der Veer, P. B. Sloep, & M. van Eekelen (Eds.), Computer Science Education Research Conference (CSERC '11) (pp. 81-86). Heerlen, The Netherlands: Open Universiteit.

Hoe complexer de processor, hoe belangrijker de structuur

NARCIS (Netherlands)

Marco van Kerkhoven

2011-01-01

Bespreking van onderzoek van Todor Stefanov in ‘Waar wij trots op zijn. De ontdekkingen van 2011’ van de Universiteit Leiden Faculteit der Wiskunde & Natuurwetenschappen. De Bulgaar Todor Stefanov onderzoekt methoden en middelen voor het ontwerpen en programmeren van multiprocessorsystemen die zijn

Data literacy and research data management in the Netherlands

NARCIS (Netherlands)

Wopereis, Iwan; Brand-Gruwel, Saskia

2018-01-01

Similar to most European countries, the Netherlands invests heavily in research data management facilities and support for university personnel. For instance, each university in the Netherlands has its program on these issues which is described in policy documents (e.g., Open Universiteit, 2014).

New preparation of fish material for interlaboratory study on PFCs

NARCIS (Netherlands)

Korytar, P.; Lohman, M.; Kwadijk, C.J.A.F.; Barneveld, van E.

2007-01-01

The Institute for Environmental Studies, Vrije Universiteit (IVM) has requested Wageningen IMARES to prepare a new fish material for use in the interlaboratory performance study on analysis of perfluorinated compounds (PFCs) due to the low amount of contaminants in the previously prepared material.

Preparation of fish material for interlaboratory study on PFCs

NARCIS (Netherlands)

Korytar, P.; Kwadijk, C.J.A.F.; Lohman, M.; Barneveld, van E.

2007-01-01

The Institute for Environmental Studies, Vrije Universiteit (IVM) has requested Wageningen IMARES for the preparation of fish material for use in interDlaboratory performance study on analysis of perfluorinated compounds (PFCs). It was requested that the material should be prepared from fillet of

Toezicht in de open samenleving : Maatschappelijke controle op multinationale ondernemingen

NARCIS (Netherlands)

van Erp, J.G.|info:eu-repo/dai/nl/161941958

2016-01-01

Globalisering creëert nieuwe mogelijkheden voor het houden van toezicht op multinationale ondernemingen. Dat is de kern van de oratie die professor Judith van Erp uitsprak bij de aanvaarding van de leerstoel Publieke Instituties aan de Universiteit Utrecht. Globalisering heeft voor ondernemingen

Op het grensvlak van chemie en biotechnologie (interview met Harry Bitter)

NARCIS (Netherlands)

Gool, van J.; Bitter, J.H.

2015-01-01

Harry Bitter, sinds twee jaar hoogleraar Biobased Chemistry & Technology aan de Wageningen Universiteit, pleit voor meer chemie en katalyse in het onderzoek naar biobased producten. ‘Mijn onderzoeksfocus ligt op hoe je de omzettingen van biomassa naar product zo optimaal mogelijk kunt uitvoeren.

Van vakgericht naar competentiegericht statistiekonderwijs. Een interventiestudie in een opleiding psychologie.

NARCIS (Netherlands)

Van Buuren, Hans

2008-01-01

Abstract This thesis describes how statistics education has been redesigned and implemented in the curriculum of the school of psychology of the Open Universiteit Nederland. In stead of autonomous and separate traditional statistics service courses and courses in research methods, both kinds of

Machinale Botrytis-detectie

NARCIS (Netherlands)

Jansen, R.M.C.

2007-01-01

Onder laboratoriumomstandigheden blijkt het goed mogelijk om een Botrytis-infectie in tomatenplanten te detecteren met behulp van vluchtige stoffen. Onderzoekers van Wageningen Universiteit en Plant Research International bekijken nu of het mogelijk is om deze stoffen te detecteren in een kas zodat

Wees een haan : Die konste om te leren spreken ende swighen alst tijt is

NARCIS (Netherlands)

Veldhuizen, M.D.

2016-01-01

In de rubriek ‘In de Kast’ bepleiten uiteenlopende figuren uit de wereld der letteren waarom een bepaalde tekst of auteur opnieuw de volle aandacht verdient. Dit keer bespreekt Martine Veldhuizen (docent Middelnederlandse Letterkunde aan de Universiteit Utrecht) een vijftiende-eeuws traktaat van

Committees

Science.gov (United States)

2012-11-01

Leadership Team of the IAHR Committee for Hydraulic Machinery and Systems Eduard EGUSQUIZA, UPC Barcelona, Spain, Chair François AVELLAN, EPFL-LMH, Switzerland, Past Chair Richard K FISHER, Voith Hydro Inc., USA, Past Chair Fidel ARZOLA, Edelca, Venezuela Michel COUSTON, Alstom Hydro, France Niklas DAHLBÄCKCK, Vatenfall, Sweden Normand DESY, Andritz VA TECH Hydro Ltd., Canada Chisachi KATO, University of Tokyo, Japan Andrei LIPEJ, Turboinstitut, Slovenija Torbjørn NIELSEN, NTNU, Norway Romeo SUSAN-RESIGA, 'Politehnica' University Timisoara, Romania Stefan RIEDELBAUCH, Stuggart University, Germany Albert RUPRECHT, Stuttgart University, Germany Qing-Hua SHI, Dong Fang Electrical Machinery Co., China Geraldo TIAGO, Universidade Federal de Itajubá, Brazil International Advisory Committee Shouqi YUAN (principal) Jiangsu University China QingHua SHI (principal) Dong Fang Electrical Machinery Co. China Fidel ARZOLA EDELCA Venezuela Thomas ASCHENBRENNER Voith Hydro GmbH & Co. KG Germany Anton BERGANT Litostroj Power doo Slovenia B C BHAOYAL Research & Technology Centre India Hermod BREKKE NTNU Norway Stuart COULSON Voith Hydro Inc. USA Paul COOPER Fluid Machinery Research Inc USA V A DEMIANOV Power Machines OJSC Russia Bart van ESCH Technische Universiteit Eindhoven Netherland Arno GEHRER Andritz Hydro Graz Austria Akira GOTO Ebara Corporation Japan Adiel GUINZBURG The Boeing Company USA D-H HELLMANN KSB AG Germany Ashvin HOSANGADI Combustion Research and Flow Technology USA Byung-Sun HWANG Korea Institute of Material Science Korea Toshiaki KANEMOTO Kyushu Institute of Technology Japan Mann-Eung KIM Korean Register of Shipping Korea Jiri KOUTNIK Voith Hydro GmbH & Co. KG Germany Jinkook LEE Eaton Corporation USA Young-Ho LEE Korea Maritime University Korea Woo-Seop LIM Hyosung Goodsprings Inc Korea Jun MATSUI Yokohama National University Japan Kazuyoshi Mitsubishi H I Ltd, Japan MIYAGAWA Christophe NICOLET Power Vision Engineering Srl Switzerland Maryse PAGE Hydro

Developing novel extensions to support prototyping for interactive social robots

NARCIS (Netherlands)

Bhömer, ten M.; Bartneck, C.; Hu, J.; Ahn, R.M.C.; Tuyls, K.P.; Delbressine, F.L.M.; Feijs, L.M.G.

2009-01-01

Lego Mindstorms NXT is a platform highly suitable for prototyping in the field of interactive social robotics. During a technology masterclass at Eindhoven University of Technology students from the department of Industrial Design have developed five novel extensions (sensors and actuators) for the

Impact of management attitudes on perceived thermal comfort

NARCIS (Netherlands)

Derksen, T.; Franchimon, F.; Bronswijk, van J.E.M.H.

2008-01-01

Objectives This study examined the influence of some organizational and management characteristics on the perception of indoor environment qualities such as thermal comfort and related stress. Methods One open office in each of three organizations in Eindhoven was studied. An office environment

Rational behavior in decision making. A comparison between humans, computers and fast and frugal strategies

NARCIS (Netherlands)

Snijders, C.C.P.

2007-01-01

Rational behavior in decision making. A comparison between humans, computers, and fast and frugal strategies Chris Snijders and Frits Tazelaar (Eindhoven University of Technology, The Netherlands) Real life decisions often have to be made in "noisy" circumstances: not all crucial information is

Integrated photonics : compact multiplexing

NARCIS (Netherlands)

Pile, D.; Chen, H.; Uden, van R.G.H.; Okonkwo, C.M.; Koonen, A.M.J.

2015-01-01

Spatial multiplexers (SMUXs) for mode division multiplexing often involve multiple strategies for mode-selective excitation and the minimization of insertion and other losses. Haoshuo Chen, Roy van Uden, Chigo Okonkwo and Ton Koonen, working at the COBRA Institute at the Eindhoven University of

The learning experience with electronic museum guides

NARCIS (Netherlands)

Bartneck, C.; Masuoka, A.; Takahashi, T.; Fukaya, T.

2006-01-01

Within the contextual model of learning framework, the authors conducted a study with electronic handheld guides at the Van Abbemuseum (Eindhoven, the Netherlands). This study investigated the influence that limiting users' freedom of choice and control by facilitated mediation of others has on

Ontwikkeling van toepassingen met plasmawater in de glastuinbouw

NARCIS (Netherlands)

Quaedvlieg, William; Hofland-Zijlstra, J.D.; Hollinger, T.C.; Noordam, Marianne; Slootweg, G.; Broek, van den R.C.F.M.; Kolk, van der Jan Paul; Ruijven, van J.P.M.; Stijger, I.

2016-01-01

In collaboration with Vitalfluid, TU Eindhoven, FloraHolland, Bactimm, Alewijnse and Medical faculty of UMC Radboud Wageningen UR Greenhouse Horticulture studied horticultural application for the use of plasma activated water. This research was funded by the GO programm Oost Nederland, the European

Re-Architecture: Reality or Utopia?

NARCIS (Netherlands)

Pereira-Roders, A.R.; Post, J.M.; Erkelens, P.A.

2008-01-01

RE-ARCHITECTURE: lifespan rehabilitation of built heritage (2004-2007) is a doctoral research funded by the Foundation for Science and Technology, Portugal; and hosted by the Unit Architectural Design and Engineering, Eindhoven University of Technology, The Netherlands. This doctoral research is now

Modelling as a foundation for academic forming in mathematics education

NARCIS (Netherlands)

Perrenet, J.C.; Morsche, ter H.G.

2004-01-01

The Bachelor curriculum of Applied Mathematics in Eindhoven includes a series of modelling projects where pairs of students solve mathematical problems posed in non-mathematical language. Communication skills training is integrated with this track. Recently a new course has been added. The students

Optical wireless communication in illumination systems

NARCIS (Netherlands)

Linnartz, J.P.M.G.

2017-01-01

Prof. Jean-Paul Linnartz van de TU Eindhoven presenteerde zijn kijk op draadloze optische communicatie. eerder werkte hij vooral aan radiocommunicatie, maar hij ziet dat radionetwerken steeds meer beperkt worden door onderlinge storingen. De groei van het radioverkeer groeit al jaren veel sneller

Contracting out maintenance and a plan for future research

NARCIS (Netherlands)

Martin, H.H.

1997-01-01

Presents a discussion of the research survey carried out at the Faculty of Technology Management at the Eindhoven University of Technology concerning contractors’ maintenance. First, gives a brief introduction to the emerging contracting out phenomenon in The Netherlands. Then, provides an overview

Does working with industry come at a price? : a study of doctoral candidates' performance in collaborative vs. non-collaborative PhD projects

NARCIS (Netherlands)

Salimi, N.; Bekkers, R.N.A.; Frenken, K.

2014-01-01

The increasing involvement of industry in academic research raised concerns whether university-industry projects actually meet the same academic standards as university projects in-house. Looking at the academic output and impact of collaborative versus non-collaborative Ph.D. projects at Eindhoven

Integrated product development and experience of communication in education

NARCIS (Netherlands)

H. Ihle; Ir. Dick van Schenk Brill; Ir. Peter van Kollenburg; Ir. H.E.V. Veenstra

2000-01-01

The Technical Departments at the Fontys University of Professional Education in Eindhoven, The Netherlands, offer a course which is devel-oped around the principles of Concurrent Engi-neering. Integrated Product Development (IPD) project teams are multi-disciplinary groups which develop products in

Waste management in underground mining. Colloquium; Abfallentsorgung im Bergbau unter Tage. Tagung

Energy Technology Data Exchange (ETDEWEB)

Frenz, W.; Martens, P.N.; Pretz, T. (eds.)

2001-07-01

The problem of underground waste management is reviewed from various aspects. Technical, legal and ecological problems are outlined with particular emphasis on the aspect of long-term safety. [German] Ziel unserer Veranstaltung ist, die Problematik der untertaegigen Abfallentsorgung aus den unterschiedlichsten Perspektiven zu beleuchten. Sowohl die technische als auch die rechtliche wie auch die oekologische Sichtweise werden aufgezeigt. In technischer Hinsicht werden der aktuelle Stand der Methoden und Fortentwicklungsmoeglichkeiten dargestellt und anhand konkreter Beispiele erlaeutert. Besondere Bedeutung hat dabei die Frage der Langzeitsicherheit. (orig.)

Interview Vincent de Waal over zijn proefschrift: De vooruitgeschoven middenvelder. De innovatiekracht van middenmanagers van welzijnsorganisaties met het oog op actief burgerschap

NARCIS (Netherlands)

Vincent de Waal; Eveline Bolt

2015-01-01

Vincent de Waal (1951) promoveerde in 2014 aan de Universiteit voor Humanistiek. Hij is werkzaam als docent- onderzoeker bij Hogeschool Utrecht (HU), Instituut Social Work. Sinds 2002 is hij onderzoeker binnen het Kenniscentrum Sociale Innovatie van de HU en vanaf 2012 betrokken bij de

Training in ontwerpen: opzet en evaluatie van het vak ontwerpmethoden [Training in Design. Outline and Evaluation of the Course Design Methods

NARCIS (Netherlands)

Joosten, S.M.M.; van den Berg, Klaas; Weenk, W.

1993-01-01

De opzet van het tweedejaarsvak Ontwerpmethoden verschilt nogal van de gebruikelijke opzet van vakken in de informatica-opleiding van de Universiteit Twente. Het strak geplande vak is gericht op integratie van bestaande voorkennis en leidt tot veel activiteit van studenten, zowel in kliene groepen

Die pastorale begeleiding van predikante van die Nederduitse ...

African Journals Online (AJOL)

21 Jan 2013 ... Stone, M.F., 1999, Coaching, counselling & mentoring: How to choose & use the right technique to boost employee performance, AMACOM, New York. Strydom, W.A., 2011, 'Pastoraat aan getraumatiseerde kinders in die intensiewesorgeenheid: 'n Gestalt benadering', DD tesis, Universiteit van Suid-. Afrika ...

Nieuwe vormen, nieuwe inkomsten: over schrijvershonoraria

NARCIS (Netherlands)

Kuitert, L.

2012-01-01

De opkomst van het digitale boek werd al vanaf het begin argwanend bekeken. E-books zouden het papieren boek verdringen en daarmee ook de boekhandels. Lisa Kuitert, hoogleraar Boekwetenschap aan de Universiteit van Amsterdam, bespreekt niet de gevolgen voor de boekverkopers of uitgevers, maar voor

Lean leiderschap voor (nog) betere teamprestaties

NARCIS (Netherlands)

van Dun, Desirée Hermina; Wilderom, Celeste P.M.

2016-01-01

Veel managers en teams hebben moeite om continu te blijven verbeteren. Recent onderzoek van de Universiteit Twente laat zien dat er bij het toepassen van lean meer aandacht nodig is voor gedragsontwikkeling van zowel medewerkers als leidinggevenden. Managers met bepaalde gedragskenmerken creëren een

SIC Industriemonitor najaar 2003

NARCIS (Netherlands)

Brouwer, N.; de Nooij, M.; Pomp, M.

2003-01-01

In juni 2000 publiceerde de Stichting voor Economisch Onderzoek (SEO) van de Universiteit van Amsterdam in opdracht van Stichting voor Industriebeleid en Communicatie (SIC) een ontwerp voor een SIC industriemonitor met een voorstel voor de inhoud en de structuur van een dergelijke monitor. Op dat

Scoring clinical competencies of learners: A quantitative descriptive ...

African Journals Online (AJOL)

Hierdie artikel beskryf die ondersoek na die korrelasie tussen verskillende kliniese assesseerders se puntetoekenning tydens assessering van leerders se kliniese vaardighede ten einde enige moontlike vreemde veranderlikes met betrekking tot redes vir swak prestasie uit te skakel. ʼn Universiteit in Gauteng, Suid-Afrika ...

Vaccins beschermen dier én mens

NARCIS (Netherlands)

Rijsman, V.M.C.

2012-01-01

Het bedrijf MSD Animal Health werkt met onderzoekers van Wageningen UR, het RIVM en de Universiteit Utrecht aan een betere bestrijding van infectieziekten die van dier op mens kunnen overslaan. 'We kunnen nu enkele producten ontwikkelen die mogelijk nooit commercieel aantrekkelijk zullen zijn, maar

Johannes Maccovius (1588-1644) zijn bijdrage aan de ontwikkeling van de gereformeerde theologie van de zeventiende eeuw

NARCIS (Netherlands)

Asselt, W.J. van

2006-01-01

In de kerkelijke geschiedschrijving behoort Jan Makowsky (1588-1644) bepaald niet tot de categorie van auteurs die op enigerlei sympathie kunnen rekenen(1). Deze Poolse aristocraat en zwager van Rembrandt(2), die bijna dertig jaar lang theologie en filosofie doceerde aan de universiteit van

Computer-Assisted Linguistic Analysis of the Peshitta

NARCIS (Netherlands)

Roorda, D.; Talstra, Eep; Dyk, Janet; van Keulen, Percy; Sikkel, Constantijn; Bosman, H.J.; Jenner, K.D.; Bakker, Dirk; Volkmer, J.A.; Gutman, Ariel; van Peursen, Wido Th.

2014-01-01

CALAP (Computer-Assisted Linguistic Analysis of the Peshitta), a joint research project of the Peshitta Institute Leiden and the Werkgroep Informatica at the Vrije Universiteit Amsterdam (1999-2005) CALAP concerned the computer-assisted analysis of the Peshitta to Kings (Janet Dyk and Percy van

Soil and worm: on eating as relating

NARCIS (Netherlands)

Bertoni, F.

2013-01-01

Earthworms and soil combine in an ecotoxicological experiment in the Vrije Universiteit in Amsterdam. To determine the effects of a toxic compound produced by genetically modified broccoli, ecotoxicologists use the earthworm in a standardized test to understand the conditions of the soil. In the

Nanodeeltjes in de strijd tegen Alzheimer

NARCIS (Netherlands)

Paulusse, Jos Marie Johannes

2015-01-01

Medicatie bij de ziekte van Alzheimer is vooral gericht op symptoombestrijding. Kan dat niet anders, vroegen wetenschappers van de Universiteit Twente zich af. De komende vier jaar gaan zij proberen een cocktail van medicijnen met behulp van nanodeeltjes gericht in de hersenen te brengen.

Wetenschapswinkel Wageningen UR : 25 jaar! : jubileummagazine 25 jaar Wetenschapswinkel Wageningen University & Research Centre

NARCIS (Netherlands)

Bakker, N.; Straver, G.H.M.B.; Hilster, de Y.; Hoofwijk, H.; Stobbelaar, D.J.

2010-01-01

Dertig jaar geleden hielden studenten vier weken lang het hoofdgebouw van de Landbouwhogeschool bezet. Ze wilden niet alleen onderzoek doen voor bedrijven. En niet alleen onderzoek om het onderzoek. Ze wilden probleemgericht onderwijs en onderzoek. De universiteit moest er ook zijn voor die groepen

Encounters in place ballet: a phenomenological perspective on older people’s walking routines in an urban park

NARCIS (Netherlands)

Eck, D. van; Pijpers, R.A.H.

2017-01-01

The phenomenological tradition within human geography continues to inspire research on everyday city life. This paper draws on David Seamon's notion of place ballet to understand the meaning of encounters between older people visiting an urban park in the city of Eindhoven, the Netherlands. The

Putting neurons in the smart grid

NARCIS (Netherlands)

Vonk, B.M.J.; Groot, de R.J.W.; Slootweg, J.G.

