WorldWideScience

Sample records for techniques vlbi slr

  1. Long-term mass variations from SLR, VLBI and GPS data

    Science.gov (United States)

    Luceri, Vincenza; Sciarretta, Cecilia; Bianco, Giuseppe

    2013-04-01

    The second-degree geopotential coefficients reflect the behaviour of the Earth's inertia tensor of order 2 which describes the main mass variations of our planet impacting polar motion and length of day (EOP). SLR, VLBI and GPS allow the estimation of those variations, either directly in the case of SLR through its dynamics, and indirectly, for all the three geodetic techniques, by deriving excitation functions from the EOP estimations. The geodetic estimates include the influence of the Earth's atmosphere and oceans, both from their mass and motion components, which can be modelled using the atmospheric and oceanic angular momenta variations. The different C21, S21 and C20 geodetic time series are compared in order to evaluate their coherence and their response to the mass variations after the removal of the motion terms. Moreover, the residual signal contents of the geodetic values, deprived by the atmospheric and oceanic mass and motion components, will be investigated.

  2. A Global Terrestrial Reference Frame from simulated VLBI and SLR data in view of GGOS

    Science.gov (United States)

    Glaser, Susanne; König, Rolf; Ampatzidis, Dimitrios; Nilsson, Tobias; Heinkelmann, Robert; Flechtner, Frank; Schuh, Harald

    2017-07-01

    In this study, we assess the impact of two combination strategies, namely local ties (LT) and global ties (GT), on the datum realization of Global Terrestrial Reference Frames in view of the Global Geodetic Observing System requiring 1 mm-accuracy. Simulated Very Long Baseline Interferometry (VLBI) and Satellite Laser Ranging (SLR) data over a 7 year time span was used. The LT results show that the geodetic datum can be best transferred if the precision of the LT is at least 1 mm. Investigating different numbers of LT, the lack of co-located sites on the southern hemisphere is evidenced by differences of 9 mm in translation and rotation compared to the solution using all available LT. For the GT, the combination applying all Earth rotation parameters (ERP), such as pole coordinates and UT1-UTC, indicates that the rotation around the Z axis cannot be adequately transferred from VLBI to SLR within the combination. Applying exclusively the pole coordinates as GT, we show that the datum can be transferred with mm-accuracy within the combination. Furthermore, adding artificial stations in Tahiti and Nigeria to the current VLBI network results in an improvement in station positions by 13 and 12%, respectively, and in ERP by 17 and 11%, respectively. Extending to every day VLBI observations leads to 65% better ERP estimates compared to usual twice-weekly VLBI observations.

  3. Observing APOD with the AuScope VLBI Array

    Science.gov (United States)

    Sun, Jing; Cao, Jianfeng

    2018-01-01

    The possibility to observe satellites with the geodetic Very Long Baseline Interferometry (VLBI) technique is vividly discussed in the geodetic community, particularly with regard to future co-location satellite missions. The Chinese APOD-A nano satellite can be considered as a first prototype—suitable for practical observation tests—combining the techniques Satellite Laser Ranging (SLR), Global Navigation Satellite Systems (GNSS) and VLBI on a single platform in a Low Earth Orbit (LEO). Unfortunately, it has hardly been observed by VLBI, so major studies towards actual frame ties could not be performed. The main reason for the lack of observations was that VLBI observations of satellites are non-standard, and suitable observing strategies were not in place for this mission. This work now presents the first serious attempt to observe the satellite with a VLBI network over multiple passes. We introduce a series of experiments with the AuScope geodetic VLBI array which were carried out in November 2016, and describe all steps integrated in the established process chain: the experiment design and observation planning, the antenna tracking and control scheme, correlation and derivation of baseline-delays, and the data analysis yielding delay residuals on the level of 10 ns. The developed procedure chain can now serve as reference for future experiments, hopefully enabling the global VLBI network to be prepared for the next co-location satellite mission. PMID:29772732

  4. VLBI2010 in NASA's Space Geodesy Project

    Science.gov (United States)

    Ma, Chopo

    2012-01-01

    In the summer of 20 11 NASA approved the proposal for the Space Geodesy Project (SGP). A major element is developing at the Goddard Geophysical and Astronomical Observatory a prototype of the next generation of integrated stations with co-located VLBI, SLR, GNSS and DORIS instruments as well as a system for monitoring the vector ties. VLBI2010 is a key component of the integrated station. The objectives ofSGP, the role of VLBI20 lOin the context of SGP, near term plans and possible future scenarios will be discussed.

  5. VLBI: A Fascinating Technique for Geodesy and Astrometry

    Science.gov (United States)

    Schuh, H.; Behrend, Dirk

    2012-01-01

    Since the 1970s Very Long Baseline Interferometry (VLBI) has proven to be a primary space-geodetic technique by determining precise coordinates on the Earth, by monitoring the variable Earth rotation and orientation with highest precision, and by deriving many other parameters of the Earth system. VLBI provides an important linkage to astronomy through, for instance, the determination of very precise coordinates of extragalactic radio sources. Additionally, it contributes to determining parameters of relativistic and cosmological models. After a short review of the history of geodetic VLBI and a summary of recent results, this paper describes future perspectives of this fascinating technique. The International VLBI Service for Geodesy and Astrometry (IVS), as a service of the International Association of Geodesy (IAG) and the International Astronomical Union (IAU), is well on its way to fully defining a next generation VLBI system, called VLBI2010. The goals of the new system are to achieve on scales up to the size of the Earth an accuracy of 1 mm in position and of 0.1 mm/year in velocity. Continuous observations shall be carried out 24 h per day 7 days per week in the future with initial results to be delivered within 24 h after taking the data. Special sessions, e.g. for monitoring the Earth rotation parameters, will provide the results in near real-time. These goals require a completely new technical and conceptual design of VLBI measurements. Based on extensive simulation studies, strategies have been developed by the IVS to significantly improve its product accuracy through the use of a network of small (approx 12 m) fast-slewing antennas. A new method for generating high precision delay measurements as well as improved methods for handling biases related to radio source structure, system electronics, and deformations of the antenna structures has been developed. Furthermore, as of January 2012, the construction of ten new VLBI2010 sites has been funded, with

  6. New International Agreements About Space Techniques Among Argentina, China and France

    Science.gov (United States)

    Pacheco, A. M.; Podestá, R.; Actis, E.; Adarvez, S.; Quinteros, J.; Li, J.; Saunier, J.; Podestá, F.; Ramos, F.; Aguilera, J.; Sosa, G.; Hauser, D.

    2018-01-01

    The International Earth Rotation and Reference Systems (IERS) is in charge of defining and materializing celestial reference systems (ICRS - ICRF) and terrestrial reference systems (ITRS - ITRF). In order to perform this task it uses data from the following techniques: Very Long Baseline Interferometry (VLBI), Satellite Laser Ranging (SLR), Global Navigation Satellite System (GNSS) and Doppler Orbitography and Radiopositioning Integrated by Satellite (DORIS). Nowadays, the Observatorio Astronómico Félix Aguilar (OAFA) has two instruments with these advanced techniques: SLR and a permanent GNSS station. In the nearby future a 40 m diameter radio telescope will be available that will be operated in VLBI mode along with a DORIS buoy which will be co-localized with a SLR telescope and GNSS antennas. In this way OAFA will become a zero station, first class, of the ITRF 2014 frame.

  7. SLR and GPS spatial techniques in ITRF. Argentine results.

    Science.gov (United States)

    Actis, Eloy Vicente; Huang, Dongping; Márquez, Raúl; Adarvez, Sonia; Flores, Matías; Brizuela, Diego; Nievas, Jesica; Podestá, Ricardo; Pacheco, Ana M.; Rojas, Hernán Alvis; Yin, Zhiqiang; Li, Jinzeng; Han, Yanben; Liu, Weidong; Wang, Rui

    2012-08-01

    Along the late 30 years spatial geodetic techniques enable us to measure horizontal and vertical deformations of the Earth’s surface with a very high precision. Performing this task we made Satellite Laser Ranging (SLR), and Global Positioning System (GPS) observations in South America ILRS 7406 Station placed at Observatorio Astronómico Félix Aguilar (OAFA) in San Juan, Argentina, accomplishing a Cooperation Agreement between CAS - NAOC and OAFA - UNSJ. Trough LAGEOS II Satellite observations we obtain rectangular coordinates of San Juan ILRS Station in the Terrestrial Reference Frame (ITR 2000), standing out that Argentine Station data were included in the late arrangements ITRF given by International Earth Rotation and Reference System Service (IERS). Spatial and temporary variations of the epoch 2010 - 2011 were evaluated finding out remarkable displacements, of about a half meter, related with seismic events on the region. We confirm these deformations by means of GP S determinations referred to Permanent GPS Station placed nearby the SLR Station.

  8. VLBI and GPS-based Time-Transfer Using CONT08 Data

    Science.gov (United States)

    Rieck, Carsten; Haas, Ruediger; Jaldehag, Kenneth; Jahansson, Jan

    2010-01-01

    One important prerequisite for geodetic Very Long Baseline Interferometry (VLBI) is the use of frequency standards with excellent short term stability. This makes VLBI stations, which are often co-located with Global Navigation Satellite System (GNSS) receiving stations, interesting for studies of time- and frequency-transfer techniques. We present an assessment of VLBI time-transfer based on the data of the two week long consecutive IVS CONT08 VLBI campaign by using GPS Carrier Phase (GPSCP). CONT08 was a 15 day long campaign in August 2008 that involved eleven VLBI stations on five continents. For CONT08 we estimated the worst case VLBI frequency link stability between the stations of Onsala and Wettzell to 1e-15 at one day. Comparisons with GPSCP confirm the VLBI results. We also identify time-transfer related challenges of the VLBI technique as used today.

  9. Ten years of SLR production in Argentina

    Science.gov (United States)

    Pacheco, A.; Podestá, R.; Yin, Z.; Liu, W.; Actis, E.; Adarvez, S.; Quinteros, J.; Podestá, F.

    2017-07-01

    SLR technique is a proved astro-geodetic art with a significant power to contribute to Earth and Space Sciences. Therefore, scientific applications of SLR System are able to perform multiple tasks in the fields of Astrometry, Geodesy and Geophysics. The results we show here were obtained from satellite observations made at SLR 7406 Station of Observatorio Astronómico Félix Aguilar (OAFA) in San Juan, Argentina. The telescope was installed early on 2006, in concordance with an International Cooperation Agreement between Universidad Nacional de San Juan, Argentina and Chinese Academy of Sciences. In this abstract we show the current research being done with ILRS 7406 station: Length of day (LOD) and Angular velocity of Earth Rotation, calculated weekly; Pole Motion. ILRS7406 is daily surveying Pole coordinates x and y; Tracking SLR to GNSS constellations. SLR System contributes to the adjustment and validation of satellite GALILEO, GPS, GLONASS, and BEIDOU orbits. Our station is nowadays member of the new ITRF 2014 frame, and these past years has been one of the 3 highest producing SLR Stations on the ILRS net, composed of about 40 stations distributed all around the world. The obtained results during this first 10 years of experience are useful to enhance the traditional collaboration between OAFA and international services such as ILRS, IERS and NASA.

  10. Co-location satellite GPS and SLR geodetic techniques at the Felix Aguilar Astronomical Observatory of San Juan, Argentina

    Science.gov (United States)

    Podestá, R.; Pacheco, A. M.; Alvis Rojas, H.; Quinteros, J.; Podestá, F.; Albornoz, E.; Navarro, A.; Luna, M.

    2018-01-01

    This work shows the strategy followed for the co-location of the Satellite Laser Ranging (SLR) ILRS 7406 telescope and the antenna of the permanent Global Positioning System (GPS) station, located at the Félix Aguilar Astronomical Observatory (OAFA) in San Juan, Argentina. The accomplishment of the co-location consisted in the design, construction, measurement, adjustment and compensation of a geodesic net between the stations SLR and GPS, securing support points solidly built in the soil. The co-location allows the coordinates of the station to be obtained by combining the data of both SLR and GPS techniques, achieving a greater degree of accuracy than individually. The International Earth Rotation and Reference Systems Service (IERS) considers the co-located stations as the most valuable and important points for the maintenance of terrestrial reference systems and their connection with the celestial ones. The 3 mm precision required by the IERS has been successfully achieved.

  11. Measuring Two Decades of Ice Mass Loss using GRACE and SLR

    Science.gov (United States)

    Bonin, J. A.; Chambers, D. P.

    2016-12-01

    We use Satellite Laser Ranging (SLR) to extend the time series of ice mass change back in time to 1994. The SLR series is of far lesser spatial resolution than GRACE, so we apply a constrained inversion technique to better localize the signal. We approximate the likely errors due to SLR's measurement errors combined with the inversion errors from using a low-resolution series, then estimate the interannual mass change over Greenland and Antarctica.

  12. ERP Estimation using a Kalman Filter in VLBI

    Science.gov (United States)

    Karbon, M.; Soja, B.; Nilsson, T.; Heinkelmann, R.; Liu, L.; Lu, C.; Mora-Diaz, J. A.; Raposo-Pulido, V.; Xu, M.; Schuh, H.

    2014-12-01

    Geodetic Very Long Baseline Interferometry (VLBI) is one of the primary space geodetic techniques, providing the full set of Earth Orientation Parameters (EOP), and it is unique for observing long term Universal Time (UT1). For applications such as satellite-based navigation and positioning, accurate and continuous ERP obtained in near real-time are essential. They also allow the precise tracking of interplanetary spacecraft. One of the goals of VGOS (VLBI Global Observing System) is to provide such near real-time ERP. With the launch of this next generation VLBI system, the International VLBI Service for Geodesy and Astrometry (IVS) increased its efforts not only to reach 1 mm accuracy on a global scale but also to reduce the time span between the collection of VLBI observations and the availability of the final results substantially. Project VLBI-ART contributes to these objectives by implementing an elaborate Kalman filter, which represents a perfect tool for analyzing VLBI data in quasi real-time. The goal is to implement it in the GFZ version of the Vienna VLBI Software (VieVS) as a completely automated tool, i.e., with no need for human interaction. Here we present the methodology and first results of Kalman filtered EOP from VLBI data.

  13. International VLBI Service for Geodesy and Astrometry 2014 Annual Report

    Science.gov (United States)

    Baver, Karen D. (Editor); Behrend, Dirk (Editor); Armstrong, Kyla L. (Editor)

    2015-01-01

    IVS is an international collaboration of organizations which operate or support Very Long Baseline Interferometry (VLBI) components. The goals are: 1. To provide a service to support geodetic, geophysical and astrometric research and operational activities. 2. To promote research and development activities in all aspects of the geodetic and astrometric VLBI technique. 3. To interact with the community of users of VLBI products and to integrate VLBI into a global Earth observing system.

  14. Multi-technique approach for deriving a VLBI signal extra-path variation model induced by gravity: the example of Medicina

    Science.gov (United States)

    Sarti, P.; Abbondanza, C.; Negusini, M.; Vittuari, L.

    2009-09-01

    During the measurement sessions gravity might induce significant deformations in large VLBI telescopes. If neglected or mismodelled, these deformations might bias the phase of the incoming signal thus corrupting the estimate of some crucial geodetic parameters (e.g. the height component of VLBI Reference Point). This paper describes a multi-technique approach implemented for measuring and quantifying the gravity-dependent deformations experienced by the 32-m diameter VLBI antenna of Medicina (Northern Italy). Such an approach integrates three different methods: Terrestrial Triangulations and Trilaterations (TTT), Laser Scanning (LS) and a Finite Element Model (FEM) of the antenna. The combination of the observations performed with these methods allows to accurately define an elevation-dependent model of the signal path variation which appears to be, for the Medicina telescope, non negligible. In the range [0,90] deg the signal path increases monotonically by almost 2 cm. The effect of such a variation has not been introduced in actual VLBI analysis yet; nevertheless this is the task we are going to pursue in the very next future.

  15. VLBI FOR GRAVITY PROBE B. IV. A NEW ASTROMETRIC ANALYSIS TECHNIQUE AND A COMPARISON WITH RESULTS FROM OTHER TECHNIQUES

    International Nuclear Information System (INIS)

    Lebach, D. E.; Ratner, M. I.; Shapiro, I. I.; Bartel, N.; Bietenholz, M. F.; Lederman, J. I.; Ransom, R. R.; Campbell, R. M.; Gordon, D.; Lestrade, J.-F.

    2012-01-01

    When very long baseline interferometry (VLBI) observations are used to determine the position or motion of a radio source relative to reference sources nearby on the sky, the astrometric information is usually obtained via (1) phase-referenced maps or (2) parametric model fits to measured fringe phases or multiband delays. In this paper, we describe a 'merged' analysis technique which combines some of the most important advantages of these other two approaches. In particular, our merged technique combines the superior model-correction capabilities of parametric model fits with the ability of phase-referenced maps to yield astrometric measurements of sources that are too weak to be used in parametric model fits. We compare the results from this merged technique with the results from phase-referenced maps and from parametric model fits in the analysis of astrometric VLBI observations of the radio-bright star IM Pegasi (HR 8703) and the radio source B2252+172 nearby on the sky. In these studies we use central-core components of radio sources 3C 454.3 and B2250+194 as our positional references. We obtain astrometric results for IM Peg with our merged technique even when the source is too weak to be used in parametric model fits, and we find that our merged technique yields astrometric results superior to the phase-referenced mapping technique. We used our merged technique to estimate the proper motion and other astrometric parameters of IM Peg in support of the NASA/Stanford Gravity Probe B mission.

  16. Development of a New VLBI Data Analysis Software

    Science.gov (United States)

    Bolotin, Sergei; Gipson, John M.; MacMillan, Daniel S.

    2010-01-01

    We present an overview of a new VLBI analysis software under development at NASA GSFC. The new software will replace CALC/SOLVE and many related utility programs. It will have the capabilities of the current system as well as incorporate new models and data analysis techniques. In this paper we give a conceptual overview of the new software. We formulate the main goals of the software. The software should be flexible and modular to implement models and estimation techniques that currently exist or will appear in future. On the other hand it should be reliable and possess production quality for processing standard VLBI sessions. Also, it needs to be capable of processing observations from a fully deployed network of VLBI2010 stations in a reasonable time. We describe the software development process and outline the software architecture.

  17. VLBI Technology Development at SHAO

    Science.gov (United States)

    Zhang, Xiuzhong; Shu, Fengchun; Xiang, Ying; Zhu, Renjie; Xu, Zhijun; Chen, Zhong; Zheng, Weimin; Luo, Jintao; Wu, Yajun

    2010-01-01

    VLBI technology development made significant progress at SHAO in the last few years. The development status of the Chinese DBBC, the software and FPGA-based correlators, and the new VLBI antenna, as well as VLBI applications are summarized in this paper.

  18. Uses of the ICRF and implications for future VLBI

    Science.gov (United States)

    Ma, Chopo

    2006-01-01

    Since its inception on 1 Jan 1998, the fundamental ICRF has been set by the VLBI positions of 212 "defining" extragalactic radio sources. In all there are approx.3000 sources with usefully accurate (< few mas) positions consistent with the ICRF. The uses of the ICRF include fundamental astrometry, monitoring of Earth orientation, and spacecraft navigation. For fundamental astrometry, stability and accuracy are most important, and realizations at different frequencies must be in proper registration. However, there is no preferred frequency, and the GAIA mission has the potential for an optical ICRF with 500,000 objects at the 50 microarcsec level some time after the planned 2011 launch. The radio ICRF should be properly prepared for a transition to assure long term stability and consistency. Earth orientation monitoring requires objects attached to the solid Earth, and VLBI will continue to be the fundamental technique. For this purpose it is essential that the new VLBI stations contemplated in the VLBI20l0 report be capable of observing a sufficiently large and well-distributed set of stable sources, and identifying these sources is an on-going effort. Spacecraft navigation by differential VLBI is planned using the Ka-band telemetry signal, and work has begun towards an ICRF realization suitable for this purpose. The balancing of different needs related to the VLBI ICRF will be discussed.

  19. Design of VLBI Array in South America

    Science.gov (United States)

    Carrara, E. A.; Abraham, Z.

    1990-11-01

    RESUMEN. Estudiamos la localizaci6n 6ptima de estaciones de \\ ras' en territorlo brasileno. Con una red VLBI de estaciones reales y ficti- cias simulamos observaciones. Se usan los datos generados de estps ex- perimentos para obtener Ia distribuci6n de brillo de radiofuentes fic- ticias por medlo de tecaicas de mapeo bIbrido. Se concluye que l mejor localizaci6n de estacionee'VLBI futuras, tomando en cuenta las estacio- nes de EUA y de Europa, se encuentra en el Norte-Noreste de razll. El analisis de los datos se hizo con los programas de CALTECH, los cuales estan instalados en una computadora VAX del Departamento de Astronomla del Instituto Astron6mico y Geoflsico de la Universidad de Sa"'o Paulo. ABSTRACT: In this work we study the optimum localization for future VLBI stations in the Brazilian territory. With a VLBI network of real and fictitious stations we make simulations of observations. The data generated in these experiments are used to obtain brightness distribution of a fictitious radio source by the hybrid mapping techniques. We conclude that the best localization of a future VLBI station taking into account the addition of US and European Stations, is roughly in North-Northeast sites in Brazil. The analysis of the data is made with the software of CALTECH, which is installed in the VAX computer of the Astronomy Department of Instituto e Geofisico - USP. Key `{` : INSTRUMENTS - INTERFEROMETRY

  20. Future global SLR network evolution and its impact on the terrestrial reference frame

    Science.gov (United States)

    Kehm, Alexander; Bloßfeld, Mathis; Pavlis, Erricos C.; Seitz, Florian

    2018-06-01

    Satellite laser ranging (SLR) is an important technique that contributes to the determination of terrestrial geodetic reference frames, especially to the realization of the origin and the scale of global networks. One of the major limiting factors of SLR-derived reference frame realizations is the datum accuracy which significantly suffers from the current global SLR station distribution. In this paper, the impact of a potential future development of the SLR network on the estimated datum parameters is investigated. The current status of the SLR network is compared to a simulated potential future network featuring additional stations improving the global network geometry. In addition, possible technical advancements resulting in a higher amount of observations are taken into account as well. As a result, we find that the network improvement causes a decrease in the scatter of the network translation parameters of up to 24%, and up to 20% for the scale, whereas the technological improvement causes a reduction in the scatter of up to 27% for the translations and up to 49% for the scale. The Earth orientation parameters benefit by up to 15% from both effects.

  1. Supernova VLBI

    Science.gov (United States)

    Bartel, N.

    2009-08-01

    We review VLBI observations of supernovae over the last quarter century and discuss the prospect of imaging future supernovae with space VLBI in the context of VSOP-2. From thousands of discovered supernovae, most of them at cosmological distances, ˜50 have been detected at radio wavelengths, most of them in relatively nearby galaxies. All of the radio supernovae are Type II or Ib/c, which originate from the explosion of massive progenitor stars. Of these, 12 were observed with VLBI and four of them, SN 1979C, SN 1986J, SN 1993J, and SN 1987A, could be imaged in detail, the former three with VLBI. In addition, supernovae or young supernova remnants were discovered at radio wavelengths in highly dust-obscured galaxies, such as M82, Arp 299, and Arp 220, and some of them could also be imaged in detail. Four of the supernovae so far observed were sufficiently bright to be detectable with VSOP-2. With VSOP-2 the expansion of supernovae can be monitored and investigated with unsurpassed angular resolution, starting as early as the time of the supernova's transition from its opaque to transparent stage. Such studies can reveal, in a movie, the aftermath of a supernova explosion shortly after shock break out.

  2. Tropospheric Delay from VLBI and GNSS Measurements

    Science.gov (United States)

    Gubanov, V. S.

    2018-02-01

    Using an updated version of the QUASAR software package developed at the Institute of Applied Astronomy of the Russian Academy of Sciences, we have processed the VLBI observations within the international CONT14 program (May 6-20, 2014), in which a global network of 17 stations was involved (a total of 250 000 observations). The package update concerned the optimization of data structure and the refinement of stochastic models for the random variations in wet tropospheric delay and atomic clock difference. The main goal of this paper is to compare the VLBI determinations of the tropospheric delay with its independent determinations using global navigation satellite systems (GNSS). We show that both these determinations agree well between themselves only in the case of a global analysis of the VLBI observations, where the VLBI station coordinates are also refined, along with the tropospheric delay and the clock synchronization and Earth orientation parameters. If, alternatively, the station coordinates are insufficiently accurate and are not refined from VLBI observations, then it is appropriate not to determine the tropospheric delay from these observations, but to take it from the publicly accessible independent GNSS data. However, this requires that the VLBI and GNSS techniques operate simultaneously at a common observing site. We have established the shortcomings of the universally accepted method of stabilizing the global solution associated with the absence of a criterion for choosing reference stations and radio sources. Two ways of their elimination are proposed: (i) introducing a coordinated list of weight factors for the errors in the coordinates of such stations and sources into the stabilization algorithm and (ii) adopting a coordinated list of stations and sources the refinement of whose coordinates is not required at all for a certain time.

  3. CDDIS_SLR_data

    Data.gov (United States)

    National Aeronautics and Space Administration — In Satellite Laser Ranging (SLR), a short pulse of coherent light generated by a laser (Light Amplification by Stimulated Emission of Radiation) is transmitted in a...

  4. The "Quasar" Network Observations in e-VLBI Mode Within the Russian Domestic VLBI Programs

    Science.gov (United States)

    Finkelstein, Andrey; Ipatov, Alexander; Kaidanovsky, Michael; Bezrukov, Ilia; Mikhailov, Andrey; Salnikov, Alexander; Surkis, Igor; Skurikhina, Elena

    2010-01-01

    The purpose of the Russian VLBI "Quasar" Network is to carry out astrometrical and geodynamical investigations. Since 2006 purely domestic observational programs with data processing at the IAA correlator have been carried out. To maintain these geodynamical programs e-VLBI technology is being developed and tested. This paper describes the IAA activity of developing a real-time VLBI system using high-speed digital communication links.

  5. Simulations of VLBI observations of a geodetic satellite providing co-location in space

    Science.gov (United States)

    Anderson, James M.; Beyerle, Georg; Glaser, Susanne; Liu, Li; Männel, Benjamin; Nilsson, Tobias; Heinkelmann, Robert; Schuh, Harald

    2018-02-01

    We performed Monte Carlo simulations of very-long-baseline interferometry (VLBI) observations of Earth-orbiting satellites incorporating co-located space-geodetic instruments in order to study how well the VLBI frame and the spacecraft frame can be tied using such measurements. We simulated observations of spacecraft by VLBI observations, time-of-flight (TOF) measurements using a time-encoded signal in the spacecraft transmission, similar in concept to precise point positioning, and differential VLBI (D-VLBI) observations using angularly nearby quasar calibrators to compare their relative performance. We used the proposed European Geodetic Reference Antenna in Space (E-GRASP) mission as an initial test case for our software. We found that the standard VLBI technique is limited, in part, by the present lack of knowledge of the absolute offset of VLBI time to Coordinated Universal Time at the level of microseconds. TOF measurements are better able to overcome this problem and provide frame ties with uncertainties in translation and scale nearly a factor of three smaller than those yielded from VLBI measurements. If the absolute time offset issue can be resolved by external means, the VLBI results can be significantly improved and can come close to providing 1 mm accuracy in the frame tie parameters. D-VLBI observations with optimum performance assumptions provide roughly a factor of two higher uncertainties for the E-GRASP orbit. We additionally simulated how station and spacecraft position offsets affect the frame tie performance.

  6. VLBI TRF Combination Using GNSS Software

    Directory of Open Access Journals (Sweden)

    Younghee Kwak

    2013-12-01

    Full Text Available Space geodetic techniques can be used to obtain precise shape and rotation information of the Earth. To achieve this, the representative combination solution of each space geodetic technique has to be produced, and then those solutions need to be combined. In this study, the representative combination solution of very long baseline interferometry (VLBI, which is one of the space geodetic techniques, was produced, and the variations in the position coordinate of each station during 7 years were analyzed. Products from five analysis centers of the International VLBI Service for Geodesy and Astrometry (IVS were used as the input data, and Bernese 5.0, which is the global navigation satellite system (GNSS data processing software, was used. The analysis of the coordinate time series for the 43 VLBI stations indicated that the latitude component error was about 15.6 mm, the longitude component error was about 37.7 mm, and the height component error was about 30.9 mm, with respect to the reference frame, International Terrestrial Reference Frame 2008 (ITRF2008. The velocity vector of the 42 stations excluding the YEBES station showed a magnitude difference of 7.3 mm/yr (30.2% and a direction difference of 13.8° (3.8%, with respect to ITRF2008. Among these, the 10 stations in Europe showed a magnitude difference of 7.8 mm/yr (30.3% and a direction difference of 3.7° (1.0%, while the 14 stations in North America showed a magnitude difference of 2.7 mm/yr (15.8% and a direction difference of 10.3° (2.9%.

  7. Release of the repressive activity of rice DELLA protein SLR1 by gibberellin does not require SLR1 degradation in the gid2 mutant.

    Science.gov (United States)

    Ueguchi-Tanaka, Miyako; Hirano, Ko; Hasegawa, Yasuko; Kitano, Hidemi; Matsuoka, Makoto

    2008-09-01

    The rice (Oryza sativa) DELLA protein SLR1 acts as a repressor of gibberellin (GA) signaling. GA perception by GID1 causes SLR1 protein degradation involving the F-box protein GID2; this triggers GA-associated responses such as shoot elongation and seed germination. In GA-insensitive and GA biosynthesis mutants, SLENDER RICE1 (SLR1) accumulates to high levels, and the severity of dwarfism is usually correlated with the level of SLR1 accumulation. An exception is the GA-insensitive F-box mutant gid2, which shows milder dwarfism than mutants such as gid1 and cps even though it accumulates higher levels of SLR1. The level of SLR1 protein in gid2 was decreased by loss of GID1 function or treatment with a GA biosynthesis inhibitor, and dwarfism was enhanced. Conversely, overproduction of GID1 or treatment with GA(3) increased the SLR1 level in gid2 and reduced dwarfism. These results indicate that derepression of SLR1 repressive activity can be accomplished by GA and GID1 alone and does not require F-box (GID2) function. Evidence for GA signaling without GID2 was also provided by the expression behavior of GA-regulated genes such as GA-20oxidase1, GID1, and SLR1 in the gid2 mutant. Based on these observations, we propose a model for the release of GA suppression that does not require DELLA protein degradation.

  8. Co-location of space geodetic techniques carried out at the Geodetic Observatory Wettzell using a closure in time and a multi-technique reference target

    Science.gov (United States)

    Kodet, J.; Schreiber, K. U.; Eckl, J.; Plötz, C.; Mähler, S.; Schüler, T.; Klügel, T.; Riepl, S.

    2018-01-01

    The quality of the links between the different space geodetic techniques (VLBI, SLR, GNSS and DORIS) is still one of the major limiting factors for the realization of a unique global terrestrial reference frame that is accurate enough to allow the monitoring of the Earth system, i.e., of processes like sea level change, postglacial rebound and silent earthquakes. According to the specifications of the global geodetic observing system of the International Association of Geodesy, such a reference frame should be accurate to 1 mm over decades, with rates of change stable at the level of 0.1 mm/year. The deficiencies arise from inaccurate or incomplete local ties at many fundamental sites as well as from systematic instrumental biases in the individual space geodetic techniques. Frequently repeated surveys, the continuous monitoring of antenna heights and the geometrical mount stability (Lösler et al. in J Geod 90:467-486, 2016. https://doi.org/10.1007/s00190-016-0887-8) have not provided evidence for insufficient antenna stability. Therefore, we have investigated variations in the respective system delays caused by electronic circuits, which is not adequately captured by the calibration process, either because of subtle differences in the circuitry between geodetic measurement and calibration, high temporal variability or because of lacking resolving bandwidth. The measured system delay variations in the electric chain of both VLBI- and SLR systems reach the order of 100 ps, which is equivalent to 3 cm of path length. Most of this variability is usually removed by the calibrations but by far not all. This paper focuses on the development of new technologies and procedures for co-located geodetic instrumentation in order to identify and remove systematic measurement biases within and between the individual measurement techniques. A closed-loop optical time and frequency distribution system and a common inter-technique reference target provide the possibility to remove

  9. Engineering processes for the African VLBI network

    Science.gov (United States)

    Thondikulam, Venkatasubramani L.; Loots, Anita; Gaylard, Michael

    2013-04-01

    The African VLBI Network (AVN) is an initiative by the SKA-SA and HartRAO, business units of the National Research Foundation (NRF), Department of Science and Technology (DST), South Africa. The aim is to fill the existing gap of Very Long Baseline Interferometry (VLBI)-capable radio telescopes in the African continent by a combination of new build as well as conversion of large redundant telecommunication antennas through an Inter-Governmental collaborative programme in Science and Technology. The issue of human capital development in the Continent in the techniques of radio astronomy engineering and science is a strong force to drive the project and is expected to contribute significantly to the success of Square Kilometer Array (SKA) in the Continent.

  10. VLBI Observations of Geostationary Satellites

    Science.gov (United States)

    Artz, T.; Nothnagel, A.; La Porta, L.

    2013-08-01

    For a consistent realization of a Global Geodetic Observing System (GGOS), a proper tie between the individual global reference systems used in the analysis of space-geodetic observations is a prerequisite. For instance, the link between the terrestrial, the celestial and the dynamic reference system of artificial Earth orbiters may be realized by Very Long O Baseline Interferometry (VLBI) observations of one or several satellites. In the preparation phase for a dedicated satellite mission, one option to realize this is using a geostationary (GEO) satellite emitting a radio signal in X-Band and/or S-Band and, thus, imitating a quasar. In this way, the GEO satellite can be observed by VLBI together with nearby quasars and the GEO orbit can, thus, be determined in a celestial reference frame. If the GEO satellite is, e.g., also equipped with a GNSS-type transmitter, a further tie between GNSS and VLBI may be realized. In this paper, a concept for the generation of a radio signal is shown. Furthermore, simulation studies for estimating the GEO position are presented with a GEO satellite included in the VLBI schedule. VLBI group delay observations are then simulated for the quasars as well as for the GEO satellite. The analysis of the simulated observations shows that constant orbit changes are adequately absorbed by estimated orbit parameters. Furthermore, the post-fit residuals are comparable to those from real VLBI sessions.

  11. GNSS-SLR satellite co-location for the estimate of local ties

    Science.gov (United States)

    Bruni, Sara; Zerbini, Susanna; Errico, Maddalena; Santi, Efisio

    2013-04-01

    The current realization of the International Terrestrial Reference Frame (ITRF) is based on four different space-geodetic techniques, so that the benefits brought by each observing system to the definition of the frame can compensate for the drawbacks of the others and technique-specific systematic errors might be identified. The strategy used to combine the observations from the different techniques is then of prominent importance for the realization of a precise and stable reference frame. This study concentrates, in particular, on the combination of Satellite Laser Ranging (SLR) and Global Navigation Satellite System (GNSS) observations by exploiting satellite co-locations. This innovative approach is based on the fact that laser tracking of GNSS satellites, carrying on board laser reflector arrays, allows for the combination of optical and microwave signals in the determination of the spacecraft orbit. Besides, the use of satellite co-locations differs quite significantly from the traditional combination method in which each single technique solution is carried out autonomously and is interrelated in a second step. One of the benefits of the approach adopted in this study is that it allows for an independent validation of the local tie, i.e. of the vector connecting the SLR and GNSS reference points in a multi-techniques station. Typically, local ties are expressed by a single value, measured with ground-based geodetic techniques and taken as constant. In principle, however, local ties might show time variations likely caused by the different monumentation characteristics of the GNSS antennas with respect to those of a SLR system. This study evaluates the possibility of using the satellite co-location approach to generate local-ties time series by means of observations available for a selected network of ILRS stations. The data analyzed in this study were acquired as part of the NASA's Earth Science Data Systems and are archived and distributed by the Crustal

  12. Using an SLR inversion to measure the mass balance of Greenland before and during GRACE

    Science.gov (United States)

    Bonin, Jennifer

    2016-04-01

    The GRACE mission has done an admirable job of measuring large-scale mass changes over Greenland since its launch in 2002. However before that time, measurements of large-scale ice mass balance were few and far between, leading to a lack of baseline knowledge. High-quality Satellite Laser Ranging (SLR) data existed a decade earlier, but normally has too low a spatial resolution to be used for this purpose. I demonstrate that a least squares inversion technique can reconstitute the SLR data and use it to measure ice loss over Greenland. To do so, I first simulate the problem by degrading today's GRACE data to a level comparable with SLR, then demonstrating that the inversion can re-localize Greenland's contribution to the low-resolution signal, giving an accurate time series of mass change over all of Greenland which compares well with the full-resolution GRACE estimates. I then utilize that method on the actual SLR data, resulting in an independent 1994-2014 time series of mass change over Greenland. I find favorable agreement between the pure-SLR inverted results and the 2012 Ice-sheet Mass Balance Inter-comparison Exercise (IMBIE) results, which are largely based on the "input-output" modeling method before GRACE's launch.

  13. Contribution of Multi-GNSS Constellation to SLR-Derived Terrestrial Reference Frame

    Science.gov (United States)

    Sośnica, K.; Bury, G.; Zajdel, R.

    2018-03-01

    All satellites of new Global Navigation Satellite Systems (GNSS) are equipped with laser retroreflectors dedicated to Satellite Laser Ranging (SLR). This paper demonstrates the contribution of SLR tracking of multi-GNSS constellations to the improved SLR-derived reference frame and scientific products. We show a solution strategy with estimating satellite orbits, SLR station coordinates, geocenter coordinates, and Earth rotation parameters using SLR observations to 2 Laser Geodynamics Satellites (LAGEOS) and 55 GNSS satellites: 1 GPS, 31 Globalnaya Navigatsionnaya Sputnikovaya Sistema, 18 Galileo, 3 BeiDou Inclined Geosynchronous Orbit, 1 BeiDou Medium Earth Orbit, and 1 Quasi-Zenith Satellite System satellite for the period 2014.0-2017.4. Due to a substantial number of GNSS observations, the number of weekly solutions for some SLR stations, for example, Arkhyz, Komsomolsk, Altay, and Brasilia, is larger up to 41% in the combined LAGEOS + GNSS solution when compared to the LAGEOS-only solution. The SLR observations to GNSS can transfer the orientation of the reference frame from GNSS to SLR solutions. As a result, the SLR-derived pole coordinates and length-of-day estimates become more consistent with GNSS microwave-based results. The root-mean-square errors of length-of-day are reduced from 122.5 μs/d to 43.0 μs/d, whereas mean offsets are reduced from -81.6 μs/d to 0.5 μs/d in LAGEOS only and in the combined LAGEOS + GNSS solutions, respectively.

  14. LOD First Estimates In 7406 SLR San Juan Argentina Station

    Science.gov (United States)

    Pacheco, A.; Podestá, R.; Yin, Z.; Adarvez, S.; Liu, W.; Zhao, L.; Alvis Rojas, H.; Actis, E.; Quinteros, J.; Alacoria, J.

    2015-10-01

    In this paper we show results derived from satellite observations at the San Juan SLR station of Felix Aguilar Astronomical Observatory (OAFA). The Satellite Laser Ranging (SLR) telescope was installed in early 2006, in accordance with an international cooperation agreement between the San Juan National University (UNSJ) and the Chinese Academy of Sciences (CAS). The SLR has been in successful operation since 2011 using NAOC SLR software for the data processing. This program was designed to calculate satellite orbits and station coordinates, however it was used in this work for the determination of LOD (Length Of Day) time series and Earth Rotation speed.

  15. Vienna VLBI and Satellite Software (VieVS) for Geodesy and Astrometry

    Science.gov (United States)

    Böhm, Johannes; Böhm, Sigrid; Boisits, Janina; Girdiuk, Anastasiia; Gruber, Jakob; Hellerschmied, Andreas; Krásná, Hana; Landskron, Daniel; Madzak, Matthias; Mayer, David; McCallum, Jamie; McCallum, Lucia; Schartner, Matthias; Teke, Kamil

    2018-04-01

    The Vienna VLBI and Satellite Software (VieVS) is state-of-the-art Very Long Baseline Interferometry (VLBI) analysis software for geodesy and astrometry. VieVS has been developed at Technische Universität Wien (TU Wien) since 2008, where it is used for research purposes and for teaching space geodetic techniques. In the past decade, it has been successfully applied on Very Long Baseline Interferometry (VLBI) observations for the determination of celestial and terrestrial reference frames as well as for the estimation of celestial pole offsets, universal Time (UT1-UTC), and polar motion based on least-squares adjustment. Furthermore, VieVS is equipped with tools for scheduling and simulating VLBI observations to extragalactic radio sources as well as to satellites and spacecraft, features which proved to be very useful for a variety of applications. VieVS is now available as version 3.0 and we do provide the software to all interested persons and institutions. A wiki with more information about VieVS is available at http://vievswiki.geo.tuwien.ac.at/.