2013-01-01

The collaboration between Eindhoven University of Technology and Dutch Distribution System Operator, Enexis, results in a direct implementation of scientific ideas and models in real world systems and faster feedback of data for analysis or validation. This is illustrated by the Smart Storage Unit:

Earth, Wind & Fire : Natuurlijke Airconditioning

NARCIS (Netherlands)

Bronsema, B.

2013-01-01

Collaboration between the Universities of Technology in Delft and Eindhoven has resulted in the development of a new concept for natural air conditioning of buildings. According to the so-called Climate Responsive Architecture developed in this research, the design of the indoor climate system,

Inducing Human Cooperation in Decentralized Networks

NARCIS (Netherlands)

Fokker, J.E.

2013-01-01

In June 2004 the Freehand I-Share' project started. It was a Dutch project joined by TUDelft, TU Eindhoven, University of Twente, VU Amsterdam, and Philips Research. Its synopsis was "Sharing resources in virtual communities for storage, communication, and processing of multimedia data." Virtual

Effectiveness of design-based learning in engineering education

NARCIS (Netherlands)

Gomez Puente, S.M.; Eijck, van M.W.; Jochems, W.M.G.

2011-01-01

Design-based learning (DBL) has been introduced as an educational concept at Eindhoven University of Technology (TU/e) in 1997, in which students work co-operatively and actively on multidisciplinary design tasks (Wijnen, 2000). Theoretically DBL is not well underpinned. It has been researched

Methods and algorithms for model-based integration and testing

NARCIS (Netherlands)

Boumen, R.; Braspenning, N.C.W.M.; Jong, de I.S.M.; Mortel - Fronczak, van de J.M.; Rooda, J.E.

2007-01-01

This paper describes three Ph.D. projects performed in the framework of the Tangram project [1], in which the Systems Engineering group (Dept. of Mechanical Engineering) from the Eindhoven University of Technology is involved. The Tangram project is a close cooperation between the Embedded Systems

Changes in smoking, sports participation and overweight: Does neighborhood prevalence matter?

NARCIS (Netherlands)

Blok, D.J.; Vlas, S.J. de; Empelen, P. van; Richardus, J.H.; Lenthe, F.J. van

2013-01-01

We investigated whether the prevalence of health-related behaviors and overweight in neighborhoods is associated with changes in smoking, sports participation and overweight over 13 years of follow-up in Dutch adults residing in 86 neighborhoods of Eindhoven in 1991. We showed that living in

Fear for external cephalic version and depression : Predictors of successful external cephalic version for breech presentation at term?

NARCIS (Netherlands)

Ciliacus, Emily; van der Zalm, Marieke; Truijens, Sophie E.; Hasaart, Tom H.; Pop, Victor J.; Kuppens, Simone M.

2014-01-01

Background Objective was to determine whether fear for external cephalic version (ECV) and depression are associated with the success rate of ECV in women with a breech presentation at term. Methods Prospective study conducted in the Catharina Hospital Eindhoven between October 2007 and May 2012.

The creative industries: conflict or collaboration? An analysis of the perspectives from which policymakers, art organizations and creative organizations in the creative industries are acting

NARCIS (Netherlands)

Nijzink, Douwe; van den Hoogen, Quirijn; Gielen, Pascal

2015-01-01

This paper compares and contrasts the instruments and values formulated in the creative industries policies of three peripheral municipalities of between 150,000 and 220,000 inhabitants in the Netherlands (Groningen, Arnhem and Eindhoven) with the needs of the creative industries itself. The needs

Experimental study on the Ranque-Hilsch vortex tube

NARCIS (Netherlands)

Gao, C.

2005-01-01

The Ranque-Hilsch vortex tube cooler (RHVT) has been investigated in the Low Temperature Group at Eindhoven University of Technology. The research was focussed on a thorough experimental investigation of the flow inside the system at a large variety of experimental conditions. Three measurement

The many faces of the mathematical modeling cycle

NARCIS (Netherlands)

Perrenet, J.C.; Zwaneveld, B.

2012-01-01

In literature about mathematical modeling a diversity can be seen in ways of presenting the modeling cycle. Every year, students in the Bachelor’s program Applied Mathematics of the Eindhoven University of Technology, after having completed a series of mathematical modeling projects, have been

High-speed production line combines 3D printing with precision machining : Customized mass production in the factory of the future

NARCIS (Netherlands)

N.n.

2015-01-01

The development of additive manufacturing is progressing rapidly. One of the main advances in the progression of this technology is 3D printing of metals. To enhance this trend, TNO's additive manufacturing department in Eindhoven, The Netherlands, is devel-oping "Hyproline", a "High Performance

The influence of traveler context on the evaluation of shopping center access

NARCIS (Netherlands)

Waerden, van der P.J.H.J.; Borgers, A.W.J.; Timmermans, H.J.P.

2009-01-01

This paper describes a study on travelers’ evaluation of a shopping centers’ access. Using an Internet based questionnaire, residents of the city of Eindhoven, The Netherlands were asked to evaluate the access of a regional shopping center. The evaluation covered not only three different transport

Validation of wind loading codes by experiments

NARCIS (Netherlands)

Geurts, C.P.W.

1998-01-01

Between 1994 and 1997, full scale measurements of the wind and wind induced pressures were carried out on the main building of Eindhoven University of Technology. Simultaneously, a comparative wind tunnel experiment was performed in an atmospheric boundary layer wind tunnel. In this paper, the

Water quality based RTC using UV/VIS sensors (extended abstract)

NARCIS (Netherlands)

Van Daal-Rombouts, P.M.M.; Langeveld, J.G.; Clemens, F.H.L.R.

2012-01-01

Kallisto is a large scale research project at water board De Dommel in The Netherlands, in cooperation with several partners (Weijers et al, 2011). It consists of quantitative and qualitative continuous on line measurements and extended modelling of the WWTP (Waste Water Treatment Plant) Eindhoven,

Formal methods and tools for the development of distributed and real time systems : Esprit Project 3096 (SPEC)

NARCIS (Netherlands)

Roever, de W.P.; Barringer, H.; Courcoubetis, C.; Gabbay, D.M.; Gerth, R.T.; Jonsson, B.; Pnueli, A.; Reed, M.; Sifakis, J.; Vytopil, J.; Wolper, P.

1990-01-01

The Basic Research Action No. 3096, Formal Methods snd Tools for the Development of Distributed and Real Time Systems, is funded in the Area of Computer Science, under the ESPRIT Programme of the European Community. The coordinating institution is the Department of Computing Science, Eindhoven

De ontwikkeling van bedrijfskundige kennis in het vakgebied facility management

NARCIS (Netherlands)

Keizer, J.A.; Vosselman, E.G.J.

1994-01-01

Afgezien van een onlangs gestarte postdoctorale opleiding voor Facility Management in Eindhoven blijft het wetenschappelijk onderwijs in deze sector tot op heden ver achter. In dit artikel wordt een aantal ideeën uitgewerkt voor het intensiveren van de onderzoeksinspanningen op het terrein van

The academic merits of modelling in higher mathematics education: A case study

NARCIS (Netherlands)

Perrenet, J.; Adan, I.

2010-01-01

Modelling is an important subject in the Bachelor curriculum of Applied Mathematics at Eindhoven University of Technology in the Netherlands. Students not only learn how to apply their knowledge to solve mathematical problems posed in non-mathematical language, but also they learn to look actively

The academic merits of modelling in higher mathematics education : a case study

NARCIS (Netherlands)

Perrenet, J.C.; Adan, I.J.B.F.

2010-01-01

Modelling is an important subject in the Bachelor curriculum of Applied Mathematics at Eindhoven University of Technology in the Netherlands. Students not only learn how to apply their knowledge to solve mathematical problems posed in non-mathematical language, but also they learn to look actively

Breaktrough innovations by locally embedded start-ups and SMEs in a global network

NARCIS (Netherlands)

Ad Breukel; Henk Zeegers

2017-01-01

This chapter diagnoses the situation of high-tech small and medium enterprises (SMEs) in the Eindhoven Brainport region in the south of the Netherlands, based on desk research and additional background interviews. This region has an ecosystem with a very proliferated heritage of technology-based

Lateral behavior of steel frames with discretely connected precast concrete infill panels

NARCIS (Netherlands)

Teeuwen, P.A.

2009-01-01

As an alternative to the conventional structures for tall buildings, a hybrid lateral load resisting structure has been designed at Eindhoven University of Technology. It consists of discretely connected precast concrete panels with window openings in steel frames, and is a new application in

Ontwerponderzoek naar paviljoen van Le Corbusier (Webpagina Archined 23-2-2010 sectie nieuws/recensies)

NARCIS (Netherlands)

Veldpaus, L.

2010-01-01

In Eindhoven is bij de TU een tentoonstelling te zien, gewijd aan het vooruitstrevende 'Pavillon des Temps Nouveaux' dat Le Corbusier samen met Pierre Jeanneret ontwierp voor de 'Exposition Internationale des Arts et des Techniques Appliques a la Vie Moderne', ofwel de Wereldtentoonstelling van 1937

Self-Reflection and Professional Competences in the Master Program for Chemical Engineers

NARCIS (Netherlands)

Reijenga, J.C.; Vinken, E.; Gupta-Bhowon, M.; Jhaumeer-Laulloo, S.; Li Kam Wah, H.; Ramasami, P.

2009-01-01

This paper presents an investigation into the quality of self-reflection during industrial intern-ships by Chemical Engineering students at the Eindhoven University of Technology in The Netherlands. The quality of the self-reflection reports written at the end of a compulsory in-dustrial internship

Quantification in echocardiography

NARCIS (Netherlands)

Korsten, H.H.M.; Mischi, M.; Grouls, R.J.E.; Jansen, A.H.M.; Dantzig, van J.M.; Peels, C.H.

2006-01-01

Until recently, more than 2200 Swan Ganz catheters were used annually in the operating rooms (OR) and intensive care unit (ICU) of the Catharina Hospital in Eindhoven, The Netherlands. After cardiologists who were specialists in echocardiography (ECHO) trained anesthesiologists in ECHO, the need for

Een andere economie is mogelijk

NARCIS (Netherlands)

ir.ing Ruud Thelosen

2016-01-01

Na het verschijnen van de nieuwe heruitgave van Rudolf Steiner's economiecursus, heeft uitgever en publicist John Hogervorst een twintigtal lezingen gehouden in Nederland en een daarvan was op het Novaliscollege in Eindhoven. Daarin legt hij de uitgangspunten en visie uit voor een groter publiek.

Analysis of potential energy saving strategies in a Bangkok school building. With CD-ROM; Analyse von Energieeinsparpotentialen am Beispiel einer Schule in Bangkok

Energy Technology Data Exchange (ETDEWEB)

Temming, H.V.

2000-05-01

In cooperation with the Gesellschaft fuer technische Zusammenarbeit GTZ, a school building in Thailand was selected for an analysis of potentials for energy saving. The selected school was the New International School of Thailand (NIST) in Bangkok. Energy-relevant data were acquired by measurements, and solutions for more efficient energy supply were developed. Recommendations were made on this basis. This dissertation is also available on CD-ROM. [German] In Zusammenarbeit mit der Gesellschaft fuer technische Zusammenarbeit GTZ wurde als Beispielobjekt eine thailaendische Schule, die New International School of Thailand (NIST) in Bangkok ausgewaehlt. An diesem Objekt wurden die verschiedenen energetischen Messungen durchgefuehrt. Diese wurden bedarfsgerecht ausgewertet. Auf der Basis der Ergebnisse wurden Loesungsmoeglichkeiten fuer eine effizientere Energieversorgung der Schule konstruiert und diese Alternativen wie oben beschrieben bewertet, woraus sich entsprechende Empfehlungen ergeben. Der Aufbau dieser Arbeit stellt sich nun folgendermassen dar: Nachdem in einem ersten Schritt die fuer diesen Kontext wichtigsten Parameter Thailands und des Untersuchungsobjektes dargestellt werden, schliesst sich hieran die Vorstellung verschiedener technische Alternativen zur Erzeugung von Kaelte an, da hier ein Fokus fuer moegliche Energieeinsparungen gesetzt wird. Anschliessend werden einige in der Arbeit verwandte Berechnungsverfahren fuer energetische oder wirtschaftliche Zuammenhaenge sowie eine ausfuehrliche Beschreibung der energetischen 1st-Situation des Untersuchungsobjektes dargestellt. Darauf aufbauend folgt nun die Vorstellung der verschiedenen Energieeinsparpotentiale durch technische und verhaltensinduzierte Optimierungsmassnahmen. Diese Arbeit endet mit der Bewertung aller aufgedeckten Potentiale und einem Gesamtfazit aus der Untersuchung. (Diese Diplomarbeit liegt auch in Form einer CD-ROM vor.) (orig./AKF)

A Focus of Discoveries

CERN Document Server

Huebener, Rudolf Peter

2008-01-01

In 1887, the Physikalisch-Technische Bundesanstalt (PTB) was originally founded as the Physikalisch-Technische Reichsanstalt (PTR) in Berlin in order to promote basic research in physics. It subsequently developed into the largest research center worldwide as a place where scientists could concentrate exclusively on their research subject, and served as a model for similar institutes established in other countries.Within a very short time, the PTR produced extremely important scientific results that cemented its international position at the top, such as Max Planck's radiation law and energy q

Esperanto: een taal van mij, een taal om van te houden = Esperanto: lingvo malfremda, lingvo amida

NARCIS (Netherlands)

Jansen, W.

2010-01-01

Onderstaande tekst vormt de artikelversie van mijn op 4 september 2009 gehouden oratie bij de aanvaarding van het bijzonder hoogleraarschap in de interlinguïstiek en het Esperanto aan de Universiteit van Amsterdam (Jansen, 2009). Ten opzichte van de oorspronkelijke oratie is de nu volgende tekst op

Metaphor Identification as a Research Method for the Study of Career

Science.gov (United States)

Creed, Allison; McIlveen, Peter

2018-01-01

In this paper, we present the Metaphor Identification Procedure Vrije Universiteit (MIPVU) for the reliable detection of metaphoric language that may be interpreted using extant vocational psychology theory. Metaphors are ubiquitous in communication and carry influential meaning for people. To illustrate MIPVU, we use transcripts of interviews…

Liberia : van vrijheidsideaal naar verloren paradijs

NARCIS (Netherlands)

Kraaij, van der F.

2013-01-01

Als enthousiaste twintiger vertrekt de schrijver in de jaren zeventig van de vorige eeuw naar het West-Afrikaanse land Liberia. Hij gaat er les geven aan de Universiteit van Liberia. Onder zijn studenten bevinden zich latere ministers; een van zijn studenten ontpopt zich als een gevreesde warlord.

03 Willemse 03.pmd

African Journals Online (AJOL)

Owner

29 Jul 2010 ... The underlying theoretical impulse provides a reading influenced by Bakhtinian notions of dialogism and the reconstruction of the circumstances in which the initial ...... Die stem van die bruinman in die Afrikaanse poësie. Ongepubliseerde M.A. verhandeling. Universiteit van Potchefstroom vir CHO.

Hoe maak je gebruik van tablets voor leren?

NARCIS (Netherlands)

Kalz, Marco; Kluijfhout, Eric; Börner, Dirk; Tabuenca, Bernardo; Kester, Liesbeth; Wolff, Charlotte; Bahreini, Kiavash; Gijselaers, Jérôme; Andeweg, Cisca; De Vries, Fred; Berkhout, Jeroen; Storm, Jeroen

2012-01-01

Kalz, M., Kluijfhout, E., Börner, D., Tabuenca, B., Kester, L., Wolff, C., Bahreini, K., Gijselaers. J., De Vries, F., Andeweg, C., Berkhout, J., & Storm, J. (2012, 28 September). Hoe maak je gebruik van tablets voor leren? Masterclass in de OpenU community. Open Universiteit, Heerlen, Nederland.

Frailty and sarcopenia

NARCIS (Netherlands)

Hobbelen, Hans

2014-01-01

Wereldwijd zien we de trend dat de bevolking vergrijst. Dit vraagt om verdieping in het verouderingsproces en in het voorkomen van gezondheidsproblemen. Deze dag van de summerschool healthy Ageing van de Universiteit Utrecht richt zich met name op de praktische kennis en vaardigheden op het gebied

OpenU 1.0

NARCIS (Netherlands)

Alberts, Jules; Finders, Anton; Martens, Harrie; Obreza, Matija; Schaeps, Leon; Slootmaker, Aad; Slot, Wim; Storm, Jeroen; Ternier, Stefaan; Van der Vegt, Wim; Vogten, Hubert

2013-01-01

Alberts, J., Finders, A., Martens, H., Obreza, M., Schaeps, L., Slootmaker, A., Slot, W., Storm, J., Ternier, S., Van der Vegt, W., & Vogten, H. (2012). OpenU (Version 1.0) [Software]. Heerlen, The Netherlands: Open Universiteit. Available under the GNU Lesser General Public License (LGPL3).

Funktioneel programmeren als basis voor het programmeeronderwijs [Functional Programming as Base for Computer Programming Courses

NARCIS (Netherlands)

Joosten, S.M.M.; van den Berg, Klaas; Mulder, F.

1990-01-01

Aan de Universiteit Twente is de afgelopen vier jaar geëxperimenteerd met een inleidende kursus in het programmeren, op basis van funktioneel programmeren. Dit artikel gaat in op het waarom van deze aanpak, de doelstelling van het programmeeronderwijs, de opzet en inhoud van de kursusonderdelen en

LINH-cijfers: meer impetigo, vooral in landelijk en Zuid-Nederland.

NARCIS (Netherlands)

Koning, S.; Jabaaij, L.

2006-01-01

Vergeleken met 1987, ging in 2001 een kwart meer kinderen voor de huidziekte impetigo (‘krentenbaard’ of ‘kinderzeer’) naar de huisarts: van jaarlijks 16,5 naar 20,6 gevallen per 1000 kinderen. Dat blijkt uit onderzoek van Sander Koning, onderzoeker aan de Erasmus Universiteit Rotterdam en

SEDIMENTOLOGIE IN UTRECHT : hoe staat het daar mee?

NARCIS (Netherlands)

Westerhoff, Wim

Sinds het vertrek van Poppe de Boer, eind 2014, stelt de Utrechtse Universiteit het zonder een hoogleraar sedimentologie. Toch gaan er jaarlijks honderden studenten op veldwerk en speelt de sedimentologie in onderwijs en onderzoek een cruciale rol. Hoe zit dat eigenlijk? En wie zijn nu de gezichten

Gewaskeuze beïnvloedt insectendiversiteit

NARCIS (Netherlands)

Poelman, E.H.

2009-01-01

Op 1 oktober 2008 promoveerde Erik Poelman aan Wageningen Universiteit op het proefschrift getiteld ‘Linking variation in plant defence to biodiversity at higher trophic levels: a multidisciplinary approach’. Het doel van dit onderzoeksproject was om te bepalen wat het effect is van variatie in de

A newly designed 45 to 60 mer oligonucleotide Agilent platform microarray for global gene expression studies of Synechocystis PCC6803: example salt stress experiment

NARCIS (Netherlands)

Aguirre von Wobeser, E.; Huisman, J.; Ibelings, B.; Matthijs, H.C.P.; Matthijs, H.C.P.

2005-01-01

A newly designed 45 to 60 mer oligonucleotide Agilent platform microarray for global gene expression studies of Synechocystis PCC6803: example salt stress experiment Eneas Aguirre-von-Wobeser 1, Jef Huisman1, Bas Ibelings2 and Hans C.P. Matthijs1 1 Universiteit van Amsterdam, Amsterdam, The

Institutionele repositories: UvA maakt onderzoek beter zichtbaar en toegankelijk

NARCIS (Netherlands)

Woutersen-Windhouwer, S.

2009-01-01

De UB Amsterdam (UvA) zet zich in om de onderzoeksresultaten van de universiteit toegankelijk te maken. Dat vergroot de impact van het onderzoek en de zichtbaarheid van de wetenschappers. Hiervoor heeft de UB een nieuwe werkwijze opgezet, waarbij ze de wetenschapppers actief benadert. En met succes:

Management van World-Wide Web Servers

NARCIS (Netherlands)

van Hengstum, F.P.H.; Pras, Aiko

1996-01-01

Het World Wide Web is een populaire Internet toepassing waarmee het mogelijk is documenten aan willekeurige Internet gebruikers aan te bieden. Omdat hiervoor nog geen voorzieningen zijn getroffen, was het tot voor kort niet goed mogelijk het World Wide Web op afstand te beheren. De Universiteit

Healthy Ageing and the importance of physical activity

NARCIS (Netherlands)

Hobbelen, Hans

2014-01-01

Wereldwijd zien we de trend dat de bevolking vergrijst. Dit vraagt om verdieping in het verouderingsproces en in het voorkomen van gezondheidsproblemen. Deze dag van de summerschool Healthy Ageing van de Universiteit Utrecht richt zich met name op de praktische kennis en vaardigheden op het gebied

Van Homo Ludens naar Homo Turisticus: regressie of stap in de menselijke evolutie?

NARCIS (Netherlands)

Lengkeek, J.

2009-01-01

In zijn afscheidsrede wilde hoogleraar Jaap Lengkeek (Wageningen Universiteit) terugblikken op een idee, een begrip, dat op zijn eigen werk de afgelopen jaren invloed heeft gehad. Het begrip dat hij hiervoor koos is 'Homo Ludens', de spelende mens, dat door de bekende historicus Johan Huizinga in

Zorg voor natuur in de eeuw van de consument

NARCIS (Netherlands)

Koppen, van C.S.A.

2005-01-01

Rede uitgesproken bij de aanvaarding van het ambt van bijzonder hoogleraar Natuur- en milieueducatie aan de Universiteit Utrecht op 24 februari 2005. Het doel van deze oratie is om op een andere, meer sociologische wijze verband te leggen tussen NME en consumptie. Consumptie geldt dan als een

10 Bel 03.pmd

African Journals Online (AJOL)

Owner

2 maart 2009 ... Congo, de missie en de literatuur: Over David van Reybrouck,. J. G. Schoup en Amaat Vyncke. Jacqueline Bel. Jacqueline Bel is als universitair hoofddocent moderne Nederlandse letterkunde verbonden aan de Vrije. Universiteit in Amsterdam. Zij is onder meer gespecialiseerd in Nederlandse en Vlaamse.

Multidisciplinary projects at the Eindhoven/Maastricht BME program

NARCIS (Netherlands)

Sauren, A.A.H.J.; Lammerts, I.M.M.; Clark, J.W.

2002-01-01

Integration and application of technical and (bio)medical knowledge in the complex area of biomedical engineering is a matter of teamwork. In our educational BME program special attention is focussed on this issue, by means of multidisciplinary projects (MDP's) for 3rd and 4th year students. The

Twee afdelings van een fakulteit 1934−1940

Directory of Open Access Journals (Sweden)

J.P. Oberholzer

2010-09-01

Full Text Available Die Universiteit benoem op voordrag van die Nederduitsch Hervormde of Gereformeerde Kerk vir dominee G.M. Pellisier in die pos Godsdienswetenskap wat deur die bedanking van professor Macmillan vakant gelaat is. Dit word die begin van ‘n ontwikkeling van twee feitlik selfstandige afdelings binne die Fakulteit Teologie. Die toetrede van H.P. Wolmarans as vierde dosent vanweë die Nederduitsch Hervormde Kerk bring nuwe teologiese aksente. Die verhouding tussen die Nederduitsch Hervormde Kerk en die Universiteit kry beslag in ‘n skriftelike kontrak. In 1937 word dit gevolg deur ‘n tweede kontrak waarin die ruimte geskep word vir die bestaan van twee fakulteitsafdelings. Vanaf 1938 funksioneer die twee afdelings naas mekaar met gelykluidende kontrakte. Hierdie kroniek volg dan verder die gang van Afdeling A, die afdeling beman deur ampsdraers van die Nederduitsch Hervormde Kerk. Die benoeming as lektore van A. van Selms in 1938 en C.H. Rautenbach in 1939 verhoog die akademiese kwaliteit van die afdeling verder.

Prediction of mechanical fatigue caused by multiple random excitations

NARCIS (Netherlands)

Bonte, M.H.A.; de Boer, Andries; Liebregts, R.

2004-01-01

A simulation method is presented for the fatigue analysis of automotive and other products that are subjected to multiple random excitations. The method is denoted as frequency domain stress-life fatigue analysis and was implemented in the automotive industry at DAF Trucks N.V. in Eindhoven, The

Development of a pneumatic roof envelope for industrial greenhouses

NARCIS (Netherlands)

Lindner, G.; Vos, de G.J.

2008-01-01

The Eindhoven University of Technology (TU/e) was approached by Van Diemen BV, a turn-key greenhouse builder looking for a new and higher insulated design for their green house envelope. They had developed a new system of climate control which rendered windows for ventilation purposes unnecessary

De verkeers(on)veiligheid in de gemeente Nijmegen.

NARCIS (Netherlands)

Vis, A.A. & Wegman, F.C.M.

1993-01-01

This paper analyses the accident rate in the Dutch municipality of Nijmegen in comparison with that of a reference area consisting of the following Dutch cities: The Hague, Eindhoven, Geleen, Haarlem, Heerlen, Leyden, Schiedam and Utrecht. The results of this study show that Nijmegen can be

Introduction: Department of Industrial Design

NARCIS (Netherlands)

Hummels, C.C.M.; Frens, J.W.; Tomico, O.

2008-01-01

Eindhoven University of Technology (TU/e) intends to be a research-driven, design-oriented university of technology at an international level with the primary objective of pro viding young people with an academic education within the ‘engineering science & technology’ domain. It aims to advance the

Perception of urban retailing environments : an empirical analysis of consumer information and usage fields

NARCIS (Netherlands)

Timmermans, H.J.P.; vd Heijden, R.E.C.M.; Westerveld, J.

1982-01-01

This article reports on an empirical analysis of consumer information and usage fields in the city of Eindhoven. The main purposes of this study are to investigate the distance, sectoral and directional biases of these fields, to analyse whether the degree of biases is related to personal

DEALed : A tool suite for distributed real-time systems development

NARCIS (Netherlands)

Bolshakov, K.; Karpov, Y.; Sintotski, A.; Malyshkin, V.

1999-01-01

DEALed is a tool suite for development of distributed systems using DEAL language. DEAL is being developed at Eindhoven University of Technology as a part of DEDOS project. Area of application of the DEALed is the development of the distributed real- time safety-critical control systems.

Effective release of lignin fragments from Lignocellulose by Lewis Acid Metal triflates in the lignin-first approach

NARCIS (Netherlands)

Huang, X.; Zhu, J.; Koranyi, T.I.; Boot, M.D.; Hensen, E.J.M.

2016-01-01

Cover image: Invited for this month′s cover is the group of Emiel Hensen at the Eindhoven University of Technology. The image shows how the lignin component can be effectively released from wood and converted into aromatics over a tandem Al-triflate and Pd/C catalyst.

Composite metal-ceramic material for high temperature energy conversion applications

NARCIS (Netherlands)

Wolff, L.R.

1988-01-01

At Eindhoven Universitu of technology a composite metal-ceramic material is being developed. It will serve as a protective confinement for a combustion heated Thermionic Energy Converter (TEC). This protective confinement of 'hot shell' consists of a composite W-TiN-SiC layer structure. The outer

Bright environments vision of the Intelligent Lighting Institute (ILI)

NARCIS (Netherlands)

Özçelebi, T.

2014-01-01

The Bright Environments research program of the Eindhoven University of Technology Intelligent Lighting Institute aims to find new methods of intelligent lighting control and human interaction. We present a summary of the institute’s work on this research field and the research vision of the Bright

Preface - The 27th International Conference on Phenomena in Ionized Gase

NARCIS (Netherlands)

Kroesen, G.M.W.; Kroesen, G.M.W.

2006-01-01

The 27th International Conference on Phenomena in Ionized Gases (ICPIG) was held in the conference resort of NH Koningshof in Veldhoven, near Eindhoven, The Netherlands, 17–22 July 2005. ICPIG is an important biennial event at which academics and industrialists working in low-temperature plasma

Knowledge triangles in the Netherlands : an entrepreneurial ecosystem approach

NARCIS (Netherlands)

Stam, E.; Romme, A.G.L.; Roso, M.; van den Toren, J.P.; van der Starre, B.T.

2016-01-01

This is a study of the knowledge triangles of research-education-innovation in several Dutch regional ecosystems. It draws on case studies of the Amsterdam, Twente and Eindhoven regions as well as the analysis of secondary data regarding a larger set of regional ecosystems in the Netherlands.

Whole building energy performance anomaly detection at TU/e

NARCIS (Netherlands)

Hensen, J.L.M.; Bynum, J.D.

2013-01-01

Existing buildings account for the majority of energy consumption in the building sector. Surveys of existing buildings have found an estimated 10-20% reduction in energy consumption may be feasible. Research at the Eindhoven University of Technology (TU/e) is seeking to realize this potential in

Developing engineering students' research and technology assessment abilities

NARCIS (Netherlands)

Vries, de M.J.; Stroeken, J.H.M.

1996-01-01

This article describes research done among M. Eng. students in several faculties of the Eindhoven University of Technology into their abilities to integrate nontechnical (social) elements in the research that led to their M. Eng. theses. It was found that these students often lacked research skills

Living with the physical and mental consequences of an ostomy : A study among 1–10-year rectal cancer survivors from the population-based PROFILES registry

NARCIS (Netherlands)

Mols, F.; Lemmens, V.E.P.P.; Bosscha, K.J.; Broek van den, W.; Thong, M.S.Y.

2014-01-01

Background This study examined the physical and mental consequences of an ostomy among 1–10-year rectal cancer survivors. Methods Patients with rectal cancer diagnosed from 2000 to 2009, as registered in the population-based Eindhoven Cancer Registry, received a questionnaire on quality of life

The Basque country declaration : gerontechnology comments

NARCIS (Netherlands)

Franco, A.; Fozard, J.L.; Bouwhuis, Don; Bronswijk, van J.E.M.H.; Charness, N.; Colombo, M.; Hsu, Y-L.; Hummels, C.C.M.; Kearns, W.D.; Kort, H.S.M.; Mahoney, D.; Spierings, D.; Tinker, A.; Wahl, H.; Wright, P.

2013-01-01

At the end of ISG*ISARC2012 World Conference, Eindhoven, June 27-29, 2012, a discussion took place by video conference, between participants of the AAL summit (chaired by Olga Rivera, Basque Country’s Deputy Minister of Health Research and Innovation) and the gerontechnology conference (chaired by

Configurable 3D rotational X-ray reconstruction

NARCIS (Netherlands)

Nguyen, Xuan Huy

2012-01-01

This report is one of the deliverables of the project "Configurable 3D Rotational X-ray Reconstruction", carried out by the author as the final part of the Professional Doctorate in Engineering (PDEng) degree program in Software Technology provided by Eindhoven University of Technology and Stan

Estimators for initial conditions for optimisation in learning hydraulic systems

NARCIS (Netherlands)

Post, W.J.A.E.M.; Burrows, C.R.; Edge, K.A.

1998-01-01

In Learning Hydraulic Systems (LHS1. developed at the Eindhoven University of Technology, a specialised optimisation routine is employed In order to reduce energy losses in hydraulic systems. Typical load situations which can be managed by LHS are variable cyclic loads, as can be observed In many

Building with materials from demolition projects

NARCIS (Netherlands)

Moonen, S.P.G.; Hermans, K.; Shu-Ming, xx; Che-Ming Chiang, xx; Chun-Ta Tzeng, xx; Kuang-Sheng Liu, xx; Nien-Tsu Chen, xx; Yi-Pin Lin, xx; Emmitt, S.

2013-01-01

Students of Eindhoven University of Technology have developed a sustainable and innovative hikers’ cabin, called "Trek-In" for SNK, a Dutch coordinating organization of natural campsites. By now, three Trek-Ins are in commercial use, while SNK intends to exploit over 100 Trek-Ins in the coming

Konfliktfreie Phasen für Radfahrer und Mopedfahrer.

NARCIS (Netherlands)

Welleman, A.G.

1984-01-01

In the study on the redivision and reconstruction of Eindhoven, the improvement of junctions in the ring road was mentioned. These junctions have special bicycle provisions. The effect of the introduction of traffic signal control and conflict free phases for cyclists and moped riders at these

Customer profiles : extracting usage models from log files

NARCIS (Netherlands)

Janeski, Miroslav

2014-01-01

The project "Customer Profiles" is executed under supervision of the Embedded System Innovation by TNO (TNO-ESI) at ASML. The project was a full-time, nine-month graduation assignment in the context of a post-master program in Software Technology offered by the Eindhoven University of Technology.

Experimental investigations into in-plane stiffness and strength of steel frames with precast concrete infill panels

NARCIS (Netherlands)

Hoenderkamp, J.C.D.; Hofmeyer, H.; Snijder, H.H.; Richard Liew, J.; Choo, Y.S.

2007-01-01

At Eindhoven University of Technology a research program on composite construction is underway aiming at the development of design rules for steel frames with precast concrete infill panels subject to horizontal loading. In two projects, 3 by 3 m steel frames are infilled with concrete: solid

Touchscreen device to 'calm and de-stress'.

Science.gov (United States)

Kuijpers, Erik; Datema, Cor

2014-10-01

A highly experienced former psychiatric nurse until recently innovation manager at the Geestelijke Gezondheidszorg Eindhoven (GGZe)--the Eindhoven Mental Health Institute in the Netherlands, and a PhD holder in physics who spent several years at Philips Healthcare, have jointly developed an interactive 'communication wall' designed primarily as a communication tool for, and as a means to help 'de-stress', patients in inpatient mental health facilities during periods of acute anxiety. Erik Kuijpers and Cor Datema will show a version of their 'Cowall' on the Britplas stand at this month's Healthcare Estates 2014. As HEJ editor, Jonathan Baillie, discovered, when he met them during one of their recent trips to the UK, late in 2013 they formed a company, Recornect, to market the system, and to provide consultancy to those keen to specify the latest technology for mental and acute healthcare settings. Their Cowall has already seen installations in mainland Europe, and the pair are now seriously targeting the UK.

De maatschappelijke impact van de Nederlandse Hartstichting

NARCIS (Netherlands)

Maas, K.; Booijink, P.; Commandeur, H.R.; Burger, F.

2009-01-01

China may be the world’s largest growth market, but it has not always been hospitable to foreign companies. This appears from a survey of 381 managers of foreign companies active in China done by the Center for International Business of Universiteit Nyenrode, Breukelen, the Netherlands. The survey

Exploring the Logistics Sector in Bangladesh : Opportunities, Threats and Practical Information

NARCIS (Netherlands)

Argyrou, Katerina|info:eu-repo/dai/nl/407629459

On behalf of the Embassy of the Kingdom of The Netherlands in Bangladesh, Nyenrode Business Universiteit has conducted studies on four priority sectors in the Bangladeshi economy: food (safety), logistics, water and ICT. In this report the research is focused on answering the question ‘How can Dutch

Continuum description of thermodynamic processes in porous media: Fundament als and Applications

NARCIS (Netherlands)

Hassanizadeh SM

1987-01-01

Dit is de tekst van een aantal lezingen die door de auteur zijn gegeven bij de afdeling civiele techniek van de Universiteit van Notre Dame te Indiana, U.S.A. Uitgangspunten en principes die ten grondslag liggen aan de beschrijving van de continue poreuze media worden gepresenteerd en

ABC transporters van Botrytis cinerea in biotische en abiotische interacties

NARCIS (Netherlands)

Schoonbeek, H.

2005-01-01

Op 29 november 2004 promoveerde Henk-jan Schoonbeek aan Wageningen Universiteit op het proefschrift getiteld 'ABC transporters from Botrytis cinerea in biotic and abiotic interactions'. Promotor was Prof. dr. ir. P.J.G.M. de Wit en co-promotor was dr.ir. M.A. de Waard, leerstoelgroep Fytopathologie,

Thijs van Vugt, Een arbeidersbuurt onder de rook van ‘De Sphinx’. Eeen sociaal-ruimtelijke geschiedenis van het Boschstraatkwartier-Oost te Maastricht, 1829-1904

Directory of Open Access Journals (Sweden)

Christianne Smit

2015-12-01

Full Text Available Thijs van Vugt, Een arbeidersbuurt onder de rook van ‘De Sphinx’. Een sociaal-ruimtelijke geschiedenis van het Boschstraatkwartier-Oost te Maastricht, 1829-1904 (Dissertatie Universiteit van Maastricht 2015; Maaslandse Monografieën 78; Hilversum: Verloren, 2015, 228 pp., isbn 978 90 8704 493 0.

Spring in the Arab Spring

NARCIS (Netherlands)

Borg, G.J.A.

2011-01-01

Column Gert Borg | Spring in the Arab Spring door dr. Gert Borg, onderzoeker bij Islam en Arabisch aan de Radboud Universiteit Nijmegen en voormalig directeur van het Nederlands-Vlaams Instituut Caïro Spring If, in Google, you type "Arab Spring" and hit the button, you get more than

Community of Learners (2): samen met vakcollega's op zoek naar een betere introductie van telproblemen

NARCIS (Netherlands)

Timmer, Mark

2014-01-01

Sinds het schooljaar 2009-2010 wordt er op de Universiteit Twente in de vorm van een "Community of Learners" (CoL) gewerkt aan verbetering van het wiskundeonderwijs. Aan de hand van verscheidene praktijkonderzoeken is reeds duidelijk geworden dat we veel kunnen leren door gezamenlijk één of twee

Arnold Roosendaal, Digital Personae and Profiles in Law. Protecting Individuals’ Rights in Online Contexts [Bespreking van: Digital Personae and Profiles in Law

NARCIS (Netherlands)

Lodder, A.R.

2014-01-01

Op 21 mei 2013 verdedigde Arnold Roosendaal aan de Universiteit Tilburg zijn proefschrift Digital Personae and Profiles in Law, promotoren waren Ronald Leenes en Bert-Jaap Koops. In de openingszin wordt het belang van het proefschrift direct duidelijk: “Personal data is the new oil of the Internet

Stress !!!

NARCIS (Netherlands)

Fledderus, M.

2012-01-01

Twee op de vijf UT-studenten hebben last van ernstige studiestress, zo erg zelfs dat het ze in hun privéleven belemmert. Die cijfers komen overeen met het landelijk beeld van stress onder studenten. Samen met 14 andere universiteits- en hogeschoolbladen enquêteerde UT Nieuws bijna 5500 studenten.

Musicking in Groningen : Towards a grounded theory of the uses and functions of music in a modern western society

NARCIS (Netherlands)

dr. Evert Bisschop Boele

2013-01-01

Proefschrift ter verkrijging van de graad van doctor aan de sociaal-wetenschappelijke faculteit van de Georg-August Universiteit van Göttingen. This study focuses on the uses and functions of music in the life of individuals in the province of Groningen at the beginning of the twenty-first century.

A dynamic usage-based approach to second language teaching

NARCIS (Netherlands)

Nguyen, Thi Phuong Hong

2013-01-01

Hoe kunnen studenten aan de Universiteit van Catho in Vietnam het beste Engels leren? Met een methode waar veel geoefend wordt met spreken en uitleg wordt gegeven over de grammatica of met een methode waarin een populaire film getoond wordt en alleen begrijpend luisteren centraal staat? De laatste

Heeft de teelt van quinoa een toekomst in België? : Interview met Ruud Timmer

NARCIS (Netherlands)

Cillen, L.; Timmer, R.D.

2014-01-01

Quinoa (Chenopodium quinoa) is een gewas dat al eeuwenlang in Zuid-Amerika wordt geteeld en gegeten en tegenwoordig aan populariteit wint bij de Europese consument. Maar is het mogelijk om dit gewas ook in België te telen? We vroegen aan Ruud Timmer, onderzoeker aan de Universiteit van Wageningen,

A270 Demo Schokgolfdemping

NARCIS (Netherlands)

Netten, B.D.; Broek, T.H.A. van den; Blom, G.

2010-01-01

In februari 2010 zijn een aantal grootschalige experimenten uitgevoerd op de A270 tussen Helmond en Eindhoven. Het doel van deze experimenten is om de potentie van coöperatieve systemen te demonstreren voor het dempen van schokgolven en daarmee de mobiliteit op de Nederlandse snelwegen te kunnen

Trapping water from desert fog

NARCIS (Netherlands)

Carvalho Esteves, de A.C.