  16. Refined discrete and empirical horizontal gradients in VLBI analysis

    Science.gov (United States)

    Landskron, Daniel; Böhm, Johannes

    2018-02-01

    Missing or incorrect consideration of azimuthal asymmetry of troposphere delays is a considerable error source in space geodetic techniques such as Global Navigation Satellite Systems (GNSS) or Very Long Baseline Interferometry (VLBI). So-called horizontal troposphere gradients are generally utilized for modeling such azimuthal variations and are particularly required for observations at low elevation angles. Apart from estimating the gradients within the data analysis, which has become common practice in space geodetic techniques, there is also the possibility to determine the gradients beforehand from different data sources than the actual observations. Using ray-tracing through Numerical Weather Models (NWMs), we determined discrete gradient values referred to as GRAD for VLBI observations, based on the standard gradient model by Chen and Herring (J Geophys Res 102(B9):20489-20502, 1997. https://doi.org/10.1029/97JB01739) and also for new, higher-order gradient models. These gradients are produced on the same data basis as the Vienna Mapping Functions 3 (VMF3) (Landskron and Böhm in J Geod, 2017.https://doi.org/10.1007/s00190-017-1066-2), so they can also be regarded as the VMF3 gradients as they are fully consistent with each other. From VLBI analyses of the Vienna VLBI and Satellite Software (VieVS), it becomes evident that baseline length repeatabilities (BLRs) are improved on average by 5% when using a priori gradients GRAD instead of estimating the gradients. The reason for this improvement is that the gradient estimation yields poor results for VLBI sessions with a small number of observations, while the GRAD a priori gradients are unaffected from this. We also developed a new empirical gradient model applicable for any time and location on Earth, which is included in the Global Pressure and Temperature 3 (GPT3) model. Although being able to describe only the systematic component of azimuthal asymmetry and no short-term variations at all, even these

  17. Hartebeesthoek Radio Astronomy Observatory (HartRAO)

    Science.gov (United States)

    Nickola, Marisa; Gaylard, Mike; Quick, Jonathan; Combrinck, Ludwig

    2013-01-01

    HartRAO provides the only fiducial geodetic site in Africa, and it participates in global networks for VLBI, GNSS, SLR, and DORIS. This report provides an overview of geodetic VLBI activities at HartRAO during 2012, including the conversion of a 15-m alt-az radio telescope to an operational geodetic VLBI antenna.

  18. The AUSTRAL VLBI observing program

    Science.gov (United States)

    Plank, L.; Lovell, J. E. J.; McCallum, J. N.; Mayer, D.; Reynolds, C.; Quick, J.; Weston, S.; Titov, O.; Shabala, S. S.; Böhm, J.; Natusch, T.; Nickola, M.; Gulyaev, S.

    2017-07-01

    The AUSTRAL observing program was started in 2011, performing geodetic and astrometric very long baseline interferometry (VLBI) sessions using the new Australian AuScope VLBI antennas at Hobart, Katherine, and Yarragadee, with contribution from the Warkworth (New Zealand) 12 m and Hartebeesthoek (South Africa) 15 m antennas to make a southern hemisphere array of telescopes with similar design and capability. Designed in the style of the next-generation VLBI system, these small and fast antennas allow for a new way of observing, comprising higher data rates and more observations than the standard observing sessions coordinated by the International VLBI Service for Geodesy and Astrometry (IVS). In this contribution, the continuous development of the AUSTRAL sessions is described, leading to an improvement of the results in terms of baseline length repeatabilities by a factor of two since the start of this program. The focus is on the scheduling strategy and increased number of observations, aspects of automated operation, and data logistics, as well as results of the 151 AUSTRAL sessions performed so far. The high number of the AUSTRAL sessions makes them an important contributor to VLBI end-products, such as the terrestrial and celestial reference frames and Earth orientation parameters. We compare AUSTRAL results with other IVS sessions and discuss their suitability for the determination of baselines, station coordinates, source coordinates, and Earth orientation parameters.

  19. Estimation of solid earth tidal parameters and FCN with VLBI

    International Nuclear Information System (INIS)

    Krásná, H.

    2012-01-01

    Measurements of a space-geodetic technique VLBI (Very Long Baseline Interferometry) are influenced by a variety of processes which have to be modelled and put as a priori information into the analysis of the space-geodetic data. The increasing accuracy of the VLBI measurements allows access to these parameters and provides possibilities to validate them directly from the measured data. The gravitational attraction of the Moon and the Sun causes deformation of the Earth's surface which can reach several decimetres in radial direction during a day. The displacement is a function of the so-called Love and Shida numbers. Due to the present accuracy of the VLBI measurements the parameters have to be specified as complex numbers, where the imaginary parts describe the anelasticity of the Earth's mantle. Moreover, it is necessary to distinguish between the single tides within the various frequency bands. In this thesis, complex Love and Shida numbers of twelve diurnal and five long-period tides included in the solid Earth tidal displacement modelling are estimated directly from the 27 years of VLBI measurements (1984.0 - 2011.0). In this work, the period of the Free Core Nutation (FCN) is estimated which shows up in the frequency dependent solid Earth tidal displacement as well as in a nutation model describing the motion of the Earth's axis in space. The FCN period in both models is treated as a single parameter and it is estimated in a rigorous global adjustment of the VLBI data. The obtained value of -431.18 ± 0.10 sidereal days differs slightly from the conventional value -431.39 sidereal days given in IERS Conventions 2010. An empirical FCN model based on variable amplitude and phase is determined, whose parameters are estimated in yearly steps directly within VLBI global solutions. (author) [de

  20. Supernova research with VLBI

    Science.gov (United States)

    Bartel, Norbert; Bietenholz, Michael F.

    2016-06-01

    Core-collapse supernovae have been monitored with VLBI from shortly after the explosion to many years thereafter. Radio emission is produced as the ejecta hit the stellar wind left over from the dyingstar. Images show the details of the interaction as the shock front expands into the circumstellar medium. Measurements of the velocity and deceleration of the expansion provide information on both the ejecta and the circumstellar medium. VLBI observations can also search for the stellar remnant of the explosion, a neutron star or a black hole. Combining the transverse expansion rate with the radial expansion rate from optical spectra allows a geometric determination of the distance to the host galaxy. We will present results from recent VLBI observations, focus on their interpretations, and show updated movies of supernovae from soon after their explosion to the present.

  1. Comparison of long-term SLR and GNSS solutions from selected stations in the frame of GGOS realization

    Science.gov (United States)

    Szafranek, K.; Schillak, S.; Araszkiewicz, A.; Figurski, M.; Lehmann, M.; Lejba, P.

    2012-04-01

    Up-to-date investigations concerning space geodesy are mostly aimed at data of various techniques joint processing. The poster presents solutions (North, East, Up components) of selected stations (McDonald, Yarragadee, Greenbelt, Monument Peak, Zimmerwald, Borowiec, Mt.Stromlo-Orroral, Potsdam, Graz, Herstmonceux and Wettzell), which adopted Satellite Laser Ranging (SLR) and Global Navigation Satellite System (GNSS) techniques and which were gathering the data in the same time (from 1994 to 2010). Processing of both types of data was made according to Global Geodetic Observing System (GGOS) recommendations, the same models and parameters from IERS Conventions 2010 were used in both processing strategies (if it was possible). The main goal was to obtain coordinates and their changes in time (velocities) basing on both techniques and to compare the results. The station coordinates were determined for the common reference epoch of both techniques - for first day of each month. Monthly orbital arcs for laser observations were created basing on solutions from several SLR sites (observations to LAGEOS-1 and LAGEOS-2 satellites) with the best solutions quality and the highest amount of observations. For GNSS coordinates determination about 130 sites belonging to International GNSS Service (IGS) were selected: 30 with local ties to SLR sites and others basing on their geolocalization (length of the baselines) and solutions time series analysis. Mainly, core IGS stations were used. Solutions of both techniques were analyzed in order to verify agreement of both techniques and for independent control of local ties.

  2. Rigorous Combination of GNSS and VLBI: How it Improves Earth Orientation and Reference Frames

    Science.gov (United States)

    Lambert, S. B.; Richard, J. Y.; Bizouard, C.; Becker, O.

    2017-12-01

    Current reference series (C04) of the International Earth Rotation and Reference Systems Service (IERS) are produced by a weighted combination of Earth orientation parameters (EOP) time series built up by combination centers of each technique (VLBI, GNSS, Laser ranging, DORIS). In the future, we plan to derive EOP from a rigorous combination of the normal equation systems of the four techniques.We present here the results of a rigorous combination of VLBI and GNSS pre-reduced, constraint-free, normal equations with the DYNAMO geodetic analysis software package developed and maintained by the French GRGS (Groupe de Recherche en GeÌodeÌsie Spatiale). The used normal equations are those produced separately by the IVS and IGS combination centers to which we apply our own minimal constraints.We address the usefulness of such a method with respect to the classical, a posteriori, combination method, and we show whether EOP determinations are improved.Especially, we implement external validations of the EOP series based on comparison with geophysical excitation and examination of the covariance matrices. Finally, we address the potential of the technique for the next generation celestial reference frames, which are currently determined by VLBI only.

  3. Absorption and emission spectroscopic characterization of blue-light receptor Slr1694 from Synechocystis sp. PCC6803.

    Science.gov (United States)

    Zirak, P; Penzkofer, A; Lehmpfuhl, C; Mathes, T; Hegemann, P

    2007-01-03

    The BLUF protein Slr1694 from the cyanobacterium Synechocystis sp. PCC6803 is characterized by absorption and emission spectroscopy. Slr1694 expressed from E. coli which non-covalently binds FAD, FMN, and riboflavin (called Slr1694(I)), and reconstituted Slr1694 which dominantly contains FAD (called Slr1694(II)) are investigated. The receptor conformation of Slr1694 (dark adapted form Slr1694(r)) is transformed to the putative signalling state (light adapted form Slr1694(s)) with red-shifted absorption and decreased fluorescence efficiency by blue-light excitation. In the dark at 22 degrees C, the signalling state recovers back to the initial receptor state with a time constants of about 14.2s for Slr1694(I) and 17s for Slr1694(II). Quantum yields of signalling state formation of approximately 0.63+/-0.07 for both Slr1694(I) and Slr1694(II) were determined by transient transmission measurements and intensity dependent steady-state transmission measurements. Extended blue-light excitation causes some bound flavin conversion to the hydroquinone form and some photo-degradation, both with low quantum efficiency. The flavin-hydroquinone re-oxidizes slowly back (time constant 5-9 min) to the initial flavoquinone form in the dark. A photo-cycle dynamics scheme is presented.

  4. 集胞藻PCC6803基因slr2049定点突变及其体内重组功能研究%Site-directed mutation of the gene slr2049 from Synechocy-stis sp.PCC 6803 and the study on the function

    Institute of Scientific and Technical Information of China (English)

    朱超; 陈思礼

    2013-01-01

    在Synechocystis sp.PCC 6803中找到与cpeS具有高度同源性的基因slr2049.采用PCR从Synechocystis sp.PCC 6803 DNA中扩增出cpcB,slr2049,hol,pcyA 4个基因;定点突变试剂盒构建8个突变体slr2049 (H21S)、slr2049 (L23S)、slr2049 (A24S)、slr2049 (F25S)、slr2049(W72L)、slr2049(G84S)、slr2049(R107S)和slr2049(Y124S);将它们与表达载体pCDFDuet-1和pET-23a(+)相连构建pCDF-cpcB-slr2049野生型和pCDF-cpcB-slr2049突变体以及pET-ho1-pcyA,进行高效表达,用亲和层析柱纯化,产物用SDS-PAGE和光谱检测.研究表明:突变体slr2049(H21S)、slr2049(L23S)、slr2049(F25S)、slr2049 (W72L)、slr2049 (G84S)、slr2049(Y124S)与野生型slr2049催化获得的重组藻蓝蛋白β亚基具有与天然藻蓝蛋白β亚基相似的光谱特性,其他2个突变体slr2049 (A24S)和slr2049(R107S)催化的产物则没有光谱特性.由此推测,第24位丙氨酸和第107位精氨酸可能是slr2049酶活性的必需氨基酸,其所处位置是slr2049的活性位点.%We have found gene slr2049 in Synechocystis sp.PCC 6803 which was homol ogous to the bilin lyase gene cpeS by some softwares for homologous analysis.Four genes were amplifed from DNA of Synechocystis sp.PCC 6803 by PCR.Eight mutants which were slr2049 (H21S),slr2049 (L23S),slr2049 (A24S),slr2049 (F25S),slr2049 (W72L),slr2049(G84S),slr2049(R107S)and sl-r2049(Y124S)were constructed by Mutan BEST Kit.pCDF-cpcB-slr2049,pCDF-cpcB-slr2049 mutants and pET-ho1-pcyA were formed from the linkage of four genes and mutants with pCDFDuet-land pET-23a (+).They were expressed and purified by affinity column.Proteins were detected by SDS-PAGE,absorption and fluorescence spectra.The results showed that phycocyanin β-subunit which had the same spectral characteristic with native phycocyanin β-subunit were catalysed by the protein encoded by gene slr2049 and mutants slr2049 (H21S),slr2049(L23S),slr2049(F25S),slr2049 (W72L),slr2049 (G84S),slr2049 (Y124S).The rest of mutants slr2049(A24S

  5. Astrometry VLBI in Space (AVS)

    Science.gov (United States)

    Cheng, Li-Jen; Reyes, George

    1995-01-01

    This paper describes a proposal for a new space radio astronomy mission for astrometry using Very Long Baseline Interferometry (VLBI) called Astrometry VLBI in Space (AVS). The ultimate goals of AVS are improving the accuracy of radio astrometry measurements to the microarcsecond level in one epoch of measurements and improving the accuracy of the transformation between the inertial radio and optical coordinate reference frames. This study will also assess the impact of this mission on astrophysics astrometry and geophysics.

  6. THE APPLICATION OF MULTIVIEW METHODS FOR HIGH-PRECISION ASTROMETRIC SPACE VLBI AT LOW FREQUENCIES

    Energy Technology Data Exchange (ETDEWEB)

    Dodson, R.; Rioja, M.; Imai, H. [International Centre for Radio Astronomy Research, M468, University of Western Australia, 35 Stirling Hwy, Crawley, Western Australia 6009 (Australia); Asaki, Y. [Institute of Space and Astronautical Science, 3-1-1 Yoshinodai, Chuou, Sagamihara, Kanagawa 252-5210 (Japan); Hong, X.-Y.; Shen, Z., E-mail: richard.dodson@icrar.org [Shanghai Astronomical Observatory, CAS, 200030 Shanghai (China)

    2013-06-15

    High-precision astrometric space very long baseline interferometry (S-VLBI) at the low end of the conventional frequency range, i.e., 20 cm, is a requirement for a number of high-priority science goals. These are headlined by obtaining trigonometric parallax distances to pulsars in pulsar-black hole pairs and OH masers anywhere in the Milky Way and the Magellanic Clouds. We propose a solution for the most difficult technical problems in S-VLBI by the MultiView approach where multiple sources, separated by several degrees on the sky, are observed simultaneously. We simulated a number of challenging S-VLBI configurations, with orbit errors up to 8 m in size and with ionospheric atmospheres consistent with poor conditions. In these simulations we performed MultiView analysis to achieve the required science goals. This approach removes the need for beam switching requiring a Control Moment Gyro, and the space and ground infrastructure required for high-quality orbit reconstruction of a space-based radio telescope. This will dramatically reduce the complexity of S-VLBI missions which implement the phase-referencing technique.

  7. THE APPLICATION OF MULTIVIEW METHODS FOR HIGH-PRECISION ASTROMETRIC SPACE VLBI AT LOW FREQUENCIES

    International Nuclear Information System (INIS)

    Dodson, R.; Rioja, M.; Imai, H.; Asaki, Y.; Hong, X.-Y.; Shen, Z.

    2013-01-01

    High-precision astrometric space very long baseline interferometry (S-VLBI) at the low end of the conventional frequency range, i.e., 20 cm, is a requirement for a number of high-priority science goals. These are headlined by obtaining trigonometric parallax distances to pulsars in pulsar-black hole pairs and OH masers anywhere in the Milky Way and the Magellanic Clouds. We propose a solution for the most difficult technical problems in S-VLBI by the MultiView approach where multiple sources, separated by several degrees on the sky, are observed simultaneously. We simulated a number of challenging S-VLBI configurations, with orbit errors up to 8 m in size and with ionospheric atmospheres consistent with poor conditions. In these simulations we performed MultiView analysis to achieve the required science goals. This approach removes the need for beam switching requiring a Control Moment Gyro, and the space and ground infrastructure required for high-quality orbit reconstruction of a space-based radio telescope. This will dramatically reduce the complexity of S-VLBI missions which implement the phase-referencing technique.

  8. Meter-wavelength VLBI. III. Pulsars

    International Nuclear Information System (INIS)

    Vandenberg, N.R.; Clark, T.A.; Clark, W.C.; Erickson, W.C.; Resch, G.M.; Broderick, J.J.

    1976-01-01

    The results and analysis of observations of pulsars, especially the Crab Nebula pulsar, taken during a series of meter-wavelength very long baseline interferometry (VLBI) experiments are discussed. Based on a crude 144 MHz visibility curve which is consistent with a Gaussian brightness distribution, the measured visibilities at 196, 111, and 74 MHz were interpreted to yield apparent angular diameters (at half-power) of 0 .03 +- 0 .01, 0 .07 +- 0 .01, and 0 .18 +- 0 .01, respectively. These sizes scale approximately as wavelength-squared, and the 74 MHz size agrees with recent observations using interplanetary scintillation techniques.The VLBI-measured total flux densities lie on the extrapolation from higher frequencies of the pulsing flux densities. Variations in the total flux density up to 25 percent were observed. A lack of fine structure other than the pulsar in the nebula is indicated by our simple visibility curves. The pulse shapes observed with the interferometer are similar to single-dish measurements at 196 MHz but reveal a steady, nonpulsing component at 111 MHz. The ratio of pulsing to total power was approximately equal to one-half but varied with time. No pulsing power was detected at 74 MHz. It was found that four strong, low-dispersion pulsars were only slightly resolved

  9. ILRS Activities in Monitoring Systematic Errors in SLR Data

    Science.gov (United States)

    Pavlis, E. C.; Luceri, V.; Kuzmicz-Cieslak, M.; Bianco, G.

    2017-12-01

    The International Laser Ranging Service (ILRS) contributes to ITRF development unique information that only Satellite Laser Ranging—SLR is sensitive to: the definition of the origin, and in equal parts with VLBI, the scale of the model. For the development of ITRF2014, the ILRS analysts adopted a revision of the internal standards and procedures in generating our contribution from the eight ILRS Analysis Centers. The improved results for the ILRS components were reflected in the resulting new time series of the ITRF origin and scale, showing insignificant trends and tighter scatter. This effort was further extended after the release of ITRF2014, with the execution of a Pilot Project (PP) in the 2016-2017 timeframe that demonstrated the robust estimation of persistent systematic errors at the millimeter level. ILRS ASC is now turning this into an operational tool to monitor station performance and to generate a history of systematics at each station, to be used with each re-analysis for future ITRF model developments. This is part of a broader ILRS effort to improve the quality control of the data collection process as well as that of our products. To this end, the ILRS has established a "Quality Control Board—QCB" that comprises of members from the analysis and engineering groups, the Central Bureau, and even user groups with special interests. The QCB meets by telecon monthly and oversees the various ongoing projects, develops ideas for new tools and future products. This presentation will focus on the main topic with an update on the results so far, the schedule for the near future and its operational implementation, along with a brief description of upcoming new ILRS products.

  10. Complex demodulation in VLBI estimation of high frequency Earth rotation components

    Science.gov (United States)

    Böhm, S.; Brzeziński, A.; Schuh, H.

    2012-12-01

    The spectrum of high frequency Earth rotation variations contains strong harmonic signal components mainly excited by ocean tides along with much weaker non-harmonic fluctuations driven by irregular processes like the diurnal thermal tides in the atmosphere and oceans. In order to properly investigate non-harmonic phenomena a representation in time domain is inevitable. We present a method, operating in time domain, which is easily applicable within Earth rotation estimation from Very Long Baseline Interferometry (VLBI). It enables the determination of diurnal and subdiurnal variations, and is still effective with merely diurnal parameter sampling. The features of complex demodulation are used in an extended parameterization of polar motion and universal time which was implemented into a dedicated version of the Vienna VLBI Software VieVS. The functionality of the approach was evaluated by comparing amplitudes and phases of harmonic variations at tidal periods (diurnal/semidiurnal), derived from demodulated Earth rotation parameters (ERP), estimated from hourly resolved VLBI ERP time series and taken from a recently published VLBI ERP model to the terms of the conventional model for ocean tidal effects in Earth rotation recommended by the International Earth Rotation and Reference System Service (IERS). The three sets of tidal terms derived from VLBI observations extensively agree among each other within the three-sigma level of the demodulation approach, which is below 6 μas for polar motion and universal time. They also coincide in terms of differences to the IERS model, where significant deviations primarily for several major tidal terms are apparent. An additional spectral analysis of the as well estimated demodulated ERP series of the ter- and quarterdiurnal frequency bands did not reveal any significant signal structure. The complex demodulation applied in VLBI parameter estimation could be demonstrated a suitable procedure for the reliable reproduction of

  11. The Space Geodesy Project and Radio Frequency Interference Characterization and Mitigation

    Science.gov (United States)

    Lawrence, Hilliard M.; Beaudoin, C.; Corey, B. E.; Tourain, C. L.; Petrachenko, B.; Dickey, John

    2013-01-01

    The Space Geodesy Project (SGP) development by NASA is an effort to co-locate the four international geodetic techniques Satellite Laser Ranging (SLR) and Lunar Laser Ranging (LLR), Very Long Baseline Interferometry (VLBI), Global Navigation Satellite System (GNSS), and Doppler Orbitography and Radiopositioning Integrated by Satellite (DORIS) into one tightly referenced campus and coordinated reference frame analysis. The SGP requirement locates these stations within a small area to maintain line-of-sight and frequent automated survey known as the vector tie system. This causes a direct conflict with the new broadband VLBI technique. Broadband means 2-14 GHz, and RFI susceptibility at -80 dBW or higher due to sensitive RF components in the front end of the radio receiver.

  12. International VLBI Service for Geodesy and Astrometry 2004 Annual Report

    Science.gov (United States)

    Behrend, Dirk (Editor); Baver, Karen D. (Editor)

    2005-01-01

    Contents include the following: Combination Studies using the Cont02 Campaign. Coordinating Center report. Analysis coordinator report. Network coordinator report. IVS Technology coordinator report. Algonquin Radio observatory. Fortaleza Station report for 2004. Gilmore Creek Geophysical Observatory. Goddard Geophysical and Astronomical observatory. Hartebeesthoek Radio Astronomy Observatory (HartRAO). Hbart, Mt Pleasant, station report for 2004. Kashima 34m Radio Telescope. Kashima and Koganei 11-m VLBI Stations. Kokee Park Geophysical Observatory. Matera GGS VLBI Station. The Medicina Station status report. Report of the Mizusawa 10m Telescope. Noto Station Activity. NYAL Ny-Alesund 20 metre Antenna. German Antarctic receiving Station (GARS) O'higgins. The IVS network station Onsala space Observatory. Sheshan VLBI Station report for 2004. 10 Years of Geodetic Experiments at the Simeiz VLBI Station. Svetloe RAdio Astronomical Observatory. JARE Syowa Station 11-m Antenna, Antarctica. Geodetic Observatory TIGO in Concepcion. Tsukuba 32-m VLBI Station. Nanshan VLBI Station Report. Westford Antenna. Fundamental-station Wettzell 20m Radiotelescope. Observatorio Astroonomico Nacional Yebes. Yellowknife Observatory. The Bonn Geodetic VLBI Operation Center. CORE Operation Center Report. U.S. Naval Observatory Operation Center. The Bonn Astro/Geo Mark IV Correlator.

  13. EUPOS and SLR Contribution to GOCE Mission

    Science.gov (United States)

    Balodis, J.; Caunite, M.; Janpaule, I.; Kenyeres, A.; Rubans, A.; Silabriedis, G.; Rosenthal, G.; Zarinsjh, A.; Zvirgzds, J.; Abel, M.

    2010-12-01

    After the interest of geodesists from several East European countries on successful use of SAPOS in Germany the European Position Determination System EUPOS® project has been established at 2002 under the leadership of Gerd Rosenthal, Berlin State Department of Urban Development. Currently the ground based GNSS augmentation system EUPOS® sub-networks has been developed successfully in 17 countries and the wish to join has been expressed by several other countries. EUPOS® is widely used in many practical applications. Two proposals - "EUPOS® Contribution to GOCE Mission" (Id 4307), "GOCE Observations using SLR for LEO satellites" (Id 4333), were submitted to ESA when ESA in autumn 2006 invited research people to submit proposals for GOCE mission applications. The report is presented in this article on the work which has been done in EUPOS® community and at the University of Latvia. During last 3 years the EUPOS® sub- networks has been completed (Poland, Lithuania, Slovakia, Bulgaria, they tied to the National levelling networks, detailed system behaviour has been depicted on the bases of EUPOS®-Riga network. The development of the SLR for LEO satellites is presented. Initially it was developed for GOCE spacecraft positioning. However, SLR till now was able to observe satellites at night.

  14. Russian State Time and Earth Rotation Service: Observations, Eop Series, Prediction

    Science.gov (United States)

    Kaufman, M.; Pasynok, S.

    2010-01-01

    Russian State Time, Frequency and Earth Rotation Service provides the official EOP data and time for use in scientific, technical and metrological works in Russia. The observations of GLONASS and GPS on 30 stations in Russia, and also the Russian and worldwide observations data of VLBI (35 stations) and SLR (20 stations) are used now. To these three series of EOP the data calculated in two other Russian analysis centers are added: IAA (VLBI, GPS and SLR series) and MCC (SLR). Joint processing of these 7 series is carried out every day (the operational EOP data for the last day and the predicted values for 50 days). The EOP values are weekly refined and systematic errors of every individual series are corrected. The combined results become accessible on the VNIIFTRI server (ftp.imvp.ru) approximately at 6h UT daily.

  15. DETECTING FLARING STRUCTURES IN SAGITTARIUS A* WITH HIGH-FREQUENCY VLBI

    International Nuclear Information System (INIS)

    Doeleman, Sheperd S.; Fish, Vincent L.; Rogers, Alan E. E.; Broderick, Avery E.; Loeb, Abraham

    2009-01-01

    The super-massive black hole candidate, Sagittarius A*, exhibits variability from radio to X-ray wavelengths on timescales that correspond to <10 Schwarzschild radii. We survey the potential of millimeter wavelength very long baseline interferometry (VLBI) to detect and constrain time-variable structures that could give rise to such variations, focusing on a model in which an orbiting hot spot is embedded in an accretion disk. Nonimaging algorithms are developed that use interferometric closure quantities to test for periodicity, and applied to an ensemble of hot spot models that sample a range of parameter space. We find that structural periodicity in a wide range of cases can be detected on most potential VLBI arrays using modern VLBI instrumentation. Future enhancements of millimeter/submillimeter VLBI arrays including phased-array processors to aggregate VLBI station collecting area, increased bandwidth recording, and addition of new VLBI sites all significantly aid periodicity detection. The methods described herein can be applied to other models of Sagittarius A*, including jet outflows and magnetohydrodynamic accretion simulations.

  16. CDDIS_VLBI_products_positions

    Data.gov (United States)

    National Aeronautics and Space Administration — Station positions and velocity solutions in Software INdependent EXchange (SINEX) format derived from analysis of Very Long Baseline Interferometry (VLBI) data....

  17. Progress in SLR-GPS co-location at San Juan (Argentina) station

    Science.gov (United States)

    Luis, Hernan; Rojas, Alvis; Adarvez, Sonia; Quinteros, Johana; Cobos, Pablo; Aracena, Andrés; Pacheco, Ana M.; Podestá, Ricardo; Actis, Eloy V.; Li, Jinzeng; Yin, Zhiqiang; Wang, Rui; Huang, Dongping; Márquez, Raúl

    2012-08-01

    From February, 2006, performing a Cooperation Agreement with National Astronomical Observatories of China (NAOC) of the Chinese Academy of Sciences (CAS), Observatorio Astronómico Félix Aguilar (OAFA) of Universidad Nacional de San Juan (UNSJ) is operating a SLR System (ILRS 7406 Station). From the beginning of 2012 a GPS Aztech - Micro Z CGRS is operative at the same place, which made the SLR - GPS co - location possible. The prior objective is to reach co - location between both techniques, so the Station became of 1st order in ITRF net. For that we study and adopt an appropriate strategy to select and place Survey Control Points that ensures higher precision in determination of 3D vectors between the selected reference point s. Afterwards we perform translocation tasks of receptor and antenna checking that the GPS verifies builder standards. Then we design and compensate survey control network, by means of software of our own draught. We expect to obtain definitive local ties with precision better than 3 mm, as suggested by IERS for co - located stations. There are very few stations with co - located spatial techniques in the Southern Hemisphere, so it is of great importance to have one in Argentina for improve our participation in IERS on the new realizations of ITRF from now on.

  18. Collaborative VLBI experiments with Radioastron

    International Nuclear Information System (INIS)

    Jones, D.L.; Preston, R.A.; Jordan, J.F.; Linfield, R.P.

    1987-01-01

    The USSR is planning to launch a 10-m radio telescope into earth orbit for use in VLBI observations. This mission (Radioastron) will be the first opportunity for astronomically important VLBI experiments with baselines much longer than can be obtained between telescopes on the earth. This paper describes the potential scientific advantages of combining data from the orbiting telescope with data from some of the very sensitive radio telescopes in western Europe, Australia, Japan, and the U.S. The advantages of using NASA's Space Network telescopes to track the Radioastron spacecraft when it is not visible from Soviet tracking stations are considered

  19. Simulating and Testing a DC-DC Half-Bridge SLR Converter

    Science.gov (United States)

    2013-06-01

    future pulse power demands with ship power, a large bank of capacitors or similar rapid discharge source is required. If capacitors are charged...Single Pulsed Avalanche Energy (j) I" Avalanche Current (i) E,, Repetilive Avalanche Energy (i) dv/dt Peak Diode Recovery dv/dt ® Po Total Power...SLR), battery charging, DC-DC, pulse power, power electronics, SLR converter 15. NUMBER OF PAGES 119 16. PRICE CODE 17. SECURITY CLASSIFICATION

  20. Consistent realization of Celestial and Terrestrial Reference Frames

    Science.gov (United States)

    Kwak, Younghee; Bloßfeld, Mathis; Schmid, Ralf; Angermann, Detlef; Gerstl, Michael; Seitz, Manuela

    2018-03-01

    The Celestial Reference System (CRS) is currently realized only by Very Long Baseline Interferometry (VLBI) because it is the space geodetic technique that enables observations in that frame. In contrast, the Terrestrial Reference System (TRS) is realized by means of the combination of four space geodetic techniques: Global Navigation Satellite System (GNSS), VLBI, Satellite Laser Ranging (SLR), and Doppler Orbitography and Radiopositioning Integrated by Satellite. The Earth orientation parameters (EOP) are the link between the two types of systems, CRS and TRS. The EOP series of the International Earth Rotation and Reference Systems Service were combined of specifically selected series from various analysis centers. Other EOP series were generated by a simultaneous estimation together with the TRF while the CRF was fixed. Those computation approaches entail inherent inconsistencies between TRF, EOP, and CRF, also because the input data sets are different. A combined normal equation (NEQ) system, which consists of all the parameters, i.e., TRF, EOP, and CRF, would overcome such an inconsistency. In this paper, we simultaneously estimate TRF, EOP, and CRF from an inter-technique combined NEQ using the latest GNSS, VLBI, and SLR data (2005-2015). The results show that the selection of local ties is most critical to the TRF. The combination of pole coordinates is beneficial for the CRF, whereas the combination of Δ UT1 results in clear rotations of the estimated CRF. However, the standard deviations of the EOP and the CRF improve by the inter-technique combination which indicates the benefits of a common estimation of all parameters. It became evident that the common determination of TRF, EOP, and CRF systematically influences future ICRF computations at the level of several μas. Moreover, the CRF is influenced by up to 50 μas if the station coordinates and EOP are dominated by the satellite techniques.

  1. Status and Prospects for Combined GPS LOD and VLBI UT1 Measurements

    Science.gov (United States)

    Senior, K.; Kouba, J.; Ray, J.

    2010-01-01

    A Kalman filter was developed to combine VLBI estimates of UT1-TAI with biased length of day (LOD) estimates from GPS. The VLBI results are the analyses of the NASA Goddard Space Flight Center group from 24-hr multi-station observing sessions several times per week and the nearly daily 1-hr single-baseline sessions. Daily GPS LOD estimates from the International GNSS Service (IGS) are combined with the VLBI UT1-TAI by modeling the natural excitation of LOD as the integral of a white noise process (i.e., as a random walk) and the UT1 variations as the integration of LOD, similar to the method described by Morabito et al. (1988). To account for GPS technique errors, which express themselves mostly as temporally correlated biases in the LOD measurements, a Gauss-Markov model has been added to assimilate the IGS data, together with a fortnightly sinusoidal term to capture errors in the IGS treatments of tidal effects. Evaluated against independent atmospheric and oceanic axial angular momentum (AAM + OAM) excitations and compared to other UT1/LOD combinations, ours performs best overall in terms of lowest RMS residual and highest correlation with (AAM + OAM) over sliding intervals down to 3 d. The IERS 05C04 and Bulletin A combinations show strong high-frequency smoothing and other problems. Until modified, the JPL SPACE series suffered in the high frequencies from not including any GPS-based LODs. We find, surprisingly, that further improvements are possible in the Kalman filter combination by selective rejection of some VLBI data. The best combined results are obtained by excluding all the 1-hr single-baseline UT1 data as well as those 24-hr UT1 measurements with formal errors greater than 5 μs (about 18% of the multi-baseline sessions). A rescaling of the VLBI formal errors, rather than rejection, was not an effective strategy. These results suggest that the UT1 errors of the 1-hr and weaker 24-hr VLBI sessions are non-Gaussian and more heterogeneous than expected

  2. Integration of Reference Frames Using VLBI

    Science.gov (United States)

    Ma, Chopo; Smith, David E. (Technical Monitor)

    2001-01-01

    Very Long Baseline Interferometry (VLBI) has the unique potential to integrate the terrestrial and celestial reference frames through simultaneous estimation of positions and velocities of approx. 40 active VLBI stations and a similar number of stations/sites with sufficient historical data, the position and position stability of approx. 150 well-observed extragalactic radio sources and another approx. 500 sources distributed fairly uniformly on the sky, and the time series of the five parameters that specify the relative orientation of the two frames. The full realization of this potential is limited by a number of factors including the temporal and spatial distribution of the stations, uneven distribution of observations over the sources and the sky, variations in source structure, modeling of the solid/fluid Earth and troposphere, logistical restrictions on the daily observing network size, and differing strategies for optimizing analysis for TRF, for CRF and for EOP. The current status of separately optimized and integrated VLBI analysis will be discussed.

  3. Search for Binary Black Hole Candidates from the VLBI Images of ...

    Indian Academy of Sciences (India)

    2016-01-27

    Jan 27, 2016 ... We have searched the core-jet pairs in the VLBI scales (< 1 kpc), from several VLBI catalogues, and found out 5 possible Binary Black Hole (BBH) candidates. We present here the search results and analyse the candidates preliminarily. We plan to study with multi-band VLBI observation. We also plan to ...

  4. Identification of a transporter Slr0982 involved in ethanol tolerance in cyanobacterium Synechocystis sp. PCC 6803

    Directory of Open Access Journals (Sweden)

    Yanan eZhang

    2015-05-01

    Full Text Available Cyanobacteria have been engineered to produce ethanol through recent synthetic biology efforts. However, one major challenge to the cyanobacterial systems for high-efficiency ethanol production is their low tolerance to the ethanol toxicity. With a major goal to identify novel transporters involved in ethanol tolerance, we constructed gene knockout mutants for 58 transporter-encoding genes of Synechocystis sp. PCC 6803 and screened their tolerance change under ethanol stress. The efforts allowed discovery of a mutant of slr0982 gene encoding an ATP-binding cassette transporter which grew poorly in BG11 medium supplemented with 1.5% (v/v ethanol when compared with the wild type, and the growth loss could be recovered by complementing slr0982 in the ∆slr0982 mutant, suggesting that slr0982 is involved in ethanol tolerance in Synechocystis. To decipher the tolerance mechanism involved, a comparative metabolomic and network-based analysis of the wild type and the ethanol-sensitive ∆slr0982 mutant was performed. The analysis allowed the identification of four metabolic modules related to slr0982 deletion in the ∆slr0982 mutant, among which metabolites like sucrose and L-pyroglutamic acid which might be involved in ethanol tolerance, were found important for slr0982 deletion in the ∆slr0982 mutant. This study reports on the first transporter related to ethanol tolerance in Synechocystis, which could be a useful target for further tolerance engineering. In addition, metabolomic and network analysis provides important findings for better understanding of the tolerance mechanism to ethanol stress in Synechocystis.

  5. International VLBI Service for Geodesy and Astrometry: 1999 Annual Report

    Science.gov (United States)

    Vandenberg, Nancy R. (Editor)

    1999-01-01

    This volume of reports is the 1999 Annual Report of the International VLBI Service for Geodesy and Astrometry -IVS. The individual reports were contributed by VLBI groups in the international geodetic community who constitute the components of IVS. The 1999 Annual Report documents the work of the IVS components for the year ending March 1, 1999, the official inauguration date of IVS. As the newest of the space technique services, IVS decided to publish this Annual Report as a reference to our organization and its components. The entire contents of this Annual Report also appear on the IVS website at: http://ivscc.gsfc.nasa.gov/pub/arl999. The IVS 1999 Annual Report will be a valuable reference for information about IVS and its components. This Annual Report will serve as a baseline from which we can measure the anticipated progress of IVS in coming years.

  6. First Space VLBI Observations and Images Using the VLBA and VSOP

    Science.gov (United States)

    Romney, J. D.; Benson, J. M.; Claussen, M. J.; Desai, K. M.; Flatters, C.; Mioduszewski, A. J.; Ulvestad, J. S.

    1997-12-01

    The National Radio Astronomy Observatory (NRAO) is a participant in the VSOP Space VLBI mission, an international collaboration led by Japan's Institute of Space and Astronautical Science. NRAO has committed up to 30% of scheduled observing time on the Very Long Baseline Array (VLBA), and corresponding correlation resources, to Space VLBI observations. The NRAO Space VLBI Project, funded by NASA, has been working for several years to complete the necessary enhancements to the VLBA correlator and the AIPS image processing system. These developments were completed by the time of the successful launch of the VSOP mission's Halca spacecraft on 1997 February 12. As part of the in-orbit checkout phase, the first Space VLBI fringes from a VLBA observation were detected on 1997 June 12, and the VSOP mission's first images, in both the 1.6- and 5-GHz bands, were obtained shortly thereafter. In-orbit test observations continued through early September, with the first General Observing Time (GOT) scientific observations beginning in July. Through mid-October, a total of 20 Space VLBI observations, comprising 190 hours, had been completed at the VLBA correlator. This paper reviews the unique features of correlation and imaging of Space VLBI observations. These include, for correlation, the ephemeris for an orbiting VLBI ``station'' which is not fixed on the surface of the earth, and the requirement to close the loop on the phase-transfer process from a frequency standard on the ground to the spacecraft. Images from a number of early tests and scientific observations are presented. NRAO's user-support program, providing expert assistance in data analysis to Space VLBI observers, is also described.