2013-01-01

A coated cotton fabric can absorb more than 3 times its weight in water from warm, moist air, and release it again at higher temperatures. John Xin at the Hong Kong Polytechnic University in China, Catarina Esteves at Eindhoven University of Technology in the Netherlands and their colleagues grafted

Design of an efficient, low weight battery electric vehicle based on a VW Lupo 3L

NARCIS (Netherlands)

Besselink, I.J.M.; Oorschot, van P.F.; Nijmeijer, H.

2010-01-01

A battery electric vehicle is being developed at the Eindhoven University of Technology, which will beused in future research projects regarding electric mobility. Energy storage in batteries is still at least 25 times heavier and has 10 times the volume in comparison to fossil fuel. This leads to

Dansmuggen in natuurontwikkelingsgebieden (Chironomidae)

NARCIS (Netherlands)

Moller Pillot, H.K.M.

1999-01-01

Chironomidae in newly created nature reserves In a newly created nature reserve near Eindhoven many interesting species of Chironomidae were found. Several new species to the Dutch fauna were identified and one species (of the genus Neozavrelia) proved to be new to science. The fauna of these young

The Virtual Campus Hub Concept

DEFF Research Database (Denmark)

Badger, Merete; Prag, Sidsel-Marie Winther; Monaco, Lucio

of Technology in Sweden, Politecnico di Torino in Italy, and Eindhoven University of Technology in the Netherlands. The project is partially funded by the European Commission under the 7th Framework Programme (project no. RI-283746). This report describes the final concept of Virtual Campus Hub. It gives...

Microwave assisted flow synthesis : coupling of electromagnetic and hydrodynamic phenomena

NARCIS (Netherlands)

Patil, N.G.; Benaskar, F.; Meuldijk, J.; Hulshof, L.A.; Hessel, V.; Schouten, J.C.; Esveld, D.C.; Rebrov, E.

2014-01-01

This article is dedicated to the remembrance of one of the coauthors, Prof. Dr. L.A. (Bert) Hulshof, who passed away recently. In his work, at DSM and at Eindhoven University of Technology, Professor Bert Hulshof made many original and creative contributions to the field of Fine Chemical Process

A questionary for assessment of visual needs and wishes

NARCIS (Netherlands)

Jorritsma, F.F.; Neve, J.J.; Kinds, G.F.; Kooijman, A.C.; Looijestijn, P.L.; Welling, J.A.; Wildt, van der G.J.

1994-01-01

The Visual Advice Centre Eindhoven (V AC-E) provides the partially sighted with advice and prescriptions for low vision aids and illumination. As a first step an assessment interview is held. The visual problems of the patient are inquired and the demands for help defined. The assessment interview

Korte mededeling

NARCIS (Netherlands)

Rensen-Bronkhorst, R.; Spronk, J.

1983-01-01

Ludwigia palustris (L.) Elliot weer in Noord-Brabant gevonden. Geïnspireerd door leuke plantevondsten op de ijsbaan van Schijndel werd op 17 augustus 1983 door de plantenwerkgroep van de KNNV-afdeling Eindhoven een bezoek gebracht aan de Nuenense ijsbaan. Door de zeer droge zomer was het terreintje

Redefining toys, games and entertainment products by designing playful interactions

NARCIS (Netherlands)

Bekker, M.M.; Hummels, C.C.M.; Nemeth, A.G.G.E.; Mendels, P.

2010-01-01

This paper describes how students are taught to design (computer) games and toys in a broad sense of the word at the Department of Industrial Design at the Eindhoven University of Technology. The curriculum is highly project driven, which means that students acquire a large amount of hands-on

Exchanging Touristic Information between City Tourists

NARCIS (Netherlands)

Braat, B.A.L.; Geleijnse, G.; Mason, J.D.

2009-01-01

This technical note is based on Bram Braat's master's thesis, written as a Industrial Design student at the Eindhoven University of Technology. The project was conducted at the User Experiences group in the context of the Hospitality project. The goal of this student project was to design a product

New patterning paradigm? : selective deposition may be the way forward to the far reaches of device scaling after 7nm.

NARCIS (Netherlands)

Lapedus, M.; Kessels, W.M.M.

2015-01-01

The Eindhoven University of Technology, for one, is working on another approach—direct-write ALD. This is based on an area-selective ALD by an area-activation technique. This makes use of electron-beam induced deposition (EBID) or ion-beam induced deposition (IBID). "We combine the advantages of

Are low vision aids still used six months after prescription?

NARCIS (Netherlands)

Neve, J.J.; Jorritsma, F.F.; Damkot, J.; Streefland, V.; Kooijman, A.C.; Looijestijn, P.L.; Welling, J.A.; Wildt, van der G.J.

1994-01-01

The Visual Advice Centre Eindhoven (VAC-E) is specialised in the rehabilitation of visually impaired persons with visual aids and illumination. Half a year after their last visit to the centre patients are contacted by telephone or by letter to enquire after their visual functioning and the use of

Talk has started about the internet of things

NARCIS (Netherlands)

Koonen, A.M.J.

2010-01-01

Professor Ton Koonen at the COBRA Institute at Eindhoven University of Technology in the Netherlands talks about the research behind his groupÿ¿s Letter `WiMedia-compliant UWB trans mission over 1 mm core diameter plastic optical fibreÿ¿ on page 434.

Characterization of BIPV(T) applications in research facility ‘SOLARBEAT’

NARCIS (Netherlands)

Valckenborg, R.M.E.; Hensen, J.L.M.; Folkerts, W.; Vries, de A.

2015-01-01

The SolarBEAT facility is an outdoor Research & Development infrastructure for innovation on BIPV(T). The facility is a cooperation between SEAC and the Technical University Eindhoven and is located in the Netherlands. It has been founded early 2014 and has grown rapidly to its full capacity at the

Teaching Hypertext and Hypermedia through the Web.

Science.gov (United States)

de Bra, Paul M. E.

This paper describes a World Wide Web-based introductory course titled "Hypermedia Structures and Systems," offered as an optional part of the curriculum in computing science at the Eindhoven University of Technology (Netherlands). The technical environment for the current (1996) edition of the course is presented, which features…

Teaching hypertext and hypermedia through the web

NARCIS (Netherlands)

De Bra, P.M.E.

1996-01-01

Since early 1994 the introductory course 2L670, "Hypermedia Structures and Systems", has been available on World Wide Web, and is an optional part of the curriculum in computing science at the Eindhoven University of Technology. The course has since been completed by more than 200 students from

Testicular cancer: marked birth cohort effects on incidence and a decline in mortality in southern Netherlands since 1970.

NARCIS (Netherlands)

Verhoeven, R.; Houterman, S.; Kiemeney, B.; Koldewijn, E.L.; Coebergh, J.W.W.

2008-01-01

The aim of our study was to interpret the changing incidence, and to describe the mortality of patients with testicular cancer in the south of the Netherlands between 1970 and 2004. On the basis of data from the Eindhoven Cancer Registry and Statistics Netherlands, 5-year moving average standardised

Design management in the architectural engineering and construction sector : proceedings of the joint CIB W096 Architectural Management and CIB TG49. Architectural Engineering Conference held in conjunction with the 8th Brazilian Workshop on Building Design Management, University of Sao Paulo, 4-8 December 2008

NARCIS (Netherlands)

Melhado, S.; Prins, M.; Emmitt, S.; Bouchlaghem, D.; Otter, den A.F.H.J.

2008-01-01

Following the Denmark meeting, held in Lyngby 2005, the CIB W096 commission on Architectural Management merged its own meetings with two large events, the Adaptables Conference in Eindhoven 2006, and the CIB world Conference in Cape Town in 2007. Papers were invited under the theme Design Management

Peak loads and network investments in sustainable energy transitions

Energy Technology Data Exchange (ETDEWEB)

Blokhuis, Erik, E-mail: e.g.j.blokhuis@tue.nl [Eindhoven University of Technology, Department of Architecture, Building and Planning, Vertigo 8.11, P.O. Box 513, 5600MB Eindhoven (Netherlands); Brouwers, Bart [Eindhoven University of Technology, Department of Architecture, Building and Planning, Vertigo 8.11, P.O. Box 513, 5600MB Eindhoven (Netherlands); Putten, Eric van der [Endinet, Gas and Electricity Network Operations, P.O. Box 2005, 5600CA Eindhoven (Netherlands); Schaefer, Wim [Eindhoven University of Technology, Department of Architecture, Building and Planning, Vertigo 8.11, P.O. Box 513, 5600MB Eindhoven (Netherlands)

2011-10-15

Current energy distribution networks are often not equipped for facilitating expected sustainable transitions. Major concerns for future electricity networks are the possibility of peak load increases and the expected growth of decentralized energy generation. In this article, we focus on peak load increases; the effects of possible future developments on peak loads are studied, together with the consequences for the network. The city of Eindhoven (the Netherlands) is used as reference city, for which a scenario is developed in which the assumed future developments adversely influence the maximum peak loads on the network. In this scenario, the total electricity peak load in Eindhoven is expected to increase from 198 MVA in 2009 to 591-633 MVA in 2040. The necessary investments for facilitating the expected increased peak loads are estimated at 305-375 million Euros. Based upon these projections, it is advocated that - contrary to current Dutch policy - choices regarding sustainable transitions should be made from the viewpoint of integral energy systems, evaluating economic implications of changes to generation, grid development, and consumption. Recently applied and finished policies on energy demand reduction showed to be effective; however, additional and connecting policies on energy generation and distribution should be considered on short term. - Highlights: > Sustainable energy transitions can result in major electricity peak load increases. > Introduction of heat pumps and electrical vehicles requires network expansion. > Under worst case assumptions, peak loads in Eindhoven increase with 200% until 2040. > The necessary investment for facilitating this 2040 peak demand is Euro 305-375 million. > Future policy choices should be made from the viewpoint of the integral energy system.

Peak loads and network investments in sustainable energy transitions

International Nuclear Information System (INIS)

Blokhuis, Erik; Brouwers, Bart; Putten, Eric van der; Schaefer, Wim

2011-01-01

Current energy distribution networks are often not equipped for facilitating expected sustainable transitions. Major concerns for future electricity networks are the possibility of peak load increases and the expected growth of decentralized energy generation. In this article, we focus on peak load increases; the effects of possible future developments on peak loads are studied, together with the consequences for the network. The city of Eindhoven (the Netherlands) is used as reference city, for which a scenario is developed in which the assumed future developments adversely influence the maximum peak loads on the network. In this scenario, the total electricity peak load in Eindhoven is expected to increase from 198 MVA in 2009 to 591-633 MVA in 2040. The necessary investments for facilitating the expected increased peak loads are estimated at 305-375 million Euros. Based upon these projections, it is advocated that - contrary to current Dutch policy - choices regarding sustainable transitions should be made from the viewpoint of integral energy systems, evaluating economic implications of changes to generation, grid development, and consumption. Recently applied and finished policies on energy demand reduction showed to be effective; however, additional and connecting policies on energy generation and distribution should be considered on short term. - Highlights: → Sustainable energy transitions can result in major electricity peak load increases. → Introduction of heat pumps and electrical vehicles requires network expansion. → Under worst case assumptions, peak loads in Eindhoven increase with 200% until 2040. → The necessary investment for facilitating this 2040 peak demand is Euro 305-375 million. → Future policy choices should be made from the viewpoint of the integral energy system.

Jan Lever: Challenging the Role of Typological Thinking in Reformational Views of Biology

NARCIS (Netherlands)

Cook, Harry; Flipse, A.C.

2017-01-01

This essay analyzes the view of evolution of Jan Lever (1922–2010), founder of the biology department at the Vrije Universiteit Amsterdam, and compares his view with those of J.H. Diemer and H. Dooyeweerd. Together with Dooyeweerd, Lever wrote a series of chapters on the species concept in

research note the oestrous response and changes in plasma ...

African Journals Online (AJOL)

Refercnces. FAURE, A.S., 1975. Vroeii embrionale verlies weens wanvoeding by Meino skape. M. Sc. (Landbou) Tesis. Universiteit van Stellenbosch. FINDLAY, J.K. & CUMMING, J.A., 1976. lncrease in ovulation rate in sheep following administration of an LHRH analogue. Biol. Repr. 15, I15. HARESIGN, W., FOSTER, J.P., ...

‘”Wipe out lines of Division (Not Distinctions)’ : Bennie Keet, Neo-Calvinism and the Struggle against Apartheid’

NARCIS (Netherlands)

Harinck, George

2017-01-01

Race was not a dominant factor in neo-Calvinism. Rather, stress was laid on the universal character of Christianity, especially in the case of Herman Bavinck. While some of the South African PhD students at the Vrije Universiteit's defended apartheid with reference to neo-Calvinism, it was B.B. Keet

“As jou broer verkeerd opgetree het teen jou ...”: Enkele aspekte van ...

African Journals Online (AJOL)

p1243322

teen jou ...”: Enkele aspekte van kerklike dissipline uit die Kerkorde van die Nederduitsch Hervormde. Kerk van Afrika. B J (Barry) van Wyk. Hervormde Teologiese Kollege. Universiteit van Pretoria. Abstract. “If a brother sins against you ...”: Certain aspects of church discipline from the Church Ordinance of the. Netherdutch ...

Eenvoudige statistische berekeningen met behulp van Excel.

NARCIS (Netherlands)

A.A.J. van Peet; H.A. Everaert

2007-01-01

In de loop der tijd hebben wij op zowel universiteits- als hogeschoolniveau studenten en collega’s zien worstelen en soms ook verdrinken in het computerprograma SPSS. Daar zijn vele oorzaken voor aan te wijzen. Dat gaan we hier niet doen. Wel willen we hier wijzen op een wijdverbreid misverstand. In

Case-mix classificatie als basis voor bekostiging van wijkverpleging : Een verkennend onderzoek in opdracht van MeanderGroep Zuid-Limburg

NARCIS (Netherlands)

Elissen, Arianne; Metzelthin, Silke; van den Bulck, Anne; Verbeek, Hilde; Ruwaard, Dirk

2017-01-01

n opdracht van MeanderGroep Zuid‐Limburg is tussen mei 2016 en april 2017 door de Universiteit Maastricht een verkennend onderzoek uitgevoerd naar de relatie tussen cliëntkenmerken en het gebruik en de kosten van wijkverpleging. Doel is om een bijdrage te leveren aan de ontwikkeling van een nieuwe

Exploration of X-ray and charged-particle spectroscopy with CCDs and PSDs

NARCIS (Netherlands)

Simons, D.P.L.; Mutsaers, P.H.A.; IJzendoorn, van L.J.; Voigt, de M.J.A.

1998-01-01

Two alternative detector types have been studied for use in the Eindhoven Scanning Ion Microprobe set-up. First, the applicability of a Charge Coupled Device (CCD) system for X-ray spectroscopy has been explored. Second, some properties of the SiTek type 1L30 Position Sensitive Detector (PSD) for

InMotion : hybrid race car, beating F1 at LeMans

NARCIS (Netherlands)

Jacob, J.; Colin Navarrete, J.A.; Montemayor, H.; Sepac, D.; Trinh, H.D.; Voorderhake, S.F.; Zidkova, P.; Paulides, J.J.H.; Borisavljevic, A.; Lomonova, E.

2013-01-01

This paper presents the design of a hybrid electric powertrain for the InMotion IM01 race car. InMotion is a multidisciplinary project group of experienced master students, PhD students, and professors from Eindhoven University of Technology (TU/e). The authors of this paper were involved in the

Design and implementation of adaptive cruise control system for the TU/e solar powered electric car

NARCIS (Netherlands)

Papaliouras, I.

2016-01-01

The technical report presents the design and implementation of Adaptive Cruise Control. (ACC) system for the “Stella Lux” solar powered electric car, which was built by Solar Team Eindhoven and won the World Solar Challenge in Australia in 2015. Initially, an over-view of the context of the project

Algorithms and Models for the Web Graph

NARCIS (Netherlands)

Gleich, David F.; Komjathy, Julia; Litvak, Nelli

2015-01-01

This volume contains the papers presented at WAW2015, the 12th Workshop on Algorithms and Models for the Web-Graph held during December 10–11, 2015, in Eindhoven. There were 24 submissions. Each submission was reviewed by at least one, and on average two, Program Committee members. The committee

Mechanical modeling of skin

NARCIS (Netherlands)

Oomens, C.W.J.; Peters, G.W.M.; Kassab, G.S.; Sacks, M.S.

2016-01-01

The chapter describes the work that was performed in the soft tissue biomechanics laboratory at Eindhoven University of Technology on the biomechanics of skin. A rationale is given for the changes from standard testing methods to inverse methods, from in vitro to in vivo and back to in vitro testing

Design Systems Group: knowledge models for design and engineering (2005-2010)

NARCIS (Netherlands)

Vries, de B.; Beetz, J.; Achten, H.H.; Dijkstra, J.; Jessurun, A.J.; Achten, H.H.; Vries, de B.; Stappers, P.J.

2010-01-01

The Design Systems chair of the Eindhoven University of Technology has two main lines of research, namely: (1) Product and Process modeling and (2) Simulation of Human Behavior in the Built Environment. In the period 2005 – 2010 three PhD’s defended their thesis and 11 students received their

A study on the implementation of in-wheel motors in a VW Lupo

NARCIS (Netherlands)

George, A.D.; Nijmeijer, H.; Besselink, I.J.M.

2012-01-01

This report presents the results of the study on the implementation of an In-Wheel Motor (IWM) propulsion system and the design of a rear suspension for such a system for a Volkswagen Lupo. Previous research has been conducted at the Eindhoven University of Technology on the impact of in-wheel

Sustainable space heating system using phase change materials

NARCIS (Netherlands)

Ercisli, H.

2016-01-01

This study is a product of a collaboration between the Eindhoven University of Technology (TU/e) and Royal Imtech N.V. within the structure of a Professional Doctorate in Engineering (PDEng) program called Smart Energy Buildings and Cities (SEB&C). SEB&C program targets to bridge the gap between the

Impact of cancer diagnosis and treatment on glycaemic control among individuals with colorectal cancer using glucose lowering drugs

NARCIS (Netherlands)

Zanders, M.M.J.; van Herk-Sukel, M.P.P.; Herings, R.M.C.; van de Poll-Franse, L.V.; Haak, H.

2016-01-01

Aims This study aims to evaluate the impact of cancer and its treatment on HbA1c values among individuals with colorectal cancer (CRC) using glucose-lowering drugs (GLDs). Methods Patients with primary CRC (1998–2011) were selected from the Eindhoven Cancer Registry and linked to the PHARMO Database

Over Aldo Rossi : welstand en architectuur-kritiek, een "insidestory"

NARCIS (Netherlands)

Bakel, van A.P.M.

1993-01-01

Ir. Anton van Bakel, T.U. Eindhoven, verricht een onderzoek naar st~Jlen van ontwerpen. De uitlomst Ieidt hela.as niet tnt bet definit~eveantwoord op bet probleem van de antwerpstijlen. Maar als mede-proefkonijn was 1k benleuwd naar de eerste contouren van een uitkomst Hij constateerde 6 stijlen van

Getting real in the classroom

NARCIS (Netherlands)

Genuchten, van M.J.I.M.; Vogel, D.R.

2007-01-01

Exposing students to real-world projects will encourage them to share, learn, and improve.The BOHKNet project began in 1998 with the universities of Eindhoven and Hong Kong. Each BOHKNet team typically consists of 8 to 10 students in two to four locations. The team is assigned a software-related

Koude douche tijdens de marathon : Een eenvoudige interventie voor een betere prestatie?

NARCIS (Netherlands)

Levels, K.; Tiemessen, I.

2010-01-01

Tijdens de marathon ven Eindhoven op 11 oktober 2009 er door TNO onderzoek gedaan naar een mogelijk positief effect van het koelen vaon hardlopers op de loopsnelheid. Het is namelijk bekend dat de efficiëntie van een hardloper afneemt als hij het warm krijgt. Kunnen koude douches dit voorkomen?

Die Fakulteit Teologie (Afd A) aan die Universiteit van Pretoria; Vrae ...

African Journals Online (AJOL)

definition is called for and some relevant issues are indicated; an honest evaluation in respect of the political and social context which is reflected in positions adopted, a pastoral compassion which takes note of human misery, cognisance of the

Die verhouding tussen vertroue en diversiteitsklimaat by 'n Suid-Afrikaanse universiteit

OpenAIRE

McCallaghan, Sean; Heyns, Marita

2016-01-01

Hierdie studie stel ondersoek in na die verwantskap tussen vertroue en die diversiteitsklimaat binne 'n Suid-Afrikaanse tersiêre inrigting. 'n Kwantitatiewe benadering met behulp van 'n nie-waarskynlikheidsgerieflikheidsteekproef (N=350) is gevolg. Die vraelys wat in die studie gebruik is, maak gebruik van 'n kombinasie van drie vooraf-gevalideerde instrumente. Die resultate dui aan dat die werknemers saamstem dat die instelling bereid is tot diversiteitsbestuur en die uitskakeling van diskri...

Interview met Leon Deben: van tegenstellingen leer je het meeste

NARCIS (Netherlands)

van Diepen, A.; Huisman, C.

2008-01-01

Wat in de jaren zeventig begonnen is als Sociologie van bouwen en wonen is uitgegroeid tot Stadssociologie. Leon Deben heeft het medeopgebouwd. Hij nam onlangs afscheid van de universiteit met een rede over de openbare ruimte. "Het centrale bestuur van de stad is druk met de waan van de dag en dan

TEENOOR DROEVOEDING EN PROTEiENPEIL OP DIE ...

African Journals Online (AJOL)

brith to 136 kg with two planes of nutrition from 53 to 136 kilograms. J. Anim. Sci. 37,683. SIEBRITS, F.K., 1979. Die kwantifisering van effekte van oat teenoor droe voeding op die spekvark. M.Sc. (Agric) verhandeling. Universiteit van Pretoria. THORBEK, GRETE, 1975. Studies on energy metabolism in growing pigs.

Passie en beschouwing. De christelijke invloed op het westerse mensbeeld

NARCIS (Netherlands)

Vandermeersch, P.M.G.P.

1988-01-01

This book reflects the introductory courses in ethics I delivered during the years 1977-87 for the first year students of the Faculty of Theology of the Katholieke Universiteit Leuven. At that time, I was unaware of the fact that P. Gay was pursuing a similar project. Indeed, his book The Education

Phosphorus and the grazing ruminant. 1. The effect of ...

African Journals Online (AJOL)

M.Sc.-tesis,. Universiteit Stellenbosch. DUDZINSKI, M.L. & ARNOLD, G.W., 1973. Comparison of diets of sheep and cattle grazing together on sown pastures on the southern tablelands of New South Wales by principal components analysis. Aust. J. Agric. Res. 24, 899. DU TOlT, P.J., MALAN, AI. & ROSSOUW, S.D., 1930.

Psalm 98: Sing 'n nuwe lied tot lof van die Koning, Jahwe

African Journals Online (AJOL)

Psalm 98: Sing 'n nuwe lied tot lof van die Koning, Jahwe. W S Prinsloo. Universiteit van Pretoria. Abstract. Sing a new song in praise of the king, Yahweh. This article surveys the problems of interpreting Psalm. 98. The chief problems are those concerned with determining the Gattung, the redactional history, strophic ...

Indirect Taxes and Public Debt in the 'World of Islam' before 1800

NARCIS (Netherlands)

Fritschy, W.; S. Cavaciocchi,

2008-01-01

Indirect taxes and public debt in the ‘world of Islam’ before 1800. A comparison of Western and Islamic public finance. Wantje Fritschy – Vrije Universiteit Amsterdam – June 2007 The ‘world of islam’ and ‘the West’ before 1800 seem to have displayed different ‘fiscal values’: not only was it

Un)familiar and (un)comfortable – the Deep History of Europe

NARCIS (Netherlands)

Fontijn, D.R.

2016-01-01

Oratie uitgesproken door Prof.dr. D.R. Fontijn bij de aanvaarding van het ambt van hoogleraar op het gebied van Archaeology of Early Europe aan de Universiteit Leiden op vrijdag 18 maart 2016 The answer to the question why Europe has become so important in world history, is often looked for in its

Global circulation and territorial development : South-East Brabant from a relational perspective

NARCIS (Netherlands)

Boekema, F.W.M.; Lagendijk, A.

2008-01-01

Since the early 1990s, the south-eastern part of North-Brabant (also known as the Greater Eindhoven region) in the Netherlands has enjoyed a major turn in its economic position and outlook. From a more or less traditional industrial region in decline, it has become a “cradle of innovation” with a

A case study : to design a XL supermarket in the Netherlands and its consequences

NARCIS (Netherlands)

Veeger, T.T.; Santos, Eliana Sousa; Baptista, Luís Santiago; Matos, Maria João Pereira de; Pedrosa, Patrícia Santos; Figueiredo, Paulo

2013-01-01

On the outskirts of the centre of Eindhoven (a medium-sized town in the south of the Netherlands), an existing supermarket located along the ring road, which forms part of a chain named "Albert Heijn," was doubled in size in 2002, making it the flagship of a new "extra large" formula, called "AH

Special Issue on advanced and emerging light sources

NARCIS (Netherlands)

Haverlag, M.; Kroesen, G.M.W.; Ferguson, I.

2011-01-01

EDITORIAL The papers in this special issue of Journal of Physics D: Applied Physics (JPhysD) originate from the 12th International Symposium on the Science and Technology of Light Sources and the 3rd International Conference on White LEDs and Solid State Lighting, held 11–16 July 2010 at Eindhoven

A tuning procedure for a racetrack microtron

NARCIS (Netherlands)

Theuws, W.H.C.; de Wit, F.F.; Weijers, S.R.; Weiss, M.; Botman, J.I.M.; Hammen, A.F.J.

1999-01-01

The electron-optical system of the Eindhoven RTM has been designed and constructed with non-stringent alignment and machining tolerances in the order of 0.1-1 mm and 0.1-1 mrad. The alignment and machining errors that are present can and must be counteracted with slightly different settings of the

Technisch lego met een Duplo-interface

NARCIS (Netherlands)

Pimentel, A.; Schipper, D.

2008-01-01

Daedalus is een ontwerpflow op systeemniveau waarmee techneuten snel kunnen experimenteren met verschillende multiprocessorarchitecturen tijdens de vroege stadia van het ontwerptraject. Het is het resultaat van tien jaar onderzoek en ontwikkeling binnen de Progress-projecten Artemis en Artemisia.

Die organisatoriese werking van Suid-Afrikaanse universiteite : 'n teoretiese en empiriese ondersoek na doelwitformulering, organisasiestruktuur en interne koördinasie by sekere Suid-Afrikaanse universiteite / Simon Geertsema

OpenAIRE

Geertsema, Simon

1981-01-01

The Aim of the Study - The study aims at describing the organizational functioning of certain South African Universities, mainly in terms of a) The processes of goal formulation, b) The structure of the universities, as well as the relationships between the main structural components, c) The nature of the communication and control processes in the Universities. By doing this the study could be of use in promoting a better understanding of the university as an organizat...

Van die Gasredakteur

African Journals Online (AJOL)

cherish and teach.'1. Die Fakulteit Geneeskunde van die Universiteit van die Oranje-Vrystaat het pragtig gegroei ge- durende die eerste 21 jaar van sy bestaan. Die entoesiasme, doelgerigtheid, harde werk en inisia- tiewe van 'n groot aantal persone was hiervoor verantwoordelik. 'If we see a bit more clearly than they, it is ...

Effect of formalin preservation on the fermentation characteristics ...

African Journals Online (AJOL)

beesvleisproduksie met lea mays as voedingsbron. Ph.D.- tesis, Universiteit van die Oranje Vrystaat. VAN SOEST, P.J., 1963. Use of detergents in the analysis of fibrous feeds. n.A rapid method for the determination of fibre and lignin. J. Assoc. Off. anal. Chem. 46, 829. WALOO, D.R., 1975. Silage and supplemental nitrogen.

Waarom wij studenten niet vertellen dat de Griekse cultuur uit ‘Zwart Afrika’ komt

NARCIS (Netherlands)

Boter, G.J.; Flinterman, J.J.

2016-01-01

The present contribution is an offshoot of a public debate on Afrocentric criticisms of the teaching of Ancient History, held at the Vrije Universiteit Amsterdam in June 2015 (for a video recording of this event see https://www.youtube.com/watch?v=WMu5lncT8OU). We argue that the central tenets of

DIE NAAM “NEDERDUITSE GEREFORMEERDE KERK”

African Journals Online (AJOL)

P.J. Strauss. DIE NAAM “NEDERDUITSE. GEREFORMEERDE KERK”. ABSTRACT. An investigation into the name of the Dutch Reformed Church (DRC) reveals that it is a reformed church in the ... P.J. Strauss, Fakulteit Teologie, Universiteit van die Vrystaat, Suid‑Afrika. ..... Dit is so omdat die staat en sy howe die reg in die ...

"New Education" for the Congo? The Indigenist Approach, New Education and Prescriptive Pedagogy

Science.gov (United States)

Depaepe, Marc; Simon, Frank; Vinck, Honoré

2015-01-01

This article responds to a question put forward approximately a decade ago by the history of education research group at the Katholieke Universiteit Leuven: Did the child-centred ideas of New Education, as promoted by Ovide Decroly, influence the education policy in the former Belgian colony of Congo? Naturally, ideas were circulating that could…

The benefits of a trial period at home using loan-aids

NARCIS (Netherlands)

Jorritsma, F.F.; Neve, J.J.; Kooijman, A.C.; Looijestijn, P.L.; Welling, J.A.; Wildt, van der G.J.

1994-01-01

As a part of the working model the Visual Advice Centre Eindhoven (V AC-E) loans, as far as possible, low vision aids to patients for a trial period of two to three weeks before a definite advice is given. The advantages, the organisation, the experience after two and a half years, and the financial

Ball handling system for tech united soccer robots

NARCIS (Netherlands)

Gerrits, K.P.; Molengraft, van de M.J.G.; Hoogendijk, R.; Steinbuch, M.

2012-01-01

This pre-master end project is done for team Tech United of Eindhoven University of Technology. The Tech United team is a group of students and employees who design, build and program soccer robots to compete in the RoboCup Middle Size League. RoboCup is a worldwide competition in which two teams of

Die woordeboek vir meganiese ingenieurs: Vorderingsverslag

Directory of Open Access Journals (Sweden)

Editorial Office

1990-07-01

Full Text Available Die komitee van die Nasionale Vakterminologiediens (NVD wat ’n woordeboek vir meganiese ingenieurswese saamstel en in Januarie 1986 met sy werksaamhede begin het, maak goeie vordering. Die dag-tot-dag-werk word deur 'n redaksiekomitee behartig wat twee keer maandeliks vergader en uit verteenwoordigers van universiteite, SAVD, YSKOR, SABS en ander instansies bestaan.

Sentrum vir Tekstegnologie. Afrikaanse Speltoetser 2.1 en Woordafbreker vir Microsoft Office®

Directory of Open Access Journals (Sweden)

Gerda De Wet

2011-10-01

Full Text Available Afrikaanse Speltoetser 2.1 en Woordafbreker vir Afrikaans is tans die nuutste in sy soort op die mark en kom van die Potchefstroomkampus van die Noordwes-Universiteit. Dit is 'n uitbreiding en verbetering op die vorige weergawe 2.0 en doen die beloftes wat op die omslag van die CD gemaak word, meestal ge-stand.

The student health services at the University of Pretoria from 2000 to 2005

Directory of Open Access Journals (Sweden)

D H van Papendorp

2007-11-01

Full Text Available The University of Pretoria’s Student Health Services provides free, voluntary, family-medicine-orientated health services with an emphasis on offering preventative medicine and health education to enrolled students. ABSTRAK Die Universiteit van Pretoria se Gesondheidsdienste voorsien gratis, vrywillige gesins-medisyne-georiënteerde gesondheidsdienste met die klem op voorkomende medisyne en gesondheidsopvoeding aan ingeskrewe studente.

Per preparare la ripresa: Progetto europeo GI-N2K, “Geographic Information – Need to Know”

Directory of Open Access Journals (Sweden)

Mauro Salvemini

2014-02-01

Full Text Available The GI-N2K project, coordinated by the Katholieke Universiteit Leuven, which began in October 2013, and formed by an international consortium of 31 partners (25  countries is funded by the Erasmus Lifelong Learning Programme, aims to reformulate  the Body of Knowledge in the field of Geographic Information Science and  Technology.

De Amsterdam a Figueroles : Experiencias UNIGIS

NARCIS (Netherlands)

Koomen, E.

2006-01-01

Eric Koomen es un investigador en SlG del Departamento de Economía Espacial de Ia Vrije Universiteit de Amsterdam. Su principal ámbito de investigacíon es el modelado del cambio del uso del suelo y su tesis doctoral se centra en Ia applicacíon de indicadores de modelos de cambios de usos del suelo.

Performance of the TU/e 2.6 Cell Rf-photogun in the 'Pancake' Regime

NARCIS (Netherlands)

Geer, van der S.B.; Loos, de M.J.; Luiten, O.J.; Brussaard, G.J.H.; Wiel, van der M.J.; Pöplau, G.

2004-01-01

The 2.6 cell rf-photogun currently in operation at Eindhoven University of Technology has been designed as a booster for a 2 MeV semi-DC accelerator with a field of 1 GV/m. In this paper we present GPT simulation results of the TU/e gun, operated without its pre-accelerator, in the low-charge

Virtual reality in the design studio : the Eindhoven perspective

NARCIS (Netherlands)

Achten, H.H.; Roelen, W.A.H.; Boekholt, J.T.; Turksma, A.A.E.; Jessurun, A.J.; Brown, A.; Knight, M.; Berridge, P.

1999-01-01

Since 1991 Virtual Reality has been used in student projects in the Building Information Technology group. It started as an experimental tool to assess the impact of VR technology in design, using the environment of the associated Calibre Institute. The technology was further developed in Calibre to

Experience with the operation of a solar central heating system in Friedrichshafen/Wiggenhausen-Sued; Betriebserfahrungen mit der solaren Nahwaermeversorgung in Friedrichshafen/Wiggenhausen-Sued

Energy Technology Data Exchange (ETDEWEB)

Stanzel, B.; Gawantka, F. [Technische Werke Friedrichshafen GmbH, Friedrichshafen (Germany)

1998-12-31

The ideas, concepts and pilot plants for solar central heating systems developed by the Institute for Thermodynamics and Thermal Engineering of Stuttgart University were implemented by the Steinbeis-Transfer Centre for Energy, Building and Solar Engineering. In order to improve the economic efficiency of solar central heating with long-term storage a pilot plant with a heat storage tank of 12,000 cubic metres was built in Wiggenhausen-Sued. The `Technische Werke Friedrichshafen` (TWF) is in charge of the project `Solar City Wiggenhausen-Sued`. This company built the plant and also operates and maintains it. (orig.) [Deutsch] Die Ideen, Konzepte und erste Pilotanlagen zur solaren Nahwaerme werden seit Mitte der achtziger Jahre vom Institut fuer Thermodynamik und Waermetechnik (ITW) der Universitaet Stuttgart entwickelt und vom Steinbeis-Transferzentrum Energie-, Gebaeude- und Solartechnik umgesetzt. Um die solare Nahwaermeversorgung mit Langzeit-Waermespeicher der Wirtschaftlichkeit etwas naeher zu bringen, wurde eine Pilotanlage mit einem 12.000 m{sup 3} grossen Waermespeicher in Wiggenhausen-Sued gebaut. Mit diesem Pilotprojekt soll neben der technischen Durchfuehrbarkeit die Kostendegression durch steigende Anlagengroesse nachgewiesen werden. Als Energiedienstleistungsunternehmen hat die Technische Werke Friedrichshafen GmbH (TWF) die technische und kaufmaennische Durchfuehrung des Projektes `Solarstadt Wiggenhausen-Sued` uebernommen. Sie errichtete, betreibt und wartet die Anlage. (orig.)

: ~ I~'i

African Journals Online (AJOL)

Ph.D. Tesis, Universiteit van Stellenbosch. DOBSON, H., COOPER, M.J. & FURR, B.J.A., 1975. Synchronization of oestrus with 1.c.1. 79, 939 an analogue of PGF2a and associated changes in plasma progesterone, oestradiol 17-13and LH in heifers. J. Reprod. Fert. 42, 141. ELLICOTT, A.R., SCOGGINS, J.R., HILL, J.R. (JR.) ...

How environment friendly is sustainable building? The quantification of the environmental burden of houses; Hoe milieuvriendelijk is duurzaam bouwen? De milieubelasting van woningen gekwantificeerd

Energy Technology Data Exchange (ETDEWEB)

Klunder, G.

2002-07-01

The aim of the study on the title subject is to identify developments, strategies, chances and bottlenecks with respect to sustainable construction of houses as an integrated part of an ecological city. The main subject of the study is to determine and assess options to reduce the environmental burden of dwellings, focusing on building materials, energy consumption and use of water. [Dutch] Het DIOC-DGO (Delfts Interfacultair Onderzoekscentrum Duurzaam Gebouwde omgeving) van de Technische Universiteit Delft verricht onderzoek naar een duurzame en leefbare omgeving. De doelstelling van het onderzoek is: het identificeren van ontwikkelingen, strategieen, kansen en knelpunten met betrekking tot duurzame nieuwbouw van woningen als integraal onderdeel van een ecologische stad. De probleemstelling luidt: hoe kan de milieubelasting van woningen substantieel worden verminderd? De stand van zaken anno 2002 is dat 30 procent van de woningen duurzaam wordt gebouwd. In de Voorbeeldprojecten duurzaam en energiezuinig bouwen worden bijna standaard rogips of natuurgips, beton met puingranulaat, naadafdichting met PE of EPDM en oplosmiddelarme verf toegepast. Uit de milieuanalyse blijkt dat de milieubelasting in de pas loopt met de grootte van de woning. De fundering, gevels en binnenwanden en vloeren zijn verantwoordelijk voor 80 tot 90 procent van de materiaalstroom. Verwacht wordt dat in de komende decennia de bestaande materialen verder worden geoptimaliseerd en ontwikkeld. Er worden vooruitstrevende ontwikkelingen voorzien in bouwtechnieken. Energiegebruik kan in drie stappen verminderd worden: het voorkomen van onnodig gebruik, het gebruik van eindeloze bronnen en het verstandige gebruik van eindige bronnen, dat wil zeggen schoon en met een hoog rendement. Enkele conclusies zijn: de milieubelasting van watergebruik speelt een ondergeschikte rol, innovaties in materialen en bouwtechnieken blijven sterk achter bij innovaties in installaties. Aanbevolen wordt: de overheid moet

AMISS - Active and passive MIcrowaves for Security and Subsurface imaging

Science.gov (United States)

Soldovieri, Francesco; Slob, Evert; Turk, Ahmet Serdar; Crocco, Lorenzo; Catapano, Ilaria; Di Matteo, Francesca

2013-04-01

The FP7-IRSES project AMISS - Active and passive MIcrowaves for Security and Subsurface imaging is based on a well-combined network among research institutions of EU, Associate and Third Countries (National Research Council of Italy - Italy, Technische Universiteit Delft - The Netherlands, Yildiz Technical University - Turkey, Bauman Moscow State Technical University - Russia, Usikov Institute for Radio-physics and Electronics and State Research Centre of Superconductive Radioelectronics "Iceberg" - Ukraine and University of Sao Paulo - Brazil) with the aims of achieving scientific advances in the framework of microwave and millimeter imaging systems and techniques for security and safety social issues. In particular, the involved partners are leaders in the scientific areas of passive and active imaging and are sharing their complementary knowledge to address two main research lines. The first one regards the design, characterization and performance evaluation of new passive and active microwave devices, sensors and measurement set-ups able to mitigate clutter and increase information content. The second line faces the requirements to make State-of-the-Art processing tools compliant with the instrumentations developed in the first line, suitable to work in electromagnetically complex scenarios and able to exploit the unexplored possibilities offered by new instrumentations. The main goals of the project are: 1) Development/improvement and characterization of new sensors and systems for active and passive microwave imaging; 2) Set up, analysis and validation of state of art/novel data processing approach for GPR in critical infrastructure and subsurface imaging; 3) Integration of state of art and novel imaging hardware and characterization approaches to tackle realistic situations in security, safety and subsurface prospecting applications; 4) Development and feasibility study of bio-radar technology (system and data processing) for vital signs detection and

Herkommer zum Hinschauen

OpenAIRE

Schilling, Jörg

2011-01-01

Tagung: Moderne Architektur exemplarisch. Hans Herkommer (1887-1956). Technische Universität Kaiserslautern, Lehrgebiet Geschichte und Theorie der Architektur. Prof. Dr. phil. Matthias Schirren. 28.-29. Oktober 2010

Die Departement Godsdiens- en Sendingwetenskap (Afd A, Universiteit van Pretoria, 1917-1978

Directory of Open Access Journals (Sweden)

P. J. van der Merwe

1992-01-01

Full Text Available The Department of Science of Religion and Missiology (Sec A, University of Pretoria, 1917-1978 The Transvaal University College began its Faculty of Theology in 1917 in co-operation with the Presbyterian Church and the Nederduitsch Hervormde Kerk. A Presbyterian minister, Prof E MacMillan, lectured from 1917 till 1934. This marked the end of Presbyterian participation. In the next period, 1935-1937, the Department suffered from a controversy between the Nederduitsch Hervormde Kerk and its new partner, the Nederduitsch Hervormde of Gereformeerde Kerk. The issue was solved when the Faculty divided into two sections, Section A for the Nederduitsch Hervormde Kerk and Section B for the Nederduitsch Hervormde of G ereformeerde Kerk. Prof H P Wolmarans was appointed to the chair of Science of Religion (Sec A in 1938 and served as head of the Department till 1959. He was succeeded by Prof F J van Zyl in 1960, who served till 1978.