  7. General Relativistic Theory of the VLBI Time Delay in the Gravitational Field of Moving Bodies

    Science.gov (United States)

    Kopeikin, Sergei

    2003-01-01

    The general relativistic theory of the gravitational VLBI experiment conducted on September 8, 2002 by Fomalont and Kopeikin is explained. Equations of radio waves (light) propagating from the quasar to the observer are integrated in the time-dependent gravitational field of the solar system by making use of either retarded or advanced solutions of the Einstein field equations. This mathematical technique separates explicitly the effects associated with the propagation of gravity from those associated with light in the integral expression for the relativistic VLBI time delay of light. We prove that the relativistic correction to the Shapiro time delay, discovered by Kopeikin (ApJ, 556, L1, 2001), changes sign if one retains direction of the light propagation but replaces the retarded for the advanced solution of the Einstein equations. Hence, this correction is associated with the propagation of gravity. The VLBI observation measured its speed, and that the retarded solution is the correct one.

  8. Validation of Galileo orbits using SLR with a focus on satellites launched into incorrect orbital planes

    Science.gov (United States)

    Sośnica, Krzysztof; Prange, Lars; Kaźmierski, Kamil; Bury, Grzegorz; Drożdżewski, Mateusz; Zajdel, Radosław; Hadas, Tomasz

    2018-02-01

    The space segment of the European Global Navigation Satellite System (GNSS) Galileo consists of In-Orbit Validation (IOV) and Full Operational Capability (FOC) spacecraft. The first pair of FOC satellites was launched into an incorrect, highly eccentric orbital plane with a lower than nominal inclination angle. All Galileo satellites are equipped with satellite laser ranging (SLR) retroreflectors which allow, for example, for the assessment of the orbit quality or for the SLR-GNSS co-location in space. The number of SLR observations to Galileo satellites has been continuously increasing thanks to a series of intensive campaigns devoted to SLR tracking of GNSS satellites initiated by the International Laser Ranging Service. This paper assesses systematic effects and quality of Galileo orbits using SLR data with a main focus on Galileo satellites launched into incorrect orbits. We compare the SLR observations with respect to microwave-based Galileo orbits generated by the Center for Orbit Determination in Europe (CODE) in the framework of the International GNSS Service Multi-GNSS Experiment for the period 2014.0-2016.5. We analyze the SLR signature effect, which is characterized by the dependency of SLR residuals with respect to various incidence angles of laser beams for stations equipped with single-photon and multi-photon detectors. Surprisingly, the CODE orbit quality of satellites in the incorrect orbital planes is not worse than that of nominal FOC and IOV orbits. The RMS of SLR residuals is even lower by 5.0 and 1.5 mm for satellites in the incorrect orbital planes than for FOC and IOV satellites, respectively. The mean SLR offsets equal -44.9, -35.0, and -22.4 mm for IOV, FOC, and satellites in the incorrect orbital plane. Finally, we found that the empirical orbit models, which were originally designed for precise orbit determination of GNSS satellites in circular orbits, provide fully appropriate results also for highly eccentric orbits with variable linear

  9. The African VLBI network project

    Science.gov (United States)

    Loots, Anita

    2015-01-01

    The AVN is one of the most significant vehicles through which capacity development in Africa for SKA participation will be realized. It is a forerunner to the long baseline Phase 2 component of the mid-frequency SKA. Besides the 26m HartRAO telescope in South Africa, Ghana is expected to be the first to establish a VLBI-capable telescope through conversion of a redundant 32m telecommunications system near Accra. The most widely used receivers in the EVN are L-band and C-band (5 GHz). L-band is divided into a low band around the hydrogen (HI) line frequency of 1420 MHz, and a high band covering the hydroxyl line frequencies of 1612-1720 MHz. The high band is much more commonly used for VLBI as it provides more bandwidth. For the AVN, the methanol maser line at 6668 MHz is a key target for the initial receiver and the related 12178MHz methanol maser line also seen in star-forming regions a potential future Ku-band receiver. In the potential future band around 22GHz(K-band), water masers in star-forming regions and meg-maser galaxies at 22.235 GHz are targets, as are other radio continuum sources such as AGNs. The AVN system will include 5GHz and 6.668GHz receiver systems with recommendation to partner countries that the first upgrade should be L-band receivers. The original satellite telecommunications feed horns cover 3.8 - 6.4 GHz and should work at 5 GHz and operation at 6.668 GHz for the methanol maser is yet to be verified. The first light science will be conducted in the 6.7 GHz methanol maser band. Telescopes developed for the AVN will initially join other global networks for VLBI. When at least four VLBI-capable telescopes are operational on the continent, it will be possible to initiate stand-alone AVN VLBI. Each country where an AVN telescope becomes operational will have its own single-dish observing program. Capacity building to run an observatory includes the establishment of competent core essential observatory staff in partner countries who can train

  10. Application of ray-traced tropospheric slant delays to geodetic VLBI analysis

    Science.gov (United States)

    Hofmeister, Armin; Böhm, Johannes

    2017-08-01

    The correction of tropospheric influences via so-called path delays is critical for the analysis of observations from space geodetic techniques like the very long baseline interferometry (VLBI). In standard VLBI analysis, the a priori slant path delays are determined using the concept of zenith delays, mapping functions and gradients. The a priori use of ray-traced delays, i.e., tropospheric slant path delays determined with the technique of ray-tracing through the meteorological data of numerical weather models (NWM), serves as an alternative way of correcting the influences of the troposphere on the VLBI observations within the analysis. In the presented research, the application of ray-traced delays to the VLBI analysis of sessions in a time span of 16.5 years is investigated. Ray-traced delays have been determined with program RADIATE (see Hofmeister in Ph.D. thesis, Department of Geodesy and Geophysics, Faculty of Mathematics and Geoinformation, Technische Universität Wien. http://resolver.obvsg.at/urn:nbn:at:at-ubtuw:1-3444, 2016) utilizing meteorological data provided by NWM of the European Centre for Medium-Range Weather Forecasts (ECMWF). In comparison with a standard VLBI analysis, which includes the tropospheric gradient estimation, the application of the ray-traced delays to an analysis, which uses the same parameterization except for the a priori slant path delay handling and the used wet mapping factors for the zenith wet delay (ZWD) estimation, improves the baseline length repeatability (BLR) at 55.9% of the baselines at sub-mm level. If no tropospheric gradients are estimated within the compared analyses, 90.6% of all baselines benefit from the application of the ray-traced delays, which leads to an average improvement of the BLR of 1 mm. The effects of the ray-traced delays on the terrestrial reference frame are also investigated. A separate assessment of the RADIATE ray-traced delays is carried out by comparison to the ray-traced delays from the

  11. Methodology for the combination of sub-daily Earth rotation from GPS and VLBI observations

    Science.gov (United States)

    Artz, T.; Bernhard, L.; Nothnagel, A.; Steigenberger, P.; Tesmer, S.

    2012-03-01

    A combination procedure of Earth orientation parameters from Global Positioning System (GPS) and Very Long Baseline Interferometry (VLBI) observations was developed on the basis of homogeneous normal equation systems. The emphasis and purpose of the combination was the determination of sub-daily polar motion (PM) and universal time (UT1) for a long time-span of 13 years. Time series with an hourly resolution and a model for tidal variations of PM and UT1-TAI (dUT1) were estimated. In both cases, 14-day nutation corrections were estimated simultaneously with the ERPs. Due to the combination procedure, it was warranted that the strengths of both techniques were preserved. At the same time, only a minimum of de-correlating or stabilizing constraints were necessary. Hereby, a PM time series was determined, whose precision is mainly dominated by GPS observations. However, this setup benefits from the fact that VLBI delivered nutation and dUT1 estimates at the same time. An even bigger enhancement can be seen for the dUT1 estimation, where the high-frequency variations are provided by GPS, while the long term trend is defined by VLBI. The estimated combined tidal PM and dUT1 model was predominantly determined from the GPS observations. Overall, the combined tidal model for the first time completely comprises the geometrical benefits of VLBI and GPS observations. In terms of root mean squared (RMS) differences, the tidal amplitudes agree with other empirical single-technique tidal models below 4 μ as in PM and 0.25 μ s in dUT1. The noise floor of the tidal ERP model was investigated in three ways resulting in about 1 μ as for diurnal PM and 0.07 μ s for diurnal dUT1 while the semi-diurnal components have a slightly better accuracy.

  12. The simulation of lunar gravity field recovery from D-VLBI of Chang’E-1 and SELENE lunar orbiters

    Science.gov (United States)

    Yan, Jianguo; Ping, Jingsong; Matsumoto, K.; Li, Fei

    2008-07-01

    The lunar gravity field is a foundation to study the lunar interior structure, and to recover the evolution history of the Moon. It is still an open and key topic for lunar science. For above mentioned reasons, it becomes one of the important scientific objectives of recent lunar missions, such as KAGUYA (SELENE) the Japanese lunar mission and Chang’E-1, the Chinese lunar mission. The Chang’E-1 and the SELENE were successfully launched in 2007. It is estimated that these two missions can fly around the Moon longer than 6 months simultaneously. In these two missions, the Chinese new VLBI (Very Long Baseline Interferometry) network will be applied for precise orbit determination (POD) by using a differential VLBI (D-VLBI) method during the mission period. The same-beam D-VLBI technique will contribute to recover the lunar gravity field together with other conventional observables, i.e. R&RR (Range and Range Rate) and multi-way Doppler. Taking VLBI tracking conditions into consideration and using the GEODYNII/SOVLE software of GSFC/NASA/USA [Rowlands, D.D., Marshall, J.A., Mccarthy, J., et al. GEODYN II System Description, vols. 1 5. Contractor Report, Hughes STX Corp. Greenbelt, MD, 1997; Ullman, R.E. SOLVE program: mathematical formulation and guide to user input, Hughes/STX Contractor Report, Contract NAS5-31760. NASA Goddard Space Flight Center, Greenbelt, Maryland, 1994], we simulated the lunar gravity field recovering ability with and without D-VLBI between the Chang’E-1 and SELENE main satellite. The cases of overlapped flying and tracking period of 30 days, 60 days and 90 days have been analyzed, respectively. The results show that D-VLBI tracking between two lunar satellites can improve the gravity field recovery remarkably. The results and methods introduced in this paper will benefit the actual missions.

  13. The Tropospheric Products of the International VLBI Service for Geodesy and Astrometry

    Science.gov (United States)

    Heinkelmann, Robert; Schwatke, Christian

    2010-01-01

    The IVS runs two tropospheric products: The IVS tropospheric parameter rapid combination monitors the zenith wet delay (ZWD) and zenith total delay (ZTD) of the rapid turnaround sessions R1 and R4. Goal of the combination is the identification and the exclusion of outliers by comparison and the assessment of the precision of current VLBI solutions in terms of tropospheric parameters. The rapid combination is done on a weekly basis four weeks after the observation files are released on IVS Data Centers. Since tropospheric and geodetic parameters, such as vertical station components, can significantly correlate, the consistency of the ZTD can be a measure of the consistency of the corresponding TRF as well. The ZWD mainly rely on accurate atmospheric pressure data. Thus, besides estimation techniques, modeling and analyst s noise, ZWD reflects differences in the atmospheric pressure data applied to the VLBI analysis. The second product, called tropospheric parameter long-term combination, aims for an accurate determination of climatological signals, such as trends of the atmospheric water vapor observed by VLBI. Therefore, the long-term homogeneity of atmospheric pressure data plays a crucial role for this product. The paper reviews the methods applied and results achieved so far and describes the new maintenance through DGFI.

  14. Rice early flowering1, a CKI, phosphorylates DELLA protein SLR1 to negatively regulate gibberellin signalling.

    Science.gov (United States)

    Dai, Cheng; Xue, Hong-Wei

    2010-06-02

    The plant hormone gibberellin (GA) is crucial for multiple aspects of plant growth and development. To study the relevant regulatory mechanisms, we isolated a rice mutant earlier flowering1, el1, which is deficient in a casein kinase I that has critical roles in both plants and animals. el1 had an enhanced GA response, consistent with the suppression of EL1 expression by exogenous GA(3). Biochemical characterization showed that EL1 specifically phosphorylates the rice DELLA protein SLR1, proving a direct evidence for SLR1 phosphorylation. Overexpression of SLR1 in wild-type plants caused a severe dwarf phenotype, which was significantly suppressed by EL1 deficiency, indicating the negative effect of SLR1 on GA signalling requires the EL1 function. Further studies showed that the phosphorylation of SLR1 is important for maintaining its activity and stability, and mutation of the candidate phosphorylation site of SLR1 results in the altered GA signalling. This study shows EL1 a novel and key regulator of the GA response and provided important clues on casein kinase I activities in GA signalling and plant development.

  15. An Improved Empirical Harmonic Model of the Celestial Intermediate Pole Offsets from a Global VLBI Solution

    Science.gov (United States)

    Belda, Santiago; Heinkelmann, Robert; Ferrándiz, José M.; Karbon, Maria; Nilsson, Tobias; Schuh, Harald

    2017-10-01

    Very Long Baseline Interferometry (VLBI) is the only space geodetic technique capable of measuring all the Earth orientation parameters (EOP) accurately and simultaneously. Modeling the Earth's rotational motion in space within the stringent consistency goals of the Global Geodetic Observing System (GGOS) makes VLBI observations essential for constraining the rotation theories. However, the inaccuracy of early VLBI data and the outdated products could cause non-compliance with these goals. In this paper, we perform a global VLBI analysis of sessions with different processing settings to determine a new set of empirical corrections to the precession offsets and rates, and to the amplitudes of a wide set of terms included in the IAU 2006/2000A precession-nutation theory. We discuss the results in terms of consistency, systematic errors, and physics of the Earth. We find that the largest improvements w.r.t. the values from IAU 2006/2000A precession-nutation theory are associated with the longest periods (e.g., 18.6-yr nutation). A statistical analysis of the residuals shows that the provided corrections attain an error reduction at the level of 15 μas. Additionally, including a Free Core Nutation (FCN) model into a priori Celestial Pole Offsets (CPOs) provides the lowest Weighted Root Mean Square (WRMS) of residuals. We show that the CPO estimates are quite insensitive to TRF choice, but slightly sensitive to the a priori EOP and the inclusion of different VLBI sessions. Finally, the remaining residuals reveal two apparent retrograde signals with periods of nearly 2069 and 1034 days.

  16. Second-degree Stokes coefficients from multi-satellite SLR

    Czech Academy of Sciences Publication Activity Database

    Blossfeld, M.; Mueller, H.; Gerstl, M.; Štefka, Vojtěch; Bouman, J.; Goettl, F.; Horwath, M.

    2015-01-01

    Roč. 89, č. 9 (2015), s. 857-871 ISSN 0949-7714 Institutional support: RVO:67985815 Keywords : multi-satellite SLR * stokes coefficients * equatorial excitation functions Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 2.486, year: 2015

  17. Absorption and emission spectroscopic characterization of BLUF protein Slr1694 from Synechocystis sp. PCC6803 with roseoflavin cofactor.

    Science.gov (United States)

    Zirak, P; Penzkofer, A; Mathes, T; Hegemann, P

    2009-11-09

    The wild-type BLUF protein Slr1694 from Synechocystis sp. PCC6803 (BLUF=blue-light sensor using FAD) has flavin adenosine dinucleotide (FAD) as natural cofactor. This light sensor causes positive phototaxis of the marine cyanobacterium. In this study the FAD cofactor of the wild-type Slr1694 was replaced by roseoflavin (RoF) and the roseoflavin derivatives RoFMN and RoFAD during heterologous expression in a riboflavin auxotrophic E. coli strain. An absorption and emission spectroscopic characterization of the cofactor-exchanged-Slr1694 (RoSlr) was carried out both under dark conditions and under illuminated conditions. The behaviour of RoF embedded in RoSlr in aqueous solution at pH 8 is compared with the behaviour of RoF in aqueous solution. The fluorescence of RoF and RoSlr is quenched by photo-induced twisted intra-molecular charge transfer at room temperature with stronger effect for RoF. The fluorescence quenching is diminished at liquid nitrogen temperature. Light exposure of RoSlr causes irreversible conversion of the protein embedded roseoflavins to 8-methylamino-flavins, 8-dimethylamino-lumichrome and 8-methylamino-lumichrome.

  18. SLR-induced changes on storm flooding in coastal areas: the role of accommodation space

    Science.gov (United States)

    Jiménez, Jose A.; Dockx, Stijn; Monbaliu, Jaak

    2015-04-01

    Most of existing predictions of climate-induce changes in coastal storminess in the Mediterranean indicate the absence of any significant increasing trend in neither wave height nor surge. However, this does not mean that magnitude and/or frequency of storm-induced coastal hazards will not be affected by climate change. Thus, sea level rise will induce a series of long-term changes in coastal areas that although not directly affecting storminess will interact with storm-induced processes and, thus, changing coastal storm risks. A typical approach to account SLR-induced effects on coastal inundation by storms is to modify present water level extreme climate by adding expected MWL increase. This implies to consider the coast as a static and passive system to SLR maintaining its configuration from actual to projected (rised) sea level and, as a result of this, the frequency of flood events should increase and, the magnitude of flooding associated to a probability of occurrence will also increase. This will only be realistic for really passive or rigid coasts. However, sandy coastlines will response to SLR and, thus, this approach should undervalue coastal resilience. Within this context, the main aim of this work is to propose a method to assess the effects of SLR on the magnitude of storm-induced coastal flooding on sandy coastlines taking into account their capacity of response. It combines the use of a inundation model (LISFLOOD-FP) for delineating the flood-prone area for given storm conditions and, a coastal module to account for SLR-induced changes in the coastal fringe. The method assumes an equilibrium-type coastal response to SLR which, ideally, implies that the beach profile will be reconstructed under the new higher water level, in such a way that the relative beach configuration will be the same. However, this should only be possible provided there is enough accommodation space in the hinterland. In most of developed coasts, the existence of human built

  19. NASA space geodesy program: Catalogue of site information

    Science.gov (United States)

    Bryant, M. A.; Noll, C. E.

    1993-01-01

    This is the first edition of the NASA Space Geodesy Program: Catalogue of Site Information. This catalogue supersedes all previous versions of the Crustal Dynamics Project: Catalogue of Site Information, last published in May 1989. This document is prepared under the direction of the Space Geodesy and Altimetry Projects Office (SGAPO), Code 920.1, Goddard Space Flight Center. SGAPO has assumed the responsibilities of the Crustal Dynamics Project, which officially ended December 31, 1991. The catalog contains information on all NASA supported sites as well as sites from cooperating international partners. This catalog is designed to provde descriptions and occupation histories of high-accuracy geodetic measuring sites employing space-related techniques. The emphasis of the catalog has been in the past, and continues to be with this edition, station information for facilities and remote locations utilizing the Satellite Laser Ranging (SLR), Lunar Laser Ranging (LLR), and Very Long Baseline Interferometry (VLBI) techniques. With the proliferation of high-quality Global Positioning System (GPS) receivers and Doppler Orbitography and Radiopositioning Integrated by Satellite (DORIS) transponders, many co-located at established SLR and VLBI observatories, the requirement for accurate station and localized survey information for an ever broadening base of scientists and engineers has been recognized. It is our objective to provide accurate station information to scientific groups interested in these facilities.

  20. Monitoring of Earth Rotation by VLBI

    Science.gov (United States)

    Ma., Chopo; Macmillan, D. S.

    2000-01-01

    Monitoring Earth rotation with Very Long Baseline Interferometry (VLBI) has unique potential because of direct access to the Celestial Reference System (CRF and Terrestrial Reference System (TRF) and the feasibility of re-analyzing the entire data set. While formal precision of better than 0.045 mas for pole and 0.002 ms for UT 1 has been seen in the best 24-hr data, the accuracy of the Earth Orientation Parameter (EOP) time series as a whole is subject to logistical, operational, analytical and conceptual constraints. The current issues related to the VLBI data set and the CORE program for greater time resolution such as analysis consistency, network jitter and reference frame stability will be discussed.

  1. International VLBI Service for Geodesy and Astrometry

    Science.gov (United States)

    Vandenberg, Nancy R. (Editor); Baver, Karen D. (Editor)

    2001-01-01

    This volume of reports is the 2000 Annual Report of the International Very Long Base Interferometry (VLBI) Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the components of IVS. The 2000 Annual Report documents the work of these IVS components over the period March 1, 1999, through December 31, 2000. The reports document changes, activities, and progress of the IVS. The entire contents of this Annual Report also appear on the IVS web site at http://ivscc.gsfc.nasa.gov/publications/ar2000.

  2. Applying Kalman filtering to investigate tropospheric effects in VLBI

    Science.gov (United States)

    Soja, Benedikt; Nilsson, Tobias; Karbon, Maria; Heinkelmann, Robert; Liu, Li; Lu, Cuixian; Andres Mora-Diaz, Julian; Raposo-Pulido, Virginia; Xu, Minghui; Schuh, Harald

    2014-05-01

    Very Long Baseline Interferometry (VLBI) currently provides results, e.g., estimates of the tropospheric delays, with a delay of more than two weeks. In the future, with the coming VLBI2010 Global Observing System (VGOS) and increased usage of electronic data transfer, it is planned that the time between observations and results is decreased. This may, for instance, allow the integration of VLBI-derived tropospheric delays into numerical weather prediction models. Therefore, future VLBI analysis software packages need to be able to process the observational data autonomously in near real-time. For this purpose, we have extended the Vienna VLBI Software (VieVS) by a Kalman filter module. This presentation describes the filter and discusses its application for tropospheric studies. Instead of estimating zenith wet delays as piece-wise linear functions in a least-squares adjustment, the Kalman filter allows for more sophisticated stochastic modeling. We start with a random walk process to model the time-dependent behavior of the zenith wet delays. Other possible approaches include the stochastic model described by turbulence theory, e.g. the model by Treuhaft and Lanyi (1987). Different variance-covariance matrices of the prediction error, depending on the time of the year and the geographic latitude, have been tested. In winter and closer to the poles, lower variances and covariances are appropriate. The horizontal variations in tropospheric delays have been investigated by comparing three different strategies: assumption of a horizontally stratified troposphere, using north and south gradients modeled, e.g., as Gauss-Markov processes, and applying a turbulence model assuming correlations between observations in different azimuths. By conducting Monte-Carlo simulations of current standard VLBI networks and of future VGOS networks, the different tropospheric modeling strategies are investigated. For this purpose, we use the simulator module of VieVS which takes into

  3. DSN Beowulf Cluster-Based VLBI Correlator

    Science.gov (United States)

    Rogstad, Stephen P.; Jongeling, Andre P.; Finley, Susan G.; White, Leslie A.; Lanyi, Gabor E.; Clark, John E.; Goodhart, Charles E.

    2009-01-01

    The NASA Deep Space Network (DSN) requires a broadband VLBI (very long baseline interferometry) correlator to process data routinely taken as part of the VLBI source Catalogue Maintenance and Enhancement task (CAT M&E) and the Time and Earth Motion Precision Observations task (TEMPO). The data provided by these measurements are a crucial ingredient in the formation of precision deep-space navigation models. In addition, a VLBI correlator is needed to provide support for other VLBI related activities for both internal and external customers. The JPL VLBI Correlator (JVC) was designed, developed, and delivered to the DSN as a successor to the legacy Block II Correlator. The JVC is a full-capability VLBI correlator that uses software processes running on multiple computers to cross-correlate two-antenna broadband noise data. Components of this new system (see Figure 1) consist of Linux PCs integrated into a Beowulf Cluster, an existing Mark5 data storage system, a RAID array, an existing software correlator package (SoftC) originally developed for Delta DOR Navigation processing, and various custom- developed software processes and scripts. Parallel processing on the JVC is achieved by assigning slave nodes of the Beowulf cluster to process separate scans in parallel until all scans have been processed. Due to the single stream sequential playback of the Mark5 data, some ramp-up time is required before all nodes can have access to required scan data. Core functions of each processing step are accomplished using optimized C programs. The coordination and execution of these programs across the cluster is accomplished using Pearl scripts, PostgreSQL commands, and a handful of miscellaneous system utilities. Mark5 data modules are loaded on Mark5 Data systems playback units, one per station. Data processing is started when the operator scans the Mark5 systems and runs a script that reads various configuration files and then creates an experiment-dependent status database

  4. Approaching the event horizon: 1.3mmλ VLBI of SgrA*

    International Nuclear Information System (INIS)

    Doeleman, Sheperd

    2008-01-01

    Advances in VLBI instrumentation now allow wideband recording that significantly increases the sensitivity of short wavelength VLBI observations. Observations of the super-massive black hole candidate at the center of the Milky Way, SgrA*, with short wavelength VLBI reduces the scattering effects of the intervening interstellar medium, allowing observations with angular resolution comparable to the apparent size of the event horizon of the putative black hole. Observations in April 2007 at a wavelength of 1.3mm on a three station VLBI array have now confirmed structure in SgrA* on scales of just a few Schwarzschild radii. When modeled as a circular Gaussian, the fitted diameter of SgrA* is 37 μas (+16,-10; 3σ), which is smaller than the expected apparent size of the event horizon of the Galactic Center black hole. These observations demonstrate that mm/sub-mm VLBI is poised to open a new window onto the study of black hole physics via high angular resolution observations of the Galactic Center.

  5. International VLBI Service for Geodesy and Astrometry 2004 General Meeting Proceedings

    Science.gov (United States)

    Vandenberg, Nancy R. (Editor); Baver, Karen D. (Editor)

    2004-01-01

    This volume is the proceedings of the third General Meeting of the International VLBI Service for Geodesy and Astromctry IVS), held in Otlawa, Canada, February 9-11,2004. The keynote of the third GM was visions for the next decade following the main theme of "Today's Results and Tomorrow's Vision". with a recognition that the outstanding VLBI results available today are the foundation and motivation for the next generation VLBI system requirements. The goal of the meeting was to provide an interesting and informative program for a wide cross section of IVS members, including station operators, program managers, and analysts.

  6. New VLBI Observing System 'OCTAVE-Family' to Support VDIF Specifications with 10 GigE for VERA, JVN, and Japanese e-VLBI (OCTAVE)

    Science.gov (United States)

    Oyama, T.; Kono, Y.; Suzuki, S.; Mizuno, S.; Bushimata, T.; Jike, T.; Kawaguchi, N.; Kobayashi, H.; Kimura, M.

    2012-12-01

    The new VLBI observing system (OCTAVE-Family) has been designed and developed based on the VSI-H and VDIF specifications at NAOJ (National Astronomical Observatory of Japan). It consists of 1) a high speed 8-Gsps 3-bit ADC (OCTAD) enabling us to acquire not only wide intermediate frequencies but also radio frequencies up to 50 GHz, 2) a converter (OCTAVIA) between one 10 GigE port and four 2 Gbps input and output ports conformable to VSI-H, 3) new recorders (OCTADISK and OCTADISK2) at rates of 4.5 Gbps and above 8 Gbps, and 4) a high speed software correlator system (OCTACOR) using GICO3 which was developed by NICT. These OCTAVE systems are connected via 10 GigE network with VDIF and VSI specifications. These components are used for VERA, JVN (Japanese VLBI network), and KJJVC (Korea-Japan Joint VLBI Correlator).

  7. International VLBI Service for Geodesy and Astronomy

    Science.gov (United States)

    Vandenberg, Nancy R. (Editor); Baver, Karen D. (Editor)

    2004-01-01

    This volume of reports is the 2003 Annual Report of the International VLBI Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the permanent components of IVS. The IVS 2003 Annual Report documents the work of the IVS components for the calendar year 2003, our fifih year of existence. The reports describe changes, activities, and progress of the IVS. Many thanks to all IVS components who contributed to this Annual Report. The entire contents of this Annual Report also appear on the IVS web site at http://ivscc.gsfc.nasa.gov/publications/ar2OO3

  8. Silencing OsSLR1 enhances the resistance of rice to the brown planthopper Nilaparvata lugens.

    Science.gov (United States)

    Zhang, Jin; Luo, Ting; Wang, Wanwan; Cao, Tiantian; Li, Ran; Lou, Yonggen

    2017-10-01

    DELLA proteins, negative regulators of the gibberellin (GA) pathway, play important roles in plant growth, development and pathogen resistance by regulating multiple phytohormone signals. Yet, whether and how they regulate plant herbivore resistance remain unknown. We found that the expression of the rice DELLA gene OsSLR1 was down-regulated by an infestation of female adults of the brown planthopper (BPH) Nilaparvata lugens. On one hand, OsSLR1 positively regulated BPH-induced levels of two mitogen-activated protein kinase and four WRKY transcripts, and of jasmonic acid, ethylene and H 2 O 2 . On the other hand, silencing OsSLR1 enhanced constitutive levels of defence-related compounds, phenolic acids, lignin and cellulose, as well as the resistance of rice to BPH in the laboratory and in the field. The increased resistance in rice with silencing of OsSLR1 is probably due to impaired JA and ethylene pathways, and, at least in part, to the increased lignin level and mechanical hardness of rice leaf sheaths. Our findings illustrate that OsSLR1, acting as an early negative regulator, plays an important role in regulating the resistance of rice to BPH by activating appropriate defence-related signalling pathways and compounds. Moreover, our data also provide new insights into relationships between plant growth and defence. © 2017 John Wiley & Sons Ltd.

  9. Positioning Reduction of Deep Space Probes Based on VLBI Tracking

    Science.gov (United States)

    Qiao, S. B.

    2011-11-01

    geocentric distance is shown to be helpful to improve the positioning precision. It is worthy of paying close attention to the applications of the same beam VLBI technique, the digital lunar topographic model, and the detector-board observations between the lander and rover to the position/trace determination of the rover. (4) The trajectory evolution of the CE-2 satellite is precisely monitored in a realtime mode during pivotal arcs such as the maneuvers in the lunar approaching stage, near the perilune, in the adjustment of the circumlunar orbit, and in the experiment of the circumlunar orbit shift. Via positioning reduction, the successful capture of the CE-2 satellite by the Moon is quickly and accurately identified and concluded, and the precise monitoring of the 15 km orbit above the lunar surface is successfully realized. These laid the methods and software infrastructure, and accumulated practical experience in engineering and technology for the smooth and successful implementation of tasks in the follow-on Chinese lunar exploration projects. As shown in the following aspects, the researches in this dissertation are urgently expected to be improved and supplemented. (1) Do some further simulations on the check of software and algorithm as well as some extra comparisons with associated software (Geodyn, OCCAM, Calc/Solve) in order to disclose and improve shortcomings and limitations of the current software system. (2) Develop software modules for the correction of various observational errors related to the transmission medium, quasi-clock bias and gravitational retardation, in particular, the correction of the quasi-clock uncertainty based on observations of extragalactic radio sources with known coordinates, for the enhancement of the systematicness and integrity of the current software. (3) Improve the function of the existing software on the reduction of observations of differential, phase referencing and same beam VLBI with simulation and real data tests. (4

  10. Possible systematics in the VLBI catalogs as seen from Gaia

    Science.gov (United States)

    Liu, N.; Zhu, Z.; Liu, J.-C.

    2018-01-01

    Aims: In order to investigate the systematic errors in the very long baseline interferometry (VLBI) positions of extragalactic sources (quasars) and the global differences between Gaia and VLBI catalogs, we use the first data release of Gaia (Gaia DR1) quasar positions as the reference and study the positional offsets of the second realization of the International Celestial Reference Frame (ICRF2) and the Goddard VLBI solution 2016a (gsf2016a) catalogs. Methods: We select a sample of 1032 common sources among three catalogs and adopt two methods to represent the systematics: considering the differential orientation (offset) and declination bias; analyzing with the vector spherical harmonics (VSH) functions. Results: Between two VLBI catalogs and Gaia DR1, we find that: i) the estimated orientation is consistent with the alignment accuracy of Gaia DR1 to ICRF, of 0.1 mas, but the southern and northern hemispheres show opposite orientations; ii) the declination bias in the southern hemisphere between Gaia DR1 and ICRF2 is estimated to be +152 μas, much larger than that between Gaia DR1 and gsf2016a which is +34 μas. Between two VLBI catalogs, we find that: i) the rotation component shows that ICRF2 and gsf2016a are generally consistent within 30 μas; ii) the glide component and quadrupole component report two declination-dependent offsets: dipolar deformation of +50 μas along the Z-axis, and quadrupolar deformation of -50 μas that would induce a pattern of sin2δ. Conclusions: The significant declination bias between Gaia DR1 and ICRF2 catalogs reported in previous studies is possibly attributed to the systematic errors of ICRF2 in the southern hemisphere. The global differences between ICRF2 and gsf2016a catalogs imply that possible, mainly declination-dependent systematics exit in the VLBI positions and need further investigations in the future Gaia data release and the next generation of ICRF.

  11. Geocenter Motion Derived from GNSS and SLR Tracking Data of LEO

    Science.gov (United States)

    Li, Y. S.; Ning, F. S.; Tseng, K. H.; Tseng, T. P.; Wu, J. M.; Chen, K. L.

    2017-12-01

    Space geodesy techniques can provide the monitoring data of global variations with high precision and large coverage through the satellites. Geocenter motion (GM) describes the difference of CF (Center of Figure) respect to CM (Center of Mass of the Earth System) due to the re-distribution and deformation of the earth system. Because satellite tracking data between ground stations and satellites orbit around the CM, geocenter motion is related to the realization of the ITRF (International Terrestrial Reference Frame) origin. In this study, GPS (Global Positioning System) observation data of IGS (International GNSS Service) and SLR (Satellite Laser Ranging) tracking data are applied to estimate the coordinates of observing sites on Earth's surface. The GPS observing sites are distributed deliberately and globally by 15° ×15° grids. Meanwhile, two different global ocean tide models are applied here. The model used in ITRF comparison and combination is parameter transformation, which is a mathematical formula allowing to transform the different frames between ITRF and CM system. Following the parameter transformation, the results of geocenter motion can be determined. The FORMOSAT-7/COSMIC-2 (F7C2) mission is a constellation of LEO (Low-Earth-Orbit) satellites, which will be launched in 2018. Besides the observing system for Meteorology, Ionosphere, and Climate, the F7C2 will be equipped with LRR (Laser Ranging Retroreflector). This work is a pilot survey to study the application of LEO SLR data in Taiwan.

  12. Observing atmospheric tides in Earth rotation parameters with VLBI

    Science.gov (United States)

    Girdiuk, Anastasiia; Böhm, Johannes; Schindelegger, Michael

    2015-04-01

    In this study, we assess the contribution of diurnal (S1) and semi-diurnal (S2) atmospheric tides to variations in Earth rotation by analyzing Very Long Baseline Interferometry (VLBI) observations. Particular emphasis is placed on the dependency of S1 and S2 estimates on varying settings in the a priori delay model. We use hourly Earth rotation parameters (ERP) of polar motion and UT1 as determined with the Vienna VLBI Software (VieVS) from 25 years of VLBI observations and we adjust diurnal and semi-diurnal amplitudes to the hourly ERP estimates after disregarding the effect of high-frequency ocean tides. Prograde and retrograde polar motion coefficients are obtained for several solutions differing in processing strategies (with/without thermal deformation, time span of observations, choice of a priori ERP model and celestial pole offsets) and we compare the corresponding harmonics with those derived from atmospheric and non-tidal oceanic angular momentum estimates.

  13. A Fast Radio Burst Search Method for VLBI Observation

    Science.gov (United States)

    Liu, Lei; Tong, Fengxian; Zheng, Weimin; Zhang, Juan; Tong, Li

    2018-02-01

    We introduce the cross-spectrum-based fast radio burst (FRB) search method for Very Long Baseline Interferometer (VLBI) observation. This method optimizes the fringe fitting scheme in geodetic VLBI data post-processing, which fully utilizes the cross-spectrum fringe phase information and therefore maximizes the power of single-pulse signals. Working with cross-spectrum greatly reduces the effect of radio frequency interference compared with using auto-power spectrum. Single-pulse detection confidence increases by cross-identifying detections from multiple baselines. By combining the power of multiple baselines, we may improve the detection sensitivity. Our method is similar to that of coherent beam forming, but without the computational expense to form a great number of beams to cover the whole field of view of our telescopes. The data processing pipeline designed for this method is easy to implement and parallelize, which can be deployed in various kinds of VLBI observations. In particular, we point out that VGOS observations are very suitable for FRB search.

  14. Application of Geodetic VLBI Data to Obtaining Long-Term Light Curves for Astrophysics

    Science.gov (United States)

    Kijima, Masachika

    2010-01-01

    The long-term light curve is important to research on binary black holes and disk instability in AGNs. The light curves have been drawn mainly using single dish data provided by the University of Michigan Radio Observatory and the Metsahovi Radio Observatory. Hence, thus far, we have to research on limited sources. I attempt to draw light curves using VLBI data for those sources that have not been monitored by any observatories with single dish. I developed software, analyzed all geodetic VLBI data available at the IVS Data Centers, and drew the light curves at 8 GHz. In this report, I show the tentative results for two AGNs. I compared two light curves of 4C39.25, which were drawn based on single dish data and on VLBI data. I confirmed that the two light curves were consistent. Furthermore, I succeeded in drawing the light curve of 0454-234 with VLBI data, which has not been monitored by any observatory with single dish. In this report, I suggest that the geodetic VLBI archive data is useful to obtain the long-term light curves at radio bands for astrophysics.

  15. The role of Slr0151, a tetratricopeptide repeat protein from Synechocystis sp. PCC 6803, during Photosystem II assembly and repair

    Directory of Open Access Journals (Sweden)

    Anna eRast

    2016-05-01

    Full Text Available The assembly and repair of photosystem II (PSII is facilitated by a variety of assembly factors. Among those, the tetratricopeptide repeat (TPR protein Slr0151 from Synechocystis sp. PCC 6803 (hereafter Synechocystis has previously been assigned a repair function under high light conditions (Yang et al., 2014, J. Integr. Plant Biol. 56, 1136-50. Here, we show that inactivation of Slr0151 affects thylakoid membrane ultrastructure even under normal light conditions. Moreover, the level and localization of Slr0151 are affected in a variety of PSII-related mutants. In particular, the data suggest a close functional relationship between Slr0151 and Sll0933, which interacts with Ycf48 during PSII assembly and is homologous to PAM68 in Arabidopsis thaliana. Immunofluorescence analysis revealed a punctate distribution of Slr0151 within several different membrane types in Synechocystis cells.

  16. VLBI-derived troposphere parameters during CONT08

    Science.gov (United States)

    Heinkelmann, R.; Böhm, J.; Bolotin, S.; Engelhardt, G.; Haas, R.; Lanotte, R.; MacMillan, D. S.; Negusini, M.; Skurikhina, E.; Titov, O.; Schuh, H.

    2011-07-01

    Time-series of zenith wet and total troposphere delays as well as north and east gradients are compared, and zenith total delays ( ZTD) are combined on the level of parameter estimates. Input data sets are provided by ten Analysis Centers (ACs) of the International VLBI Service for Geodesy and Astrometry (IVS) for the CONT08 campaign (12-26 August 2008). The inconsistent usage of meteorological data and models, such as mapping functions, causes systematics among the ACs, and differing parameterizations and constraints add noise to the troposphere parameter estimates. The empirical standard deviation of ZTD among the ACs with regard to an unweighted mean is 4.6 mm. The ratio of the analysis noise to the observation noise assessed by the operator/software impact (OSI) model is about 2.5. These and other effects have to be accounted for to improve the intra-technique combination of VLBI-derived troposphere parameters. While the largest systematics caused by inconsistent usage of meteorological data can be avoided and the application of different mapping functions can be considered by applying empirical corrections, the noise has to be modeled in the stochastic model of intra-technique combination. The application of different stochastic models shows no significant effects on the combined parameters but results in different mean formal errors: the mean formal errors of the combined ZTD are 2.3 mm (unweighted), 4.4 mm (diagonal), 8.6 mm [variance component (VC) estimation], and 8.6 mm (operator/software impact, OSI). On the one hand, the OSI model, i.e. the inclusion of off-diagonal elements in the cofactor-matrix, considers the reapplication of observations yielding a factor of about two for mean formal errors as compared to the diagonal approach. On the other hand, the combination based on VC estimation shows large differences among the VCs and exhibits a comparable scaling of formal errors. Thus, for the combination of troposphere parameters a combination of the two

  17. Identification of a New Target slr0946 of the Response Regulator Sll0649 Involving Cadmium Tolerance in Synechocystis sp. PCC 6803

    Directory of Open Access Journals (Sweden)

    Tao Sun

    2017-08-01

    Full Text Available Survival of photosynthetic cyanobacteria is challenged by environmental contaminations like heavy metals. Among them, deciphering the regulatory mechanisms for cadmium (Cd in cyanobacteria would facilitate the construction of Cd-resistant strains. In this study, the DNA-Affinity-Purified-chromatin immunoprecipitation assay was employed to identify the direct targets of Sll0649, which was a Cd2+-related response regulator identified in our previous work in model cyanobacteria Synechocystis sp. PCC 6803. As a result, the promoter region of slr0946 encoding the arsenate reductase was enriched fourfolds by quantitative real time PCR analysis. Further, deletion of slr0946 led to a sensitive phenotype to Cd2+ stress compared with the wild type (WT and the sensitive phenotype of Δslr0946 could be rescued by complementation assay via introducing slr0946 back into Δslr0946. Finally, individually overexpression of slr0946 as well as two Cd2+-related genes identified priviously (i.e., sll1598 and slr0798 in WT could significantly improve the tolerance of Synechocystis sp. PCC 6803 to Cd2+. This study provided a better understanding of the tolerance mechanism to Cd2+ in cyanobacteria and also feasible strategies for tolerance modifications to heavy metals in the future.

  18. Postglacial Rebound from VLBI Geodesy: On Establishing Vertical Reference

    Science.gov (United States)

    Argus, Donald F.

    1996-01-01

    Difficulty in establishing a reference frame fixed to the earth's interior complicates the measurement of the vertical (radial) motions of the surface. I propose that a useful reference frame for vertical motions is that found by minimizing differences between vertical motions observed with VLBI [Ma and Ryan] and predictions from postglacial rebound predictions [Peltier]. The optimal translation of the geocenter is 1.7mm/year toward 36degN, 111degE when determined from the motions of 10 VLBI sites. This translation gives a better fit of observations to predictions than does the VLBI reference frame used by Ma and Ryan, but the improvement is statistically insignificant. The root mean square of differences decreases 20% to 0.73 mm/yr and the correlation coefficient increases from 0.76 to 0.87. Postglacial rebound is evident in the uplift of points in Sweden and Ontario that were beneath the ancient ice sheets of Fennoscandia and Canada, and in the subsidence of points in the northeastern U.S., Germany, and Alaska that were around the periphery of the ancient ice sheets.

  19. Automated and dynamic scheduling for geodetic VLBI - A simulation study for AuScope and global networks

    Science.gov (United States)

    Iles, E. J.; McCallum, L.; Lovell, J. E. J.; McCallum, J. N.

    2018-02-01

    As we move into the next era of geodetic VLBI, the scheduling process is one focus for improvement in terms of increased flexibility and the ability to react with changing conditions. A range of simulations were conducted to ascertain the impact of scheduling on geodetic results such as Earth Orientation Parameters (EOPs) and station coordinates. The potential capabilities of new automated scheduling modes were also simulated, using the so-called 'dynamic scheduling' technique. The primary aim was to improve efficiency for both cost and time without losing geodetic precision, particularly to maximise the uses of the Australian AuScope VLBI array. We show that short breaks in observation will not significantly degrade the results of a typical 24 h experiment, whereas simply shortening observing time degrades precision exponentially. We also confirm the new automated, dynamic scheduling mode is capable of producing the same standard of result as a traditional schedule, with close to real-time flexibility. Further, it is possible to use the dynamic scheduler to augment the 3 station Australian AuScope array and thereby attain EOPs of the current global precision with only intermittent contribution from 2 additional stations. We thus confirm automated, dynamic scheduling bears great potential for flexibility and automation in line with aims for future continuous VLBI operations.

  20. Love numbers for the long-period tides estimated by VLBI

    Science.gov (United States)

    Krásná, Hana; Böhm, Johannes; Haas, Rüdiger; Schuh, Harald

    2013-04-01

    Love and Shida numbers are proportionality factors characterizing the deformation of the anelastic Earth which arises as a response to external forces from the Moon and Sun. The increasing precision and quality of the Very Long Baseline Interferometry (VLBI) measurements allow determining those parameters. In particular, the long history of the VLBI data enables the estimation of Love and Shida numbers at the low frequencies of the tidal waves including the periods from 14 days to 18.6 years. In this study we analyse 27 years of VLBI measurements (1984.0 - 2011.0) following the recent IERS Conventions 2010. In several global solutions, we estimate the complex Love and Shida numbers of the solid Earth tides for the main long-period tidal waves. Furthermore, we determine the Love and Shida numbers of the rotational deformation due to polar motion, the so-called pole tide. We also focus on station displacement where still some deficiencies in the long-period signal modelling can be seen.

  1. Precise Orbital and Geodetic Parameter Estimation using SLR Observations for ILRS AAC

    Directory of Open Access Journals (Sweden)

    Young-Rok Kim

    2013-12-01

    Full Text Available In this study, we present results of precise orbital geodetic parameter estimation using satellite laser ranging (SLR observations for the International Laser Ranging Service (ILRS associate analysis center (AAC. Using normal point observations of LAGEOS-1, LAGEOS-2, ETALON-1, and ETALON-2 in SLR consolidated laser ranging data format, the NASA/ GSFC GEODYN II and SOLVE software programs were utilized for precise orbit determination (POD and finding solutions of a terrestrial reference frame (TRF and Earth orientation parameters (EOPs. For POD, a weekly-based orbit determination strategy was employed to process SLR observations taken from 20 weeks in 2013. For solutions of TRF and EOPs, loosely constrained scheme was used to integrate POD results of four geodetic SLR satellites. The coordinates of 11 ILRS core sites were determined and daily polar motion and polar motion rates were estimated. The root mean square (RMS value of post-fit residuals was used for orbit quality assessment, and both the stability of TRF and the precision of EOPs by external comparison were analyzed for verification of our solutions. Results of post-fit residuals show that the RMS of the orbits of LAGEOS-1 and LAGEOS-2 are 1.20 and 1.12 cm, and those of ETALON-1 and ETALON-2 are 1.02 and 1.11 cm, respectively. The stability analysis of TRF shows that the mean value of 3D stability of the coordinates of 11 ILRS core sites is 7.0 mm. An external comparison, with respect to International Earth rotation and Reference systems Service (IERS 08 C04 results, shows that standard deviations of polar motion Xp and Yp are 0.754 milliarcseconds (mas and 0.576 mas, respectively. Our results of precise orbital and geodetic parameter estimation are reasonable and help advance research at ILRS AAC.

  2. Using TDRSS as an orbiting VLBI observatory

    International Nuclear Information System (INIS)

    Ulvestad, J.S.

    1987-01-01

    The procedures and results of experimental VLBI astronomical observations performed using TDRSE, the first deployed satellite of the NASA TDRSS, as one of the network telescopes are reviewed. The other two elements of the VLBI network were the high-sensitivity 64-m antennas of the NASA DSN in Australia and of ISAS in Japan, with a 25-m Japanese antenna used to check their performance. The E configuration of the Mark III recording system at White Sands was used to record seven contiguous 2-MHz channels centered at 2.27799 GHz during five 3-h periods in July-August 1986. Although satellite pointing failures and ground-station problems limited the number of useful observations to six, interferometric fringes of the sources were obtained in all of these observations, demonstrating the feasibility of the approach. 6 references

  3. International VLBI Service for Geodesy and Astrometry 2007 Annual Report

    Science.gov (United States)

    Behrend, D. (Editor); Baver, K. D. (Editor)

    2008-01-01

    This volume of reports is the 2007 Annual Report of the International VLBI Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the components of IVS. The 2007 Annual Report documents the work of these IVS components over the period January 1, 2007 through December 31, 2007. The reports document changes, activities, and progress of the IVS. The entire contents of this Annual Report also appear on the IVS Web site at http://ivscc.gsfc.nasa.gov/publications/ar2007.

  4. International VLBI Service for Geodesy and Astrometry 2008 Annual Report

    Science.gov (United States)

    Behrend, Dirk; Baver, Karen D.

    2009-01-01

    This volume of reports is the 2008 Annual Report of the International VLBI Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the components of IVS. The 2008 Annual Report documents the work of these IVS components over the period January 1, 2008 through December 31, 2008. The reports document changes, activities, and progress of the IVS. The entire contents of this Annual Report also appear on the IVS Web site at http://ivscc.gsfc.nasa.gov/publications/ar2008.

  5. International VLBI Service for Geodesy and Astrometry 2011 Annual Report

    Science.gov (United States)

    Baver, Karen D. (Editor); Behrend, Dirk

    2012-01-01

    This volume of reports is the 2011 Annual Report of the International VLBI Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the components of IVS. The 2011 Annual Report documents the work of these IVS components over the period January 1, 2011 through December 31, 2011. The reports document changes, activities, and progress of the IVS. The entire contents of this Annual Report also appear on the IVS Web site at http://ivscc.gsfc.nasa.gov/publications/ar2011.

  6. International VLBI Service for Geodesy and Astrometry 2005 Annual Report

    Science.gov (United States)

    Behrend, Dirk (Editor); Baver, Karen D. (Editor)

    2006-01-01

    This volume of reports is the 2005 Annual Report of the International VLBI Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the components of IVS. The 2005 Annual Report documents the work of these IVS components over the period January 1, 2005 through December 31, 2005. The reports document changes, activities, and progress of the IVS. The entire contents of this Annual Report also appear on the IVS Web site at http://ivscc.gsfc.nasa.gov/publications/ar2005.

  7. Astrometry VLBI in Space (AVS

    Science.gov (United States)

    Altunin, V.; Alekseev, V.; Akim, E.; Eubanks, M.; Kingham, K.; Treuhaft, R.; Sukhanov, K.

    1995-01-01

    A proposed new space radio astronomy mission for astrometry is described. The Astrometry VLBI (very long baseline) in Space (AVS) nominal mission includes two identical spacecraft, each with a 4-m antenna sending data to a 70-m ground station. The goals of AVS are improving astrometry accuracy to the microarcsecond level and improving the accuracy of the transformation between the inertial radio and optical coordinate reference frames.

  8. NASA's Contribution to Global Space Geodesy Networks

    Science.gov (United States)

    Bosworth, John M.

    1999-01-01

    The NASA Space Geodesy program continues to be a major provider of space geodetic data for the international earth science community. NASA operates high performance Satellite Laser Ranging (SLR), Very Long Baseline Interferometry (VLBI) and Global Positioning System (GPS) ground receivers at well over 30 locations around the world and works in close cooperation with space geodetic observatories around the world. NASA has also always been at the forefront in the quest for technical improvement and innovation in the space geodesy technologies to make them even more productive, accurate and economical. This presentation will highlight the current status of NASA's networks; the plans for partnerships with international groups in the southern hemisphere to improve the geographic distribution of space geodesy sites and the status of the technological improvements in SLR and VLBI that will support the new scientific thrusts proposed by interdisciplinary earth scientists. In addition, the expanding role of the NASA Space geodesy data archive, the CDDIS will be described.

  9. An Experiment on Radio Location of Objects in the Near-Earth Space with VLBI in 2012

    Directory of Open Access Journals (Sweden)

    Nechaeva M.

    2013-03-01

    Full Text Available An experiment on radar location of space debris objects using of the method of VLBI was carried out in April, 2012. The radar VLBI experiment consisted in irradiation of some space debris objects (4 rocket stages and 5 inactive satellites with a signal of the transmitter with RT-70 in Evpatoria, Ukraine. Reflected signals were received by a complex of radio telescopes in the VLBI mode. The following VLBI stations took part in the observations: Ventspils (RT-32, Urumqi (RT-25, Medicina (RT-32 and Simeiz (RT-22. The experiment included measurements of the Doppler frequency shift and the delay for orbit refining, and measurements of the rotation period and sizes of objects by the amplitudes of output interferometer signals. The cross-correlation of VLBI-data is performed at a correlator NIRFI-4 of Radiophysical Research Institute (Nizhny Novgorod. Preliminary data processing resulted in the series of Doppler frequency shifts, which comprised the information on radial velocities of the objects. Some results of the experiment are presented.

  10. Orbit Determination Using SLR Data for STSAT-2C:Short-arc Analysis

    Directory of Open Access Journals (Sweden)

    Young-Rok Kim

    2015-09-01

    Full Text Available In this study, we present the results of orbit determination (OD using satellite laser ranging (SLR data for the Science and Technology Satellite (STSAT-2C by a short-arc analysis. For SLR data processing, the NASA/GSFC GEODYN II software with one year (2013/04 – 2014/04 of normal point observations is used. As there is only an extremely small quantity of SLR observations of STSAT-2C and they are sparsely distribution, the selection of the arc length and the estimation intervals for the atmospheric drag coefficients and the empirical acceleration parameters was made on an arc-to-arc basis. For orbit quality assessment, the post-fit residuals of each short-arc and orbit overlaps of arcs are investigated. The OD results show that the weighted root mean square post-fit residuals of short-arcs are less than 1 cm, and the average 1-day orbit overlaps are superior to 50/600/900 m for the radial/cross-track/along-track components. These results demonstrate that OD for STSAT-2C was successfully achieved with cm-level range precision. However its orbit quality did not reach the same level due to the availability of few and sparse measurement conditions. From a mission analysis viewpoint, obtaining the results of OD for STSAT-2C is significant for generating enhanced orbit predictions for more frequent tracking.

  11. The hazard of Sea Level Rise (SLR) in Greece: from scientific knowledge towards risk awareness of main actors

    Science.gov (United States)

    Dandoulaki, Miranda; Karymbalis, Efthimios; Yorgos, Melissourgos; Skordili, Sophia; Valkanou, Kanella

    2014-05-01

    A natural hazard that is expected to affect coastal areas in the near future is Sea-Level Rise (SLR) due to climate change. According to recent reports the eustatic sea-level rise caused by global warming will reach approximately 18-59 cm by the year 2100. Potential impacts of future sea-level rise include coastal erosion, frequent and intensified cyclonic activity and associated storm surge flooding that may affect the coastal zones, saltwater intrusion into groundwater aquifers, the inundation of ecologically significant wetlands, and threats to cultural and historical resources, as well as to infrastructure. The identification of sensitive sections of coasts and the assessment of potential impacts of SLR on these is therefore a fundamental, yet initial, step towards their protection. Greece has the most extensive coastline among all Mediterranean countries with most of the socio-economic activities concentrated along the coastal zone. Almost all big urban centres are coastal ones and the same stands for a great part of infrastructure (ports, airports, roads, electricity and telecommunications network etc). As a result, the impacts of a potential rise of the sea level are expected to seriously affect the entire country. The paper examines the vulnerability to SLR of coastal zones in Greece; however its main focus is how knowledge can lead to policy making and the protection of coastal areas. The main actors in respect to protection from SLR in Greece are identified and there is an attempt to pin point how the knowledge is communicated and shared between them. Barriers, bridges and gaps are detected as regards how information and knowledge lead to risk awareness and finally to the implementation of protection policies. A main finding of the paper is that SLR risk is far from becoming a policy priority in Greece, although steps are taken for addressing impacts attributed to SLR such as coastal erosion. In order to address this risk, there are many potential

  12. El Nino, La Nina and VLBI Measured LOD

    Science.gov (United States)

    Clark, Thomas A.; Gipson, J. M.; Ma, C.

    1998-01-01

    VLBI is one of the most important techniques for measuring Earth orientation parameters (EOP), and is unique in its ability to make high accuracy measurements of UT1, and its time derivative, which is related to changes in the length of day, conventionally called LOD. These measurements of EOP give constraints on geophysical models of the solid-Earth, atmosphere and oceans. Changes in EOP are due either to external torques from gravitational forces, or to the exchange of angular momentum between the Earth, atmosphere and oceans. The effect of the external torques is strictly harmonic and nature, and is therefore easy to remove. We analyze an LOD time series derived from VLBI measurements with the goal of comparing this to predictions from AAM, and various ENSO indices. Previous work by ourselves and other investigators demonstrated a high degree of coherence between atmospheric angular momentum (AAM) and EOP. We continue to see this. As the angular momentum of the atmosphere increases, the rate of rotation of the Earth decreases, and vice versa. The signature of the ENSO is particularly strong. At the peak of the 1982-83 El Nino increased LOD by almost 1 ms. This was subsequently followed by a reduction in LOD of 0.75 ms. At its peak, in February of 1998, the 1997-98 El Nino increased LOD by 0.8 msec. As predicted at the 1998 Spring AGU, this has been followed by an abrupt decrease in LOD which is currently -0.4 ms. At this time (August, 1998) the current ENSO continues to develop in new and unexpected ways. We plan to update our analysis with all data available prior to the Fall AGU.

  13. The New Generation Russian VLBI Network

    Science.gov (United States)

    Finkelstein, Andrey; Ipatov, Alexander; Smolentsev, Sergey; Mardyshkin, Vyacheslav; Fedotov, Leonid; Surkis, Igor; Ivanov, Dmitrij; Gayazov, Iskander

    2010-01-01

    This paper deals with a new project of the Russian VLBI Network dedicated for Universal Time determinations in quasi on-line mode. The basic principles of the network design and location of antennas are explained. Variants of constructing receiving devices, digital data acquisition system, and phase calibration system are specially considered. The frequency ranges and expected values of noise temperature are given.

  14. Preliminary design work on a DSN VLBI correlator. [Deep Space Network

    Science.gov (United States)

    Lushbaugh, W. A.; Layland, J. W.

    1978-01-01

    The Deep Space Network is in the process of fielding high-density digital instrumentation recorders for support of the Pioneer Venus 1978 entry experiment and other related tasks. It has long been obvious that these recorders would also serve well as the recording medium for very long base interferometry (VLBI) experiments with relatively weak radio sources, provided that a suitable correlation processor for these tape recordings could be established. The overall design and current status of a VLBI correlator designed to mate with these tape recorders are described.

  15. The Potential for a Ka-band (32 GHz) Worldwide VLBI Network

    Science.gov (United States)

    Jacobs, C. S.; Bach, U.; Colomer, F.; Garcia-Miro, C.; Gomez-Gonzalez, J.; Gulyaev, S.; Horiuchi, S.; Ichikawa, R.; Kraus, A.; Kronschnabl, G.; hide

    2012-01-01

    Ka-band (32 GHz, 9mm) Very Long Baseline Interferometric (VLBI) networking has now begun and has tremendous potential for expansion over the next few years. Ka-band VLBI astrometry from NASA's Deep Space Network has already developed a catalog of 470 observable sources with highly accurate positions. Now, several antennas worldwide are planning or are considering adding Ka-band VLBI capability. Thus, there is now an opportunity to create a worldwide Ka-band network with potential for high resolution imaging and astrometry. With baselines approaching a Giga-lambda, a Ka-band network would be able to probe source structure at the nano-radian (200 as) level ( 100X better than Hubble) and thus gain insight into the astrophysics of the most compact regions of emission in active galactic nuclei. We discuss the advantages of Ka-band, show the known sources and candidates, simulate projected baseline (uv) coverage, and discuss potential radio frequency feeds. The combination of these elements demonstrates the feasibility of a worldwide Ka network within the next few years!

  16. VLBI observations with the Kunming 40-meter radio telescope

    International Nuclear Information System (INIS)

    Hao Longfei; Wang Min; Yang Jun

    2010-01-01

    The Kunming 40-meter radio telescope is situated in the yard of the Yunnan Astronomical Observatory (Longitude: 102.8 0 East, Latitude: 25.0 0 North) and saw its first light in 2006 May. The Kunming station successfully joined the VLBI tracking of China's first lunar probe 'Chang'E-1 together with the other Chinese telescopes: the Beijing Miyun 50-meter radio telescope, Urumqi Nanshan 25-meter radio telescope, and Shanghai Sheshan 25-meter radio telescope, and received the downlinked scientific data together with the Miyun station from October of 2007 to March of 2009. We give an introduction to the new Chinese VLBI facility and investigate its potential applications. Due to its location, the Kunming station can significantly improve the u - v coverage of the European VLBI Network (EVN), in particular, in long baseline observations. We also report the results of the first EVN fringe-test experiment of N09SX1 with the Kunming station. The first fringes in the European telescopes were successfully detected at 2.3 GHz with the ftp-transferred data on 2009 June 17. From scheduling the observations to performing the post correlations, the Kunming station shows its good compatibility to work with the EVN. The imaging result of the extended source 1156+295 further demonstrates that the Kunming station greatly enhances the EVN performance. (research papers)

  17. THE BENEFITS OF VLBI ASTROMETRY TO PULSAR TIMING ARRAY SEARCHES FOR GRAVITATIONAL RADIATION

    Energy Technology Data Exchange (ETDEWEB)

    Madison, D. R.; Chatterjee, S.; Cordes, J. M. [Department of Astronomy and Center for Radiophysics and Space Research, Cornell University, Ithaca, NY 14850 (United States)

    2013-11-10

    Precision astrometry is an integral component of successful pulsar timing campaigns. Astrometric parameters are commonly derived by fitting them as parameters of a timing model to a series of pulse times of arrival (TOAs). TOAs measured to microsecond precision over spans of several years can yield position measurements with sub-milliarcsecond precision. However, timing-based astrometry can become biased if a pulsar displays any red spin noise or a red signal produced by the stochastic gravitational wave background. We investigate how noise of different spectral types is absorbed by timing models, leading to significant estimation biases in the astrometric parameters. We find that commonly used techniques for fitting timing models in the presence of red noise (Cholesky whitening) prevent the absorption of noise into the timing model remarkably well if the time baseline of observations exceeds several years, but are inadequate for dealing with shorter pulsar data sets. Independent of timing, pulsar-optimized very long baseline interferometry (VLBI) is capable of providing position estimates precise to the sub-milliarcsecond levels needed for high-precision timing. In order to make VLBI astrometric parameters useful in pulsar timing models, the transformation between the International Celestial Reference Frame (ICRF) and the dynamical solar system ephemeris used for pulsar timing must be constrained to within a few microarcseconds. We compute a transformation between the ICRF and pulsar timing frames and quantitatively discuss how the transformation will improve in coming years. We find that incorporating VLBI astrometry into the timing models of pulsars for which only a couple of years of timing data exist will lead to more realistic assessments of red spin noise and could enhance the amplitude of gravitational wave signatures in post-fit timing residuals by factors of 20 or more.

  18. SAND: an automated VLBI imaging and analysing pipeline - I. Stripping component trajectories

    Science.gov (United States)

    Zhang, M.; Collioud, A.; Charlot, P.

    2018-02-01

    We present our implementation of an automated very long baseline interferometry (VLBI) data-reduction pipeline that is dedicated to interferometric data imaging and analysis. The pipeline can handle massive VLBI data efficiently, which makes it an appropriate tool to investigate multi-epoch multiband VLBI data. Compared to traditional manual data reduction, our pipeline provides more objective results as less human interference is involved. The source extraction is carried out in the image plane, while deconvolution and model fitting are performed in both the image plane and the uv plane for parallel comparison. The output from the pipeline includes catalogues of CLEANed images and reconstructed models, polarization maps, proper motion estimates, core light curves and multiband spectra. We have developed a regression STRIP algorithm to automatically detect linear or non-linear patterns in the jet component trajectories. This algorithm offers an objective method to match jet components at different epochs and to determine their proper motions.

  19. Earth orientation determinations by short duration VLBI observations

    Science.gov (United States)

    Nothnagel, Axel; Zhihan, Qian; Nicolson, George D.; Tomasi, Paolo

    1994-03-01

    In May 1989 and April 1990 the radio telescopes of the Wettzell Geodetic Fundamental Station in Germany and of the Shanghai Observatory near Seshan in China observed two series of daily VLBI experiments of short duration for precise determination of UT1. In 1990 a few experiments were complemented by the Hartebeesthoek Radio Astronomy Observatory in South Africa and the Medicina telescope of the Bologna Istituto di Radioastronomia in Italy. Employing the South African station together with the east-west baseline formed by the observatories of Seshan and Medicina permitted simultaneous determinations of UT1 and polar motion. Here we report on the results of these observations. Comparing the UT1 results with those of the IRIS Intensive series gives a clear indication of the absolute accuracy of such short duration VLBI measurements which is estimated to be of the order of ±60 µs.

  20. Basic Earth's Parameters as estimated from VLBI observations

    Directory of Open Access Journals (Sweden)

    Ping Zhu

    2017-11-01

    Full Text Available The global Very Long Baseline Interferometry observation for measuring the Earth rotation's parameters was launched around 1970s. Since then the precision of the measurements is continuously improving by taking into account various instrumental and environmental effects. The MHB2000 nutation model was introduced in 2002, which is constructed based on a revised nutation series derived from 20 years VLBI observations (1980–1999. In this work, we firstly estimated the amplitudes of all nutation terms from the IERS-EOP-C04 VLBI global solutions w.r.t. IAU1980, then we further inferred the BEPs (Basic Earth's Parameters by fitting the major nutation terms. Meanwhile, the BEPs were obtained from the same nutation time series using a BI (Bayesian Inversion. The corrections to the precession rate and the estimated BEPs are in an agreement, independent of which methods have been applied.

  1. ostglacial rebound from VLBI Geodesy: On Establishing Vertical Reference

    Science.gov (United States)

    Argus, Donald .

    1996-01-01

    I propose that a useful reference frame for vertical motions is that found by minimizing differences between vertical motions observed with VLBI [Ma and Ryan, 1995] and predictions from postglacial rebound predictions [Peltier, 1995].

  2. On the Assessment of Global Terrestrial Reference Frame Temporal Variations

    Science.gov (United States)

    Ampatzidis, Dimitrios; Koenig, Rolf; Zhu, Shengyuan

    2015-04-01

    Global Terrestrial Reference Frames (GTRFs) as the International Terrestrial Reference Frame (ITRF) provide reliable 4-D position information (3-D coordinates and their evolution through time). The given 3-D velocities play a significant role in precise position acquisition and are estimated from long term coordinate time series from the space-geodetic techniques DORIS, GNSS, SLR, and VLBI. GTRFs temporal evolution is directly connected with their internal stability: The more intense and inhomogeneous velocity field, the less stable TRF is derived. The assessment of the quality of the GTRF is mainly realized by comparing it to each individual technique's reference frame. E.g the comparison of GTRFs to SLR-only based TRF gives the sense of the ITRF stability with respect to the Geocenter and scale and their associated rates respectively. In addition, the comparison of ITRF to the VLBI-only based TRF can be used for the scale validation. However, till now there is not any specified methodology for the total assessment (in terms of origin, orientation and scale respectively) of the temporal evolution and GTRFs associated accuracy. We present a new alternative diagnostic tool for the assessment of GTRFs temporal evolution based on the well-known time-dependent Helmert type transformation formula (three shifts, three rotations and scale rates respectively). The advantage of the new methodology relies on the fact that it uses the full velocity field of the TRF and therefore all points not just the ones common to different techniques. It also examines simultaneously rates of origin, orientation and scale. The methodology is presented and implemented to the two existing GTRFs on the market (ITRF and DTRF which is computed from DGFI) , the results are discussed. The results also allow to compare directly each GTRF dynamic behavior. Furthermore, the correlations of the estimated parameters can also provide useful information to the proposed GTRFs assessment scheme.

  3. International VLBI Service for Geodesy and Astrometry 2013 Annual Report

    Science.gov (United States)

    Baver, Karen D.; Behrend, Dirk; Armstrong, Kyla L.

    2014-01-01

    This volume of reports is the 2013 Annual Report of the International VLBI Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the permanent components of IVS. The IVS 2013 Annual Report documents the work of the IVS components for the calendar year 2013, our fifteenth year of existence. The reports describe changes, activities, and progress of the IVS. Many thanks to all IVS components who contributed to this Annual Report. With the exception of the first section and the last section, the contents of this Annual Report also appear on the IVS Web site at http://ivscc.gsfc.nasa.gov/publications/ar2013.

  4. A VLBI resolution of the Pleiades distance controversy.

    Science.gov (United States)

    Melis, Carl; Reid, Mark J; Mioduszewski, Amy J; Stauffer, John R; Bower, Geoffrey C

    2014-08-29

    Because of its proximity and its youth, the Pleiades open cluster of stars has been extensively studied and serves as a cornerstone for our understanding of the physical properties of young stars. This role is called into question by the "Pleiades distance controversy," wherein the cluster distance of 120.2 ± 1.5 parsecs (pc) as measured by the optical space astrometry mission Hipparcos is significantly different from the distance of 133.5 ± 1.2 pc derived with other techniques. We present an absolute trigonometric parallax distance measurement to the Pleiades cluster that uses very long baseline radio interferometry (VLBI). This distance of 136.2 ± 1.2 pc is the most accurate and precise yet presented for the cluster and is incompatible with the Hipparcos distance determination. Our results cement existing astrophysical models for Pleiades-age stars. Copyright © 2014, American Association for the Advancement of Science.

  5. Early science with the Korean VLBI network: evaluation of system performance

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Sang-Sung; Byun, Do-Young; Kim, Jongsoo; Jung, Taehyun; Song, Min-Gyu; Oh, Chung Sik; Roh, Duk-Gyoo; Je, Do-Heung; Wi, Seog-Oh; Sohn, Bong Won; Oh, Se-Jin; Kim, Kee-Tae; Yeom, Jae-Hwan; Chung, Moon-Hee; Kang, Jiman; Han, Seog-Tae; Lee, Jung-Won; Kim, Bong Gyu; Chung, Hyunsoo [Korea Astronomy and Space Science Institute, Daedeokdae-ro 776, Yuseong-gu, Daejeon 305-348 (Korea, Republic of); Petrov, Leonid, E-mail: sslee@kasi.re.kr [Astrogeo Center, Falls Church, VA 22043 (United States); and others

    2014-04-01

    We report the very long baseline interferometry (VLBI) observing performance of the Korean VLBI Network (KVN). The KVN is the first millimeter-dedicated VLBI network in East Asia. The KVN consists of three 21 m radio telescopes with baseline lengths in a range of 305-476 km. The quasi-optical system equipped on the antennas allows simultaneous observations at 22, 43, 86, and 129 GHz. The first fringes of the KVN were obtained at 22 GHz on 2010 June 8. Test observations at 22 and 43 GHz on 2010 September 30 and 2011 April 4 confirmed that the full cycle of VLBI observations works according to specification: scheduling, antenna control system, data recording, correlation, post-correlation data processing, astrometry, geodesy, and imaging analysis. We found that decorrelation due to instability in the hardware at times up to 600 s is negligible. The atmosphere fluctuations at KVN baseline are partly coherent, which allows us to extend integration time under good winter weather conditions up to 600 s without significant loss of coherence. The post-fit residuals at KVN baselines do not exhibit systematic patterns, and the weighted rms of the residuals is 14.8 ps. The KVN is ready to image compact radio sources both in snapshot and full-track modes with residual noise in calibrated phases of less than 2 deg at 22 and 43 GHz and with dynamic ranges of ∼300 for snapshot mode and ∼1000 for full-track mode. With simultaneous multi-frequency observations, the KVN can be used to make parsec-scale spectral index maps of compact radio sources.

  6. DETECTING CHANGING POLARIZATION STRUCTURES IN SAGITTARIUS A* WITH HIGH FREQUENCY VLBI

    International Nuclear Information System (INIS)

    Fish, Vincent L.; Doeleman, Sheperd S.; Rogers, Alan E. E.; Broderick, Avery E.; Loeb, Abraham

    2009-01-01

    Sagittarius A* is the source of near infrared, X-ray, radio, and (sub)millimeter emission associated with the supermassive black hole at the Galactic Center. In the submillimeter regime, Sgr A* exhibits time-variable linear polarization on timescales corresponding to 6 M sun black hole. In previous work, we demonstrated the potential for total-intensity (sub)millimeter-wavelength very long baseline interferometry (VLBI) to detect time-variable-and periodic-source structure changes in the Sgr A* black hole system using nonimaging analyses. Here, we extend this work to include full polarimetric VLBI observations. We simulate full-polarization (sub)millimeter VLBI data of Sgr A* using a hot spot model that is embedded within an accretion disk, with emphasis on nonimaging polarimetric data products that are robust against calibration errors. Although the source-integrated linear polarization fraction in the models is typically only a few percent, the linear polarization fraction on small angular scales can be much higher, enabling the detection of changes in the polarimetric structure of Sgr A* on a wide variety of baselines. The shortest baselines track the source-integrated linear polarization fraction, while longer baselines are sensitive to polarization substructures that are beam-diluted by connected-element interferometry. The detection of periodic variability in source polarization should not be significantly affected even if instrumental polarization terms cannot be calibrated out. As more antennas are included in the (sub)millimeter-VLBI array, observations with full polarization will provide important new diagnostics to help disentangle intrinsic source polarization from Faraday rotation effects in the accretion and outflow region close to the black hole event horizon.

  7. DETECTING CHANGING POLARIZATION STRUCTURES IN SAGITTARIUS A* WITH HIGH FREQUENCY VLBI

    Energy Technology Data Exchange (ETDEWEB)

    Fish, Vincent L; Doeleman, Sheperd S; Rogers, Alan E. E. [Massachusetts Institute of Technology, Haystack Observatory, Route 40, Westford, MA 01886 (United States); Broderick, Avery E [Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St. George Street, Toronto, ON M5S 3H8 (Canada); Loeb, Abraham [Institute for Theory and Computation, Harvard University, Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2009-12-01

    Sagittarius A* is the source of near infrared, X-ray, radio, and (sub)millimeter emission associated with the supermassive black hole at the Galactic Center. In the submillimeter regime, Sgr A* exhibits time-variable linear polarization on timescales corresponding to <10 Schwarzschild radii of the presumed 4 x 10{sup 6} M {sub sun} black hole. In previous work, we demonstrated the potential for total-intensity (sub)millimeter-wavelength very long baseline interferometry (VLBI) to detect time-variable-and periodic-source structure changes in the Sgr A* black hole system using nonimaging analyses. Here, we extend this work to include full polarimetric VLBI observations. We simulate full-polarization (sub)millimeter VLBI data of Sgr A* using a hot spot model that is embedded within an accretion disk, with emphasis on nonimaging polarimetric data products that are robust against calibration errors. Although the source-integrated linear polarization fraction in the models is typically only a few percent, the linear polarization fraction on small angular scales can be much higher, enabling the detection of changes in the polarimetric structure of Sgr A* on a wide variety of baselines. The shortest baselines track the source-integrated linear polarization fraction, while longer baselines are sensitive to polarization substructures that are beam-diluted by connected-element interferometry. The detection of periodic variability in source polarization should not be significantly affected even if instrumental polarization terms cannot be calibrated out. As more antennas are included in the (sub)millimeter-VLBI array, observations with full polarization will provide important new diagnostics to help disentangle intrinsic source polarization from Faraday rotation effects in the accretion and outflow region close to the black hole event horizon.

  8. VLBI detection of the internal shocks in nova V959 Mon

    Science.gov (United States)

    Yang, J.; Paragi, Z.; O'Brien, T.; Chomiuk, L.; Linford, J. D.

    V959 Mon is a classical nova detected at GeV gamma-ray wavelengths on 2012 June 19. While classical novae are now routinely detected in gamma-rays, the origin of the shocks that produce relativistic particles has remained unknown. We carried out electronic European VLBI Network (e-EVN) observations that revealed a pair of compact synchrotron emission features in V959 Mon on 2012 Sep 18. Since synchrotron emission requires strong shocks as well, we identify these features as the location where the gamma rays were produced. We also detected the extended ejecta in the follow-up EVN observations. They expanded much faster in East-West direction than the compact knots detected in the aforementioned e-EVN measurements. By comparing the VLBI results with lower resolution images obtained using e-MERLIN and the VLA - as reported by Chomiuk et al. (2014) - it appears that 1) influenced by the binary orbit, the nova ejecta was highly asymmetric with a dense and slow outflow in the equatorial plane and low-density and faster ejecta along the poles; and 2) the VLBI knots were related to shocks formed in the interaction region of these outflows.

  9. Optimizing the African VLBI Network for Astronomy and Geodesy

    Science.gov (United States)

    de Witt, A.; Mayer, D.; MacLeod, G.; Combrinck, L.; Petrov, L.; Nickola, M.

    2016-12-01

    The African VLBI Network will be a pan-African network of radio telescopes comprised of converted redundant satellite Earth-station antennas and new purpose-built radio telescopes. The first of these antennas, in Ghana, is currently being converted to a radio telescope and current funding is estimated to permit the conversion of two more antennas in Africa. These antennas will initially be equipped with a 5-GHz and 6.7-GHz receiver and the next receiver likely to be fitted is a 1.4-1.7-GHz receiver. While it would be advantageous for the AVN antennas to be able to participate also in geodetic and astrometric VLBI observations, there is no funding currently for this. In this paper we re-visit the scientific justifications for the AVN in an attempt to optimize the AVN for each science case, both astronomical and geodetic.

  10. International VLBI Service for Geodesy and Astrometry 2012 Annual Report

    Science.gov (United States)

    Baver, Karen D.; Behrend, Dirk; Armstrong, Kyla L.

    2013-01-01

    This volume of reports is the 2012 Annual Report of the International VLBI Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the permanent components of IVS. The IVS 2012 Annual Report documents the work of the IVS components for the calendar year 2012, our fourteenth year of existence. The reports describe changes, activities, and progress ofthe IVS. Many thanks to all IVS components who contributed to this Annual Report. With the exception of the first section and parts of the last section (described below), the contents of this Annual Report also appear on the IVS Web site athttp:ivscc.gsfc.nasa.gov/publications/ar2012

  11. On the Impact of Inhomogeneities in Meteorological Data on VLBI Data Analysis

    Science.gov (United States)

    Balidakis, Kyriakos; Heinkelmann, Robert; Phogat, Apurva; Soja, Benedikt; Glaser, Susanne; Nilsson, Tobias; Karbon, Maria; Schuh, Harald

    2016-12-01

    In this study, we address the issue of the quality of meteorological data employed for VLBI data analysis. We use data from six numerical weather models (NWMs) to form references on which the homogenization process is based. We explore the impact of the choice of NWM as well as the way to extract data from it. Among our findings is that data from the surface fields of NWMs are not suitable for either geodetic analysis or homogenization efforts, whether they are in their original form or after they have been compensated for the height difference between the orography of the NWM and the actual elevation. The reason lies in the fact that for 77% of the VLBI stations a height bias larger than 2.5 mm appears, as well as an average bias in the zenith wet delay estimates of 12.2 mm. Should the proposed extraction approach be followed, the difference between operational and reanalysis NWMs is not significant for such an application. Our conclusions are based on the analysis of VLBI data over 13 years.

  12. Earth Rotation Parameters from DSN VLBI: 1996

    Science.gov (United States)

    Steppe, J. A.; Oliveau, S. H.; Sovers, O. J.

    1996-01-01

    A despcription of the DSN VLBI data set and of most aspects of the data analysis can be found in the IERS Technical Note 17, pp. R-19 to R-32 (see also IERS Technical Note 19, pp. R-21 to R-27). The main changes in this year's analysis form last year's are simply due to including another year's data.

  13. Proceedings of the Sixth General Meeting of the International VLBI Service for Geodesy and Astrometry

    Science.gov (United States)

    Behrend, Dirk (Editor); Baver, Karen D. (Editor)

    2010-01-01

    This volume is the proceedings of the sixth General Meeting of the International VLBI Service for Geodesy and Astrometry (IVS), held in Hobart, Tasmania, Australia, February 7-13, 2010. The contents of this volume also appear on the IVS Web site at http://ivscc.gsfc.nasa.gov/publications/gm2010. The keynote of the sixth GM was the new perspectives of the next generation VLBI system under the theme "VLBI2010: From Vision to Reality". The goal of the meeting was to provide an interesting and informative program for a wide cross-section of IVS members, including station operators, program managers, and analysts. This volume contains 88 papers. All papers were edited by the editors for usage of the English language, form, and minor content-related issues.

  14. Space Geodetic Technique Co-location in Space: Simulation Results for the GRASP Mission

    Science.gov (United States)

    Kuzmicz-Cieslak, M.; Pavlis, E. C.