MijnOU.nl (proef met een sociale netwerkdienst binnen de Open Universiteit)

NARCIS (Netherlands)

Eshuis, Jannes; Hermans, Henry

2010-01-01

Doel van het project Mijnou.nl Het ideaal van een volledig gepersonaliseerd startportaal, waarin studenten via een Single Sign On (SSO) toegang vinden tot al het leermateriaal waarop zij rechten hebben verworven, relevante informatie vinden over activiteiten op studiecentra, contacten kunnen

The Dossier Green Office. The most sustainable industrial building in the Netherlands; Het Dossier Groen Kantoor. Het duurzaamste bedrijfsgebouw van Nederland

Energy Technology Data Exchange (ETDEWEB)

Verdonk, A.

2011-03-25

About forty houses competed for the title of Most sustainable Industrial building Netherlands 2011, an initiative of a Dutch radio program ('Vroege Vogels') and the magazine De Ingenieur (The Engineer). The jury selected the renovated over one hundred years old water tower with newly built pavilion in Bussum as the winner. Besides the winner attention was also paid to innovative concepts applied in other buildings, including the office of Rijkswaterstaat Terneuzen, the Vomar Voordeelmarkt in Heerhugowaard, The Christiaan Huygens College, Eindhoven, the new Administration Centre of the Rabobank in Utrecht, and the office of the district water board Rivierenland Tiel. [Dutch] Zo'n veertig panden streden om de titel Duurzaamste Bedrijfsgebouw van Nederland 2011, een initiatief van het VARA-programma Vroege Vogels en De Ingenieur. De jury wees de gerenoveerde, ruim honderd jaar oude watertoren met nieuw aangebouwd paviljoen in Bussum aan als winnaar. Naast de winnaar wordt ook aandacht besteed aan de toegepaste innovatieve concepten in enkele andere gebouwen. Onder meer het kantoor van de Rijkswaterstaat in Terneuzen, de Vomar Voordeelmarkt in Heerhugowaard, Het Christiaan Huygens College in Eindhoven, het nieuwe Bestuurscentrum van de Rabobank in Utrecht, en het kantoor van Waterschap Rivierenland in Tiel.

Goal Driven Software Project Risk Management: Design eines COSO II-ERM-basierten Domain Models

OpenAIRE

Schiessl, Christoph

2016-01-01

von Christoph Schiessl Arbeit an der Bibliothek noch nicht eingelangt - Daten nicht geprueft Abweichender Titel nach Übersetzung der Verfasserin/des Verfassers Technische Universität Wien, Univ., Diplomarbeit, 2016

Wolframcarbid/Silber-Kontaktwerkstoffe durch Gasdruckinfiltration

OpenAIRE

Stadler, Thomas

2017-01-01

von Thomas Stadler Arbeit an der Bibliothek noch nicht eingelangt - Daten nicht geprueft Abweichender Titel nach Übersetzung der Verfasserin/des Verfassers Technische Universität Wien, Univ., Diplomarbeit, 2017

How Blockchain technology and other innovations change(d) the future of banking

OpenAIRE

Semenchenko, Mariia

2016-01-01

von Mariia Semenchenko Arbeit an der Bibliothek noch nicht eingelangt - Daten nicht geprueft Abweichender Titel nach Übersetzung der Verfasserin/des Verfassers Technische Universität Wien, Univ., Masterarbeit, 2016

The Role of Trust in Participatory Processes

OpenAIRE

Dobrova, Anna

2017-01-01

von Anna Dobrova Arbeit an der Bibliothek noch nicht eingelangt - Daten nicht geprueft Abweichender Titel nach Übersetzung der Verfasserin/des Verfassers Technische Universität Wien, Univ., Diplomarbeit, 2017

Ab-initio Rechnungen für Th dotiertes Kalziumfluorid (CaF2)

OpenAIRE

Dessovic, Philipp

2016-01-01

von Philipp Dessovic Arbeit an der Bibliothek noch nicht eingelangt - Daten nicht geprueft Abweichender Titel nach Übersetzung der Verfasserin/des Verfassers Technische Universität Wien, Univ., Diplomarbeit, 2016

Ontology matchmaking of product ramp-up knowledge in manufacturing industries - How to transfer a cake-baking recipe between bakeries

OpenAIRE

Willmann, Roland

2016-01-01

von Roland Willmann Arbeit an der Bibliothek noch nicht eingelangt - Daten nicht geprueft Abweichender Titel nach Übersetzung der Verfasserin/des Verfassers Technische Universität Wien, Univ., Dissertation, 2016

MAGMA: A Liquid Software Approach to Fault Tolerance, Computer Network Security, and Survivable Networking

Science.gov (United States)

2001-12-01

and Lieutenant Namik Kaplan , Turkish Navy. Maj Tiefert’s thesis, “Modeling Control Channel Dynamics of SAAM using NS Network Simulation”, helped lay...DEC99] Deconinck , Dr. ir. Geert, Fault Tolerant Systems, ESAT / Division ACCA , Katholieke Universiteit Leuven, October 1999. [FRE00] Freed...Systems”, Addison-Wesley, 1989. [KAP99] Kaplan , Namik, “Prototyping of an Active and Lightweight Router,” March 1999 [KAT99] Kati, Effraim

Physikalisch-Technische Bundesanstalt (PTB). Annual report 2015

International Nuclear Information System (INIS)

2016-03-01

''PTB's central mission and the demands it places on itself are to make available an innovative metrological infrastructure at the highest international level in Germany to promote Germany's export-oriented high-tech economy, to meet the demands of a complex society and to support science that is operating at the cutting edge worldwide.'' This is what is stated in the ''Agreement on Objectives'' for the years from 2015 to 2019 between the Federal Ministry for Economic Affairs and Energy (Bundesministerium fuer Wirtschaft und Energie - BMWi) and PTB, which was signed on 12 January 2016 by State Secretary Machnig and me. Both this agreement and the newly developed ''Work and research program 2015 to 2017'' thus clearly define PTB's medium-term guidelines focusing on ''Innovation and industry'', ''Energy and the environment'', ''Humans and health'', ''Legal and international metrology'' as well as ''The new System of Units''.

Physikalisch-Technische Bundesanstalt (PTB). Annual report 1994

International Nuclear Information System (INIS)

1995-03-01

The annual report presents general information on the institution's activities and the various departments, and reports on scientific work in the field of metrology and safety engineering. Brief scientific accounts refer to work in the domains of mechanics and acoustics, electricity, heat, optics, industrial metrology, atomic physics, technical and scientific services, collection and disposal of radioactive waste. (orig.) [de

Physikalisch-Technische Bundesanstalt (PTB). Annual report 2006

International Nuclear Information System (INIS)

2007-03-01

The following topics are dealt with: Mechanics and acoustics, electricity, chemical physics and explosion protection, optics, manufacturing measureing techniques, ionizing radiation, temperature and synchrotron radiation, medical physics and metrological information techniques, the German calibration service, quality management. (HSI)

BAUHAUS MUSEUM DESSAU

OpenAIRE

Malík, Andrej

2016-01-01

von Andrej Malík Arbeit an der Bibliothek noch nicht eingelangt - Daten nicht geprueft Abweichender Titel nach Übersetzung der Verfasserin/des Verfassers Technische Universität Wien, Univ., Diplomarbeit, 2016

Environmental risk limits for imidacloprid

NARCIS (Netherlands)

Posthuma-Doodeman CJAM; SEC

2008-01-01

Dit rapport geeft milieurisicogrenzen voor het insecticide imidacloprid in water. Milieurisicogrenzen zijn de technisch-wetenschappelijke advieswaarden voor de uiteindelijke milieukwaliteitsnormen in Nederland. De milieurisicogrenzen zijn afgeleid volgens de methodiek die is voorgeschreven

Environmental risk limits for lambda-cyhalothrin

NARCIS (Netherlands)

Leeuwen LC van; Vos JH; Mensink BJWG; SEC

2008-01-01

Dit rapport geeft milieurisicogrenzen voor het insecticide lambda-cyhalothrin in water en sediment. Milieurisicogrenzen zijn de technisch-wetenschappelijke advieswaarden voor de uiteindelijke milieukwaliteitsnormen in Nederland. De milieurisicogrenzen zijn afgeleid volgens de methodiek die

Computer Education in the Vocational Teacher Training Centre at Eindhoven.

Science.gov (United States)

Houben, J. W. M. A.; Verbunt, J. A.

1985-01-01

Teachers from The Netherland's 26 higher technical colleges in need of a teaching qualification (called an "informatica") were able to obtain it by in-service training, organized and offered by universities. Types of courses offered and policy describing information technology activities to be developed in the country by 1989 are…

Perspectieven in de robotica : Overzicht van samenwerkende disciplines

NARCIS (Netherlands)

Horne, C.; De Wolf, S.; Abd El Ghany, M.; Dumay, A.

1986-01-01

Symposium gehouden op 20 juni 1986 in het gebouw van de afdeling der Elektrotechniek, Technische Hogeschool Delft, georganiseerd door de IEEE Student Branch Delft, in samenwerking met IEEE Benelux Section NERG en KIvI

Outbreak of Bacillus cereus Infections in a Neonatal Intensive Care Unit Traced to Balloons Used in Manual Ventilation

OpenAIRE

Van Der Zwet, Wil C.; Parlevliet, Gerard A.; Savelkoul, Paul H.; Stoof, Jeroen; Kaiser, Annie M.; Van Furth, A. Marceline; Vandenbroucke-Grauls, Christina M.

2000-01-01

In 1998, an outbreak of systemic infections caused by Bacillus cereus occurred in the Neonatal Intensive Care Unit of the University Hospital Vrije Universiteit, Amsterdam, The Netherlands. Three neonates developed sepsis with positive blood cultures. One neonate died, and the other two neonates recovered. An environmental survey, a prospective surveillance study of neonates, and a case control study were performed, in combination with molecular typing, in order to identify potential sources ...

Toezicht in de open samenleving : Maatschappelijke controle op multinationale ondernemingen

OpenAIRE

van Erp, J.G.

2016-01-01

Globalisering creëert nieuwe mogelijkheden voor het houden van toezicht op multinationale ondernemingen. Dat is de kern van de oratie die professor Judith van Erp uitsprak bij de aanvaarding van de leerstoel Publieke Instituties aan de Universiteit Utrecht. Globalisering heeft voor ondernemingen veel nieuwe mogelijkheden gecreëerd, maar ook nieuwe gelegenheden voor organisatiecriminaliteit. Daarom moet toezicht zich vernieuwen. In haar leerstoel wil Van Erp nieuwe toezichtinstituties onderzoe...

The Impact of Anti-Immigration Parties on Mainstream Parties' Immigration Positions in the Netherlands, Flanders and the UK 1987-2010: Divided electorates, left-right politics and the pull towards restrictionism

OpenAIRE

DAVIS, Amber

2012-01-01

Defence date: 20 April 2012; Examining Board: Professor Rainer Bauböck, EUI, for Professor Peter Mair (†), EUI (supervisor); Professor Virginie Guiraudon, National Center for Scientific Research, Paris; Professor Meindert Fennema, Universiteit van Amsterdam; Professor Dirk Jacobs, Université Libre de Bruxelles The rise of anti-immigration parties across Western Europe has put enormous pressure on mainstream parties to adapt their competitive strategies. This thesis tests the hypothesis tha...

Natsionalistlike meeleolude kaardistamine jätkub / Rael Artel

Index Scriptorium Estoniae

Artel, Rael, 1980-

2008-01-01

"Public Preparation Social Club. Natsionalismi sümptomid ja kriitika kaasaegses kunstis" 11. VII Pärnu Kunstnike Majas ja 12.-16. VII Pärnumaal. Korraldas ja modereeris Rael Artel, ettekannetega esinesid Kendra Ballingall (Winnipeg), Remco de Blaaij (Eindhoven), Övül Durmusoglu (Istanbul/Viin), Ronen Eidelman (Tel Aviv/Weimar), Claire Feeley (Dublin), Erden Kosova (Istanbul), Johannes Paul Raether (Berliin), Sara Stenczer (Budapest/Pariis) ja Tamara Zlobina (Kiiev)

Electron Energy Distribution and Transfer Phenomena in Non-Equilibrium Gases

Science.gov (United States)

2016-09-01

Zhang, W. Van Gaens, B. Van Gessel, S. Hofmann, E. Van Veldhuizen , A. Bogaerts and P. Bruggeman, "Spatially resolved ozone densities and gas...34 Plasma Phys. Control. Fusion, Vol. 57, No. 1 (2015) 014026. [4] B. Van Gessel, R. Brandenburg and P. Bruggeman, "Electron properties and air mixing...025031. [32] M. Van de Sande, Laser Scattering on Low Temperature Plasmas, Netherlands: Eindhoven, University of Technology, 2002. 40 DISTRIBUTION

Review of access, licenses and understandability of open datasets used in hydrology research

Science.gov (United States)

Falkenroth, Esa; Arheimer, Berit; Lagerbäck Adolphi, Emma

2015-04-01

The amount of open data available for hydrology research is continually growing. In the EU-funded project SWITCH-ON (Sharing Water-related Information to Tackle Changes in the Hydrosphere - for Operational Needs), we are addressing water concerns by exploring and exploiting the untapped potential of these new open data. This work is enabled by many ongoing efforts to facilitate the use of open data. For instance, a number of portals (such as the GEOSS Portal and the INSPIRE community geoportal) provide the means to search for such open data sets and open spatial data services. However, in general, the systematic use of available open data is still fairly uncommon in hydrology research. Factors that limits (re)usability of a data set include: (1) accessibility, (2) understandability and (3) licences. If you cannot access the data set, you cannot use if for research. If you cannot understand the data set you cannot use it for research. Finally, if you are not permitted to use the data, you cannot use it for research. Early on in the project, we sent out a questionnaire to our research partners (SMHI, Universita di Bologna, University of Bristol, Technische Universiteit Delft and Technische Universitaet Wien) to find out what data sets they were planning to use in their experiments. The result was a comprehensive list of useful open data sets. Later, this list of data sets was extended with additional information on data sets for planned commercial water-information products and services. With the list of 50 common data sets as a starting point, we reviewed issues related to access, understandability and licence conditions. Regarding access to data sets, a majority of data sets were available through direct internet download via some well-known transfer protocol such as ftp or http. However, several data sets were found to be inaccessible due to server downtime, incorrect links or problems with the host database management system. One possible explanation for this

Environmental risk limits for antimony

NARCIS (Netherlands)

van Leeuwen LC; Aldenberg T; SEC; mev

2012-01-01

Dit rapport geeft milieurisicogrenzen voor antimoon in (grond)water, sediment, en bodem. Milieurisicogrenzen zijn de technisch-wetenschappelijke advieswaarden voor de uiteindelijke milieukwaliteitsnormen in Nederland. De milieurisicogrenzen voor antimoon zijn gebaseerd op de uitkomsten van de EU

Environmental risk limits for acrolein

NARCIS (Netherlands)

Bodar CWM; SEC

2008-01-01

Dit rapport geeft milieurisicogrenzen voor acroleine in (grond)water, bodem en lucht. Milieurisicogrenzen zijn de technisch-wetenschappelijke advieswaarden voor de uiteindelijke milieukwaliteitsnormen in Nederland. De milieurisicogrenzen voor acroleine zijn gebaseerd op de uitkomsten van de EU

EDITORIAL: Selected papers from the 10th International Workshop on Micro and Nanotechnology for Power Generation and Energy Conversion Applications (PowerMEMS 2010) Selected papers from the 10th International Workshop on Micro and Nanotechnology for Power Generation and Energy Conversion Applications (PowerMEMS 2010)

Science.gov (United States)

Reynaerts, Dominiek; Vullers, Ruud

2011-10-01

This special section of Journal of Micromechanics and Microengineering features papers selected from the 10th International Workshop on Micro and Nanotechnology for Power Generation and Energy Conversion Applications (PowerMEMS 2010). The workshop was organized in Leuven, Belgium from 30 November to 3 December 2010 by Katholieke Universiteit Leuven and the imec/Holst Centre. This was a special PowerMEMS Workshop, for several reasons. First of all, we celebrated the 10th anniversary of the workshop: the first PowerMEMS meeting was organized in Sendai, Japan in 2000. None of the organizers or participants of this first meeting could have predicted the impact of the workshop over the next decade. The second reason was that, for the first time, the conference organization spanned two countries: Belgium and the Netherlands. Thanks to the advances in information technology, teams from Katholieke Universiteit Leuven (Belgium) and the imec/Holst Centre in Eindhoven (the Netherlands) have been able to work together seamlessly as one team. The objective of the PowerMEMS Workshop is to stimulate innovation in micro and nanotechnology for power generation and energy conversion applications. Its scope ranges from integrated microelectromechanical systems (MEMS) for power generation, dissipation, harvesting, and management, to novel nanostructures and materials for energy-related applications. True to the objective of the PowerMEMSWorkshop, the 2010 technical program covered a broad range of energy related research, ranging from the nanometer to the millimeter scale, discussed in 5 invited and 52 oral presentations, and 112 posters. This special section includes 14 papers covering vibration energy harvesters, thermal applications and micro power systems. Finally, we wish to express sincere appreciation to the members of the International Steering Committee, the Technical Program Committee and last but not least the Local Organizing Committee. This special issue was edited in

Nieuwe technieken om spuiwater te zuiveren zijn veelbelovend (interview met o.a. Erik van Os)

NARCIS (Netherlands)

Arkesteijn, M.; Os, van E.A.

2012-01-01

TNO en Wageningen UR Glastuinbouw hebben samen een proefproject gedaan met twee veelbelovende technieken om spuiwater te zuiveren: omgekeerde osmose en membraandestillatie. Deze test vond plaats bij Olij Rozen in De Kwakel. Technisch gezien voldoen beide technieken.

An international intercomparison of passive dosemeters, electronic dosemeters and dose rate meters used for environmental radiation measurements

DEFF Research Database (Denmark)

Bøtter-Jensen, L.; Thompson, I.M.G.

1995-01-01

during 1994. The intercomparison was organised by the Physikalisch Technische Bundesanstalt (PTB), Braunschweig, Germany, and by the Riso National Laboratory, Roskilde, Denmark. This paper describes the intercomparison experiments performed at the newly established Riso Natural Environmental Radiation...

Absorption of formaldehyde in water

NARCIS (Netherlands)

Winkelman, Jozef Gerhardus Maria

2003-01-01

Deze dissertatie beschrijft theoretisch en experimenteel werk aan de absorptie van formaldehyde in water. Met resultaten hiervan zijn chemisch-technische modellen ontwikkeld voor de beschrijving en optimalisatie van industriële formaldehydeabsorbeurs. Deze samenvatting geeft eerst algemene

Saksamaal Müncheni tehnikaülikoolis / Tuuliki Tõiste, Katri Mägi

Index Scriptorium Estoniae

Tõiste, Tuuliki

2014-01-01

Erasmuse programmi toel viibiti 28.11-02.12. 2011 koolituslähetusel Müncheni tehnikaülikooli (Technische Universität München, TUM) korraldatud rahvusvahelisel nädalal, kus raamatukogutöötajatele oli eraldi programm

Fear for external cephalic version and depression: predictors of successful external cephalic version for breech presentation at term?