    2011-12-01

    The Global Geodetic Observing System-GGOS, places very stringent requirements in the accuracy and stability of future realizations of the International Terrestrial Reference Frame (ITRF): an origin definition at 1 mm or better at epoch and a temporal stability on the order of 0.1 mm/y, with similar numbers for the scale (0.1 ppb) and orientation components. These goals were derived from the requirements of Earth science problems that are currently the international community's highest priority. None of the geodetic positioning techniques can achieve this goal alone. This is due in part to the non-observability of certain attributes from a single technique. Another limitation is imposed from the extent and uniformity of the tracking network and the schedule of observational availability and number of suitable targets. The final limitation derives from the difficulty to "tie" the reference points of each technique at the same site, to an accuracy that will support the GGOS goals. The future GGOS network will address decisively the ground segment and to certain extent the space segment requirements. The JPL-proposed multi-technique mission GRASP (Geodetic Reference Antenna in Space) attempts to resolve the accurate tie between techniques, using their co-location in space, onboard a well-designed spacecraft equipped with GNSS receivers, a SLR retroreflector array, a VLBI beacon and a DORIS system. Using the anticipated system performance for all four techniques at the time the GGOS network is completed (ca 2020), we generated a number of simulated data sets for the development of a TRF. Our simulation studies examine the degree to which GRASP can improve the inter-technique "tie" issue compared to the classical approach, and the likely modus operandi for such a mission. The success of the examined scenarios is judged by the quality of the origin and scale definition of the resulting TRF.

  15. 1.3 mm WAVELENGTH VLBI OF SAGITTARIUS A*: DETECTION OF TIME-VARIABLE EMISSION ON EVENT HORIZON SCALES

    International Nuclear Information System (INIS)

    Fish, Vincent L.; Doeleman, Sheperd S.; Beaudoin, Christopher; Bolin, David E.; Rogers, Alan E. E.; Blundell, Ray; Gurwell, Mark A.; Moran, James M.; Primiani, Rurik; Bower, Geoffrey C.; Plambeck, Richard; Chamberlin, Richard; Freund, Robert; Friberg, Per; Honma, Mareki; Oyama, Tomoaki; Inoue, Makoto; Krichbaum, Thomas P.; Lamb, James; Marrone, Daniel P.

    2011-01-01

    Sagittarius A*, the ∼4 x 10 6 M sun black hole candidate at the Galactic center, can be studied on Schwarzschild radius scales with (sub)millimeter wavelength very long baseline interferometry (VLBI). We report on 1.3 mm wavelength observations of Sgr A* using a VLBI array consisting of the JCMT on Mauna Kea, the Arizona Radio Observatory's Submillimeter Telescope on Mt. Graham in Arizona, and two telescopes of the CARMA array at Cedar Flat in California. Both Sgr A* and the quasar calibrator 1924-292 were observed over three consecutive nights, and both sources were clearly detected on all baselines. For the first time, we are able to extract 1.3 mm VLBI interferometer phase information on Sgr A* through measurement of closure phase on the triangle of baselines. On the third night of observing, the correlated flux density of Sgr A* on all VLBI baselines increased relative to the first two nights, providing strong evidence for time-variable change on scales of a few Schwarzschild radii. These results suggest that future VLBI observations with greater sensitivity and additional baselines will play a valuable role in determining the structure of emission near the event horizon of Sgr A*.

  16. Current Trends and Challenges in Satellite Laser Ranging

    Science.gov (United States)

    Appleby, Graham M.; Bianco, Giuseppe; Noll, Carey E.; Pavlis, Erricos C.; Pearlman, Michael R.

    2016-12-01

    Satellite Laser Ranging (SLR) is used to measure accurately the distance from ground stations to retro-reflectors on satellites and on the Moon. SLR is one of the fundamental space-geodetic techniques that define the International Terrestrial Reference Frame (ITRF), which is the basis upon which many aspects of global change over space, time, and evolving technology are measured; with VLBI the two techniques define the scale of the ITRF; alone the SLR technique defines its origin (geocenter). The importance of the reference frame has recently been recognized at the inter-governmental level through the United Nations, which adopted in February 2015 the Resolution "Global Geodetic Reference Frame for Sustainable Development." Laser Ranging provides precision orbit determination and instrument calibration and validation for satellite-borne altimeters for the better understanding of sea level change, ocean dynamics, ice mass-balance, and terrestrial topography. It is also a tool to study the dynamics of the Moon and fundamental constants and theories. With the exception of the currently in-orbit GPS constellation, all GNSS satellites now carry retro-reflectors for improved orbit determination, harmonization of reference frames, and in-orbit co-location and system performance validation; the next generation of GPS satellites due for launch from 2019 onwards will also carry retro-reflectors. The ILRS delivers weekly realizations that are accumulated sequentially to extend the ITRF and the Earth Orientation Parameter series with a daily resolution. SLR technology continues to evolve towards the next-generation laser ranging systems and it is expected to successfully meet the challenges of the GGOS2020 program for a future Global Space Geodetic Network. Ranging precision is improving as higher repetition rate, narrower pulse lasers, and faster detectors are implemented within the network. Automation and pass interleaving at some stations is expanding temporal coverage and

  17. 78 FR 7331 - SLR; Fajardo Offshore Grand Prix; Rada Fajardo; Fajardo, PR

    Science.gov (United States)

    2013-02-01

    ... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 100 [Docket Number USCG-2012-1098] RIN 1625-AA08 SLR; Fajardo Offshore Grand Prix; Rada Fajardo; Fajardo, PR AGENCY: Coast Guard, DHS. ACTION: Notice of Proposed Rulemaking. SUMMARY: The Coast Guard is establishing a special local regulation on the...

  18. VLBI observations of Infrared-Faint Radio Sources

    Science.gov (United States)

    Middelberg, Enno; Phillips, Chris; Norris, Ray; Tingay, Steven

    2006-10-01

    We propose to observe a small sample of radio sources from the ATLAS project (ATLAS = Australia Telescope Large Area Survey) with the LBA, to determine their compactness and map their structures. The sample consists of three radio sources with no counterpart in the co-located SWIRE survey (3.6 um to 160 um), carried out with the Spitzer Space Telescope. This rare class of sources, dubbed Infrared-Faint Radio Sources, or IFRS, is inconsistent with current galaxy evolution models. VLBI observations are an essential way to obtain further clues on what these objects are and why they are hidden from infrared observations: we will map their structure to test whether they resemble core-jet or double-lobed morphologies, and we will measure the flux densities on long baselines, to determine their compactness. Previous snapshot-style LBA observations of two other IFRS yielded no detections, hence we propose to use disk-based recording with 512 Mbps where possible, for highest sensitivity. With the observations proposed here, we will increase the number of VLBI-observed IFRS from two to five, soon allowing us to draw general conclusions about this intriguing new class of objects.

  19. Spermidine promotes Bacillus subtilis biofilm formation by activating expression of the matrix regulator slrR.

    Science.gov (United States)

    Hobley, Laura; Li, Bin; Wood, Jennifer L; Kim, Sok Ho; Naidoo, Jacinth; Ferreira, Ana Sofia; Khomutov, Maxim; Khomutov, Alexey; Stanley-Wall, Nicola R; Michael, Anthony J

    2017-07-21

    Ubiquitous polyamine spermidine is not required for normal planktonic growth of Bacillus subtilis but is essential for robust biofilm formation. However, the structural features of spermidine required for B. subtilis biofilm formation are unknown and so are the molecular mechanisms of spermidine-stimulated biofilm development. We report here that in a spermidine-deficient B. subtilis mutant, the structural analogue norspermidine, but not homospermidine, restored biofilm formation. Intracellular biosynthesis of another spermidine analogue, aminopropylcadaverine, from exogenously supplied homoagmatine also restored biofilm formation. The differential ability of C-methylated spermidine analogues to functionally replace spermidine in biofilm formation indicated that the aminopropyl moiety of spermidine is more sensitive to C -methylation, which it is essential for biofilm formation, but that the length and symmetry of the molecule is not critical. Transcriptomic analysis of a spermidine-depleted B. subtilis speD mutant uncovered a nitrogen-, methionine-, and S -adenosylmethionine-sufficiency response, resulting in repression of gene expression related to purine catabolism, methionine and S -adenosylmethionine biosynthesis and methionine salvage, and signs of altered membrane status. Consistent with the spermidine requirement in biofilm formation, single-cell analysis of this mutant indicated reduced expression of the operons for production of the exopolysaccharide and TasA protein biofilm matrix components and SinR antagonist slrR Deletion of sinR or ectopic expression of slrR in the spermidine-deficient Δ speD background restored biofilm formation, indicating that spermidine is required for expression of the biofilm regulator slrR Our results indicate that spermidine functions in biofilm development by activating transcription of the biofilm matrix exopolysaccharide and TasA operons through the regulator slrR . © 2017 by The American Society for Biochemistry and

  20. ITRF2014 Evaluation with ILRS Data and Products

    Science.gov (United States)

    Pavlis, E. C.; Luceri, V.; Kuzmicz-Cieslak, M.; König, D.; Bianco, G.

    2015-12-01

    The development and release of the new realization of the International Terrestrial Reference Frame—ITRF2014 requires elaborate testing to ensure the quality of the final product. The evaluation effort ensures that the ITRF is of the indicated quality by its error estimates and the combination has not compromised the contributing techniques' input. The International Laser Ranging Service (ILRS) contributes unique information that only Satellite Laser Ranging—SLR is sensitive to: the definition of the origin, and in equal parts with VLBI, the scale of the model. The ILRS analysts adopted a revision of the internal standards and procedures in developing our contribution to ITRF2014 from our eight Analysis Centers. Anticipating the release of ITRF2014 we worked on designing and executing tests using data and products unique to ILRS. In addition to the data contributed to ITRF2014, ILRS has several other targets, in lower and higher orbits, the SLR tracking data of which are used as independent data for the evaluation process. Since SLR data are primarily sensitive to the origin and scale definition of the TRF model, these model attributes are the best to be validated using SLR data. LAGEOS and ETALON data collected outside the span of data used in ITRF2014 can also evaluate the quality of the estimated velocity vectors. The use of independent SLR data evaluates the model throughout the period that such data are available. SLR data from low altitude missions can validate the performance of the model from the late '70s all the way to present (using e.g. STARLETTE and LARES data). This presentation will give an overview of the new model's evaluation using exclusively ILRS tracking data and other ILRS products.

  1. Time series of low-degree geopotential coefficients from SLR data: estimation of Earth's figure axis and LOD variations

    Science.gov (United States)

    Luceri, V.; Sciarretta, C.; Bianco, G.

    2012-12-01

    The redistribution of the mass within the earth system induces changes in the Earth's gravity field. In particular, the second-degree geopotential coefficients reflect the behaviour of the Earth's inertia tensor of order 2, describing the main mass variations of our planet impacting the EOPs. Thanks to the long record of accurate and continuous laser ranging observations to Lageos and other geodetic satellites, SLR is the only current space technique capable to monitor the long time variability of the Earth's gravity field with adequate accuracy. Time series of low-degree geopotential coefficients are estimated with our analysis of SLR data (spanning more than 25 years) from several geodetic satellites in order to detect trends and periodic variations related to tidal effects and atmospheric/oceanic mass variations. This study is focused on the variations of the second-degree Stokes coefficients related to the Earth's principal figure axis and oblateness: C21, S21 and C20. On the other hand, surface mass load variations induce excitations in the EOPs that are proportional to the same second-degree coefficients. The time series of direct estimates of low degree geopotential and those derived from the EOP excitation functions are compared and presented together with their time and frequency analysis.

  2. Development of Very Long Baseline Interferometry (VLBI) techniques in New Zealand: Array simulation, image synthesis and analysis

    Science.gov (United States)

    Weston, S. D.

    2008-04-01

    This thesis presents the design and development of a process to model Very Long Base Line Interferometry (VLBI) aperture synthesis antenna arrays. In line with the Auckland University of Technology (AUT) Institute for Radiophysics and Space Research (IRSR) aims to develop the knowledge, skills and experience within New Zealand, extensive use of existing radio astronomical software has been incorporated into the process namely AIPS (Astronomical Imaging Processing System), MIRIAD (a radio interferometry data reduction package) and DIFMAP (a program for synthesis imaging of visibility data from interferometer arrays of radio telescopes). This process has been used to model various antenna array configurations for two proposed New Zealand sites for antenna in a VLBI array configuration with existing Australian facilities and a passable antenna at Scott Base in Antarctica; and the results are presented in an attempt to demonstrate the improvement to be gained by joint trans-Tasman VLBI observation. It is hoped these results and process will assist the planning and placement of proposed New Zealand radio telescopes for cooperation with groups such as the Australian Long Baseline Array (LBA), others in the Pacific Rim and possibly globally; also potential future involvement of New Zealand with the SKA. The developed process has also been used to model a phased building schedule for the SKA in Australia and the addition of two antennas in New Zealand. This has been presented to the wider astronomical community via the Royal Astronomical Society of New Zealand Journal, and is summarized in this thesis with some additional material. A new measure of quality ("figure of merit") for comparing the original model image and final CLEAN images by utilizing normalized 2-D cross correlation is evaluated as an alternative to the existing subjective visual operator image comparison undertaken to date by other groups. This new unit of measure is then used ! in the presentation of the

  3. New results on spin determination of nanosatellite BLITS from High Repetition Rate SLR data

    Science.gov (United States)

    Kucharski, D.; Kirchner, G.; Lim, H.-C.; Koidl, F.

    2013-03-01

    The nanosatellite BLITS (Ball Lens In The Space) demonstrates a successful design of the new spherical lens type satellite for Satellite Laser Ranging (SLR). The spin parameters of the satellite were calculated from more than 1000 days of SLR data collected from 6 High Repetition Rate (HRR) systems: Beijing, Changchun, Graz, Herstmonceux, Potsdam, Shanghai.Analysis of the 892 passes (September 26, 2009-June 18, 2012) shows precession of the spin axis around orientation of the along track vector calculated at the launch epoch of the satellite RA = 9h16m39s, Dec = 43.1°. The spin period of BLITS remains stable with the mean value Tmean = 5.613 s, RMS = 11 ms. The incident angle between the spin axis and the symmetry axis of the body changes within 60° range.

  4. THE IMPACT OF FREQUENCY STANDARDS ON COHERENCE IN VLBI AT THE HIGHEST FREQUENCIES

    Energy Technology Data Exchange (ETDEWEB)

    Rioja, M.; Dodson, R. [ICRAR, University of Western Australia, Perth (Australia); Asaki, Y. [Institute of Space and Astronautical Science, 3-1-1 Yoshinodai, Chuou, Sagamihara, Kanagawa 252-5210 (Japan); Hartnett, J. [School of Physics, University of Western Australia, Perth (Australia); Tingay, S., E-mail: maria.rioja@icrar.org [ICRAR, Curtin University, Perth (Australia)

    2012-10-01

    We have carried out full imaging simulation studies to explore the impact of frequency standards in millimeter and submillimeter very long baseline interferometry (VLBI), focusing on the coherence time and sensitivity. In particular, we compare the performance of the H-maser, traditionally used in VLBI, to that of ultra-stable cryocooled sapphire oscillators over a range of observing frequencies, weather conditions, and analysis strategies. Our simulations show that at the highest frequencies, the losses induced by H-maser instabilities are comparable to those from high-quality tropospheric conditions. We find significant benefits in replacing H-masers with cryocooled sapphire oscillator based frequency references in VLBI observations at frequencies above 175 GHz in sites which have the best weather conditions; at 350 GHz we estimate a 20%-40% increase in sensitivity over that obtained when the sites have H-masers, for coherence losses of 20%-10%, respectively. Maximum benefits are to be expected by using co-located Water Vapor Radiometers for atmospheric correction. In this case, we estimate a 60%-120% increase in sensitivity over the H-maser at 350 GHz.

  5. International VLBI Service for Geodesy and Astrometry: 2000 General Meeting Proceedings

    Science.gov (United States)

    Vandenberg, Nancy R. (Editor); Baver, Karen D. (Editor)

    2000-01-01

    This volume is the proceedings of the first General Meeting of the International Very Long Base Interferometry (VLBI) Service for Geodesy and Astrometry (IVS), held in Koetzting, Germany, February 21-24, 2000. The content of this volume also appears on the IVS web site at: http://ivscc.gsfc.nasa.gov/publications/gm2000. The goal of the program committee for the General Meeting was to provide an interesting and informative program for a wide cross section of IVS members, including station operators, program managers, and analysts. The program included reports, tutorials, invited and contributed papers, and poster presentations. The tutorial papers should be particularly useful references because each one provides an overview and introduction to a topic relevant to VLBI.

  6. NASA's Next Generation Space Geodesy Network

    Science.gov (United States)

    Desai, S. D.; Gross, R. S.; Hilliard, L.; Lemoine, F. G.; Long, J. L.; Ma, C.; McGarry, J. F.; Merkowitz, S. M.; Murphy, D.; Noll, C. E.; hide

    2012-01-01

    NASA's Space Geodesy Project (SGP) is developing a prototype core site for a next generation Space Geodetic Network (SGN). Each of the sites in this planned network co-locate current state-of-the-art stations from all four space geodetic observing systems, GNSS, SLR, VLBI, and DORIS, with the goal of achieving modern requirements for the International Terrestrial Reference Frame (ITRF). In particular, the driving ITRF requirements for this network are 1.0 mm in accuracy and 0.1 mm/yr in stability, a factor of 10-20 beyond current capabilities. Development of the prototype core site, located at NASA's Geophysical and Astronomical Observatory at the Goddard Space Flight Center, started in 2011 and will be completed by the end of 2013. In January 2012, two operational GNSS stations, GODS and GOON, were established at the prototype site within 100 m of each other. Both stations are being proposed for inclusion into the IGS network. In addition, work is underway for the inclusion of next generation SLR and VLBI stations along with a modern DORIS station. An automated survey system is being developed to measure inter-technique vectorties, and network design studies are being performed to define the appropriate number and distribution of these next generation space geodetic core sites that are required to achieve the driving ITRF requirements. We present the status of this prototype next generation space geodetic core site, results from the analysis of data from the established geodetic stations, and results from the ongoing network design studies.

  7. Development of web tools to disseminate space geodesy data-related products

    Science.gov (United States)

    Soudarin, Laurent; Ferrage, Pascale; Mezerette, Adrien

    2015-04-01

    In order to promote the products of the DORIS system, the French Space Agency CNES has developed and implemented on the web site of the International DORIS Service (IDS) a set of plot tools to interactively build and display time series of site positions, orbit residuals and terrestrial parameters (scale, geocenter). An interactive global map is also available to select sites, and to get access to their information. Besides the products provided by the CNES Orbitography Team and the IDS components, these tools allow comparing time evolutions of coordinates for collocated DORIS and GNSS stations, thanks to the collaboration with the Terrestrial Frame Combination Center of the International GNSS Service (IGS). A database was created to improve robustness and efficiency of the tools, with the objective to propose a complete web service to foster data exchange with the other geodetic services of the International Association of Geodesy (IAG). The possibility to visualize and compare position time series of the four main space geodetic techniques DORIS, GNSS, SLR and VLBI is already under way at the French level. A dedicated version of these web tools has been developed for the French Space Geodesy Research Group (GRGS). It will give access to position time series provided by the GRGS Analysis Centers involved in DORIS, GNSS, SLR and VLBI data processing for the realization of the International Terrestrial Reference Frame. In this presentation, we will describe the functionalities of these tools, and we will address some aspects of the time series (content, format).

  8. Earth orientation parameters from VLBI determined with a Kalman filter

    Directory of Open Access Journals (Sweden)

    Maria Karbon

    2017-11-01

    We prove that the Kalman filter is more than on par with the classical least squares method and that it is a valuable alternative, especially on the advent of the VLBI2010 Global Observing System and within the GGOS frame work.

  9. Japanese VLBI Network Observations of a Gamma-Ray Narrow ...

    Indian Academy of Sciences (India)

    J. Astrophys. Astr. (2014) 35, 215–218 c Indian Academy of Sciences. Japanese VLBI Network Observations of a Gamma-Ray. Narrow-Line Seyfert 1 Galaxy 1H 0323+342. Kiyoaki Wajima1,∗. , Kenta Fujisawa2, Masaaki Hayashida3. & Naoki Isobe4. 1Shanghai Astronomical Observatory, Chinese Academy of Sciences,.

  10. Electron content near the lunar surface using dual-frequency VLBI tracking data in a single lunar orbiter mission

    International Nuclear Information System (INIS)

    Wang, Zhen; Wang, Na; Ping, Jin-Song

    2015-01-01

    In VLBI observations of Vstar, a subsatellite of the Japanese lunar mission SELENE, there were opportunities for lunar grazing occultation when Vstar was very close to the limb of the Moon. This kind of chance made it possible to probe the thin plasma layer above the Moon's surface as a meaningful by-product of VLBI, by using the radio occultation method with coherent radio waves from the S/X bands. The dual-frequency measurements were carried out at Earth-based VLBI stations. In the line-of-sight direction between the satellite and the ground-based tracking station where VLBI measurements were made, the effects of the terrestrial ionosphere, interplanetary plasma and the thin lunar ionosphere mixed together in the combined observables of dual-frequency Doppler shift and phase shift. To separate the variation of the ionospheric total electron content (TEC) near the surface of the Moon from the mixed signal, the influences of the terrestrial ionosphere and interplanetary plasma have been removed by using an extrapolation method based on a short-term trend. The lunar TEC is estimated from the dual-frequency observation for Vstar from UT 22:18 to UT 22:20 on 2008 June 28 at several tracking stations. The TEC results obtained from VLBI sites are identical, however, they are not as remarkable as the result obtained at the Usuda deep space tracking station. (paper)

  11. Operational production of Geodetic Excitation Functions from EOP estimated values at ASI-CGS

    Science.gov (United States)

    Sciarretta, C.; Luceri, V.; Bianco, G.

    2009-04-01

    ASI-CGS is routinely providing geodetic excitation functions from its own estimated EOP values (at present SLR and VLBI; the current use of GPS EOP's is also planned as soon as this product will be fully operational) on the ASI geodetic web site (http://geodaf.mt.asi.it). This product has been generated and monitored (for ASI internal use only) in a long pre-operational phase (more than two years), including validation and testing. The daily geodetic excitation functions are now weekly updated along with the operational ASI SLR and VLBI EOP solutions and compared, whenever possible, with the atmospheric excitation functions available at the IERS SBAAM, under the IB and not-IB assumption, including the "wind" term. The work will present the available estimated geodetic function time series and its comparison with the relevant atmospheric excitation functions, deriving quantitative indicators on the quality of the estimates. The similarities as well as the discrepancies among the atmospheric and geodetic series will be analysed and commented, evaluating in particular the degree of correlation among the two estimated time series and the likelihood of a linear dependence hypothesis.

  12. MARBLE (Multiple Antenna Radio-interferometry for Baseline Length Evaluation): Development of a Compact VLBI System for Calibrating GNSS and Electronic Distance Measurement Devices

    Science.gov (United States)

    Ichikawa, R.; Ishii, A.; Takiguchi, H.; Kimura, M.; Sekido, M.; Takefuji, K.; Ujihara, H.; Hanado, Y.; Koyama, Y.; Kondo, T.; Kurihara, S.; Kokado, K.; Kawabata, R.; Nozawa, K.; Mukai, Y.; Kuroda, J.; Ishihara, M.; Matsuzaka, S.

    2012-12-01

    We are developing a compact VLBI system with a 1.6-m diameter aperture dish in order to provide reference baseline lengths for calibration. The reference baselines are used to validate surveying instruments such as GPS and EDM and is maintained by the Geospatial Information Authority of Japan (GSI). The compact VLBI system will be installed at both ends of the reference baseline. Since the system is not sensitive enough to detect fringes between the two small dishes, we have designed a new observation concept including one large dish station. We can detect two group delays between each compact VLBI system and the large dish station based on conventional VLBI measurement. A group delay between the two compact dishes can be indirectly calculated using a simple equation. We named the idea "Multiple Antenna Radio-interferometry for Baseline Length Evaluation", or MARBLE system. The compact VLBI system is easy transportable and consists of the compact dish, a new wide-band front-end system, azimuth and elevation drive units, an IF down-converter unit, an antenna control unit (ACU), a counterweight, and a monument pillar. Each drive unit is equipped with a zero-backlash harmonic drive gearing component. A monument pillar is designed to mount typical geodetic GNSS antennas easily and an offset between the GNSS antenna reference point. The location of the azimuth-elevation crossing point of the VLBI system is precisely determined with an uncertainty of less than 0.2 mm. We have carried out seven geodetic VLBI experiments on the Kashima-Tsukuba baseline (about 54 km) using the two prototypes of the compact VLBI system between December 2009 and December 2010. The average baseline length and repeatability of the experiments is 54184874.0 ± 2.4 mm. The results are well consistent with those obtained by GPS measurements. In addition, we are now planning to use the compact VLBI system for precise time and frequency comparison between separated locations.

  13. Controller Design and Experiment for Tracking Mount of Movable SLR, ARGO-M

    Directory of Open Access Journals (Sweden)

    Cheol Hoon Park

    2012-04-01

    Full Text Available Controller design procedure for prototype tracking mount of Movable SLR (Satellite Laser Ranging, ARGO-M is presented. Tracking mount of ARGO-M is altitude-azimuth type and it has two axes of elevation and azimuth to control its position. Controller consists of velocity and acceleration feed-forward controller, position controller at outer loop, velocity controller at inner loop. There are two kinds of position control modes. One is the pointing mode to move from one position to the other position as fast as possible and the other one is tracking mode to follow SLR trajectory as precise as possible. Because the requirement of tracking accuracy is less than 5 arcsec and it is very tight error budget, a sophisticated controller needs to be prepared to meet the accuracy. Especially, ARGO-M is using the cross-roller bearing at each axis to increase the mechanical accuracy, which requires add-on controller DOB (Disturbance observer to suppress friction load and low frequency disturbances. The pointing and tracking performance of the designed controller is simulated and visualized using MATLAB/ Simulink and SimMechanics and the experimental results using test are presented as well.

  14. Overview of current status of SLR production and uses in Japan and other Asian countries

    International Nuclear Information System (INIS)

    Iio, M.

    1985-01-01

    The current status of short-lived radionuclide (SLR) production and use in Japan and other Asian countries is reviewed. The activities of six cyclotrons for medical use in Asia (except Japan) and Australia are reported. In Japan 10 dedicated medical cyclotrons were installed by 1983. Even though SLR application in Japan is in the cradle stage and is limited to only a few institutions, an analysis of these applications indicates the high efficacy of the dedicated small cyclotrons as compared with large, multipurpose cyclotrons. Because of the lack of high-energy commercial cyclotrons by 1982, a satisfactory iodine-123 supply of labeling quality has been limited. However, since two of the three medical cyclotron manufacturers and more than three positron camera producers are located there, Japan has high potential for the routine practice of nuclear medicine

  15. VLBI imaging of CTA 102

    International Nuclear Information System (INIS)

    Wehrle, A.E.; Cohen, M.

    1989-01-01

    The object CTA 102, a low-frequency variable quasar, was observed with a VLBI Global Array in 1987.5 and 1988.5 at 5.0 GHz. The structure is complex, with three compact components along a line at PA = 157 deg, and several extended, ill-defined components east of the southernmost compact component. The components have no detectable relative motions, with mu less than 0.5 mas/yr along the main axis. This contrasts with the observation reported by Baath (1987), who found mu = 0.65 + or - 0.15 mas/yr at 932 MHz, which is exceptionally high. The new upper limit allows CTA 102 to be in the normal range of superluminal sources. 11 refs

  16. The DELLA Protein SLR1 Integrates and Amplifies Salicylic Acid- and Jasmonic Acid-Dependent Innate Immunity in Rice.

    Science.gov (United States)

    De Vleesschauwer, David; Seifi, Hamed Soren; Filipe, Osvaldo; Haeck, Ashley; Huu, Son Nguyen; Demeestere, Kristof; Höfte, Monica

    2016-03-01

    Gibberellins are a class of tetracyclic plant hormones that are well known to promote plant growth by inducing the degradation of a class of nuclear growth-repressing proteins, called DELLAs. In recent years, GA and DELLAs are also increasingly implicated in plant responses to pathogen attack, although our understanding of the underlying mechanisms is still limited, especially in monocotyledonous crop plants. Aiming to further decipher the molecular underpinnings of GA- and DELLA-modulated plant immunity, we studied the dynamics and impact of GA and DELLA during infection of the model crop rice (Oryza sativa) with four different pathogens exhibiting distinct lifestyles and infection strategies. Opposite to previous findings in Arabidopsis (Arabidopsis thaliana), our findings reveal a prominent role of the DELLA protein Slender Rice1 (SLR1) in the resistance toward (hemi)biotrophic but not necrotrophic rice pathogens. Moreover, contrary to the differential effect of DELLA on the archetypal defense hormones salicylic acid (SA) and jasmonic acid (JA) in Arabidopsis, we demonstrate that the resistance-promoting effect of SLR1 is due at least in part to its ability to boost both SA- and JA-mediated rice defenses. In a reciprocal manner, we found JA and SA treatment to interfere with GA metabolism and stabilize SLR1. Together, these findings favor a model whereby SLR1 acts as a positive regulator of hemibiotroph resistance in rice by integrating and amplifying SA- and JA-dependent defense signaling. Our results highlight the differences in hormone defense networking between rice and Arabidopsis and underscore the importance of GA and DELLA in molding disease outcomes. © 2016 American Society of Plant Biologists. All Rights Reserved.

  17. LOD estimation from DORIS observations

    Science.gov (United States)

    Stepanek, Petr; Filler, Vratislav; Buday, Michal; Hugentobler, Urs

    2016-04-01

    The difference between astronomically determined duration of the day and 86400 seconds is called length of day (LOD). The LOD could be also understood as the daily rate of the difference between the Universal Time UT1, based on the Earth rotation, and the International Atomic Time TAI. The LOD is estimated using various Satellite Geodesy techniques as GNSS and SLR, while absolute UT1-TAI difference is precisely determined by VLBI. Contrary to other IERS techniques, the LOD estimation using DORIS (Doppler Orbitography and Radiopositioning Integrated by satellite) measurement did not achieve a geodetic accuracy in the past, reaching the precision at the level of several ms per day. However, recent experiments performed by IDS (International DORIS Service) analysis centre at Geodetic Observatory Pecny show a possibility to reach accuracy around 0.1 ms per day, when not adjusting the cross-track harmonics in the Satellite orbit model. The paper presents the long term LOD series determined from the DORIS solutions. The series are compared with C04 as the reference. Results are discussed in the context of accuracy achieved with GNSS and SLR. Besides the multi-satellite DORIS solutions, also the LOD series from the individual DORIS satellite solutions are analysed.

  18. The DELLA Protein SLR1 Integrates and Amplifies Salicylic Acid- and Jasmonic Acid-Dependent Innate Immunity in Rice1

    Science.gov (United States)

    De Vleesschauwer, David; Seifi, Hamed Soren; Haeck, Ashley; Huu, Son Nguyen; Demeestere, Kristof

    2016-01-01

    Gibberellins are a class of tetracyclic plant hormones that are well known to promote plant growth by inducing the degradation of a class of nuclear growth-repressing proteins, called DELLAs. In recent years, GA and DELLAs are also increasingly implicated in plant responses to pathogen attack, although our understanding of the underlying mechanisms is still limited, especially in monocotyledonous crop plants. Aiming to further decipher the molecular underpinnings of GA- and DELLA-modulated plant immunity, we studied the dynamics and impact of GA and DELLA during infection of the model crop rice (Oryza sativa) with four different pathogens exhibiting distinct lifestyles and infection strategies. Opposite to previous findings in Arabidopsis (Arabidopsis thaliana), our findings reveal a prominent role of the DELLA protein Slender Rice1 (SLR1) in the resistance toward (hemi)biotrophic but not necrotrophic rice pathogens. Moreover, contrary to the differential effect of DELLA on the archetypal defense hormones salicylic acid (SA) and jasmonic acid (JA) in Arabidopsis, we demonstrate that the resistance-promoting effect of SLR1 is due at least in part to its ability to boost both SA- and JA-mediated rice defenses. In a reciprocal manner, we found JA and SA treatment to interfere with GA metabolism and stabilize SLR1. Together, these findings favor a model whereby SLR1 acts as a positive regulator of hemibiotroph resistance in rice by integrating and amplifying SA- and JA-dependent defense signaling. Our results highlight the differences in hormone defense networking between rice and Arabidopsis and underscore the importance of GA and DELLA in molding disease outcomes. PMID:26829979

  19. On an Allan variance approach to classify VLBI radio-sources on the basis of their astrometric stability

    Science.gov (United States)

    Gattano, C.; Lambert, S.; Bizouard, C.

    2017-12-01

    In the context of selecting sources defining the celestial reference frame, we compute astrometric time series of all VLBI radio-sources from observations in the International VLBI Service database. The time series are then analyzed with Allan variance in order to estimate the astrometric stability. From results, we establish a new classification that takes into account the whole multi-time scales information. The algorithm is flexible on the definition of ``stable source" through an adjustable threshold.

  20. International VLBI Service for Geodesy and Astrometry 2000 Annual Report

    Science.gov (United States)

    Vandenberg, N. R. (Editor); Baver, K. D. (Editor); Smith, David E. (Technical Monitor)

    2000-01-01

    This volume of reports is the 2000 Annual Report of the International Very Long Base Interferometry (VLBI) Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the permanent components of IVS. The IVS 2000 Annual Report documents the work of the IVS components for the period March 1, 1999 (the official inauguration date of IVS) through December 31, 2000. The reports document changes, activities, and progress of the IVS. The entire contents of this Annual Report also appear on the IVS web site at http://ivscc.gsfc.nasa.gov/publications/ar2000. This book and the web site are organized as follows: (1) The first section contains general information about IVS, a map showing the location of the components, information about the Directing Board members, and the report of the IVS Chair; (2) The second section of Special Reports contains a status report of the IVS Working Group on GPS phase center mapping, a reproduction of the resolution making IVS a Service of the International Astronomical Union (IAU), and a reprint of the VLBI Standard Interface (VSI); (3) The next seven sections hold the component reports from the Coordinators, Network Stations, Operation Centers, Correlators, Data Centers, Analysis Centers, and Technology Development Centers; and (4) The last section includes reference information about IVS: the Terms of Reference, the lists of Member and Affiliated organizations, the IVS Associate Member list, a complete list of IVS components, the list of institutions contributing to this report, and a list of acronyms. The 2000 Annual Report demonstrates the vitality of the IVS and the outstanding progress we have made during our first 22 months.

  1. Introducing a New Software for Geodetic Analysis

    Science.gov (United States)

    Hjelle, Geir Arne; Dähnn, Michael; Fausk, Ingrid; Kirkvik, Ann-Silje; Mysen, Eirik

    2017-04-01

    At the Norwegian Mapping Authority, we are currently developing Where, a new software for geodetic analysis. Where is built on our experiences with the Geosat software, and will be able to analyse and combine data from VLBI, SLR, GNSS and DORIS. The software is mainly written in Python which has proved very fruitful. The code is quick to write and the architecture is easily extendable and maintainable, while at the same time taking advantage of well-tested code like the SOFA and IERS libraries. This presentation will show some of the current capabilities of Where, including benchmarks against other software packages, and outline our plans for further progress. In addition we will report on some investigations we have done experimenting with alternative weighting strategies for VLBI.

  2. The effect of meteorological data on atmospheric pressure loading corrections in VLBI data analysis

    Science.gov (United States)

    Balidakis, Kyriakos; Glaser, Susanne; Karbon, Maria; Soja, Benedikt; Nilsson, Tobias; Lu, Cuixian; Anderson, James; Liu, Li; Andres Mora-Diaz, Julian; Raposo-Pulido, Virginia; Xu, Minghui; Heinkelmann, Robert; Schuh, Harald

    2015-04-01

    Earth's crustal deformation is a manifestation of numerous geophysical processes, which entail the atmosphere and ocean general circulation and tidal attraction, climate change, and the hydrological circle. The present study deals with the elastic deformations induced by atmospheric pressure variations. At geodetic sites, APL (Atmospheric Pressure Loading) results in displacements covering a wide range of temporal scales which is undesirable when rigorous geodetic/geophysical analysis is intended. Hence, it is of paramount importance that the APL signal are removed at the observation level in the space geodetic data analysis. In this study, elastic non-tidal components of loading displacements were calculated in the local topocentric frame for all VLBI (Very Long Baseline Interferometry) stations with respect to the center-of-figure of the solid Earth surface and the center-of-mass of the total Earth system. The response of the Earth to the load variation at the surface was computed by convolving Farrell Green's function with the homogenized in situ surface pressure observations (in the time span 1979-2014) after the subtraction of the reference pressure and the S1, S2 and S3 thermal tidal signals. The reference pressure was calculated through a hypsometric adjustment of the absolute pressure level determined from World Meteorological Organization stations in the vicinity of each VLBI observatory. The tidal contribution was calculated following the 2010 International Earth Rotation and Reference Systems Service conventions. Afterwards, this approach was implemented into the VLBI software VieVS@GFZ and the entirety of available VLBI sessions was analyzed. We rationalize our new approach on the basis that the potential error budget is substantially reduced, since several common errors are not applicable in our approach, e.g. those due to the finite resolution of NWM (Numerical Weather Models), the accuracy of the orography model necessary for adjusting the former as

  3. EVIDENCE FOR LOW BLACK HOLE SPIN AND PHYSICALLY MOTIVATED ACCRETION MODELS FROM MILLIMETER-VLBI OBSERVATIONS OF SAGITTARIUS A*

    Energy Technology Data Exchange (ETDEWEB)

    Broderick, Avery E [Canadian Institute for Theoretical Astrophysics, 60 St. George Street, Toronto, ON M5S 3H8 (Canada); Fish, Vincent L; Doeleman, Sheperd S [Massachusetts Institute of Technology, Haystack Observatory, Route 40, Westford, MA 01886 (United States); Loeb, Abraham [Institute for Theory and Computation, Harvard University, Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2011-07-10

    Millimeter very long baseline interferometry (mm-VLBI) provides the novel capacity to probe the emission region of a handful of supermassive black holes on sub-horizon scales. For Sagittarius A* (Sgr A*), the supermassive black hole at the center of the Milky Way, this provides access to the region in the immediate vicinity of the horizon. Broderick et al. have already shown that by leveraging spectral and polarization information as well as accretion theory, it is possible to extract accretion-model parameters (including black hole spin) from mm-VLBI experiments containing only a handful of telescopes. Here we repeat this analysis with the most recent mm-VLBI data, considering a class of aligned, radiatively inefficient accretion flow (RIAF) models. We find that the combined data set rules out symmetric models for Sgr A*'s flux distribution at the 3.9{sigma} level, strongly favoring length-to-width ratios of roughly 2.4:1. More importantly, we find that physically motivated accretion flow models provide a significantly better fit to the mm-VLBI observations than phenomenological models, at the 2.9{sigma} level. This implies that not only is mm-VLBI presently capable of distinguishing between potential physical models for Sgr A*'s emission, but further that it is sensitive to the strong gravitational lensing associated with the propagation of photons near the black hole. Based upon this analysis we find that the most probable magnitude, viewing angle, and position angle for the black hole spin are a = 0.0{sup +0.64+0.86}, {theta}=68{sup o+5o+9o}{sub -20}{sup o}{sub -28}{sup o}, and {xi}=-52{sup o+17o+33o}{sub -15}{sup o}{sub -24}{sup o} east of north, where the errors quoted are the 1{sigma} and 2{sigma} uncertainties.

  4. EVIDENCE FOR LOW BLACK HOLE SPIN AND PHYSICALLY MOTIVATED ACCRETION MODELS FROM MILLIMETER-VLBI OBSERVATIONS OF SAGITTARIUS A*

    International Nuclear Information System (INIS)

    Broderick, Avery E.; Fish, Vincent L.; Doeleman, Sheperd S.; Loeb, Abraham

    2011-01-01

    Millimeter very long baseline interferometry (mm-VLBI) provides the novel capacity to probe the emission region of a handful of supermassive black holes on sub-horizon scales. For Sagittarius A* (Sgr A*), the supermassive black hole at the center of the Milky Way, this provides access to the region in the immediate vicinity of the horizon. Broderick et al. have already shown that by leveraging spectral and polarization information as well as accretion theory, it is possible to extract accretion-model parameters (including black hole spin) from mm-VLBI experiments containing only a handful of telescopes. Here we repeat this analysis with the most recent mm-VLBI data, considering a class of aligned, radiatively inefficient accretion flow (RIAF) models. We find that the combined data set rules out symmetric models for Sgr A*'s flux distribution at the 3.9σ level, strongly favoring length-to-width ratios of roughly 2.4:1. More importantly, we find that physically motivated accretion flow models provide a significantly better fit to the mm-VLBI observations than phenomenological models, at the 2.9σ level. This implies that not only is mm-VLBI presently capable of distinguishing between potential physical models for Sgr A*'s emission, but further that it is sensitive to the strong gravitational lensing associated with the propagation of photons near the black hole. Based upon this analysis we find that the most probable magnitude, viewing angle, and position angle for the black hole spin are a = 0.0 +0.64+0.86 , θ=68 o+5 o +9 o -20 o -28 o , and ξ=-52 o+17 o +33 o -15 o -24 o east of north, where the errors quoted are the 1σ and 2σ uncertainties.