Science.gov (United States)

Ciliacus, Emily; van der Zalm, Marieke; Truijens, Sophie E; Hasaart, Tom H; Pop, Victor J; Kuppens, Simone M

2014-03-12

Objective was to determine whether fear for external cephalic version (ECV) and depression are associated with the success rate of ECV in women with a breech presentation at term. Prospective study conducted in the Catharina Hospital Eindhoven between October 2007 and May 2012. Participants fulfilled The Edinburgh Depression Scale (EDS) questionnaire and expressed their degree of fear on a visual analogue scale from one to ten before ECV. Obstetric factors were evaluated as well. Primary outcome was the relation between psychological factors (fear for ECV and depression EDS scores) and ECV success rate. Secondary outcome was a possible relation between fear for ECV and increased abdominal muscle tension. The overall success rate was 55% and was significantly lower (p < 0.001) in nulliparous women (44.3%) compared with parous women (78.0%). Fear for ECV and depression EDS-scores were not related with ECV success rate. Parity, placental location, BMI and engagement of the fetal breech were obstetric factors associated with ECV outcome. There was no relation between fear for ECV and abdominal muscle tone. Fear for ECV and depression were not related with ECV success rate in this study. Engagement of the fetal breech was the most important factor associated with a successful ECV. The Eindhoven Breech Intervention Study, NCT00516555.

Prostate cancer treatment in Europe at the end of 1990s

International Nuclear Information System (INIS)

Gatta, Gemma; Zigon, Giulia; Buemi, Antoine

2009-01-01

Background. There is wide variation in prostate cancer incidence and survival across Europe. In many countries incidence is rising sharply in relation to the introduction of prostate-specific antigen assay, and there is concern that patients may not be treated appropriately. We therefore aimed to characterize treatment for prostate cancer across Europe. Methods. We performed a high resolution population-based study, collecting information on the treatment of 3 486 prostate cancer cases diagnosed in 1995-1999 in 11 cancer registries from six European countries. Results. Overall, about one in three patients received radical treatment (prostatectomy 23% or radiotherapy 14%); about 60% of younger patients ( 70% in Civilised, Haut-Rh in, Tarn and Eindhoven and <50% in Slovakia and Cracow. Overall 34% of patients with apparently low-risk disease received radical treatment, varying from 17% and 22% in Bas-Rhin and Granada, to 52% and 56% in Calvados and Eindhoven. Conclusions. Our data indicate wide variation in the treatment for prostate cancer even among patients with apparently similar disease, and further suggest a non-negligible proportion may be receiving inappropriate radical treatment for apparently low-risk disease. Current guidelines indicate active surveillance should become the main means of managing low-risk disease

From cybercrime to cyborg crime : An exploration of high-tech cybercrime, offenders and victims through the lens of Actor-Network Theory

NARCIS (Netherlands)

van der Wagen, Wytske

2018-01-01

Universiteiten die worden gehackt, computersystemen die worden gegijzeld of tot ‘zombies’ gemaakt, servers van Internetproviders die worden gebombardeerd, we worden bijna dagelijks wel geconfronteerd met cybercrime en haar gevolgen. Deze meer technische vormen van criminaliteit wijken op

Van vakgericht naar competentiegericht statistiekonderwijs. Een interventiestudie in een opleiding psychologie.

OpenAIRE

Van Buuren, Hans

2008-01-01

Abstract This thesis describes how statistics education has been redesigned and implemented in the curriculum of the school of psychology of the Open Universiteit Nederland. In stead of autonomous and separate traditional statistics service courses and courses in research methods, both kinds of courses have been integrated into a coherent whole, including psychological theory, to realize a better fit with the educational target goal: the autonomous study of science by carrying out (psychologi...

Comparative evaluation of power generation systems with integrated gasification of biomass; Vergleich von Systemen zur Stromerzeugung mit integrierter Biomassevergasung

Energy Technology Data Exchange (ETDEWEB)

Roesch, C [Forschungszentrum Karlsruhe (Germany); Kaltschmitt, M [Stuttgart Univ. (Germany)

1998-09-01

Gasification of biomass followed by power generation from the lean product gas can make a significant contribution to power generation without affecting the climate or environment. It is made even more interesting by the high efficiencies and promising pollution ratings that can be achieved. To make full use of this technology, some technical problems still require solving, and some non-technical obstacles need to be removed. (orig./SR) [Deutsch] Zusammenfassend kann festgehalten werden, dass die Biomassevergasung mit anschliessender Verstromung des Schwachgases einen nennenswerten Beitrag zu einer umwelt- und klimavertraeglicheren Energiebereitstellung in Europa leisten kann. Dies gilt insbesondere vor dem Hintergrund der erreichbaren hohen Stromwirkungsgrade und der vielversprechenden Umweltkenngroessen, durch die diese Technik gekennzeichnet ist. Um die Vorteile der Biomassevergasung realisieren zu koennen, muessen jedoch noch verschiedene technische Probleme geloest und nicht technische Hindernisse aus dem Weg geraeumt werden. (orig./SR)

FttH-investeringen glashelder beoordelen : kosten model maakt glasvezelaanleg inzichtelijk

NARCIS (Netherlands)

Phillipson, F.

2008-01-01

Operators en investeerders zijn bijzonder geinteresseerd in de kosten die bij de uitrol van glasvezelnetwerken, zoals Fiber-to-the-Home, komen kijken. Een kostenmodel voor de langetermijnkosten van dergelijke netwerken maakt het mogelijk om diverse technische oplossingen onder verschillende

Haalbaarheidsstudie naar de productie en afzet van Zeeuwse cider

NARCIS (Netherlands)

Schreuder, S.A.M.M.; Ravesloot, M.B.M.

2005-01-01

Verslag van een onderzoek om inzicht te krijgen in de technische en economische mogelijkheden van de productie van cider in Zeeland. In dat kader is een bureaustudie uitgevoerd naar de kenmerken van de ciderconsumptie en productie in diverse Europese landen.

Voermaatregelen sorteerden geen positief effect bij vleeseenden

NARCIS (Netherlands)

Buisonjé, de F.E.; Getkate, J.A.; Enting, H.

1997-01-01

In een Spelderholt-proef is gekeken naar mogelijkheden om via voermaatregelen het optreden van pootproblemen bij Peking-eenden te verminderen. Deze maatregelen betroffen de verschijningsvorm, beschikbaarheid en samenstelling van het voer. Tevens is het effect van deze aanpassingen op technische

Optimalisatie performance van vleeskuikens bij mobiel voer- en drinksysteem (scanFeeder) op praktijkbedrijf

NARCIS (Netherlands)

Harn, van J.; Veldkamp, T.

2007-01-01

Het gebruik van de Ridder ScanFeeder, een mobiel voer- en drinksysteem met strooiselbeluchting voor vleeskuikens, geeft een betere strooiselkwaliteit (ruller en droger strooisel) en minder voetzoolaandoeningen. De technische resultaten bij dit systeem blijven echter achter bij die van een

PAES: Positron annihilation induced Auger electron spectrometer

OpenAIRE

Hugenschmidt, Christoph

2015-01-01

Positron annihilation induced Auger electron spectroscopy (PAES) is a newly developed application for surface studies with high elemental selectivity and exceptional surface sensitivity. The instrument is operated by the Technische Universität München and is located at NEPOMUC.

Progress report on reversal and substitute element technique for thread calibration on CMMs

DEFF Research Database (Denmark)

Carmignato, Simone; Larsen, Erik; Sobiecki, Rene

. For this project, the Centre for Geometrical Metrology (CGM) at the Technical University of Denmark (DTU) takes care of thread measurements, in collaboration with Dipartimento di Innovazione Meccanica e Gestionale (DIMEG) - University of Padova - Italy, Physikalisch-Technische Bundesanstalt Braunschweig (PTB...

Feasibility of the reversal and substitute element technique for thread calibration

DEFF Research Database (Denmark)

Larsen, Erik; Carmignato, Simone; De Chiffre, Leonardo

. For this project, the Centre for Geometrical Metrology (CGM) at the Technical University of Denmark (DTU) takes care of thread measurements, in collaboration with Dipartimento di Innovazione Meccanica e Gestionale (DIMEG) - University of Padova - Italy, Physikalisch-Technische Bundesanstalt Braunschweig (PTB...

Praktische kengetallen over fokkerij, huisvesting, voeding, lichaamssamensteiling, urine- en fecesproductie en toediening van diergeneesmiddelen bij het varken

NARCIS (Netherlands)

Berende, P.L.M.

1997-01-01

In dit rapport worden de omstandigheden beschreven waaronder de Nederlandse varkens gehouden worden, alsmede gebruikte rassen en kruisingen. Daarnaast zullen enkele kengetallen m.b.t. de technische resultaten gegeven worden. Verder wordt aandacht besteed aan de lichaamssamenstelling van varkens en

Agro 13 No 3 Ready

African Journals Online (AJOL)

Larvicidal Activity of Aqeous Extract of Moringa oleifera Seeds on Anopheles gambiae ... development of resistance mechanisms in the mosquitoes, hence leading to the resurgence of malaria and ..... increasingly regulated world. Annual review of ... Deutsche Gesellschaft fur TechnischeZusammenarbeit (GTZ). Federal ...

Situated cognitive engineering: Developing adaptive track handling support for naval command and control centers

NARCIS (Netherlands)

Neerincx, M.A.; Brake, G.M. te; Ven, J.G.M. van de; Arciszewski, H.F.R.; Greef, T.E. de; Lindenberg, J.

2008-01-01

Dit artikel presenteert een 'situated cognitive engineering' (SCE) methode voor het verkrijgen van een theoretisch en empirisch onderbouwde Requirements Baseline, waarin operationele, human factors, en technische eisen in samenhang naar voren komen. De methode wordt toegelicht met een ontwerp van

Environmental risk limits for lambda-cyhalothrin

OpenAIRE

Leeuwen LC van; Vos JH; Mensink BJWG; SEC

2008-01-01

Dit rapport geeft milieurisicogrenzen voor het insecticide lambda-cyhalothrin in water en sediment. Milieurisicogrenzen zijn de technisch-wetenschappelijke advieswaarden voor de uiteindelijke milieukwaliteitsnormen in Nederland. De milieurisicogrenzen zijn afgeleid volgens de methodiek die is voorgeschreven in de Europese Kaderrichtlijn Water.

The Use of ICT to Support Students with Dyslexia

OpenAIRE

Diraä, Nadia; Engelen, Jan; Ghesquière, Pol; Neyens, Koen

2009-01-01

The Katholieke Universiteit Leuven (K.U.Leuven) has a tradition of supporting students with a disability in order to guarantee equal opportunities to achieve their educational, personal and vocational goals. The K.U.Leuven policy is working towards inclusive education in the long term, by improving facilities and accommodation for certain target groups in the short term. Efforts have also been directed to make the learning environment more accessible for all kind of students, especially over ...

Methodiek werkveldonderzoek Hogeschool INHOLLAND

OpenAIRE

Ramaekers, G.W.M.; Allen, J.P.; Heijke, J.A.M.; van Loo, J.B.; van der Velden, R.K.W.

2004-01-01

In mei 2003 heeft Hogeschool INHOLLAND het Researchcentrum voor Onderwijs en Arbeidsmarkt (ROA) van de Universiteit Maastricht opdracht verleend een instrument te ontwikkelen waarmee de mening van het werkveld over de kwaliteit van haar opleidingen in kaart kan worden gebracht. Het instrument is getest in een pilot-project, dat heeft plaatsgevonden in het kader van de accreditatie van een elftal opleidingen van Hogeschool INHOLLAND.Het ROA had bij het uitvoeren van het pilot-project de leidin...

Visit of Mrs Fientje Moerman - Vice-minister of the Flemish Government - Belgium.

CERN Multimedia

Maximilien Brice

2005-01-01

Fientje Moerman has visited the CMS cavern and assembly hall, followed by Building SM18, where the LHC superconducting magnets are being tested. After lunch with the CERN Management, her visit ended with a tour of the ISOLDE facilities. Picture 02 : in the CMS cavern, where she is seen with Walter van Doninck of Vrije Universiteit Brussel (right), together with Andreas De Leenheer of Ghent University (centre left) and Eddi De Wolf of Antwerp University (centre right).

Technische Documentatie en Handleiding voor MEI 2.0

NARCIS (Netherlands)

Oorschot MMP van; Linders D; LAE

2001-01-01

The main purpose of this technical documentation is to clearly establish the key ideas and methods used during development of the MEI-model. This document introduces in this way the technical set-up of the model for application developers and administrators. In describing how MEI (version 2) works

Fluid mechanics. An introduction. Technische Stroemungslehre. Eine Einfuehrung

Energy Technology Data Exchange (ETDEWEB)

Kalide, W

1980-01-01

Originally written for students in the field of engineering, this book may also be of use in the engineering practice. The subject is presented with a view to practice. Fundamental theorems of fluid mechanics are presented without going too much into theory. The chapter on supersonic flow has been extended in the fifth edition as this is a field of great importance in engineering. The new chapter on gas dynamics takes account of these processes in turbine and compressor construction and aeronautical engineering. There is an appendix with material data, characteristic values, flow resistance coefficients, diagrams and two tables with rated pressure loss values for pipeline flow.

PAES: Positron annihilation induced Auger electron spectrometer

Directory of Open Access Journals (Sweden)

Christoph Hugenschmidt

2015-08-01

Full Text Available Positron annihilation induced Auger electron spectroscopy (PAES is a newly developed application for surface studies with high elemental selectivity and exceptional surface sensitivity. The instrument is operated by the Technische Universität München and is located at NEPOMUC.

Accelerated degeneration testing for flowmeter sensors. Evaluation and constancy against measuring; Beschleunigte Abnutzungspruefung fuer Durchflusssensoren. Abschaetzung der Messbestaendigkeit

Energy Technology Data Exchange (ETDEWEB)

Rose, Juergen; Fenske, Helmut; Gerdes, Oda [Physikalisch-Technische Bundesanstalt (PTB), Berlin (Germany). Fachbereich Waerme

2009-01-15

Test specifications for flow sensors state that a fatigue test should be carried out for 2400 h. The PTB (Physikalisch-Technische Bundesanstalt), in cooperation with industrial organisations, developed a faster fatigue test for mechanical and static sensors which requires only 600 h. (orig.)

Waterverdamping uit dunne mest; resultaten van modelberekeningen

NARCIS (Netherlands)

Wagenberg, van A.V.; Verdoes, N.; Vranken, E.; Berckmans, D.

1999-01-01

In een geïntegreerd luchtbehandelingsysteem kunnen technische oplossingen voor de emissieproblematiek (ammoniak, geur) en de mestproblematiek worden gecombineerd. Door ventilatielucht uit de stal intensief in contact te brengen met mest kan water uit de mest verdampen. Daardoor droogt de mest. Het

Embedded Linux in het onderwijs

NARCIS (Netherlands)

Dr Ruud Ermers

2008-01-01

Embedded Linux wordt bij steeds meer grote bedrijven ingevoerd als embedded operating system. Binnen de opleiding Technische Informatica van Fontys Hogeschool ICT is Embedded Linux geïntroduceerd in samenwerking met het lectoraat Architectuur van Embedded Systemen. Embedded Linux is als vakgebied

Een biobed, geen praktische oplossing

NARCIS (Netherlands)

Sande-Schellekens, van de A.; Backus, G.

1993-01-01

De benodigde arbeid voor het laten functioneren van een biobed bedraagt 10 tot 15 minuten per varkensplaats per jaar. Hierbij is geen rekening gehouden met het oplossen van storingen. De biobedden, zoals hier toegepast, zijn door de vele storingen technisch niet inpasbaar

The fully integrated biomedical engineering programme at Eindhoven University of Technology.

Science.gov (United States)

Slaaf, D W; van Genderen, M H P

2009-05-01

The development of a fully integrated biomedical engineering programme (life sciences included from the start) is described. Details are provided about background, implementation, and didactic concept: design centred learning combined with courses. The curriculum has developed into a bachelor-master's programme with two different master's degrees: Master's Degree in Biomedical Engineering and Master's Degree in Medical Engineering. Recently, the programme has adopted semester programming, has included a major and minor in the bachelor's degree phase, and a true bachelor's degree final project. Details about the programme and data about where graduates find jobs are provided in this paper.

Rectenna demonstrators at Holst Centre / IMEC and Eindhoven University of Technology

NARCIS (Netherlands)

Visser, H.J.; Pflug, H.; Keyrouz, S.

2015-01-01

To realize a sufficiently high dc voltage for a realistic load impedance with a rectenna we may increase the receiving aperture or employ a voltage boost circuit. A gridded, square loop FSS, loaded with Schottky diodes is demonstrated as an example of the first solution. For the second solution we

The fully integrated biomedical engineering programme at Eindhoven University of Technology

NARCIS (Netherlands)

Slaaf, D.W.; Genderen, van M.H.P.

2009-01-01

The development of a fully integrated biomedical engineering programme (life sciences included from the start) is described. Details are provided about background, implementation, and didactic concept: design centred learning combined with courses. The curriculum has developed into a

Verification of a uranium micromass standard using the Eindhoven scanning microprobe

NARCIS (Netherlands)

Simons, D.P.L.; Lagerwaard, A.; Mutsaers, P.H.A.; Voigt, de M.J.A.

1999-01-01

Analysis of dust samples from uranium enrichment facilities is focused on the detection and analysis of uranium-containing particles. A chemical and isotopic analysis of individual particles from dust samples is thought to be an effective analytical tool to check the absence of nuclear-weapon

Tech United Eindhoven, winner RoboCup 2014 MSL : Middle Size League

NARCIS (Netherlands)

Lopez Martinez, C.; Schoenmakers, F.; Naus, G.; Meessen, K.; Douven, Y.; van de Loo, H.; Bruijnen, D.J.H.; Aangenent, W.; Groenen, J.P.J.; van Ninhuijs, B.; Briegel, M.; Hoogendijk, R.; van Brakel, P.; Van Den Berg, R.; Hendriks, O.; Arts, R.R.M.J.W.; Botden, F.J.B.M.; Houtman, W.; van 't Klooster, M.E.; van der Velden, J.R.; Beeren, C.; de Koning, C.K.M.; Klooster, O.F.C.; Soetens, R.; van de Molengraft, R.; Bianchi, R.A.C.; Levent Akin, H.; Ramamoorthy, S.; Sugiura, K.

2015-01-01

In this paper we discuss improvements in mechanical, electrical and software design, which we did to become RoboCup 2014 world champion. Regarding hardware and control our progress includes first steps towards improved passing accuracy via velocity feedback control on the shooting lever. In terms of

Die identifisering van maatstawwe vir die navorsingsprestasie van akademici

Directory of Open Access Journals (Sweden)

H. A. Labuschagne

1990-06-01

Full Text Available Identification of criteria for academic research performance. At South African universities, the achievement of objectives is usually measured in terms of so-called "process criteria" (e.g. pass rates, instead of performance criteria which reflect the quality of academic personnel. Stimulated by the need to identify valid indices of research performance, as a component of academic performance, this study investigated the dimensionality of several criteria, identified from empirical and literature studies. It was found that various valid criteria could be represented by six constructs, viz.: the stature of the researcher as scientist; scientific contributions; enhancement of own profession; community development; participation in research projects; and giving advice to persons or institutions outside the university. Opsomming By Suid-Afrikaanse universiteite word doelwitbereiking gewoonlik aan die hand van sogenaamde "prosesmaat-stawwe" (bv. slaagsyfers in plaas van prestasiemaatstawwe wat die gehalte van akademiese personeel weerspieel, gemeet. Na aanleiding van 'n behoefte aan die identifisering van geldige rigtingwysers vir navorsingsprestasie as 'n komponent van akademiese prestasie, is daar ondersoek ingestel na die dimensionaliteit van verskillende maatstawwe wat vooraf deur middel van empiriese- en literatuurstudies geidentifiseer is. Daar is gevind dat verskeie geldige maatstawwe deur ses konstrukte verteenwoordig word, te wete: die statuur van die navorser as wetenskaplike, wetenskaplike bydraes, uitbouing van eie professie, gemeenskapsontwikkeling, deelname aan navorsingsprojekte en advieslewering aan persone of instellings buite die Universiteit.

Nikola Tesla: een biografie

NARCIS (Netherlands)

ir.ing. Ruud Thelosen

2015-01-01

De Technische uitvinder Tesla heeft 700 patenten op zijn naam staan als hij overlijdt. Zijn uitvindingen hebben de wereld in de 20e eeuw volledig veranderd. Zijn wisselstroom generator hebben heel de VS van elektriciteit voorzien. Radioverkeer , remote control werd mogelijk dankzij Tesla. Volgens

'Uytnemende Schilder van Antwerpen' : Joos van Cleve: atelier, productie en werkmethoden

NARCIS (Netherlands)

Leeflang, Micha

2007-01-01

Joos van Cleve (ca. 1480-1541) was een van de meest invloedrijke Antwerpse schilders in de eerste helft van dezestiende eeuw. Hij kreeg belangrijke opdrachten voor portretten en altaarstukken van onder anderen de Franse koning Frans I. Micha Leeflang onderzocht met name de materieel-technische

Meer of minder licht

NARCIS (Netherlands)

Graaf, A. van der; Steentjes, A.

2000-01-01

Interview Wout van Bommel, informatie over DYNO onderzoek van Alferdinck en Hogema bij TNO Technische Menskunde De natuur heeft 'recht op duisternis', zegt de milieubeweging, en daarom moet de verlichting op wegen worden teruggedrongen. De overheid wil dat ook, want de kosten moeten omlaag.

DARMSTADT: Superconducting electron accelerator in operation

International Nuclear Information System (INIS)

Anon.

1991-01-01

In December, the S-DALINAC superconducting radiofrequency electron accelerator at the Nuclear Physics Institute of Darmstadt's Technische Hochschule was completed. This pioneer continuous-wave (c.w.) machine passed a major milestone several years ago when it accelerated its first low energy electron beam

Doorslaan in veld emissie

NARCIS (Netherlands)

Abelmann, Leon; le Fèbre, A.J.

2008-01-01

Dit verhaal gaat over doorslaan. Het vertelt iets technisch over doorslag in veldemissie, maar vooral hoe een promotie-onderzoek een promovendus tot wanhoop kan drijven, en hoe een begeleider voorkomt dat hij doorslaat. Het begint allemaal bij de hard disk. Dat is een mechanisch geadresseerd

Ethische aspecten van big data

NARCIS (Netherlands)

N. (Niek) van Antwerpen; Klaas Jan Mollema

2017-01-01

Big data heeft niet alleen geleid tot uitdagende technische vraagstukken, ook gaat het gepaard met allerlei nieuwe ethische en morele kwesties. Om verantwoord met big data om te gaan, moet ook over deze kwesties worden nagedacht. Want slecht datagebruik kan nadelige gevolgen hebben voor

Regional costs and benefits of alternative post-Kyoto climate regimes: Comparison of variants of the Multi-stage and Per Capita Convergence regimes

NARCIS (Netherlands)

Vuuren DP van; Elzen MGJ den; Berk MM; Lucas P; Eickhout B; Eerens H; Oostenrijk R; KMD

2003-01-01

Deze studie verkent de technische, economische en milieu implicaties van verschillende zogenaamde post-Kyoto regimes voor de verdeling van regionale reductie doelstellingen die leiden tot stabilisatie van de broeikasgasconcentratie in de atmosfeer op 550 en 650 ppmv CO2-equivalenten (het S550e

Reducing Consequences of Car Collision using Inspiration from Nature

DEFF Research Database (Denmark)

Lenau, Torben Anker; Helten, Katharina; Hepperle, Clemens

2011-01-01

is a result of a project where researchers from two universities (Technical University of Denmark, DTU, and Technische Universität München, TUM) explored three different biomimetic design approaches namely the transfer checklist approach, the inspiration card approach and the interdisciplinary team approach...

In Groot-Brittannië heiligt het doel de middelen

NARCIS (Netherlands)

Hoof, H.A.J.M. van

1997-01-01

In Nederland bestaat nogal wat politieke weerstand tegen observatie met 'technische hulpmiddelen'. In Groot-Brittannië is dat anders. Daar zijn camera's in winkelstraten inmiddels een vertrouwd gezicht geworden. En de Britten gaan nog een stapje verder. Ze hebben sinds kort een database met

PRISMA as a quality tool for promoting customer satisfaction in the telecommunications industry

International Nuclear Information System (INIS)

Dye, J.; Schaaf, T. van der

2002-01-01

Near-miss event reporting systems have a successful history in managing risk in industries such as medicine, aviation, nuclear power, and the petrochemical industry. By treating events of customer dissatisfaction as accidents, near-miss event reporting systems designed to reduce risks to safety in hazardous environments may be borrowed by the telecommunications industry. The system chosen for this study was the Prevention and Recovery Information System for Monitoring and Analysis (PRISMA), developed by the Eindhoven University of Technology (EUT). The purpose of this study was to determine the feasibility of applying PRISMA as a tool to reduce risks to customer dissatisfaction. Participants in the project included the EUT Safety Management Group, a consultant, and six Network Service Managers from a telecommunications company whose duties included responding to customer complaints. Twenty-three incidents were investigated with an average of 5.9 root causes arising from 2.9 process owners per event. Causal trees were generated for each incident and root causes were classified according to the Eindhoven Classification Model (ECM). The distribution of 135 root causes was 50% organizational, 32% human, 16% technical and 2% unclassifiable. The participants were successful in executing the functional steps of PRISMA in response to incidents of customer dissatisfaction. This study established the suitability of PRISMA as a tool for managing risks to customer satisfaction within the telecommunications domain

PRISMA as a quality tool for promoting customer satisfaction in the telecommunications industry

Energy Technology Data Exchange (ETDEWEB)

Dye, J.; Schaaf, T. van der

2002-03-01

Near-miss event reporting systems have a successful history in managing risk in industries such as medicine, aviation, nuclear power, and the petrochemical industry. By treating events of customer dissatisfaction as accidents, near-miss event reporting systems designed to reduce risks to safety in hazardous environments may be borrowed by the telecommunications industry. The system chosen for this study was the Prevention and Recovery Information System for Monitoring and Analysis (PRISMA), developed by the Eindhoven University of Technology (EUT). The purpose of this study was to determine the feasibility of applying PRISMA as a tool to reduce risks to customer dissatisfaction. Participants in the project included the EUT Safety Management Group, a consultant, and six Network Service Managers from a telecommunications company whose duties included responding to customer complaints. Twenty-three incidents were investigated with an average of 5.9 root causes arising from 2.9 process owners per event. Causal trees were generated for each incident and root causes were classified according to the Eindhoven Classification Model (ECM). The distribution of 135 root causes was 50% organizational, 32% human, 16% technical and 2% unclassifiable. The participants were successful in executing the functional steps of PRISMA in response to incidents of customer dissatisfaction. This study established the suitability of PRISMA as a tool for managing risks to customer satisfaction within the telecommunications domain.

Consolidation of returned products in a distribution centre

OpenAIRE

Erráez Castelltort, Joan Albert

2014-01-01

The following project was carried out from September 2014 to February 2015 in the Industrial Management department of Universiteit Gent (Belgium); I came from Universitat Politècnica de Catalunya (UPC) for six months to do my Master Thesis, so I worked on it as an exchange student. In September, my official promoter, Professor Dr. Hendrik Van Landeghem, addressed me to Professor Dr. El-Houssaine Aghezzaf, who explained me the possibility to do the project with NIKE European Logistics Cente...

Stress !!!

OpenAIRE

Fledderus, M.

2012-01-01

Twee op de vijf UT-studenten hebben last van ernstige studiestress, zo erg zelfs dat het ze in hun privéleven belemmert. Die cijfers komen overeen met het landelijk beeld van stress onder studenten. Samen met 14 andere universiteits- en hogeschoolbladen enquêteerde UT Nieuws bijna 5500 studenten. Opvallend is dat mannelijke studenten uit Twente zich veel minder druk lijken te maken over hun studie. Onder vrouwen ligt de stress juist erg hoog ten opzichte van het landelijk gemiddelde.

"Meerdere Midden-Paleolithische bewoningsfasen in een loess-bodem sequentie te Veldwezelt-Hezerwater, Limburg, België"

OpenAIRE

Bringmans, Patrick

2006-01-01

Meerdere Midden-Paleolithische Bewoningsfasen in een Loess-bodem Sequ entie te Veldwezelt-Hezerwater, Limburg, België Midden de jaren ’90 van de 20ste eeuw werd er door het “Laboratorium voo r Prehistorie” aan de Katholieke Universiteit Leuven een geo-archeologis ch project opgestart om in de loess-groeves van Limburgs-Haspengouw naar sporen van de Pleistocene mens te gaan prospecteren. Uit deze prospecti es bleek, dat vooral de loess-groeve te Veldwezelt-Hezerwater de beste p erspectiev...

Groener drogen

NARCIS (Netherlands)

Loman, N.G.M. (Niek)

2012-01-01

Auteur: N.G.M. (Niek) Loman Begeleiders: Ing. H.W. (Pim) van den Dool, Discrete Technologie en Productie Automatisering, RUG Dr.ir. I. (Ingrid) ten Have MBA, Interfac. Opleidingsinst. Technische Bedrijfskunde, RUG Drs. C.M. (Karin) Ree, Bèta Wetenschapswinkel, Science & Society Group, RUG Drs. R.W.

Jam Session reloaded: Von der Marmeladenfabrik zum Kultur- und Kreativraum : Revitalisierung und Umnutzung der Zuegg-Marmeladenfabrik am Tribusplatz in Lana, Südtirol

OpenAIRE

Hillebrand, Annika

2015-01-01

von Annika Hillebrand Zusammenfassung in englischer Sprache Parallelt. [Übers. des Autors]: Jam Session Reloaded: From the jam factory to the cultural and creative space revitalization and redevelopment of Zuegg jam factory on Tribusplatz in Lana, South Tyrol Technische Universität Wien, Univ., Diplomarbeit, 2015

Leben heisst ein Kämpfer sein : zum Verhältnis von Wissenschaft und Öffentlichkeit am Beispiel der modernen Eisenhüttenkunde and der Technischen Hochschule Aachen

NARCIS (Netherlands)

Krebs, S.

2007-01-01

To Live is to be Fighter - On the Relatioship of Science and Public Illustrated by the Example of Modern Ferrous Metallurgy at the Technical University Aachen. - The contribution pursues the question of how Fritz Wüst, professor of ferrous metallurgy at the Technische Hochschule Aachen (1901-1921),

A borderless Library

CERN Multimedia

CERN Library

2010-01-01

The CERN Library has a large collection of documents in online or printed format in all disciplines needed by physicists, engineers and technicians. However,  users sometimes need to read documents not available at CERN. But don’t worry! Thanks to its Interlibrary loan and document delivery service, the CERN Library can still help you. Just fill in the online form or email us. We will then locate the document in other institutions and order it for you free of charge. The CERN Library cooperates with the largest libraries in Europe, such as ETH (Eidgenössische Technische Hochschule) in Zurich, TIB (Technische Informationsbibliothek) in Hanover and the British Library in London. Thanks to our network and our expertise in document search, most requests are satisfied in record time: articles are usually served in .pdf version a few hours after the order, and books or other printed materials are delivered within a few days. It is possible to ask for all types of documents suc...

Technically-oriented operation management systems in conjunction with commercial DB systems

Energy Technology Data Exchange (ETDEWEB)

Lex, M.; Heselmann, B. [GiS mbH, Erlangen (Germany); Eschbach, P. [BASF Consult GmbH, Muenchen (Germany)

2001-07-01

Due to the liberalization of the electricity market, the efficiency and competitiveness of a power plant is increasingly measured at the cost per amount of energy generated. Thus, aspects of market-orientation and clearly cheaper electricity generation are in the foreground. Technically-oriented DP systems are necessary to save operating cost. These systems have structures differing from the mere business-oriented systems, because of the different frame conditions and operators' desire to stand out against rivalling competitors by technical and organizational measures. (orig.) [German] Die Effektivitaet und damit Konkurrenzfaehigkeit eines Kraftwerkes wird mit der Liberalisierung des Strommarktes verstaerkt an den Kosten je erzeugter Energieeinheit gemessen. Fuer den Betrieb ruecken damit Aspekte einer marktgerechten und somit deutlich kostenguenstigeren Stromerzeugung verstaerkt in den Vordergrund. Wer Betriebskosten sparen will, braucht technisch orientierte DV-Systeme, die aufgrund der unterschiedlichen Rahmenbedingungen und des Wunsches aller Anlagenbetreiber, sich durch technisch-organisatorische Massnahmen vom Wettbewerb vorteilhaft abzuheben, voellig andere Strukturen aufweisen als die betriebswirtschaftlich orientierten Systeme. (orig.)

The EPR (European Pressurized Water Reactor) containment - concept, testing of leakage behaviour, FRP liner

Energy Technology Data Exchange (ETDEWEB)

Touret, J.P. [EDF SEPTEN, Villeurbanne (France); Liersch, G. [Bayernwerk Kerenergie GmbH, Muenchen (Germany); Danisch, R. [Siemens AG, KWU NAD, Erlangen (Germany)

2001-07-01

The Basic Design of the EPR has now been completed. The containment plays a major safety-related role with respect to protection of the environment against radioactive releases. The EPR features a double (steel-reinforced concrete/prestressed concrete) containment design, with the inner containment coated additionally with a fibreglass-reinforced plastic (FRP) liner in certain areas. This means that containment leaktightness is provided mainly by the prestressed concrete and the FRP liner in the event of a postulated accident. The numerous findings of the tests carried out so far in both France and Germany are summarized. (orig.) [German] Das Basic Design fuer den EPR ist fertiggestellt. Entscheidend fuer eine Realisierung wird neben der politischen Akzeptanz vor allem die Wettbewerbsfaehigkeit mit anderen Energietraegern sein. Im EPR-Projekt wird der hohe Sicherheitsstandard der heutigen Kernkraftwerke in Deutschland und Frankreich ergaenzt, indem zusaetzlich technische Massnahmen ergriffen werden, um die Konsequenzen beim unterstellten Versagen aller sicherheitstechnischen Einrichtungen mit der Folge eines postulierten Niederschmelzen des Kerns technisch zu beherrschen. (orig.)

(Distributed) Denial-of-Service : deel 2

NARCIS (Netherlands)

Luiijf, H.A.M.

2013-01-01

Het geblokkeerd raken van een dienstverlening wordt in het Engels vaak aangeduid met de term Denial-of-Service (afkort: DoS). Al wordt de term veelal gebruikt in de cyberspace-omgeving, is deze feitelijk generieker, DoS kan zowel een technische oorzaak hebben, als bewust worden veroorzaakt door

Communicatie-architectuur PLC’s en Unity

NARCIS (Netherlands)

J.L. Scholte

2017-01-01

Voor het afronden van de studie Technische Informatica aan de Haagse Hogeschool te Delft is het noodzakelijk om een afstudeeropdracht uit te voeren. In de loop van zeventien weken is deze opdracht uitgevoerd bij het bedrijf JB Systems te Vlaardingen en Delft door de afstudeerder Jordy Scholte. Dit

Physik gestern und heute: Visualisierung mit der Schlierenmethode

Science.gov (United States)

Heering, Peter

2006-07-01

Der Name des österreichischen Forschers Ernst Mach ist heute noch mit der Schallgeschwindigkeit verbunden. Diese Auszeichnung resultiert aus Machs Untersuchungen, wie sich Projektile mit Überschallgeschwindigkeit durch die Luft bewegen. Gerade in jüngster Zeit hat die Anwendung derartiger Methoden durch technische Modifikationen wieder einen Aufschwung erfahren.

Privacy, werk en internet of things

NARCIS (Netherlands)

Van Der Sype, Yung Shin; Vedder, Anton

2016-01-01

Technologisch zijn ondernemingen nog niet klaar voor 3.0. Hoewel reeds heel wat technische snufjes in de onderneming binnensijpelen, staat de technologie nog niet op punt om al van een Internet of Things te spreken. Dit geeft ons de tijd om ons juridisch voor te bereiden op de opkomende

Tax accounting - IFRS IAS 12 : Voor accountants, controllers en fiscalisten

NARCIS (Netherlands)

Naarding, E.; Langendijk, H.P.A.J.

2010-01-01

Deel 7 van de reeks 'Tax Assurance in beeld' is een werkboek dat vraagstukken bevat om de technische aspecten van IAS 12 Income Taxes van de International Accounting Standards Board (IASB) te oefenen. Het boek is bedoeld voor accountants, controllers en fiscalisten die zich willen bekwamen in de

Tax accounting - IFRS IAS 12: Voor accountants, controllers en fiscalisten

NARCIS (Netherlands)

Naarding, E.W.J.; Langendijk, H.P.A.J.

2010-01-01

Deel 7 van de reeks 'Tax Assurance in beeld' is een werkboek dat vraagstukken bevat om de technische aspecten van IAS 12 Income Taxes van de International Accounting Standards Board (IASB) te oefenen. Het boek is bedoeld voor accountants, controllers en fiscalisten die zich willen bekwamen in de

Persistent chlorinated hydrocarbons (PHC) - end products and intermediate products of technical synthesis processes in surface water of the Rhine region. Vol. 5: Site profiles of persistent chlorinated hydrocarbons - source-oriented monitoring in aquatic media; Persistente chlorierte Kohlenwasserstoffe (PCKW) - End- und Zwischenprodukte technischer Synthesen in Gewaessern der Rheinregion. Band 5 der Reihe: Standortprofile persistenter chlorierter Kohlenwasserstoffe - ursachenorientiertes Monitoring in aquatischen Medien

Energy Technology Data Exchange (ETDEWEB)

Heinisch, E.; Kettrup, A.; Bergheim, W.; Wenzel, S.

2003-07-01

Schwebstoffen, die in 20 zumeist Landesinstitutionen z. T. im Zeitraum von 1984-2002 erhoben worden waren, wurde der Versuch unternommen, die Belastungshoehen und Stoffmusterprofile fuer Probenahmelokalitaeten am Rhein und Fluessen in BW, Hess, RP und NRW kenntlich zu machen. Die untersuchten Verbindungen waren die isomeren Di-, Tri- und Tetrachlorbenzene, Penta- und Hexachlorbenzen, Ochtachlorstyren (OCS), Hexachlorbutadien (HCBD) sowie die 6 DIN-(IUPAC-, Ballschmiter)Kongenere der PCB, Substanzen, die zumeist im Sinne von REACH als PBT-, z. T. als vPvB-Stoffe bezeichnet wurden bzw. als ''prioritaer gefaehrliche Stoffe'' (PCBz, HCB, HCBD) eingestuft sind. Die statistisch verrechneten Einzeldaten wurden zu Streckenprofilen und Zeitreihen verarbeitet, mit dem Ziel, lokale oder regionale Immissionen, Hinweise zu ihrer Entstehung und gegenwaertigen Bedeutung kenntlich zu machen. Hintergrund dieser Bestrebungen ist, dass Fachpublikationen ueber technische Synthesen oder Zwangsanfall der Verbindungen nach Art, Menge und Zeitraum nicht vorliegen, was als Defizit zu betrachten ist. Besonders Tetrachlorbenzen (hauptsaechlich das 1,2,4,5-TeCBz) und das HCBD konnten als Indikatorsubstanzen fuer historische und rezente technische Synthesen chlororganischer Verbindungen sichtbar gemacht werden. Die hoeher chlorierten PCB-Kongenere Nr. 138, 153 und 180 (HPCB) erwiesen sich als ausserordentlich persistent. Die Chemiestandorte im Umfeld der Probenahmelokalitaeten Rheinfelden, Grenzach, Lampertheimer Altrhein, Biebesheimer Rhein, Muendung Schwarzbach, Bischofsheim und Griesheim (Main), Hitdorf, Duisburg-Homberg und Huels (Lippe) konnten durch Maxima und spezielle Stoffmusterverteilungen transparent gemacht werden. (orig.)

Dynamics and Stochastics Festschrift Keane (Michael S) on the occasion of his 65th birthday on 2 Jan 2005

CERN Document Server

Denteneer, Dee; Verbitskiy, Evgeny

2006-01-01

Contains 29 contributions by Mike's closest colleagues and friends, covering a broad range of topics in Dynamics and Stochastics. - To celebrate Mike's scientific achievements, a conference entitled "Dynamical Systems, Probability Theory and Statistical Mechanics" was organized in Eindhoven, The Netherlands, during the week of January 3-7, 2005. This conference was hosted jointly by EURANDOM and by Philips Research. It drew over 80 participants from 5 continents, which is a sign of the warm affection and high esteem for Mike felt by the international mathematics community.