  5. Digital Base Band Converter As Radar Vlbi Backend / Dbbc Kā Ciparošanas Sistēma Radara Vlbi Novērojumiem

    Science.gov (United States)

    Tuccari, G.; Bezrukovs, Vl.; Nechaeva, M.

    2012-12-01

    A digital base band converter (DBBC) system has been developed by the Istituto di Radioastronomia (Noto, Italy) for increasing the sensitivity of European VLBI Network (EVN) by expanding the full observed bandwidth using numerical methods. The output data rate of this VLBI-backend is raised from 1 to 4 Gbps for each radiotelescope. All operations related to the signal processing (frequency translation, amplification, frequency generation with local oscillators, etc.) are transferred to the digital domain, which allows - in addition to well-known advantages coming from digital technologies - achieving better repeatability, precision, simplicity, etc. The maximum input band of DBBC system is 3.5 GHz, and the instantaneous bandwidth is up to 1 GHz for each radio frequency/intermediate frequency (RF/IF) out of the eight possible. This backend is a highly powerful platform for other radioastronomy applications, and a number of additional so-called personalities have been developed and used. This includes PFB (polyphase filter bank) receivers and Spectra for high resolution spectroscopy. An additional new development with the same aim - to use the DBBC system as a multi-purpose backend - is related to the bi-static radar observations including Radar VLBI. In such observations it is possible to study the population of space debris, with detection of even centimetre class fragments. A powerful transmitter is used to illuminate the sky region to be analyzed, and the echoes coming from known or unknown objects are reflected to one or more groundbased telescopes thus producing a single-dish or interferometric detection. The DBBC Radar VLBI personality is able to realize a high-resolution spectrum analysis, maintaining in the central area the echo signal at the expected frequency including the Doppler shift of frequency. For extremely weak signals a very large integration time is needed, so for this personality different input parameters are provided. The realtime information

  6. Imaging VLBI polarimetry data from Active Galactic Nuclei using the Maximum Entropy Method

    Directory of Open Access Journals (Sweden)

    Coughlan Colm P.

    2013-12-01

    Full Text Available Mapping the relativistic jets emanating from AGN requires the use of a deconvolution algorithm to account for the effects of missing baseline spacings. The CLEAN algorithm is the most commonly used algorithm in VLBI imaging today and is suitable for imaging polarisation data. The Maximum Entropy Method (MEM is presented as an alternative with some advantages over the CLEAN algorithm, including better spatial resolution and a more rigorous and unbiased approach to deconvolution. We have developed a MEM code suitable for deconvolving VLBI polarisation data. Monte Carlo simulations investigating the performance of CLEAN and the MEM code on a variety of source types are being carried out. Real polarisation (VLBA data taken at multiple wavelengths have also been deconvolved using MEM, and several of the resulting polarisation and Faraday rotation maps are presented and discussed.

  7. JTRF2014, the JPL Kalman filter and smoother realization of the International Terrestrial Reference System

    Science.gov (United States)

    Abbondanza, Claudio; Chin, Toshio M.; Gross, Richard S.; Heflin, Michael B.; Parker, Jay W.; Soja, Benedikt S.; van Dam, Tonie; Wu, Xiaoping

    2017-10-01

    We present and discuss JTRF2014, the Terrestrial Reference Frame (TRF) the Jet Propulsion Laboratory constructed by combining space-geodetic inputs from very long baseline interferometry (VLBI), satellite laser ranging (SLR), Global Navigation Satellite Systems (GNSS), and Doppler orbitography and radiopositioning integrated by satellite submitted for the realization of ITRF2014. Determined through a Kalman filter and Rauch-Tung-Striebel smoother assimilating position observations, Earth orientation parameters, and local ties, JTRF2014 is a subsecular, time series-based TRF whose origin is at the quasi-instantaneous center of mass (CM) as sensed by SLR and whose scale is determined by the quasi-instantaneous VLBI and SLR scales. The dynamical evolution of the positions accounts for a secular motion term, annual, and semiannual periodic modes. Site-dependent variances based on the analysis of loading displacements induced by mass redistributions of terrestrial fluids have been used to control the extent of random walk adopted in the combination. With differences in the amplitude of the annual signal within the range 0.5-0.8 mm, JTRF2014-derived center of network-to-center of mass (CM-CN) is in remarkable agreement with the geocenter motion obtained via spectral inversion of GNSS, Gravity Recovery and Climate Experiment (GRACE) observations and modeled ocean bottom pressure from Estimating the Circulation and Climate of the Ocean (ECCO). Comparisons of JTRF2014 to ITRF2014 suggest high-level consistency with time derivatives of the Helmert transformation parameters connecting the two frames below 0.18 mm/yr and weighted root-mean-square differences of the polar motion (polar motion rate) in the order of 30 μas (17 μas/d).

  8. Establishing a Modern Ground Network for Space Geodesy Applications

    Science.gov (United States)

    Pearlman, M.; Pavlis, E.; Altamimi, Z.; Noll, C.

    2010-01-01

    Ground-based networks of co-located space-geodesy techniques (VLBI, SLR, GLASS, DORIS) are the basis for the development and maintenance of the :International Terrestrial deference Frame (ITRE), which is the basis for our metric measurements of global change. The Global Geodetic Observing System (GGOS) within the International Association of Geodesy has established a task to develop a strategy to design, integrate and maintain the fundamental geodetic network and supporting infrastructure in a sustainable way to satisfy the long-term requirements for the reference frame. The GGOS goal is an origin definition at I mm or better and a temporal stability on the order of 0.1 mm/y, with similar numbers for the scale and orientation components. These goals are based on scientific requirements to address sea level rise with confidence. As a first step, simulations focused on establishing the optimal global SLR and VLBI network, since these two techniques alone are sufficient to define the reference frame. The GLASS constellations will then distribute the reference frame to users anywhere on the Earth. Using simulated data to be collected by the future networks, we investigated various designs and the resulting accuracy in the origin, scale and orientation of the resulting ITRF. We present here the results of extensive simulation studies aimed at designing optimal global geodetic networks to support GGOS science products. Current estimates are the network will require 24 - 32 globally distributed co-location sites. Stations in the near global network will require geologically stable sites witla good weather, established infrastructure, and local support and personnel. EGOS will seek groups that are interested in participation. GGOS intends to issues a Call for Participation of groups that would like to take part in the network implementation and operation_ Some examples of integrated stations currently in operation or under development will be presented. We will examine

  9. Long-term millimeter VLBI monitoring of M 87 with KVN at milliarcsecond resolution: nuclear spectrum

    Science.gov (United States)

    Kim, Jae-Young; Lee, Sang-Sung; Hodgson, Jeffrey A.; Algaba, Juan-Carlos; Zhao, Guang-Yao; Kino, Motoki; Byun, Do-Young; Kang, Sincheol

    2018-02-01

    We study the centimeter- to millimeter-wavelength synchrotron spectrum of the core of the radio galaxy M 87 at ≲0.8 mas 110Rs spatial scales using four years of fully simultaneous, multi-frequency VLBI data obtained by the Korean VLBI Network (KVN). We find a core spectral index α of ≳‑0.37 (S ∝ ν+α) between 22 and 129 GHz. By combining resolution-matched flux measurements from the Very Long Baseline Array (VLBA) at 15 GHz and taking the Event Horizon Telescope (EHT) 230 GHz core flux measurements in epochs 2009 and 2012 as lower limits, we find evidence of a nearly flat core spectrum across 15 and 129 GHz, which could naturally connect the 230 GHz VLBI core flux. The extremely flat spectrum is a strong indication that the jet base does not consist of a simple homogeneous plasma, but of inhomogeneous multi-energy components, with at least one component with the turn-over frequency ≳ 100 GHz. The spectral shape can be qualitatively explained if both the strongly (compact, optically thick at >100 GHz) and the relatively weakly magnetized (more extended, optically thin at <100 GHz) plasma components are colocated in the footprint of the relativistic jet.

  10. J2 : An evaluation of new estimates from GPS, GRACE, and load models compared to SLR

    NARCIS (Netherlands)

    Lavallée, D.A.; Moore, P.; Clarke, P.J.; Petrie, E.J.; Van Dam, T.; King, M.A.

    2010-01-01

    Changes in J2, resulting from past and present changes in Earth's climate, are traditionally observed by Satellite Laser ranging (SLR). Assuming an elastic Earth, it is possible to infer changes in J2 from changes in Earth's shape observed by GPS. We compare estimates of non-secular J2 changes from

  11. Analysis of ILRS Site Ties

    Science.gov (United States)

    Husson, V. S.; Long, J. L.; Pearlman, M.

    2001-12-01

    By the end of 2000, 94% of ILRS stations had completed station and site information forms (i.e. site logs). These forms contain six types of information. These six categories include site identifiers, contact information, approximate coordinates, system configuration history, system ranging capabilities, and local survey ties. The ILRS Central Bureau, in conjunction with the ILRS Networks and Engineering Working Group, has developed procedures to quality control site log contents. Part of this verification entails data integrity checks of local site ties and is the primary focus of this paper. Local survey ties are critical to the combination of space geodetic network coordinate solutions (i.e. GPS, SLR, VLBI, DORIS) of the International Terrestrial Reference Frame (ITRF). Approximately 90% of active SLR sites are collocated with at least one other space geodetic technique. The process used to verify these SLR ties, at collocated sites, is identical to the approach used in ITRF2000. Local vectors (X, Y, Z) from each ILRS site log are differenced from its corresponding ITRF2000 position vectors (i.e. no transformations). These X, Y, and Z deltas are converted into North, East, and Up. Any deltas, in any component, larger than 5 millimeter is flagged for investigation. In the absence of ITRF2000 SLR positions, CSR positions were used. To further enhance this comparison and to fill gaps in information, local ties contained in site logs from the other space geodetic services (i.e. IGS, IVS, IDS) were used in addition to ITRF2000 ties. Case studies of two collocated sites (McDonald/Ft. Davis and Hartebeeshtoek) will be explored in-depth. Recommendations on how local site surveys should be conducted and how this information should be managed will also be presented.

  12. ESTIMATING THE PARAMETERS OF SAGITTARIUS A*'s ACCRETION FLOW VIA MILLIMETER VLBI

    Energy Technology Data Exchange (ETDEWEB)

    Broderick, Avery E [Canadian Institute for Theoretical Astrophysics, 60 St. George St., Toronto, ON M5S 3H8 (Canada); Fish, Vincent L; Doeleman, Sheperd S [Massachusetts Institute of Technology, Haystack Observatory, Route 40, Westford, MA 01886 (United States); Loeb, Abraham [Institute for Theory and Computation, Harvard University, Center for Astrophysics, 60 Garden St., Cambridge, MA 02138 (United States)

    2009-05-20

    Recent millimeter-VLBI observations of Sagittarius A* (Sgr A*) have, for the first time, directly probed distances comparable to the horizon scale of a black hole. This provides unprecedented access to the environment immediately around the horizon of an accreting black hole. We leverage both existing spectral and polarization measurements and our present understanding of accretion theory to produce a suite of generic radiatively inefficient accretion flow (RIAF) models of Sgr A*, which we then fit to these recent millimeter-VLBI observations. We find that if the accretion flow onto Sgr A* is well described by an RIAF model, the orientation and magnitude of the black hole's spin are constrained to a two-dimensional surface in the spin, inclination, position angle parameter space. For each of these, we find the likeliest values and their 1{sigma} and 2{sigma} errors to be a = 0{sup +0.4+0.7}, {theta}=50{sup o+10{sup o}}{sup +30{sup o}}{sub -10{sup o}}{sub -10{sup o}}, and {xi}=-20{sup o+31{sup o}}{sup +107{sup o}}{sub -16{sup o}}{sub -29{sup o}}, when the resulting probability distribution is marginalized over the others. The most probable combination is a = 0{sup +0.2+0.4}, {theta}=90{sup o}{sub -40{sup o}}{sub -50{sup o}}, and {xi}=-14{sup o+7{sup o}}{sup +11{sup o}}{sub -7{sup o}}{sub -11{sup o}}, though the uncertainties on these are very strongly correlated, and high probability configurations exist for a variety of inclination angles above 30 deg. and spins below 0.99. Nevertheless, this demonstrates the ability millimeter-VLBI observations, even with only a few stations, to significantly constrain the properties of Sgr A*.

  13. VLBI observations of the nuclei of a mixed sample of bright galaxies and quasars at 327 MHz

    International Nuclear Information System (INIS)

    Ananthakrishnan, S.; Kulkarni, V.K.

    1989-01-01

    The first VLBI observations using the Ooty telescope are presented. An array consisting of telescopes at Ooty (India), Crimea (USSR), Torun (Poland), Westerbork (Netherlands) and Jodrell Bank (United Kingdom) was operated in 1983 December at a frequency of 327 MHz. Nearby galaxies, compact quasars and SS433 were observed in this pilot experiment. Most of the galaxies were found to be well resolved. The structure of SS433 (visible only on the shortest baseline) is consistent with that obtained in previous high-frequency VLBI work. The visibilities of the compact quasars indicate that large-scale scattering may be taking place in the interplanetary medium. (author)

  14. Next Generation NASA Initiative for Space Geodesy

    Science.gov (United States)

    Merkowitz, S. M.; Desai, S.; Gross, R. S.; Hilliard, L.; Lemoine, F. G.; Long, J. L.; Ma, C.; McGarry J. F.; Murphy, D.; Noll, C. E.; hide

    2012-01-01

    Space geodesy measurement requirements have become more and more stringent as our understanding of the physical processes and our modeling techniques have improved. In addition, current and future spacecraft will have ever-increasing measurement capability and will lead to increasingly sophisticated models of changes in the Earth system. Ground-based space geodesy networks with enhanced measurement capability will be essential to meeting these oncoming requirements and properly interpreting the sate1!ite data. These networks must be globally distributed and built for longevity, to provide the robust data necessary to generate improved models for proper interpretation ofthe observed geophysical signals. These requirements have been articulated by the Global Geodetic Observing System (GGOS). The NASA Space Geodesy Project (SGP) is developing a prototype core site as the basis for a next generation Space Geodetic Network (SGN) that would be NASA's contribution to a global network designed to produce the higher quality data required to maintain the Terrestrial Reference Frame and provide information essential for fully realizing the measurement potential of the current and coming generation of Earth Observing spacecraft. Each of the sites in the SGN would include co-located, state of-the-art systems from all four space geodetic observing techniques (GNSS, SLR, VLBI, and DORIS). The prototype core site is being developed at NASA's Geophysical and Astronomical Observatory at Goddard Space Flight Center. The project commenced in 2011 and is scheduled for completion in late 2013. In January 2012, two multiconstellation GNSS receivers, GODS and GODN, were established at the prototype site as part of the local geodetic network. Development and testing are also underway on the next generation SLR and VLBI systems along with a modern DORIS station. An automated survey system is being developed to measure inter-technique vector ties, and network design studies are being

  15. VizieR Online Data Catalog: VLBI Ecliptic Plane Survey: VEPS-1 (Shu+, 2017)

    Science.gov (United States)

    Shu, F.; Petrov, L.; Jiang, W.; Xia, B.; Jiang, T.; Cui, Y.; Takefuji, K.; McCallum, J.; Lovell, J.; Yi, S.-O.; Hao, L.; Yang, W.; Zhang, H.; Chen, Z.; Li, J.

    2017-08-01

    We began observations in the search mode in 2015 February. The participating stations included the three core stations of the Chinese VLBI Network (CVN): seshan25, kunming, and urumqi. Depending on the participating stations, the longest baseline length in each session can be varied from 3200km to 9800km. Our observations were performed at a 2048Mbps data rate, with 16 Intermediate Frequency (IF) channels and 2-bit sampling. The first eight IFs of 32MHz bandwidth were distributed in the range of [8.188, 8.444]GHz, and the remaining eight IFs of 32MHz bandwidth were in the range of [8.700, 8.956]GHz. Table 1: Summary of the VLBI Ecliptic Plane Survey (VEPS) observations in search mode: --------------------------------------------------- Date Dur. Code Stations Number of (Y/M/D) (h) Targets --------------------------------------------------- 2015 Feb 13 24 VEPS01 ShKmUr 293 2015 Feb 14 24 VEPS02 ShKmUr 338 2015 Apr 23 24 VEPS03 UrKv 300 2015 Apr 24 24 VEPS04 ShKmUrKv 400 2015 Aug 10 25 VEPS05 ShKmKvHo 252 2015 Aug 19 25 VEPS06 ShKmKvHo 277 2016 Mar 02 24 VEPS07 ShKmUrKb 333 2016 Mar 11 24 VEPS08 ShKmUrKb 477 2016 May 13 24 VEPS09 ShUrHo 291 2016 May 14 22 VEPS10 ShUrKv 322 2016 Jul 06 24 VEPS11 ShUrKb 307 2016 Sep 02 23 VEPS12 ShUr 424 2016 Sep 03 23 VEPS13 ShKmUr 344 --------------------------------------------------- Sh=Seshan25; Km=Kunming; Ur=Urumqi; Kv=Sejong; Kb=Kashim34; Ho=Hobart26. --------------------------------------------------- We ran two absolute astrometry dual-band VLBA programs that targeted ecliptic plane compact radio sources: the dedicated survey of weak ecliptic plane calibrators with the VLBA BS250 program in 2016 March-May, and the VLBA Calibrator Survey 9 (VCS-9) in 2015 August-2016 September. The International VLBI Service for Geodesy and Astrometry (IVS) runs a number of VLBI observing programs. We made an attempt to improve the coordinates of some VEPS sources detected in the search mode and provide additional measurements of telescope

  16. 78 FR 7663 - SLR; 2013 International Rolex Regatta; St. Thomas Harbor; St. Thomas, U.S. Virgin Islands

    Science.gov (United States)

    2013-02-04

    ... 1625-AA08 SLR; 2013 International Rolex Regatta; St. Thomas Harbor; St. Thomas, U.S. Virgin Islands... special local regulations on the waters of St. Thomas Harbor in St. Thomas, U. S. Virgin Islands during... 5 p.m., Monday through Friday, except federal holidays. The telephone number is 202-366-9329. See...

  17. Influence of ocean tides on the diurnal and semidiurnal earth rotation variations from VLBI observations

    Science.gov (United States)

    Gubanov, V. S.; Kurdubov, S. L.

    2015-05-01

    The International astrogeodetic standard IERS Conventions (2010) contains a model of the diurnal and semidiurnal variations in Earth rotation parameters (ERPs), the pole coordinates and the Universal Time, arising from lunisolar tides in the world ocean. This model was constructed in the mid-1990s through a global analysis of Topex/Poseidon altimetry. The goal of this study is to try to estimate the parameters of this model by processing all the available VLBI observations on a global network of stations over the last 35 years performed within the framework of IVS (International VLBI Service) geodetic programs. The complexity of the problemlies in the fact that the sought-for corrections to the parameters of this model lie within 1 mm and, thus, are at the limit of their detectability by all currently available methods of ground-based positional measurements. This requires applying universal software packages with a high accuracy of reduction calculations and a well-developed system of controlling the simultaneous adjustment of observational data to analyze long series of VLBI observations. This study has been performed with the QUASAR software package developed at the Institute of Applied Astronomy of the Russian Academy of Sciences. Although the results obtained, on the whole, confirm a high accuracy of the basic model in the IERS Conventions (2010), statistically significant corrections that allow this model to be refined have been detected for some harmonics of the ERP variations.

  18. Round-Trip System Available to Measure Path Length Variation in Korea VLBI System for Geodesy

    Science.gov (United States)

    Oh, Hongjong; Kondo, Tetsuro; Lee, Jinoo; Kim, Tuhwan; Kim, Myungho; Kim, Suchul; Park, Jinsik; Ju, Hyunhee

    2010-01-01

    The construction project of Korea Geodetic VLBI officially started in October 2008. The construction of all systems will be completed by the end of 2011. The project was named Korea VLBI system for Geodesy (KVG), and its main purpose is to maintain the Korea Geodetic Datum. In case of the KVG system, an observation room with an H-maser frequency standard is located in a building separated from the antenna by several tens of meters. Therefore KVG system will adopt a so-called round-trip system to transmit reference signals to the antenna with reduction of the effect of path length variations. KVG s round-trip system is designed not only to use either metal or optical fiber cables, but also to measure path length variations directly. We present this unique round trip system for KVG.

  19. SLR-induced temporal and spatial changes in hotspots to storms along the Catalan coast

    Science.gov (United States)

    Jiménez, Jose A.; Sanuy, Marc; Valdemoro, Herminia

    2017-04-01

    any significant increasing trend, this does not imply that storm-induced coastal hazards will not change. Thus, SLR will induce a series of long-term changes in coastal areas that although not directly affecting storminess will modify the coastal resilient capacity and, thus, changing coastal storm risks. To provide long-term predictions of hotspot, we have assessed the long-term SLR influence on erosion and inundation risks. To do this, an equilibrium-based approach has been adopted in which background SLR-induced shoreline retreat and beach vertical response are assessed for different SLR scenarios. Obtained values are used to predict future coastal morphology and to compute the resilient capacity for each beach at any time horizon. With this information, future erosion and inundation risks and corresponding new spatial distributions of coastal hotspots are calculated for selected probabilities. Obtained results show a significant increase in hotspots along the coast, with most of the changes concentrated in areas with small accommodation space and dominated by mild slope shorefaces. The extension of the new hotspots seems to indicate than unless land planning is considered as a tool for risk reduction, massive protection need to be implemented in certain areas.

  20. Microwave Amplitude Modulation Technique to Measure Spin-Lattice (T 1) and Spin-Spin (T 2) Relaxation Times

    Science.gov (United States)

    Misra, Sushil K.

    The measurement of very short spin-lattice, or longitudinal, relaxation (SLR) times (i.e., 10-10 Misra, 1998), and polymer resins doped with rare-earth ions (Pescia et al., 1999a; Pescia et al. 1999b). The ability to measure such fast SLR data on amorphous Si and copper-chromium-tin spinel led to an understanding of the role of exchange interaction in affecting spin-lattice relaxation, while the data on polymer resins doped with rare-earth ions provided evidence of spin-fracton relaxation (Pescia et al., 1999a, b). But such fast SLR times are not measurable by the most commonly used techniques of saturation- and inversion-recovery (Poole, 1982; Alger, 1968), which only measure spin-lattice relaxation times longer than 10-6 s. A summary of relevant experimental data is presented in Table 1.

  1. Two-Component Structure of the Radio Source 0014+813 from VLBI Observations within the CONT14 Program

    Science.gov (United States)

    Titov, O. A.; Lopez, Yu. R.

    2018-03-01

    We consider a method of reconstructing the structure delay of extended radio sources without constructing their radio images. The residuals derived after the adjustment of geodetic VLBI observations are used for this purpose. We show that the simplest model of a radio source consisting of two point components can be represented by four parameters (the angular separation of the components, the mutual orientation relative to the poleward direction, the flux-density ratio, and the spectral index difference) that are determined for each baseline of a multi-baseline VLBI network. The efficiency of this approach is demonstrated by estimating the coordinates of the radio source 0014+813 observed during the two-week CONT14 program organized by the International VLBI Service (IVS) in May 2014. Large systematic deviations have been detected in the residuals of the observations for the radio source 0014+813. The averaged characteristics of the radio structure of 0014+813 at a frequency of 8.4 GHz can be calculated from these deviations. Our modeling using four parameters has confirmed that the source consists of two components at an angular separation of 0.5 mas in the north-south direction. Using the structure delay when adjusting the CONT14 observations leads to a correction of the average declination estimate for the radio source 0014+813 by 0.070 mas.

  2. SN 1986J VLBI. IV. The Nature of the Central Component

    Science.gov (United States)

    Bietenholz, Michael F.; Bartel, Norbert

    2017-12-01

    We report on Very Large Array measurements between 1 and 45 GHz of the evolving radio spectral energy distribution (SED) of SN 1986J, made in conjunction with very long baseline interferometry (VLBI) imaging. The SED of SN 1986J is unique among supernovae, and shows an inversion point and a high-frequency turnover. Both are due to the central component seen in the VLBI images, and both are progressing downward in frequency with time. The optically thin spectral index of the central component is almost the same as that of the shell. We fit a simple model to the evolving SED consisting of an optically thin shell and a partly absorbed central component. The evolution of the SED is consistent with that of a homologously expanding system. Both components are fading, but the shell is fading more rapidly. We conclude that the central component is physically inside the expanding shell, and not a surface hotspot central only in projection. Our observations are consistent with the central component being due to interaction of the shock with the dense and highly structured circumstellar medium that resulted from a period of common-envelope evolution of the progenitor. However, a young pulsar-wind nebula or emission from an accreting black hole can also not be ruled out at this point.

  3. Analysis for orbital rendezvous of Chang'E-5 using SBI technique

    Science.gov (United States)

    Huang, Y.; Shan, Q.; Li, P.

    2016-12-01

    Chang'E-5 will be launched in later 2017/early 2018 using a new generation rocket from Wenchang satellite launch center, Hainan, China. It is a lunar sampling return mission, and it is the first time for China to carry out orbital rendezvous and docking in the Moon. How to achieve orbital rendezvous successfully in the Moon is very important in Chang'E-5 mission. Orbital rendezvous will be implemented between an orbiter and an ascender 200 km above the Moon. The ground tracking techniques include range, Doppler and VLBI, and they will be used to track the orbiter and the ascender when the ascender is about 70 km farther away from the orbiter. Later the ascender will approach the orbiter automatically. As a successful example, in Chang'E-3, the differential phase delay (delta delay) data between the rover and the lander are obtained with a random error of about 1 ps, and the relative position of the rover is determined with an accuracy of several meters by using same beam VLBI (SBI) technique. Here the application of the SBI technique for Chang'E-5 orbital rendezvous is discussed. SBI technique can be used to track the orbiter and the ascender simultaneously when they are in the same beam. Delta delay of the two probes can be derived, and the measurement accuracy is much higher than that of the traditional VLBI data because of the cancelation of common errors. Theoretically it can result in a more accurate relative orbit between the two probes. In the simulation, different strategies are discussed to analyze the contribution of SBI data to the orbit accuracy improvement especially relative orbit between the orbiter and ascender. The simulation results show that the relative position accuracy of the orbiter and ascender can reach about 1 m with delta delay data of 10 ps.

  4. Estimating the Celestial Reference Frame via Intra-Technique Combination

    Science.gov (United States)

    Iddink, Andreas; Artz, Thomas; Halsig, Sebastian; Nothnagel, Axel

    2016-12-01

    One of the primary goals of Very Long Baseline Interferometry (VLBI) is the determination of the International Celestial Reference Frame (ICRF). Currently the third realization of the internationally adopted CRF, the ICRF3, is under preparation. In this process, various optimizations are planned to realize a CRF that does not benefit only from the increased number of observations since the ICRF2 was published. The new ICRF can also benefit from an intra-technique combination as is done for the Terrestrial Reference Frame (TRF). Here, we aim at estimating an optimized CRF by means of an intra-technique combination. The solutions are based on the input to the official combined product of the International VLBI Service for Geodesy and Astrometry (IVS), also providing the radio source parameters. We discuss the differences in the setup using a different number of contributions and investigate the impact on TRF and CRF as well as on the Earth Orientation Parameters (EOPs). Here, we investigate the differences between the combined CRF and the individual CRFs from the different analysis centers.

  5. Astrometria diferencial de precision con VLBI el triangulo de Draco (y estudios de SN1993J)

    Science.gov (United States)

    Ros, E.

    1997-11-01

    The Very Long Baseline Interferometry (VLBI) technique provides unprecedented resolutions in astronomy. In this PhD we show progress in the study of high precision phase-delay differential astrometry through observations of the radio source triangle formed by the BL-Lac objects 1803+784 and 2007+777, and the QSO 1928+738, in the Northern constellation of Draco (the Dragon), from observations carried out on 20/21 November 1991 with an intercontinental interferometric array simultaneously at the frequencies of 2.3 and 8.4 GHz. We have determined the angular separations among the three radio sources with submilliarcsecond accuracy from a weighted least squares analysis of the differential phase delay from the three celestial bodies. Our present work introduces important advances with respect to previous astrometric studies, carried out over radio source pairs separated by smaller angular distances. We have consistently modeled the parameters involved in an astrometric VLBI observation, in order to reproduce the differential phase observed for radio sources separated by almost 7o on the sky. We have demonstrated the possibility of phase-connection over these angular distances at 8.4 GHz, even at an epoch of a maximum in the solar activity. After the phase-connection we have corrected the effects of the extended structure of the radio source and of the ionosphere. This last correction is one of the main technical achievements of this thesis: it is possible to remove the ionospheric contribution with independent measurements of the ionosphere total electron content obtained at Global Positioning Systems (GPS) sites the VLBI observing stations. The triangular geometry introduces constraints in parameter space that allow a better estimation of the angular separations among the radio sources. It is possible to test the consistency of the astrometric results through the Sky-Closure, defined as the circular sum of the angular separations of the three radio sources, determined

  6. Nonlinear integral equations for thermodynamics of the sl(r + 1) Uimin-Sutherland model

    International Nuclear Information System (INIS)

    Tsuboi, Zengo

    2003-01-01

    We derive traditional thermodynamic Bethe ansatz (TBA) equations for the sl(r+1) Uimin-Sutherland model from the T-system of the quantum transfer matrix. These TBA equations are identical to the those from the string hypothesis. Next we derive a new family of nonlinear integral equations (NLIEs). In particular, a subset of these NLIEs forms a system of NLIEs which contains only a finite number of unknown functions. For r=1, this subset of NLIEs reduces to Takahashi's NLIE for the XXX spin chain. A relation between the traditional TBA equations and our new NLIEs is clarified. Based on our new NLIEs, we also calculate the high-temperature expansion of the free energy

  7. Photogrammetry-Based Head Digitization for Rapid and Accurate Localization of EEG Electrodes and MEG Fiducial Markers Using a Single Digital SLR Camera.

    Science.gov (United States)

    Clausner, Tommy; Dalal, Sarang S; Crespo-García, Maité

    2017-01-01

    The performance of EEG source reconstruction has benefited from the increasing use of advanced head modeling techniques that take advantage of MRI together with the precise positions of the recording electrodes. The prevailing technique for registering EEG electrode coordinates involves electromagnetic digitization. However, the procedure adds several minutes to experiment preparation and typical digitizers may not be accurate enough for optimal source reconstruction performance (Dalal et al., 2014). Here, we present a rapid, accurate, and cost-effective alternative method to register EEG electrode positions, using a single digital SLR camera, photogrammetry software, and computer vision techniques implemented in our open-source toolbox, janus3D . Our approach uses photogrammetry to construct 3D models from multiple photographs of the participant's head wearing the EEG electrode cap. Electrodes are detected automatically or semi-automatically using a template. The rigid facial features from these photo-based models are then surface-matched to MRI-based head reconstructions to facilitate coregistration to MRI space. This method yields a final electrode coregistration error of 0.8 mm, while a standard technique using an electromagnetic digitizer yielded an error of 6.1 mm. The technique furthermore reduces preparation time, and could be extended to a multi-camera array, which would make the procedure virtually instantaneous. In addition to EEG, the technique could likewise capture the position of the fiducial markers used in magnetoencephalography systems to register head position.

  8. Detection of Intrinsic Source Structure at ∼3 Schwarzschild Radii with Millimeter-VLBI Observations of SAGITTARIUS A*

    Science.gov (United States)

    Lu, Ru-Sen; Krichbaum, Thomas P.; Roy, Alan L.; Fish, Vincent L.; Doeleman, Sheperd S.; Johnson, Michael D.; Akiyama, Kazunori; Psaltis, Dimitrios; Alef, Walter; Asada, Keiichi; Beaudoin, Christopher; Bertarini, Alessandra; Blackburn, Lindy; Blundell, Ray; Bower, Geoffrey C.; Brinkerink, Christiaan; Broderick, Avery E.; Cappallo, Roger; Crew, Geoffrey B.; Dexter, Jason; Dexter, Matt; Falcke, Heino; Freund, Robert; Friberg, Per; Greer, Christopher H.; Gurwell, Mark A.; Ho, Paul T. P.; Honma, Mareki; Inoue, Makoto; Kim, Junhan; Lamb, James; Lindqvist, Michael; Macmahon, David; Marrone, Daniel P.; Martí-Vidal, Ivan; Menten, Karl M.; Moran, James M.; Nagar, Neil M.; Plambeck, Richard L.; Primiani, Rurik A.; Rogers, Alan E. E.; Ros, Eduardo; Rottmann, Helge; SooHoo, Jason; Spilker, Justin; Stone, Jordan; Strittmatter, Peter; Tilanus, Remo P. J.; Titus, Michael; Vertatschitsch, Laura; Wagner, Jan; Weintroub, Jonathan; Wright, Melvyn; Young, Ken H.; Zensus, J. Anton; Ziurys, Lucy M.

    2018-05-01

    We report results from very long baseline interferometric (VLBI) observations of the supermassive black hole in the Galactic center, Sgr A*, at 1.3 mm (230 GHz). The observations were performed in 2013 March using six VLBI stations in Hawaii, California, Arizona, and Chile. Compared to earlier observations, the addition of the APEX telescope in Chile almost doubles the longest baseline length in the array, provides additional uv coverage in the N–S direction, and leads to a spatial resolution of ∼30 μas (∼3 Schwarzschild radii) for Sgr A*. The source is detected even at the longest baselines with visibility amplitudes of ∼4%–13% of the total flux density. We argue that such flux densities cannot result from interstellar refractive scattering alone, but indicate the presence of compact intrinsic source structure on scales of ∼3 Schwarzschild radii. The measured nonzero closure phases rule out point-symmetric emission. We discuss our results in the context of simple geometric models that capture the basic characteristics and brightness distributions of disk- and jet-dominated models and show that both can reproduce the observed data. Common to these models are the brightness asymmetry, the orientation, and characteristic sizes, which are comparable to the expected size of the black hole shadow. Future 1.3 mm VLBI observations with an expanded array and better sensitivity will allow more detailed imaging of the horizon-scale structure and bear the potential for a deep insight into the physical processes at the black hole boundary.

  9. Radio Occultation Experiments with Venus Express and Mars Express using the Planetary Radio Interferometry and Doppler Experiment (PRIDE) Technique

    Science.gov (United States)

    Bocanegra Bahamon, T.; Gurvits, L.; Molera Calves, G.; Cimo, G.; Duev, D.; Pogrebenko, S.; Dirkx, D.; Rosenblatt, P.

    2017-12-01

    The Planetary Radio Interferometry and Doppler Experiment (PRIDE) is a technique that can be used to enhance multiple radio science experiments of planetary missions. By 'eavesdropping' on the spacecraft signal using radio telescopes from different VLBI networks around the world, the PRIDE technique provides precise open-loop Doppler and VLBI observables to able to reconstruct the spacecraft's orbit. The application of this technique for atmospheric studies has been assessed by observing ESA's Venus Express (VEX) and Mars Express (MEX) during multiple Venus and Mars occultation events between 2012 and 2014. From these observing sessions density, temperature and pressure profiles of Venus and Mars neutral atmosphere and ionosphere have been retrieved. We present an error propagation analysis where the uncertainties of the atmospheric properties measured with this technique have been derived. These activities serve as demonstration of the applicability of the PRIDE technique for radio occultation studies, and provides a benchmark against the traditional Doppler tracking provided by the NASA's DSN and ESA's Estrack networks for these same purposes, in the framework of the upcoming ESA JUICE mission to the Jovian system.

  10. Remote Control and Monitoring of VLBI Experiments by Smartphones

    Science.gov (United States)

    Ruztort, C. H.; Hase, H.; Zapata, O.; Pedreros, F.

    2012-12-01

    For the remote control and monitoring of VLBI operations, we developed a software optimized for smartphones. This is a new tool based on a client-server architecture with a Web interface optimized for smartphone screens and cellphone networks. The server uses variables of the Field System and its station specific parameters stored in the shared memory. The client running on the smartphone by a Web interface analyzes and visualizes the current status of the radio telescope, receiver, schedule, and recorder. In addition, it allows commands to be sent remotely to the Field System computer and displays the log entries. The user has full access to the entire operation process, which is important in emergency cases. The software also integrates a webcam interface.

  11. Applying Information Retrieval Techniques to Detect Duplicates and to Rank References in the Preliminary Phases of Systematic Literature Reviews

    Directory of Open Access Journals (Sweden)

    Ramon Abilio

    2015-08-01

    Full Text Available Systematic Literature Review (SLR is a means to synthesize relevant and high quality studies related to a specific topic or research questions. In the Primary Selection stage of an SLR, the selection of studies is usually performed manually by reading title, abstract and keywords of each study. In the last years, the number of published scientific studies has grown increasing the effort to perform this sort of reviews. In this paper, we proposed strategies to detect non-papers and duplicated references in results exported by search engines, and strategies to rank the references in decreasing order of importance for an SLR, regarding the terms in the search string. These strategies are based on Information Retrieval techniques. We implemented the strategies and carried out an experimental evaluation of their applicability using two real datasets. As results, the strategy to detect non-papers presented 100% of precision and 50% of recall; the strategy to detect duplicates detected more duplicates than the manual inspection; and one of the strategies to rank relevant references presented 50% of precision and 80% of recall. Therefore, the results show that the proposed strategies can minimize the effort in the Primary Selection stage of an SLR.

  12. 18 centimeter VLBI observations of the quasar NRAO 140 during and after a low-frequency outburst

    International Nuclear Information System (INIS)

    Marscher, A.P.; Broderick, J.J.; Padrielli, L.; Bartel, N.; Romney, J.D.; Virginia Polytechnic Institute and State Univ., Blacksburg; CNR, Istituto di Radioastronomia, Bologna, Italy; Harvard-Smithsonian Center for Astrophysics, Cambridge, MA; Natitonal Radio Astronomy Observatory, Charlottesville, VA)

    1987-01-01

    VLBI and spectra observations have been used to identify the specific site of a low-frequency outburst in the quasar NRAO 140. The properties of the low-frequency variability in the quasar are compared with the predictions of several models. The refractive scintillation model alone does not account for the source's properties. 32 references

  13. Large scale mass redistribution and surface displacement from GRACE and SLR

    Science.gov (United States)

    Cheng, M.; Ries, J. C.; Tapley, B. D.

    2012-12-01

    Mass transport between the atmosphere, ocean and solid earth results in the temporal variations in the Earth gravity field and loading induced deformation of the Earth. Recent space-borne observations, such as GRACE mission, are providing extremely high precision temporal variations of gravity field. The results from 10-yr GRACE data has shown a significant annual variations of large scale vertical and horizontal displacements occurring over the Amazon, Himalayan region and South Asia, African, and Russian with a few mm amplitude. Improving understanding from monitoring and modeling of the large scale mass redistribution and the Earth's response are a critical for all studies in the geosciences, in particular for determination of Terrestrial Reference System (TRS), including geocenter motion. This paper will report results for the observed seasonal variations in the 3-dimentional surface displacements of SLR and GPS tracking stations and compare with the prediction from time series of GRACE monthly gravity solution.

  14. GPU Based Software Correlators - Perspectives for VLBI2010

    Science.gov (United States)

    Hobiger, Thomas; Kimura, Moritaka; Takefuji, Kazuhiro; Oyama, Tomoaki; Koyama, Yasuhiro; Kondo, Tetsuro; Gotoh, Tadahiro; Amagai, Jun

    2010-01-01

    Caused by historical separation and driven by the requirements of the PC gaming industry, Graphics Processing Units (GPUs) have evolved to massive parallel processing systems which entered the area of non-graphic related applications. Although a single processing core on the GPU is much slower and provides less functionality than its counterpart on the CPU, the huge number of these small processing entities outperforms the classical processors when the application can be parallelized. Thus, in recent years various radio astronomical projects have started to make use of this technology either to realize the correlator on this platform or to establish the post-processing pipeline with GPUs. Therefore, the feasibility of GPUs as a choice for a VLBI correlator is being investigated, including pros and cons of this technology. Additionally, a GPU based software correlator will be reviewed with respect to energy consumption/GFlop/sec and cost/GFlop/sec.

  15. Ionospheric Response to the Total Solar Eclipse of 22 July 2009 as Deduced from VLBI and GPS Data

    Science.gov (United States)

    Guo, L.; Shu, F. C.; Zheng, W. M.; Kondo, T.; Ichikawa, R.; Hasegawa, S.; Sekido, M.

    2010-01-01

    A total solar eclipse occurred over China at latitudes of about 30 N on the morning of 22 July 2009, providing a unique opportunity to investigate the influence of the sun on the earth's upper ionosphere. GPS observations from Shanghai GPS Local Network and VLBI observations from stations Shanghai, Urumqi, and Kashima were used to observe the response of TEC to the total solar eclipse. From the GPS data reduction, the sudden decrease of TEC at the time of the eclipse, amounting to 2.8 TECU, and gradual increase of TEC after the eclipse were found by analyzing the diurnal variations. More distinctly, the variations of TEC were studied along individual satellite passes. The delay in reaching the minimum level of TEC with the maximum phase of eclipse was 5-10 min. Besides, we also compared the ionospheric activity derived from different VLBI stations with the GPS results and found a strong correlation between them.

  16. Prospect of Continuous VLBI Measurement of Earth Rotation in Monitoring Geophysical Fluids

    Science.gov (United States)

    Chao, Benjamin F.; Ma, Chopo; Clark, Thomas

    1998-01-01

    Large-scale mass transports in the geophysical fluids of the Earth system excite Earth's rotational variations in both length-of-day and polar motion. The excitation process is via the conservation of angular momentum. Therefore Earth rotation observations contain information about the integrated angular momentum (consisting of both the mass term and the motion term) of the geophysical fluids, which include atmosphere, hydrosphere, mantle, and the outer and inner cores. Such global information is often important and otherwise unattainable depending on the nature of the mass transport, its magnitude and time scale. The last few years have seen great advances in VLBI measurement of Earth rotation in precision and temporal resolution. These advances have opened new. areas in geophysical fluid studies, such as oceanic tidal angular momentum, atmospheric tides, Earth librations, and rapid atmospheric angular momentum fluctuations. Precision of 10 microseconds in UTI and 200 microarcseconds in polar motion can now be achieved on hourly basis. Building upon this heritage, the multi-network geodetic VLBI project, Continuous Observation of the Rotation of the Earth (CORE), promises to further these studies and to make possible studies on elusive but tell-tale geophysical processes such as oscillatory modes in the core and in the atmosphere. Currently the early phase of CORE is underway. Within a few years into the new mellinnium, the upcoming space gravity missions (such as GRACE) will measure the temporal variations in Earth's gravitational field, thus providing complementary information to that from Earth rotation study for a better understanding of global geophysical fluid processes.

  17. VLBI-simulations for the estimation of degree-three Love and Shida numbers h3 and l3

    Science.gov (United States)

    Mendes Cerveira, P. J.; Boehm, J.; Wresnik, J.; Spicakova, H.; Schuh, H.

    2007-12-01

    For the displacement due to solid Earth tides, the IERS Conventions 2003 recommend several corrections to nominal values. One of these corrections is the in-phase contribution by using the real Love and Shida numbers h3 and l3 at all degree-3 tides, where only the contribution of the moon is relevant. The maximum predicted radial displacement is in the order of 1.7 mm. The nominal values are 0.292 for h3, and 0.015 for l3, respectively. Using realistic station and source catalogues, we simulated VLBI (Very Long Baseline Interferometry) group time delays, with a white noise going up to 2 cm, and taking into account the solid Earth tides displacement. Goal of this study was to investigate whether degree-3 Love and Shida numbers can be unambiguously determined from VLBI observations. Therefore, several setups w.r.t., e.g., station constellation, cutoff angle, time span, sampling interval, and different levels of white noise were tested. Attention was put into the separability and correlation between the degree-2 and degree-3 Love and Shida numbers.

  18. Mark III VLBI observations of the nucleus of M81 at 2.3 and 8.3 GHz

    International Nuclear Information System (INIS)

    Bartel, N.; Corey, B.E.; Shapiro, I.I.; Rogers, A.E.E.; Whitney, A.R.; Preston, R.A.

    1982-01-01

    The authors report here on simultaneous VLBI observations made with the Mark III system at 2.3 and 8.3 GHz. Observations on 14 and 16 March 1981 utilized the 100 m diameter telescope in Effelsberg, W. Germany (MPIR); the 43 m telescope at Green Bank, WV (NRAO); and the 40 m telescope near Big Pine, CA (OVRO). (Auth.)

  19. First mm-VLBI Observations between the TRAO 14-m and the NRO 45-m Telescopes: Observations of 86 GHz SiO Masers in VY Canis Majoris

    Science.gov (United States)

    Shibata, Katsunori M.; Chung, Hyung-Soo; Kameno, Seiji; Roh, Duk-Gyoo; Umemoto, Tomofumi; Kim, Kwang-Dong; Asada, Keiichi; Han, Seog-Tae; Mochizuki, Nanako; Cho, Se-Hyung; Sawada-Satoh, Satoko; Kim, Hyun-Goo; Bushimata, Takeshi; Minh, Young Chol; Miyaji, Takeshi; Kuno, Nario; Mikoshiba, Hiroshi; Sunada, Kazuyoshi; Inoue, Makoto; Kobayashi, Hideyuki

    2004-06-01

    We have made VLBI observations at 86GHz using a 1000-km baseline between Korea and Japan with successful detections of SiO v = 1, J = 2 - 1 maser emissions from VY CMa and Orion KL in 2001 June. This was the first VLBI result for this baseline and the first astronomical VLBI observation for the Korean telescope. Since then, we observed SiO v = 1, J = 2 - 1 maser emission in VY CMa in 2002 January and 2003 February and derived the distributions of the maser emissions. Our results show that the maser emissions extend over 2-4 stellar radii, and were within the inner radius of the dust shell. We observed other SiO maser sources and continuum sources, and 86-GHz continuum emissions were detected from three continuum sources. It was verified that this baseline has a performance comparable to the most sensitive baseline in the VLBA and the CMVA, and is capable of investigating the proper motions of maser features in circumstellar envelopes using monitoring observations.

  20. Frequent VLBI Monitoring on Parsec-Scales of 450+ Extragalactic FERMI Sources at 8 and 32 GHz

    Science.gov (United States)

    Jacobs, Christopher S.; Majid, W. A.; Romero-Wolf, A.; García-Mirí, C.; Horiuchi, S.; Snedeker, L. G.; Sotuela, I.

    2012-10-01

    Executive Summary: An existing Ka-band (32 GHz, 9mm) catalog of 450+ sources is being monitored every 6-10 weeks on Giga-lambda baselines. These observations are sensitive to parsec scale activity in the AGN cores providing unique tests of gamma ray emission models. Abstract: The Fermi Large Area Telescope (LAT) has now released the 2nd catalog of high-energy gamma-ray sources (2FGL) derived from the first 24 months of mission science data with 1873 sources detected and characterized in the 100 MeV to 100 GeV range. 1017 of 1873 sources at high Galactic latitude (abs(b) > 10 degrees) are associated statistically with active galactic nuclei (AGNs). Parsec-scale VLBI measurements play an important role in characterizing the nature of the candidate AGNs by providing crucial extra information to improve the probability of correct identification - VLBI filters out objects which do not host strong compact jets at parsec scale. We are carrying out regular VLBI monitoring of 450+ compact extragalactic sources using Deep Space Network (DSN) 34-meter antennas over intercontinental baselines simultaneously at 8 and 32 GHz. In addition to precision astrometric measurements of AGN compact cores used to maintain the JPL extragalactic reference frame, this program has the potential to provide regular simultaneous flux density measurements at 8 and 32 GHz with precision level of ~20%. By providing measurements on both East-West and North-South baselines with large antennas and Gbit/s recording capability, our program can probe sources down to a flux limit of 30 mJy (10-sigma), potentially increasing the sample to a fainter population of sources. In these regards, our program complements well existing northern and southern hemisphere VLBI monitoring programs, by providing flux measurements at 32 GHz, covering a fainter population sample, and by filling the gap for sources in the -20 to -45 degree declination range. Further, our program also provides additional flexibility for

  1. Use of GPS TEC Maps for Calibrating Single Band VLBI Sessions

    Science.gov (United States)

    Gordon, David

    2010-01-01

    GPS TEC ionosphere maps were first applied to a series of K and Q band VLBA astrometry sessions to try to eliminate a declination bias in estimated source positions. Their usage has been expanded to calibrate X-band only VLBI observations as well. At K-band, approx.60% of the declination bias appears to be removed with the application of GPS ionosphere calibrations. At X-band however, it appears that up to 90% or more of the declination bias is removed, with a corresponding increase in RA and declination uncertainties of approx.0.5 mas. GPS ionosphere calibrations may be very useful for improving the estimated positions of the X-only and S-only sources in the VCS and RDV sessions.

  2. Operational radio interferometry observation network (ORION) mobile VLBI station. [for NASA Crustal Dynamics Project

    Science.gov (United States)

    Renzetti, N. A.; Vegos, C. J.; Parks, G. S.; Sniffin, R. W.; Gannon, D. L.; Nishimura, H. G.; Clements, P. A.; Mckinney, R. P.; Menninger, F. J.; Vandenberg, N. R.

    1983-01-01

    The design and current status of the ORION mobile VLBI station is described. The station consists of a five-meter antenna, a receiving and recording system installed in a mobile antenna transporter, and an electronics transporter. The station is designed for field operation by a two-person crew at the rate of two sites per week. The various subsystems are described in detail, including the antenna, housing facilities for electronics and crew, microwave equipment, receiver, data acquisition subsystem, frequency and timing subsystem, phase calibration, monitoring and control, water vapor radiometer, and communications.

  3. Verification of the astrometric performance of the Korean VLBI network, using comparative SFPR studies with the VLBA AT 14/7 mm

    Energy Technology Data Exchange (ETDEWEB)

    Rioja, María J.; Dodson, Richard; Jung, TaeHyun; Sohn, Bong Won; Byun, Do-Young; Cho, Se-Hyung; Lee, Sang-Sung; Kim, Jongsoo; Kim, Kee-Tae; Oh, Chung Sik; Han, Seog-Tae; Je, Do-Heung; Chung, Moon-Hee; Wi, Seog-Oh; Kang, Jiman; Lee, Jung-Won; Chung, Hyunsoo; Kim, Hyo Ryoung; Kim, Hyun-Goo [Korea Astronomy and Space Science Institute, Daedeokdae-ro 776, Yuseong-gu, Daejeon 305-348 (Korea, Republic of); Agudo, Iván, E-mail: maria.rioja@icrar.org [Joint Institute for VLBI in Europe, Postbus 2, NL-7990 AA Dwingeloo (Netherlands); and others

    2014-11-01

    The Korean VLBI Network (KVN) is a new millimeter VLBI dedicated array with the capability to simultaneously observe at multiple frequencies, up to 129 GHz. The innovative multi-channel receivers present significant benefits for astrometric measurements in the frequency domain. The aim of this work is to verify the astrometric performance of the KVN using a comparative study with the VLBA, a well-established instrument. For that purpose, we carried out nearly contemporaneous observations with the KVN and the VLBA, at 14/7 mm, in 2013 April. The KVN observations consisted of simultaneous dual frequency observations, while the VLBA used fast frequency switching observations. We used the Source Frequency Phase Referencing technique for the observational and analysis strategy. We find that having simultaneous observations results in superior compensation for all atmospheric terms in the observables, in addition to offering other significant benefits for astrometric analysis. We have compared the KVN astrometry measurements to those from the VLBA. We find that the structure blending effects introduce dominant systematic astrometric shifts, and these need to be taken into account. We have tested multiple analytical routes to characterize the impact of the low-resolution effects for extended sources in the astrometric measurements. The results from the analysis of the KVN and full VLBA data sets agree within 2σ of the thermal error estimate. We interpret the discrepancy as arising from the different resolutions. We find that the KVN provides astrometric results with excellent agreement, within 1σ, when compared to a VLBA configuration that has a similar resolution. Therefore, this comparative study verifies the astrometric performance of the KVN using SFPR at 14/7 mm, and validates the KVN as an astrometric instrument.

  4. Beyond the usual mapping functions in GPS, VLBI and Deep Space tracking.

    Science.gov (United States)

    Barriot, Jean-Pierre; Serafini, Jonathan; Sichoix, Lydie

    2014-05-01

    We describe here a new algorithm to model the water contents of the atmosphere (including ZWD) from GPS slant wet delays relative to a single receiver. We first make the assumption that the water vapor contents are mainly governed by a scale height (exponential law), and secondly that the departures from this decaying exponential can be mapped as a set of low degree 3D Zernike functions (w.r.t. space) and Tchebyshev polynomials (w.r.t. time.) We compare this new algorithm with previous algorithms known as mapping functions in GPS, VLBI and Deep Space tracking and give an example with data acquired over a one day time span at the Geodesy Observatory of Tahiti.

  5. A Static Displacement Monitoring System for VLBI Antenna Using Close-Range Photogrammetry

    Directory of Open Access Journals (Sweden)

    Hyukgil Kim

    2017-11-01

    Full Text Available In this study, a static displacement monitoring program was developed to maintain the accurate performance of a Very Long Baseline Interferometry (VLBI antenna by monitoring its structural stability. The monitoring program was designed to measure static displacement, among the many displacements of the antenna’s main reflector, which can directly affect its performance. The program measures the position of a monitored object with mm-level accuracy through close-range photogrammetry that uses high-resolution Charge Coupled Device (CCD cameras. The developed program will be used to evaluate the structural soundness of an antenna based on continuous displacement measurements, which can also be used as basic data for repair and reinforcement work in the future.

  6. A comparative study of amplitude calibrations for the East Asia VLBI Network: A priori and template spectrum methods

    Science.gov (United States)

    Cho, Ilje; Jung, Taehyun; Zhao, Guang-Yao; Akiyama, Kazunori; Sawada-Satoh, Satoko; Kino, Motoki; Byun, Do-Young; Sohn, Bong Won; Shibata, Katsunori M.; Hirota, Tomoya; Niinuma, Kotaro; Yonekura, Yoshinori; Fujisawa, Kenta; Oyama, Tomoaki

    2017-12-01

    We present the results of a comparative study of amplitude calibrations for the East Asia VLBI Network (EAVN) at 22 and 43 GHz using two different methods of an "a priori" and a "template spectrum", particularly on lower declination sources. Using observational data sets of early EAVN observations, we investigated the elevation-dependence of the gain values at seven stations of the KaVA (KVN and VERA Array) and three additional telescopes in Japan (Takahagi 32 m, Yamaguchi 32 m, and Nobeyama 45 m). By comparing the independently obtained gain values based on these two methods, we found that the gain values from each method were consistent within 10% at elevations higher than 10°. We also found that the total flux densities of two images produced from the different amplitude calibrations were in agreement within 10% at both 22 and 43 GHz. By using the template spectrum method, furthermore, the additional radio telescopes can participate in KaVA (i.e., EAVN), giving a notable sensitivity increase. Therefore, our results will constrain the detailed conditions in order to measure the VLBI amplitude reliably using EAVN, and discuss the potential of possible expansion to telescopes comprising EAVN.

  7. Connecting VLBI and Gaia celestial reference frames

    Directory of Open Access Journals (Sweden)

    Zinovy Malkin

    2016-09-01

    Full Text Available The current state of the link problem between radio and optical celestial reference frames is considered.The main objectives of the investigations in this direction during the next few years are the preparation of a comparisonand the mutual orientation and rotation between the optical it Gaia Celestial Reference Frame (GCRFand the 3rd generation radio International Celestial Reference Frame (ICRF3, obtained from VLBI observations.Both systems, ideally, should be a realization of the ICRS (International Celestial Reference System at micro-arcsecond level accuracy.Therefore, the link accuracy between the ICRF and GCRF should be obtained with similar error level, which is not a trivial taskdue to relatively large systematic and random errors in source positions at different frequency bands.In this paper, a brief overview of recent work on the GCRF--ICRF link is presented.Additional possibilities to improve the GCRF--ICRF link accuracy are discussed.The suggestion is made to use astrometric radio sources with optical magnitude to 20$^m$ rather than to 18$^m$ as currently plannedfor the GCRF--ICRF link.In addition, the use of radio stars is also a prospective method to obtain independent and accurate orientation between the Gaia frame and the ICRF.

  8. Connecting VLBI and Gaia Celestial Reference Frames

    Energy Technology Data Exchange (ETDEWEB)

    Malkin, Zinovy, E-mail: malkin@gao.spb.ru [Department of Radio Astronomy Research, The Pulkovo Astronomical Observatory, St. Petersburg (Russian Federation); Institute of Earth Sciences, St. Petersburg State University, St. Petersburg (Russian Federation); Astronomy and Cosmic Geodesy Department, Kazan Federal University, Kazan (Russian Federation)

    2016-09-12

    The current state of the link problem between radio and optical celestial reference frames is considered. The main objectives of the investigations in this direction during the next few years are the preparation of a comparison and the mutual orientation and rotation between the optical Gaia Celestial Reference Frame (GCRF) and the 3rd generation radio International Celestial Reference Frame (ICRF3), obtained from VLBI observations. Both systems, ideally, should be a realization of the ICRS (International Celestial Reference System) at micro-arcsecond level accuracy. Therefore, the link accuracy between the ICRF and GCRF should be obtained with similar error level, which is not a trivial task due to relatively large systematic and random errors in source positions at different frequency bands. In this paper, a brief overview of recent work on the GCRF–ICRF link is presented. Additional possibilities to improve the GCRF–ICRF link accuracy are discussed. The suggestion is made to use astrometric radio sources with optical magnitude to 20{sup m} rather than to 18{sup m} as currently planned for the GCRF–ICRF link. In addition, the use of radio stars is also a prospective method to obtain independent and accurate orientation between the Gaia frame and the ICRF.

  9. NASA Space Geodesy Program: GSFC data analysis, 1993. VLBI geodetic results 1979 - 1992

    Science.gov (United States)

    Ma, Chopo; Ryan, James W.; Caprette, Douglas S.

    1994-01-01

    The Goddard VLBI group reports the results of analyzing Mark 3 data sets acquired from 110 fixed and mobile observing sites through the end of 1992 and available to the Space Geodesy Program. Two large solutions were used to obtain site positions, site velocities, baseline evolution for 474 baselines, earth rotation parameters, nutation offsets, and radio source positions. Site velocities are presented in both geocentric Cartesian and topocentric coordinates. Baseline evolution is plotted for the 89 baselines that were observed in 1992 and positions at 1988.0 are presented for all fixed stations and mobile sites. Positions are also presented for quasar radio sources used in the solutions.

  10. IVS Organization

    Science.gov (United States)

    2004-01-01

    International VLBI Service (IVS) is an international collaboration of organizations which operate or support Very Long Baseline Interferometry (VLBI) components. The goals are: To provide a service to support geodetic, geophysical and astrometric research and operational activities. To promote research and development activities in all aspects of the geodetic and astrometric VLBI technique. To interact with the community of users of VLBI products and to integrate VLBI into a global Earth observing system.

  11. A two-level approach to VLBI terrestrial and celestial reference frames using both least-squares adjustment and Kalman filter algorithms

    Science.gov (United States)

    Soja, B.; Krasna, H.; Boehm, J.; Gross, R. S.; Abbondanza, C.; Chin, T. M.; Heflin, M. B.; Parker, J. W.; Wu, X.

    2017-12-01

    The most recent realizations of the ITRS include several innovations, two of which are especially relevant to this study. On the one hand, the IERS ITRS combination center at DGFI-TUM introduced a two-level approach with DTRF2014, consisting of a classical deterministic frame based on normal equations and an optional coordinate time series of non-tidal displacements calculated from geophysical loading models. On the other hand, the JTRF2014 by the combination center at JPL is a time series representation of the ITRF determined by Kalman filtering. Both the JTRF2014 and the second level of the DTRF2014 are thus able to take into account short-term variations in the station coordinates. In this study, based on VLBI data, we combine these two approaches, applying them to the determination of both terrestrial and celestial reference frames. Our product has two levels like DTRF2014, with the second level being a Kalman filter solution like JTRF2014. First, we compute a classical TRF and CRF in a global least-squares adjustment by stacking normal equations from 5446 VLBI sessions between 1979 and 2016 using the Vienna VLBI and Satellite Software VieVS (solution level 1). Next, we obtain coordinate residuals from the global adjustment by applying the level-1 TRF and CRF in the single-session analysis and estimating coordinate offsets. These residuals are fed into a Kalman filter and smoother, taking into account the stochastic properties of the individual stations and radio sources. The resulting coordinate time series (solution level 2) serve as an additional layer representing irregular variations not considered in the first level of our approach. Both levels of our solution are implemented in VieVS in order to test their individual and combined performance regarding the repeatabilities of estimated baseline lengths, EOP, and radio source coordinates.

  12. GPS Position Time Series @ JPL

    Science.gov (United States)

    Owen, Susan; Moore, Angelyn; Kedar, Sharon; Liu, Zhen; Webb, Frank; Heflin, Mike; Desai, Shailen

    2013-01-01

    Different flavors of GPS time series analysis at JPL - Use same GPS Precise Point Positioning Analysis raw time series - Variations in time series analysis/post-processing driven by different users. center dot JPL Global Time Series/Velocities - researchers studying reference frame, combining with VLBI/SLR/DORIS center dot JPL/SOPAC Combined Time Series/Velocities - crustal deformation for tectonic, volcanic, ground water studies center dot ARIA Time Series/Coseismic Data Products - Hazard monitoring and response focused center dot ARIA data system designed to integrate GPS and InSAR - GPS tropospheric delay used for correcting InSAR - Caltech's GIANT time series analysis uses GPS to correct orbital errors in InSAR - Zhen Liu's talking tomorrow on InSAR Time Series analysis

  13. International VLBI Service for Geodesy and Astrometry. Delivering high-quality products and embarking on observations of the next generation

    Science.gov (United States)

    Nothnagel, A.; Artz, T.; Behrend, D.; Malkin, Z.

    2017-07-01

    The International VLBI Service for Geodesy and Astrometry (IVS) regularly produces high-quality Earth orientation parameters from observing sessions employing extensive networks or individual baselines. The master schedule is designed according to the telescope days committed by the stations and by the need for dense sampling of the Earth orientation parameters (EOP). In the pre-2011 era, the network constellations with their number of telescopes participating were limited by the playback and baseline capabilities of the hardware (Mark4) correlators. This limitation was overcome by the advent of software correlators, which can now accommodate many more playback units in a flexible configuration. In this paper, we describe the current operations of the IVS with special emphasis on the quality of the polar motion results since these are the only EOP components which can be validated against independent benchmarks. The polar motion results provided by the IVS have improved continuously over the years, now providing an agreement with IGS results at the level of 20-25 μas in a WRMS sense. At the end of the paper, an outlook is given for the realization of the VLBI Global Observing System.

  14. Prospects for UT1 Measurements from VLBI Intensive Sessions

    Science.gov (United States)

    Boehm, Johannes; Nilsson, Tobias; Schuh, Harald

    2010-01-01

    Very Long Baseline Interferometry (VLBI) Intensives are one-hour single baseline sessions to provide Universal Time (UT1) in near real-time up to a delay of three days if a site is not e-transferring the observational data. Due to the importance of UT1 estimates for the prediction of Earth orientation parameters, as well as any kind of navigation on Earth or in space, there is not only the need to improve the timeliness of the results but also their accuracy. We identify the asymmetry of the tropospheric delays as the major error source, and we provide two strategies to improve the results, in particular of those Intensives which include the station Tsukuba in Japan with its large tropospheric variation. We find an improvement when (1) using ray-traced delays from a numerical weather model, and (2) when estimating tropospheric gradients within the analysis of Intensive sessions. The improvement is shown in terms of reduction of rms of length-of-day estimates w.r.t. those derived from Global Positioning System observations

  15. Multi-source self-calibration: Unveiling the microJy population of compact radio sources

    NARCIS (Netherlands)

    Radcliffe, J. F.; Garrett, M. A.; Beswick, R. J.; Muxlow, T. W. B.; Barthel, P. D.; Deller, A. T.; Middelberg, E.

    2016-01-01

    Context. Very long baseline interferometry (VLBI) data are extremely sensitive to the phase stability of the VLBI array. This is especially important when we reach μJy rms sensitivities. Calibration using standard phase-referencing techniques is often used to improve the phase stability of VLBI

  16. One Step Solution to the Local Tie Vectors of GNSS/SLR in ITRF

    Directory of Open Access Journals (Sweden)

    MA Xiaping

    2018-01-01

    Full Text Available This paper proposes a one-step solution of local tie vectors,the solution takes RP (Reference Point and axes offsets of SLR telescope as unknown parameters,GNSS baselines network and conventional terrestrial observation (horizontal,vertical angle and distance are combined in ITRF (International Terrestrial Reference Frame,and multiply constraint conditions are established between RP and observation marks and two axes offsets.Local tie vectors and related covariance matrices of the 3 co-located sites in Beijing,Kunming,Xi'an of CMONOC (Crustal Movement Observation Network of China are solved with the proposed one step solution.The results show that the RMS (root mean square error of local tie vectors is less than 2.0 mm.Besides,the differences are less than 2.0 mm compared with the traditional step by step solution,and the offsets and corresponding RMS between the horizontal axis and vertical axis are 3.8 mm,0.7 mm,3.6 mm and 1.3 mm,1.2 mm,1.3 mm,respectively.

  17. Single-dish and VLBI observations of Cygnus X-3 during the 2016 giant flare episode

    Science.gov (United States)

    Egron, E.; Pellizzoni, A.; Giroletti, M.; Righini, S.; Stagni, M.; Orlati, A.; Migoni, C.; Melis, A.; Concu, R.; Barbas, L.; Buttaccio, S.; Cassaro, P.; De Vicente, P.; Gawroński, M. P.; Lindqvist, M.; Maccaferri, G.; Stanghellini, C.; Wolak, P.; Yang, J.; Navarrini, A.; Loru, S.; Pilia, M.; Bachetti, M.; Iacolina, M. N.; Buttu, M.; Corbel, S.; Rodriguez, J.; Markoff, S.; Wilms, J.; Pottschmidt, K.; Cadolle Bel, M.; Kalemci, E.; Belloni, T.; Grinberg, V.; Marongiu, M.; Vargiu, G. P.; Trois, A.

    2017-11-01

    In 2016 September, the microquasar Cygnus X-3 underwent a giant radio flare, which was monitored for 6 d with the Medicina Radio Astronomical Station and the Sardinia Radio Telescope. Long observations were performed in order to follow the evolution of the flare on an hourly scale, covering six frequency ranges from 1.5 to 25.6 GHz. The radio emission reached a maximum of 13.2 ± 0.7 Jy at 7.2 GHz and 10 ± 1 Jy at 18.6 GHz. Rapid flux variations were observed at high radio frequencies at the peak of the flare, together with rapid evolution of the spectral index: α steepened from 0.3 to 0.6 (with Sν ∝ ν-α) within 5 h. This is the first time that such fast variations are observed, giving support to the evolution from optically thick to optically thin plasmons in expansion moving outward from the core. Based on the Italian network (Noto, Medicina and SRT) and extended to the European antennas (Torun, Yebes, Onsala), very long baseline interferometry (VLBI) observations were triggered at 22 GHz on five different occasions, four times prior to the giant flare, and once during its decay phase. Flux variations of 2 h duration were recorded during the first session. They correspond to a mini-flare that occurred close to the core 10 d before the onset of the giant flare. From the latest VLBI observation we infer that 4 d after the flare peak the jet emission was extended over 30 mas.

  18. Data mining techniques for thermophysical properties of refrigerants

    International Nuclear Information System (INIS)

    Kuecueksille, Ecir Ugur; Selbas, Resat; Sencan, Arzu

    2009-01-01

    This study presents ten modeling techniques within data mining process for the prediction of thermophysical properties of refrigerants (R134a, R404a, R407c and R410a). These are linear regression (LR), multi layer perception (MLP), pace regression (PR), simple linear regression (SLR), sequential minimal optimization (SMO), KStar, additive regression (AR), M5 model tree, decision table (DT), M5'Rules models. Relations depending on temperature and pressure were carried out for the determination of thermophysical properties as the specific heat capacity, viscosity, heat conduction coefficient, density of the refrigerants. Obtained model results for every refrigerant were compared and the best model was investigated. Results indicate that use of derived formulations from these techniques will facilitate design and optimize of heat exchangers which is component of especially vapor compression refrigeration system

  19. Motion and properties of nuclear radio components in Seyfert galaxies seen with VLBI

    Science.gov (United States)

    Middelberg, E.; Roy, A. L.; Nagar, N. M.; Krichbaum, T. P.; Norris, R. P.; Wilson, A. S.; Falcke, H.; Colbert, E. J. M.; Witzel, A.; Fricke, K. J.

    2004-04-01

    We report EVN, MERLIN and VLBA observations at 18 cm, 6 cm and 3.6 cm of the Seyfert galaxies NGC 7674, NGC 5506, NGC 2110 and Mrk 1210 to study their structure and proper motions on pc scales and to add some constraints on the many possible causes of the radio-quietness of Seyferts. The component configurations in NGC 7674 and NGC 2110 are simple, linear structures, whereas the configurations in NGC 5506 and Mrk 1210 have multiple components with no clear axis of symmetry. We suggest that NGC 7674 is a low-luminosity compact symmetric object. Comparing the images at different epochs, we find a proper motion in NGC 7674 of (0.92±0.07) c between the two central components separated by 282 pc and, in NGC 5506, we find a 3 σ upper limit of 0.50 c for the components separated by 3.8 pc. Our results confirm and extend earlier work showing that the outward motion of radio components in Seyfert galaxies is non-relativistic on pc scales. We briefly discuss whether this non-relativistic motion is intrinsic to the jet-formation process or results from deceleration of an initially relativistic jet by interaction with the pc or sub-pc scale interstellar medium. We combined our sample with a list compiled from the literature of VLBI observations made of Seyfert galaxies, and found that most Seyfert nuclei have at least one flat-spectrum component on the VLBI scale, which was not seen in the spectral indices measured at arcsec resolution. We found also that the bimodal alignment of pc and kpc radio structures displayed by radio galaxies and quasars is not displayed by this sample of Seyferts, which shows a uniform distribution of misalignment between 0° and 90°. The frequent misalignment could result from jet precession or from deflection of the jet by interaction with gas in the interstellar medium.

  20. Stability of Global Geodetic Results

    Science.gov (United States)

    Herring, T.

    The precision of global geodetic techniques has reached unprecedented levels. Sys- tems capable of millimeter level horizontal and several millimeter vertical precisions are now deployed. The Global Positioning System (GPS) has the most deployed continuously-operating receivers with several hundred providing data through the in- ternet for analysis. However, the satellite system used with GPS evolves with time as new generations of GPS satellites are launched. During the 1990's, the constellation evolved from Block I to Block II and IIA with the most recent generation being Block IIR. There are considerable differences in the size and antenna configurations in the different generations of satellites. The antenna configuration specifically could cause systematic changes in the terrestrial reference system. Results from the ITRF2000 combinations suggest that there are significant time variations in the scale of GPS system possibly due to phase center variations in GPS transmission antennas. These variations could result in height changes of up to 3 mm/yr. We will investigate the stability of the GPS system through combination of GPS results with results from VLBI and SLR. All components of the transformation between the systems, rotation, translation and scale will be investigated.

  1. International VLBI Service for Geodesy and Astrometry: General Meeting Proceedings

    Science.gov (United States)

    Vandenberg, Nancy R. (Editor); Baver, Karen D. (Editor)

    2002-01-01

    This volume contains the proceedings of the second General Meeting of the International VLBI Service for Geodesy and Astrometry (IVS), held in Tsukuba, Japan, February 4-7, 2002. The contents of this volume also appear on the IVS Web site at http://ivscc.gsfc.nasa.gov/publications/gm2002. The key-note of the second GM was prospectives for the future, in keeping with the re-organization of the IAG around the motivation of geodesy as 'an old science with a dynamic future' and noting that providing reference frames for Earth system science that are consistent over decades on the highest accuracy level will provide a challenging role for IVS. The goal of the meeting was to provide an interesting and informative program for a wide cross section of IVS members, including station operators, program managers, and analysts. This volume contains 72 papers and five abstracts of papers presented at the GM. The volume also includes reports about three splinter meetings held in conjunction with the GM: a mini-TOW (Technical Operations Workshop), the third IVS Analysis Workshop and a meeting of the analysis working group on geophysical modeling.

  2. Detecting Changing Polarization Structures in Sagittarius A* with High Frequency VLBI

    Science.gov (United States)

    Fish, Vincent L.; Doeleman, Sheperd S.; Broderick, Avery E.; Loeb, Abraham; Rogers, Alan E. E.

    2009-12-01

    Sagittarius A* is the source of near infrared, X-ray, radio, and (sub)millimeter emission associated with the supermassive black hole at the Galactic Center. In the submillimeter regime, Sgr A* exhibits time-variable linear polarization on timescales corresponding to errors. Although the source-integrated linear polarization fraction in the models is typically only a few percent, the linear polarization fraction on small angular scales can be much higher, enabling the detection of changes in the polarimetric structure of Sgr A* on a wide variety of baselines. The shortest baselines track the source-integrated linear polarization fraction, while longer baselines are sensitive to polarization substructures that are beam-diluted by connected-element interferometry. The detection of periodic variability in source polarization should not be significantly affected even if instrumental polarization terms cannot be calibrated out. As more antennas are included in the (sub)millimeter-VLBI array, observations with full polarization will provide important new diagnostics to help disentangle intrinsic source polarization from Faraday rotation effects in the accretion and outflow region close to the black hole event horizon.

  3. 100 ways to make good photos great tips & techniques for improving your digital photography

    CERN Document Server

    Cope, Peter

    2013-01-01

    A practical, accessible guide to turning your good photographs into great ones whether you are shooting on the latest digital SLR or a camera phone! Discover 100 simple and fun ways to improve your photographs both in-camera and through post-processing image manipulation. Every key photographic genre is covered, from perfect portraits and the great outdoors, to travel photos and shooting at night. Filled with inspirational examples of great photographs compared against the more average images, with easy to follow techniques for how you can achieve the same results.

  4. NASA Space Geodesy Program: GSFC data analysis, 1992. Crustal Dynamics Project VLBI geodetic results, 1979 - 1991

    Science.gov (United States)

    Ryan, J. W.; Ma, C.; Caprette, D. S.

    1993-01-01

    The Goddard VLBI group reports the results of analyzing 1648 Mark 3 data sets acquired from fixed and mobile observing sites through the end of 1991, and available to the Crustal Dynamics Project. Two large solutions were used to obtain Earth rotation parameters, nutation offsets, radio source positions, site positions, site velocities, and baseline evolution. Site positions are tabulated on a yearly basis for 1979 to 1995, inclusive. Site velocities are presented in both geocentric Cartesian and topocentric coordinates. Baseline evolution is plotted for 200 baselines, and individual length determinations are presented for an additional 356 baselines. This report includes 155 quasar radio sources, 96 fixed stations and mobile sites, and 556 baselines.

  5. First Results of the VLBI Experiment on Radar Location of the Asteroid 2012 DA14

    Directory of Open Access Journals (Sweden)

    Nechaeva M.

    2013-12-01

    Full Text Available An international VLBI experiment on radio location of the asteroid 2012 DA14 was organized on 2013 February 15–16, during its flyby close to Earth. The purpose of observations was to investigate and specify orbital parameters of the asteroid, as well as to evaluate its rotation period and other characteristics. The irradiation of the asteroid was performed by the RT-70 transmitter at Evpatoria (Crimea, Ukraine, while the reflected signals were successfully accepted by the two 32 m radio telescopes at Medicina (Bologna, Italy and Irbene (Ventspils, Latvia. Processing and interpretation of the data were performed both in the Radiophysical Research Institute at Nizhny Novgorod and in the Ventspils International Radio Astronomy Center. The first results of this experiment are presented and discussed.

  6. Multifrequency radio VLBI observations of the superluminal low-frequency variable quasar NRAO 140

    International Nuclear Information System (INIS)

    Marscher, A.P.; Broderick, J.J.

    1985-01-01

    VLBI maps of the quasar NRAO 140 at three wavelengths: 18, 6, and 2.8 cm are presented. The source consists of a jetlike structure delineated by a nearly colinear series of components which are progressively more compact toward the northwestern end of the source. The multifrequency observations make it possible to dissect accurately the spectrum of the source, which leads to an affirmation of the previously reported Compton problem and superluminal motion. The Compton problem requires relativistic motion with Doppler factor delta greater than 3.7. One of the components is separating from the core at a rate of 0.15 milliarcsec/yr, which translates to an apparent velocity between 4c and 13c, depending on the values of H(0) and q(0). The energy in relativistic electrons in one of the components far exceeds the energy in magnetic field, but the total energy requirement need not exceed approximately 10 to the 54th ergs. 27 references

  7. Cadmium triggers an integrated reprogramming of the metabolism of Synechocystis PCC6803, under the control of the Slr1738 regulator

    Directory of Open Access Journals (Sweden)

    Aude Jean-Christophe

    2007-10-01

    Full Text Available Abstract Background Cadmium is a persistent pollutant that threatens most biological organisms, including cyanobacteria that support a large part of the biosphere. Using a multifaceted approach, we have investigated the global responses to Cd and other relevant stresses (H2O2 and Fe in the model cyanobacterium Synechocystis PCC6803. Results We found that cells respond to the Cd stress in a two main temporal phases process. In the "early" phase cells mainly limit Cd entry through the negative and positive regulation of numerous genes operating in metal uptake and export, respectively. As time proceeds, the number of responsive genes increases. In this "massive" phase, Cd downregulates most genes operating in (i photosynthesis (PS that normally provides ATP and NADPH; (ii assimilation of carbon, nitrogen and sulfur that requires ATP and NAD(PH; and (iii translation machinery, a major consumer of ATP and nutrients. Simultaneously, many genes are upregulated, such as those involved in Fe acquisition, stress tolerance, and protein degradation (crucial to nutrients recycling. The most striking common effect of Cd and H2O2 is the disturbance of both light tolerance and Fe homeostasis, which appeared to be interdependent. Our results indicate that cells challenged with H2O2 or Cd use different strategies for the same purpose of supplying Fe atoms to Fe-requiring metalloenzymes and the SUF machinery, which synthesizes or repairs Fe-S centers. Cd-stressed cells preferentially breakdown their Fe-rich PS machinery, whereas H2O2-challenged cells preferentially accelerate the intake of Fe atoms from the medium. Conclusion We view the responses to Cd as an integrated "Yin Yang" reprogramming of the whole metabolism, we found to be controlled by the Slr1738 regulator. As the Yin process, the ATP- and nutrients-sparing downregulation of anabolism limits the poisoning incorporation of Cd into metalloenzymes. As the compensatory Yang process, the PS breakdown

  8. Archiving Space Geodesy Data for 20+ Years at the CDDIS

    Science.gov (United States)

    Noll, Carey E.; Dube, M. P.

    2004-01-01

    Since 1982, the Crustal Dynamics Data Information System (CDDIS) has supported the archive and distribution of geodetic data products acquired by NASA programs. These data include GPS (Global Positioning System), GLONASS (GLObal NAvigation Satellite System), SLR (Satellite Laser Ranging), VLBI (Very Long Baseline Interferometry), and DORIS (Doppler Orbitography and Radiolocation Integrated by Satellite). The data archive supports NASA's space geodesy activities through the Solid Earth and Natural Hazards (SENH) program. The CDDIS data system and its archive have become increasingly important to many national and international programs, particularly several of the operational services within the International Association of Geodesy (IAG), including the International GPS Service (IGS), the International Laser Ranging Service (ILRS), the International VLBI Service for Geodesy and Astrometry (IVS), the International DORIS Service (IDS), and the International Earth Rotation Service (IERS). The CDDIS provides easy and ready access to a variety of data sets, products, and information about these data. The specialized nature of the CDDIS lends itself well to enhancement and thus can accommodate diverse data sets and user requirements. All data sets and metadata extracted from these data sets are accessible to scientists through ftp and the web; general information about each data set is accessible via the web. The CDDIS, including background information about the system and its user communities, the computer architecture, archive contents, available metadata, and future plans will be discussed.

  9. Predicting impact of SLR on coastal flooding in Banda Aceh coastal defences

    Science.gov (United States)

    Al'ala, Musa; Syamsidik, Kato, Shigeru

    2017-10-01

    Banda Aceh is a low-lying city located at the northern tip of Sumatra Island and situated at the conjuncture of Malacca Strait and the Andaman Sea. A Sea Level Rise (SLR) rate at 7 mm/year has been observed around this region. In the next 50 years, this city will face a serious challenge to encounter impacts of the sea level rise, such as frequent coastal floodings. This study is aimed at estimating impacts of the sea level rise induced coastal floodings on several types of coastal structures and city drainage system. Numerical simulations of Delft3D were applied to investigate the influence of the gradual sea level rise in 50 years. The hydrodynamic process of coastal flooding and sediment transport were simulated by Delft3D-Flow. Topography and bathymetry data were collected from GEBCO and updated with the available nautical chart (DISHIDROS, JICA, and field measurements). Hydrodynamic process gains the flow process revealing the level of the sea water intrusion also observed in the model. Main rivers (Krueng Aceh, Krueng Neng, and Alue Naga Flood Canal) and the drainage system were observed to see the tides effects on coastal structures and drainage system. The impact on coastal community focusing on affected area, shoreline retreat, the rate of sea intrusion was analyzed with spatial tools. New coastal line, coastal flooding vulnerable area, and the community susceptibility properties map influenced by 50 years sea level rise is produced. This research found that the city needs to address strategies to anticipate the exacerbating impacts of the sea level rise by managing its coastal spatial planning and modify its drainage system, especially at the drainage outlets.

  10. Imaging Simulations for the Korean VLBI Network (KVN

    Directory of Open Access Journals (Sweden)

    Tae-Hyun Jung

    2005-03-01

    Full Text Available The Korean VLBI Network (KVN will open a new field of research in astronomy, geodesy and earth science using the newest three 21m radio telescopes. This will expand our ability to look at the Universe in the millimeter regime. Imaging capability of radio interferometry is highly dependent upon the antenna configuration, source size, declination and the shape of target. In this paper, imaging simulations are carried out with the KVN system configuration. Five test images were used which were a point source, multi-point sources, a uniform sphere with two different sizes compared to the synthesis beam of the KVN and a Very Large Array (VLA image of Cygnus A. The declination for the full time simulation was set as +60 degrees and the observation time range was --6 to +6 hours around transit. Simulations have been done at 22GHz, one of the KVN observation frequency. All these simulations and data reductions have been run with the Astronomical Image Processing System (AIPS software package. As the KVN array has a resolution of about 6 mas (milli arcsecond at 22GHz, in case of model source being approximately the beam size or smaller, the ratio of peak intensity over RMS shows about 10000:1 and 5000:1. The other case in which model source is larger than the beam size, this ratio shows very low range of about 115:1 and 34:1. This is due to the lack of short baselines and the small number of antenna. We compare the coordinates of the model images with those of the cleaned images. The result shows mostly perfect correspondence except in the case of the 12mas uniform sphere. Therefore, the main astronomical targets for the KVN will be the compact sources and the KVN will have an excellent performance in the astrometry for these sources.

  11. Satellite laser ranging to low Earth orbiters: orbit and network validation

    Science.gov (United States)

    Arnold, Daniel; Montenbruck, Oliver; Hackel, Stefan; Sośnica, Krzysztof

    2018-04-01

    Satellite laser ranging (SLR) to low Earth orbiters (LEOs) provides optical distance measurements with mm-to-cm-level precision. SLR residuals, i.e., differences between measured and modeled ranges, serve as a common figure of merit for the quality assessment of orbits derived by radiometric tracking techniques. We discuss relevant processing standards for the modeling of SLR observations and highlight the importance of line-of-sight-dependent range corrections for the various types of laser retroreflector arrays. A 1-3 cm consistency of SLR observations and GPS-based precise orbits is demonstrated for a wide range of past and present LEO missions supported by the International Laser Ranging Service (ILRS). A parameter estimation approach is presented to investigate systematic orbit errors and it is shown that SLR validation of LEO satellites is not only able to detect radial but also along-track and cross-track offsets. SLR residual statistics clearly depend on the employed precise orbit determination technique (kinematic vs. reduced-dynamic, float vs. fixed ambiguities) but also reveal pronounced differences in the ILRS station performance. Using the residual-based parameter estimation approach, corrections to ILRS station coordinates, range biases, and timing offsets are derived. As a result, root-mean-square residuals of 5-10 mm have been achieved over a 1-year data arc in 2016 using observations from a subset of high-performance stations and ambiguity-fixed orbits of four LEO missions. As a final contribution, we demonstrate that SLR can not only validate single-satellite orbit solutions but also precise baseline solutions of formation flying missions such as GRACE, TanDEM-X, and Swarm.

  12. CASA Uno GPS orbit and baseline experiments

    Science.gov (United States)

    Schutz, B. E.; Ho, C. S.; Abusali, P. A. M.; Tapley, B. D.

    1990-01-01

    CASA Uno data from sites distributed in longitude from Australia to Europe have been used to determine orbits of the GPS satellites. The characteristics of the orbits determined from double difference phase have been evaluated through comparisons of two-week solutions with one-week solutions and by comparisons of predicted and estimated orbits. Evidence of unmodeled effects is demonstrated, particularly associated with the orbit planes that experience solar eclipse. The orbit accuracy has been assessed through the repeatability of unconstrained estimated baseline vectors ranging from 245 km to 5400 km. Both the baseline repeatability and the comparison with independent space geodetic methods give results at the level of 1-2 parts in 100,000,000. In addition, the Mojave/Owens Valley (245 km) and Kokee Park/Ft. Davis (5409 km) estimates agree with VLBI and SLR to better than 1 part in 100,000,000.

  13. The use of satellite laser observations in studying the crustal movements

    Directory of Open Access Journals (Sweden)

    Gamal F. Attia

    2012-12-01

    Full Text Available The mutual tectonic displacements of the lithospheric blocks take place within the deep fracture dividing them into hundreds and thousands kilometers long. It is possible to suggest that the reason of the accumulation of considerable local shift deformations is the change of the velocity of the tectonic motion in some or other parts of fractures as a result of different physical, chemical and mechanical processes. Nowadays, the range precision of Satellite Laser Ranging (SLR technique reaches a few millimeters level. Therefore, the space geodesy technique becomes a very important tool in detecting and monitoring recent crustal movements. Regular repeated measurements of the baselines between some stations on different plates give the possibility to construct precise and detail models of crustal movements. In this paper, the length of four baselines between Helwan-SLR station and other four SLR stations are calculated using satellite geodetical technique.

  14. Tidal Response to Sea-Level Rise in Different Types of Estuaries: The Importance of Length, Bathymetry, and Geometry

    Science.gov (United States)

    Du, Jiabi; Shen, Jian; Zhang, Yinglong J.; Ye, Fei; Liu, Zhuo; Wang, Zhengui; Wang, Ya Ping; Yu, Xin; Sisson, Mac; Wang, Harry V.

    2018-01-01

    Tidal response to sea-level rise (SLR) varies in different coastal systems. To provide a generic pattern of tidal response to SLR, a systematic investigation was conducted using numerical techniques applied to idealized and realistic estuaries, with model results cross-checked by analytical solutions. Our results reveal that the response of tidal range to SLR is nonlinear, spatially heterogeneous, and highly affected by the length and bathymetry of an estuary and weakly affected by the estuary convergence with an exception of strong convergence. Contrary to the common assumption that SLR leads to a weakened bottom friction, resulting in increased tidal amplitude, we demonstrate that tidal range is likely to decrease in short estuaries and in estuaries with a narrow channel and large low-lying shallow areas.

  15. Constraining proposed combinations of ice history and Earth rheology using VLBI determined baseline length rates in North America

    Science.gov (United States)

    Mitrovica, J. X.; Davis, J. L.; Shapiro, I. I.

    1993-01-01

    We predict the present-day rates of change of the lengths of 19 North American baselines due to the glacial isostatic adjustment process. Contrary to previously published research, we find that the three dimensional motion of each of the sites defining a baseline, rather than only the radial motions of these sites, needs to be considered to obtain an accurate estimate of the rate of change of the baseline length. Predictions are generated using a suite of Earth models and late Pleistocene ice histories, these include specific combinations of the two which have been proposed in the literature as satisfying a variety of rebound related geophysical observations from the North American region. A number of these published models are shown to predict rates which differ significantly from the VLBI observations.

  16. First Attempt of Orbit Determination of SLR Satellites and Space Debris Using Genetic Algorithms

    Science.gov (United States)

    Deleflie, F.; Coulot, D.; Descosta, R.; Fernier, A.; Richard, P.

    2013-08-01

    We present an orbit determination method based on genetic algorithms. Contrary to usual estimation methods mainly based on least-squares methods, these algorithms do not require any a priori knowledge of the initial state vector to be estimated. These algorithms can be applied when a new satellite is launched or for uncatalogued objects that appear in images obtained from robotic telescopes such as the TAROT ones. We show in this paper preliminary results obtained from an SLR satellite, for which tracking data acquired by the ILRS network enable to build accurate orbital arcs at a few centimeter level, which can be used as a reference orbit ; in this case, the basic observations are made up of time series of ranges, obtained from various tracking stations. We show as well the results obtained from the observations acquired by the two TAROT telescopes on the Telecom-2D satellite operated by CNES ; in that case, the observations are made up of time series of azimuths and elevations, seen from the two TAROT telescopes. The method is carried out in several steps: (i) an analytical propagation of the equations of motion, (ii) an estimation kernel based on genetic algorithms, which follows the usual steps of such approaches: initialization and evolution of a selected population, so as to determine the best parameters. Each parameter to be estimated, namely each initial keplerian element, has to be searched among an interval that is preliminary chosen. The algorithm is supposed to converge towards an optimum over a reasonable computational time.

  17. Scientific analysis of satellite ranging data

    Science.gov (United States)

    Smith, David E.

    1994-01-01

    A network of satellite laser ranging (SLR) tracking systems with continuously improving accuracies is challenging the modelling capabilities of analysts worldwide. Various data analysis techniques have yielded many advances in the development of orbit, instrument and Earth models. The direct measurement of the distance to the satellite provided by the laser ranges has given us a simple metric which links the results obtained by diverse approaches. Different groups have used SLR data, often in combination with observations from other space geodetic techniques, to improve models of the static geopotential, the solid Earth, ocean tides, and atmospheric drag models for low Earth satellites. Radiation pressure models and other non-conservative forces for satellite orbits above the atmosphere have been developed to exploit the full accuracy of the latest SLR instruments. SLR is the baseline tracking system for the altimeter missions TOPEX/Poseidon, and ERS-1 and will play an important role in providing the reference frame for locating the geocentric position of the ocean surface, in providing an unchanging range standard for altimeter calibration, and for improving the geoid models to separate gravitational from ocean circulation signals seen in the sea surface. However, even with the many improvements in the models used to support the orbital analysis of laser observations, there remain systematic effects which limit the full exploitation of SLR accuracy today.

  18. Seismology and space-based geodesy

    Science.gov (United States)

    Tralli, David M.; Tajima, Fumiko

    1993-01-01

    The potential of space-based geodetic measurement of crustal deformation in the context of seismology is explored. The achievements of seismological source theory and data analyses, mechanical modeling of fault zone behavior, and advances in space-based geodesy are reviewed, with emphasis on realizable contributions of space-based geodetic measurements specifically to seismology. The fundamental relationships between crustal deformation associated with an earthquake and the geodetically observable data are summarized. The response and spatial and temporal resolution of the geodetic data necessary to understand deformation at various phases of the earthquake cycle is stressed. The use of VLBI, SLR, and GPS measurements for studying global geodynamics properties that can be investigated to some extent with seismic data is discussed. The potential contributions of continuously operating strain monitoring networks and globally distributed geodetic observatories to existing worldwide modern digital seismographic networks are evaluated in reference to mutually addressable problems in seismology, geophysics, and tectonics.

  19. The effect of manual therapy and neuroplasticity education on chronic low back pain: a randomized clinical trial.

    Science.gov (United States)

    Louw, Adriaan; Farrell, Kevin; Landers, Merrill; Barclay, Martin; Goodman, Elise; Gillund, Jordan; McCaffrey, Sara; Timmerman, Laura

    2017-12-01

    To determine if a neuroplasticity educational explanation for a manual therapy technique will produce a different outcome compared to a traditional mechanical explanation. Sixty-two patients with chronic low back pain (CLBP) were recruited for the study. Following consent, demographic data were obtained as well as pain ratings for low back pain (LBP) and leg pain (Numeric Pain Rating Scale), disability (Oswestry Disability Index), fear-avoidance (Fear-Avoidance-Beliefs Questionnaire), forward flexion (fingertips-to-floor), and straight leg raise (SLR) (inclinometer). Patients were then randomly allocated to receive one of two explanations (neuroplasticity or mechanical), a manual therapy technique to their lumbar spine, followed by post-intervention measurements of LBP, leg pain, forward flexion, and SLR. Sixty-two patients (female 35 [56.5%]), with a mean age of 60.1 years and mean duration of 9.26 years of CLBP participated in the study. There were no statistically significant interactions for LBP ( p  = .325), leg pain ( p  = .172), and trunk flexion ( p  = .818) between the groups, but SLR showed a significant difference in favor of the neuroplasticity explanation ( p  = .041). Additionally, the neuroplasticity group were 7.2 times (95% confidence interval = 1.8-28.6) more likely to improve beyond the MDC on the SLR than participants in the mechanical group. The results of this study show that a neuroplasticity explanation, compared to a traditional biomechanical explanation, resulted in a measureable difference in SLR in patients with CLBP when receiving manual therapy. Future studies need to explore if the increase in SLR correlated to changes in cortical maps of the low back.

  20. MODEST: A Tool for Geodesy and Astronomy

    Science.gov (United States)

    Sovers, Ojars J.; Jacobs, Christopher S.; Lanyi, Gabor E.

    2004-01-01

    Features of the JPL VLBI modeling and estimation software "MODEST" are reviewed. Its main advantages include thoroughly documented model physics, portability, and detailed error modeling. Two unique models are included: modeling of source structure and modeling of both spatial and temporal correlations in tropospheric delay noise. History of the code parallels the development of the astrometric and geodetic VLBI technique and the software retains many of the models implemented during its advancement. The code has been traceably maintained since the early 1980s, and will continue to be updated with recent IERS standards. Scripts are being developed to facilitate user-friendly data processing in the era of e-VLBI.

  1. The Extragalactic Lens VLBI Imaging Survey (ELVIS): Investigating galaxy cores and black holes with gravitational lens central images

    Science.gov (United States)

    Boyce, Edward R.

    This thesis describes the Extragalactic Lens VLBI Imaging Survey (ELVIS), a search for central images in gravitational lenses. We present the first four ELVIS targets, for which we have radio VLBI observations with resolutions of a few milli-arcseconds and sensitivities of 15 - 38mJy. For PMN J1838-3427, CLASS B0739+366 and CLASS B0445+123 we have not detected any central images, but have set stringent upper limits on their flux densities. For CLASS B2319+051 we have made a tentative detection of a third radio source, which may be either a central image or radio emission from the lens galaxy. Using the upper limits on the central image flux densities, we gain new information about the matter distributions in the lens galaxies of these systems. We fit a broken power law model for the matter profile, and constrain the allowed break radii and inner index of this model. To demagnify the central images to the observed level the matter profiles must be slightly shallower than or steeper than isothermal, which is consistent with previous studies of early type galaxy profiles. The presence of a super-massive black hole weakens the constraints somewhat, but the profiles are still close to isothermal. Relative to previous work, we reduce the maximum sizes of shallow cores by factors of 2 to 3, and raise the indices of r 0( r -g central cusps by g = 0.05 - 0.35. If we take the source in B2319+051 to be a central image, then we select a narrow band of allowed break radii and inner indices, finding that a constant density core has size 150--380 pc, and a pure power law has index g = 1.5 - 1.67. Our constraints still allow sufficiently shallow profiles that some super-massive black holes may form central image pairs rather than eliminating the central image, and these image pairs may be detected with future instruments. (Copies available exclusively from MIT Libraries, Rm. 14-0551, Cambridge, MA 02139-4307. Ph. 617-253-5668; Fax 617-253-1690.)

  2. Poisson filtering of laser ranging data

    Science.gov (United States)

    Ricklefs, Randall L.; Shelus, Peter J.

    1993-01-01

    The filtering of data in a high noise, low signal strength environment is a situation encountered routinely in lunar laser ranging (LLR) and, to a lesser extent, in artificial satellite laser ranging (SLR). The use of Poisson statistics as one of the tools for filtering LLR data is described first in a historical context. The more recent application of this statistical technique to noisy SLR data is also described.

  3. Improvement of the software Bernese for SLR data processing in the Main Metrological Centre of the State Time and Frequency Service

    Science.gov (United States)

    Tsyba, E.; Kaufman, M.

    2015-08-01

    Preparatory works for resuming operational calculations of the Earth rotation parameters based on the results of satellite laser ranging data processing (LAGEOS 1, LAGEOS 2) are to be completed in the Main Metrology Centre Of The State Time And Frequency Service (VNIIFTRI) in 2014. For this purpose BERNESE 5.2 software (Dach & Walser, 2014) was chosen as a base software which has been used for many years in the Main Metrological Centre of the State Time and Frequency Service to process phase observations of GLONASS and GPS satellites. Although in the BERNESE 5.2 software announced presentation the possibility of the SLR data processing is declared, it has not been fully implemented. In particular there is no such an essential element as corrective action (as input or resulting parameters) in the local time scale ("time bias"), etc. Therefore, additional program blocks have been developed and integrated into the BERNESE 5.2 software environment. The program blocks are written in Perl and Matlab program languages and can be used both for Windows and Linux, 32-bit and 64-bit platforms.

  4. A Three-decade X-band VLBI Study of 3CR Lobe-dominated Quasar Nuclei

    Directory of Open Access Journals (Sweden)

    Hough David H.

    2013-12-01

    Full Text Available We report X-band VLBI observations of several 3CR lobe-dominated quasar nuclei from 1981 to 2010, mostly obtained with the NRAO VLBA. The goal is to follow flux density outbursts and to fully determine the jet morphology and kinematics on 1-100 pc scales. In 3C207, the core region has flux outbursts at mean intervals of ~7 yr; one of these is actually a double outburst from a stationary true core and a swinging component ~0.5 mas apart. The position angle (PA of the swinging component varies by ~40°, while the PA values of the jet components span ~25°. The jet extends to ~25 mas. Average superluminal speeds are ~10c. One component shows apparent acceleration from 7c to 14c at 2-3 mas from the true core, in a jet recollimation zone that redirects the flow toward PA ~90°. Individual jet components expand until reaching the recollimation zone. In 3C263 and other objects, some of the same phenomena are seen, including ejection of jet components over a range in PA, superluminal motion, and apparent acceleration, but to a lesser degree. Possible physical interpretations involving beaming, orientation, projection, precession, and magnetic effects are discussed.

  5. Identification of motion from multi-channel EMG signals for control of prosthetic hand

    International Nuclear Information System (INIS)

    Geethanjali, P.; Ray, K.K.

    2011-01-01

    Full text: The authors in this paper propose an effective and efficient pattern recognition technique from four channel electromyogram (EMG) signals for control of multifunction prosthetic hand. Time domain features such as mean absolute value, number of zero crossings, number of slope sign changes and waveform length are considered for pattern recognition. The patterns are classified using simple logistic regression (SLR) technique and decision tree (DT) using J48 algorithm. In this study six specific hand and wrist motions are identified from the EMG signals obtained from ten different able-bodied. By considering relevant dominant features for pattern recognition, the processing time as well as memory space of the SLR and DT classifiers is found to be less in comparison with neural network (NN), k-nearest neighbour model 1 (kNN Model-1), k-nearest neighbour model 2 (kNN-Model-2) and linear discriminant analysis. The classification accuracy of SLR classifier is found to be 91 ± 1.9%. (author)

  6. Coastal vulnerability assessment for Chennai, east coast of India using geospatial techniques

    Digital Repository Service at National Institute of Oceanography (India)

    ArunKumar, A.; Kunte, P.D.

    the high and low vulnerable areas, areas of inundation due to future SLR, and land loss due to coastal erosion. Both conventional and remotely sensed data were used and analyzed with the aid of the remote sensing and geographic information system tools...

  7. A systematic review of applying modern software engineering techniques to developing robotic systems

    Directory of Open Access Journals (Sweden)

    Claudia Pons

    2012-01-01

    Full Text Available Robots have become collaborators in our daily life. While robotic systems become more and more complex, the need to engineer their software development grows as well. The traditional approaches used in developing these software systems are reaching their limits; currently used methodologies and tools fall short of addressing the needs of such complex software development. Separating robotics’ knowledge from short-cycled implementation technologies is essential to foster reuse and maintenance. This paper presents a systematic review (SLR of the current use of modern software engineering techniques for developing robotic software systems and their actual automation level. The survey was aimed at summarizing existing evidence concerning applying such technologies to the field of robotic systems to identify any gaps in current research to suggest areas for further investigation and provide a background for positioning new research activities.

  8. Research Article. A new gravity laboratory in Ny-Ålesund, Svalbard

    Directory of Open Access Journals (Sweden)

    Breili K.

    2017-02-01

    Full Text Available The Norwegian Mapping Authority (NMA has recently established a new gravity laboratory in Ny-Ålesund at Svalbard, Norway. The laboratory consists of three independent pillars and is part of the geodetic core station that is presently under construction at Brandal, approximately 1.5 km north of NMA’s old station. In anticipation of future use of the new gravity laboratory, we present benchmark gravity values, gravity gradients, and final coordinates of all new pillars. Test measurements indicate a higher noise level at Brandal compared to the old station. The increased noise level is attributed to higher sensitivity to wind.We have also investigated possible consequences of moving to Brandal when it comes to the gravitational signal of present-day ice mass changes and ocean tide loading. Plausible models representing ice mass changes at the Svalbard archipelago indicate that the gravitational signal at Brandal may differ from that at the old site with a size detectable with modern gravimeters. Users of gravity data from Ny-Ålesund should, therefore, be cautious if future observations from the new observatory are used to extend the existing gravity record. Due to its lower elevation, Brandal is significantly less sensitive to gravitational ocean tide loading. In the future, Brandal will be the prime site for gravimetry in Ny-Ålesund. This ensures gravity measurements collocated with space geodetic techniques like VLBI, SLR, and GNSS.

  9. DORIS and GNSS processing at CNES/CLS for the contribution to the next ITRF2013

    Science.gov (United States)

    Loyer, Sylvain; Capdeville, Hugues; Soudarin, Laurent; Mezerette, Adrien; Lemoine, Jean-Michel; Mercier, Flavien; Perosanz, Felix

    2014-05-01

    CNES serves as Analysis Center in the International DORIS Service (IDS) and the International GNSS Service (IGS). DORIS and GNSS data are processed by its subsidiary CLS with the GRGS package software GINS/DYNAMO. For the contribution to the next release of the International Terrestrial Reference Frame planned this year (ITRF2013), two decades of data were analyzed (1993-2013 for DORIS, 1998-2013 for GPS, and 2009-2013 for GLONASS). In this context, the CNES/CLS Analysis Centers provided SINEX solutions to the IDS and IGS Combination Centers, respectively multi-satellite weekly solutions and daily solutions. Normal equations derived from this analysis are also made available to the GRGS Combination Center for the combination at the observation level of the geodetic parameters measured by DORIS, GPS, SLR and VLBI techniques. The purpose of this presentation is to point out how the overall quality of the DORIS and GNSS data processing benefits from the use of the same software and a common basis of models. Here, we present the modeling standards, the networks and the processing strategies. Assessments of some models are also discussed. The quality and the homogeneity of the products (orbits, station coordinates and Earth Orientation Parameters) over the complete period are shown, as well as the temporal variations of some parameters (dynamical parameters, orbit residuals, internal orbit overlaps ...). Some examples of time series of DORIS and GNSS station positions at collocated sites complete this presentation.

  10. Radio Imaging of Envelopes of Evolved Stars

    Science.gov (United States)

    Cotton, Bill

    2018-04-01

    This talk will cover imaging of stellar envelopes using radio VLBI techniques; special attention will be paid to the technical differences between radio and optical/IR interferomery. Radio heterodyne receivers allow a straightforward way to derive spectral cubes and full polarization observations. Milliarcsecond resolution of very bright, i.e. non thermal, emission of molecular masers in the envelopes of evolved stars can be achieved using VLBI techniques with baselines of thousands of km. Emission from SiO, H2O and OH masers are commonly seen at increasing distance from the photosphere. The very narrow maser lines allow accurate measurements of the velocity field within the emitting region.

  11. A framework for sign language recognition using support vector machines and active learning for skin segmentation and boosted temporal sub-units

    OpenAIRE

    Awad, George M.

    2007-01-01

    This dissertation describes new techniques that can be used in a sign language recognition (SLR) system, and more generally in human gesture systems. Any SLR system consists of three main components: Skin detector, Tracker, and Recognizer. The skin detector is responsible for segmenting skin objects like the face and hands from video frames. The tracker keeps track of the hand location (more specifically the bounding box) and detects any occlusions that might happen between any skin objects. ...

  12. STELLAR LOCUS REGRESSION: ACCURATE COLOR CALIBRATION AND THE REAL-TIME DETERMINATION OF GALAXY CLUSTER PHOTOMETRIC REDSHIFTS

    International Nuclear Information System (INIS)

    High, F. William; Stubbs, Christopher W.; Rest, Armin; Stalder, Brian; Challis, Peter

    2009-01-01

    We present stellar locus regression (SLR), a method of directly adjusting the instrumental broadband optical colors of stars to bring them into accord with a universal stellar color-color locus, producing accurately calibrated colors for both stars and galaxies. This is achieved without first establishing individual zero points for each passband, and can be performed in real-time at the telescope. We demonstrate how SLR naturally makes one wholesale correction for differences in instrumental response, for atmospheric transparency, for atmospheric extinction, and for Galactic extinction. We perform an example SLR treatment of Sloan Digital Sky Survey data over a wide range of Galactic dust values and independently recover the direction and magnitude of the canonical Galactic reddening vector with 14-18 mmag rms uncertainties. We then isolate the effect of atmospheric extinction, showing that SLR accounts for this and returns precise colors over a wide range of air mass, with 5-14 mmag rms residuals. We demonstrate that SLR-corrected colors are sufficiently accurate to allow photometric redshift estimates for galaxy clusters (using red sequence galaxies) with an uncertainty σ(z)/(1 + z) = 0.6% per cluster for redshifts 0.09 < z < 0.25. Finally, we identify our objects in the 2MASS all-sky catalog, and produce i-band zero points typically accurate to 18 mmag using only SLR. We offer open-source access to our IDL routines, validated and verified for the implementation of this technique, at http://stellar-locus-regression.googlecode.com.

  13. Characterization of the molecular mechanism underlying gibberellin perception complex formation in rice.

    Science.gov (United States)

    Hirano, Ko; Asano, Kenji; Tsuji, Hiroyuki; Kawamura, Mayuko; Mori, Hitoshi; Kitano, Hidemi; Ueguchi-Tanaka, Miyako; Matsuoka, Makoto

    2010-08-01

    The DELLA protein SLENDER RICE1 (SLR1) is a repressor of gibberellin (GA) signaling in rice (Oryza sativa), and most of the GA-associated responses are induced upon SLR1 degradation. It is assumed that interaction between GIBBERELLIN INSENSITIVE DWARF1 (GID1) and the N-terminal DELLA/TVHYNP motif of SLR1 triggers F-box protein GID2-mediated SLR1 degradation. We identified a semidominant dwarf mutant, Slr1-d4, which contains a mutation in the region encoding the C-terminal GRAS domain of SLR1 (SLR1(G576V)). The GA-dependent degradation of SLR1(G576V) was reduced in Slr1-d4, and compared with SLR1, SLR1(G576V) showed reduced interaction with GID1 and almost none with GID2 when tested in yeast cells. Surface plasmon resonance of GID1-SLR1 and GID1-SLR1(G576V) interactions revealed that the GRAS domain of SLR1 functions to stabilize the GID1-SLR1 interaction by reducing its dissociation rate and that the G576V substitution in SLR1 diminishes this stability. These results suggest that the stable interaction of GID1-SLR1 through the GRAS domain is essential for the recognition of SLR1 by GID2. We propose that when the DELLA/TVHYNP motif of SLR1 binds with GID1, it enables the GRAS domain of SLR1 to interact with GID1 and that the stable GID1-SLR1 complex is efficiently recognized by GID2.

  14. Characterization of the Molecular Mechanism Underlying Gibberellin Perception Complex Formation in Rice[C][W

    Science.gov (United States)

    Hirano, Ko; Asano, Kenji; Tsuji, Hiroyuki; Kawamura, Mayuko; Mori, Hitoshi; Kitano, Hidemi; Ueguchi-Tanaka, Miyako; Matsuoka, Makoto

    2010-01-01

    The DELLA protein SLENDER RICE1 (SLR1) is a repressor of gibberellin (GA) signaling in rice (Oryza sativa), and most of the GA-associated responses are induced upon SLR1 degradation. It is assumed that interaction between GIBBERELLIN INSENSITIVE DWARF1 (GID1) and the N-terminal DELLA/TVHYNP motif of SLR1 triggers F-box protein GID2-mediated SLR1 degradation. We identified a semidominant dwarf mutant, Slr1-d4, which contains a mutation in the region encoding the C-terminal GRAS domain of SLR1 (SLR1G576V). The GA-dependent degradation of SLR1G576V was reduced in Slr1-d4, and compared with SLR1, SLR1G576V showed reduced interaction with GID1 and almost none with GID2 when tested in yeast cells. Surface plasmon resonance of GID1-SLR1 and GID1-SLR1G576V interactions revealed that the GRAS domain of SLR1 functions to stabilize the GID1-SLR1 interaction by reducing its dissociation rate and that the G576V substitution in SLR1 diminishes this stability. These results suggest that the stable interaction of GID1-SLR1 through the GRAS domain is essential for the recognition of SLR1 by GID2. We propose that when the DELLA/TVHYNP motif of SLR1 binds with GID1, it enables the GRAS domain of SLR1 to interact with GID1 and that the stable GID1-SLR1 complex is efficiently recognized by GID2. PMID:20716699

  15. The use of cartographic modeling to assess the impacts of coastal flooding: a case study of Port Said Governorate, Egypt.

    Science.gov (United States)

    Abou Samra, Rasha M

    2017-09-01

    Low-set coastal areas are expected to aggravate inundation on account of sea level rise (SLR). The present study is planned to appraise the impacts of coastal flooding in Port Said city, Egypt by using remote sensing, GIS, and cartographic modeling techniques. To accomplish this scope, Landsat 8-OLI image dated 2016 and SRTM 1Arc-Second Digital Elevation Model (DEM) data were used. Landsat image was classified into seven land use and land cover (LULC) classes by using remote sensing and GIS's software. Different inundation scenarios 1.0, 2.0, and 3.0-m coastal elevation were used to figure the influence of SLR on the study area. Estimation of potential losses under SLR was made by overlaying the expected scenarios on land use. The inundation areas under the expected SLR scenarios of 1.0, 2.0, and 3.0 m were estimated at 827.49, 1072.67, and 1179.41 km 2 , respectively. In conclusion, this study demonstrated that expected coastal flooding scenarios will lead up to serious impacts on LULC classes and coastal features in the study area.

  16. SHARP - V. Modelling gravitationally-lensed radio arcs imaged with global VLBI observations

    Science.gov (United States)

    Spingola, C.; McKean, J. P.; Auger, M. W.; Fassnacht, C. D.; Koopmans, L. V. E.; Lagattuta, D. J.; Vegetti, S.

    2018-05-01

    We present milliarcsecond (mas) angular resolution observations of the gravitationally lensed radio source MG J0751+2716 (at z = 3.2) obtained with global Very Long Baseline Interferometry (VLBI) at 1.65 GHz. The background object is highly resolved in the tangential and radial directions, showing evidence of both compact and extended structure across several gravitational arcs that are 200 to 600 mas in size. By identifying compact sub-components in the multiple images, we constrain the mass distribution of the foreground z = 0.35 gravitational lens using analytic models for the main deflector [power-law elliptical mass model; ρ(r)∝r-γ, where γ = 2 corresponds to isothermal] and for the members of the galaxy group. Moreover, our mass models with and without the group find an inner mass-density slope steeper than isothermal for the main lensing galaxy, with γ1 = 2.08 ± 0.02 and γ2 = 2.16 ± 0.02 at the 4.2σ level and 6.8σ level, respectively, at the Einstein radius (b1 = 0.4025 ± 0.0008 and b2 = 0.307 ± 0.002 arcsec, respectively). We find randomly distributed image position residuals of about 3 mas, which are much larger that the measurement errors (40 μas on average). This suggests that at the mas level, the assumption of a smooth mass distribution fails, requiring additional structure in the model. However, given the environment of the lensing galaxy, it is not clear whether this extra mass is in the form of sub-haloes within the lens or along the line of sight, or from a more complex halo for the galaxy group.

  17. Reversal of an Epigenetic Switch Governing Cell Chaining in Bacillus subtilis by Protein Instability

    Science.gov (United States)

    Chai, Yunrong; Kolter, Roberto; Losick, Richard

    2010-01-01

    Bacillus subtilis forms long chains of cells during growth and biofilm formation. Cell separation is mediated by autolysins, whose genes are under the negative control of a heteromeric complex composed of the proteins SinR and SlrR. Formation of the SinR•SlrR complex is governed by a self-reinforcing, double-negative feedback loop in which SinR represses the gene for SlrR and SlrR, by forming the SinR•SlrR complex, titrates SinR and prevents it from repressing slrR. The loop is a bistable switch and exists in a SlrRLOW state in which autolysin genes are on, and a SlrRHIGH state in which autolysin genes are repressed by SinR•SlrR. Cells in the SlrRLOW state are driven into the SlrRHIGH state by SinI, an antirepressor that binds to and inhibits SinR. However, the mechanism by which cells in the SlrRHIGH state revert back to the SlrRLOW state is unknown. We report that SlrR is proteolytically unstable and present evidence that self-cleavage via a LexA-like autopeptidase and ClpC contribute to its degradation. Cells producing a self-cleavage-resistant mutant of SlrR exhibited more persistent chaining during growth and yielded biofilms with enhanced structural complexity. We propose that degradation of SlrR allows cells to switch from the SlrRHIGH to the SlrRLOW state. PMID:20923420

  18. Effect of lunar gravity models on Chang'E-2 orbit determination using VLBI tracking data

    Directory of Open Access Journals (Sweden)

    Erhu Wei

    2016-11-01

    Full Text Available The precise orbit determination of Chang'E-2 is the most important issue for successful mission and scientific applications, while the lunar gravity field model with big uncertainties has large effect on Chang'E-2 orbit determination. Recently, several new gravity models have been produced using the latest lunar satellites tracking data, such as LP165P, SGM150J, GL0900D and GRGM900C. In this paper, the four gravity models mentioned above were evaluated through the power spectra analysis, admittance and coherence analysis. Effect of four lunar gravity models on Chang'E-2 orbit determination performance is investigated and assessed using Very Long Baseline Interferometry (VLBI tracking data. The overlap orbit analysis, the posteriori data residual, and the orbit prediction are used to evaluate the orbit precision between successive arcs. The LP165P model has better orbit overlap performance than the SGM150J model for Chang'E-2100 km × 100 km orbit and the SGM150J model performs better for Chang'E-2100 km × 15 km orbit, while GL0900D and GRGM900C have the best orbit overlap results for the two types of Chang'E-2 orbit. For the orbit prediction, GRGM900C has the best orbit prediction performance in the four models.

  19. Very Long Baseline Interferometry: Dependencies on Frequency Stability

    Science.gov (United States)

    Nothnagel, Axel; Nilsson, Tobias; Schuh, Harald

    2018-04-01

    Very Long Baseline Interferometry (VLBI) is a differential technique observing radiation of compact extra-galactic radio sources with pairs of radio telescopes. For these observations, the frequency standards at the telescopes need to have very high stability. In this article we discuss why this is, and we investigate exactly how precise the frequency standards need to be. Four areas where good clock performance is needed are considered: coherence, geodetic parameter estimation, correlator synchronization, and UT1 determination. We show that in order to ensure the highest accuracy of VLBI, stability similar to that of a hydrogen maser is needed for time-scales up to a few hours. In the article, we are considering both traditional VLBI where extra-galactic radio sources are observed, as well as observation of man-made artificial radio sources emitted by satellites or spacecrafts.

  20. Whole-body magnetic resonance imaging in inflammatory arthritis

    DEFF Research Database (Denmark)

    Østergaard, Mikkel; Eshed, Iris; Althoff, Christian E.

    2017-01-01

    Objective: Whole-body magnetic resonance imaging (WB-MRI) is a relatively new technique that can enable assessment of the overall inflammatory status of people with arthritis, but standards for image acquisition, definitions of key pathologies, and a quantification system are required. Our aim...... was to perform a systematic literature review (SLR) and to develop consensus definitions of key pathologies, anatomical locations for assessment, a set of MRI sequences and imaging planes for the different body regions, and a preliminary scoring system for WB-MRI in inflammatory arthritis. Methods: An SLR...

  1. Monitoring Global Geophysical Fluids by Space Geodesy

    Science.gov (United States)

    Chao, Benjamin F.; Dehant, V.; Gross, R. S.; Ray, R. D.; Salstein, D. A.; Watkins, M.

    1999-01-01

    Since its establishment on 1/1/1998 by the International Earth Rotation Service, the Coordinating Center for Monitoring Global Geophysical Fluids (MGGF) and its seven Special Bureaus have engaged in an effort to support and facilitate the understanding of the geophysical fluids in global geodynamics research. Mass transports in the atmosphere-hydrosphere-solid Earth-core system (the "global geophysical fluids") will cause the following geodynamic effects on a broad time scale: (1) variations in the solid Earth's rotation (in length-of-day and polar motion/nutation) via the conservation of angular momentum and effected by torques at the fluid-solid Earth interface; (2) changes in the global gravitational field according to Newton's gravitational law; and (3) motion in the center of mass of the solid Earth relative to that of the whole Earth ("geocenter") via the conservation of linear momentum. These minute signals have become observable by space geodetic techniques, primarily VLBI, SLR, GPS, and DORIS, with ever increasing precision/accuracy and temporal/spatial resolution. Each of the seven Special Bureaus within MGGF is responsible for calculations related to a specific Earth component or aspect -- Atmosphere, Ocean, Hydrology, Ocean Tides, Mantle, Core, and Gravity/Geocenter. Angular momenta and torques, gravitational coefficients, and geocenter shift will be computed for geophysical fluids based on global observational data, and from state-of-the-art models, some of which assimilate such data. The computed quantities, algorithm and data formats are standardized. The results are archived and made available to the scientific research community. This paper reports the status of the MGGF activities and current results.

  2. Spatio-Temporal Dynamics of a Coastal Island Using Geospatial Techniques: A Case in Hatiya Island, Bangladesh

    Science.gov (United States)

    Ramjan, S.; Mahmud, M. S.; Hossain, M. A.; Hasan, M.; Ashrafi, Z. M.

    2016-12-01

    Bangladesh is recognized for its high vulnerability to sea level rise (SLR). SLR directly and indirectly (by altering morphology of river estuary) accelerates erosion processes, washes out the loose materials of the coast and coastal islands. Hatiya, highly populated coastal island, located in Meghna river estuary is under severe threat of coastal erosion, which has not been quantified yet. The accurate mapping of the shoreline and coastal changes are very important for adopting conservation measures e.g. protection of human life, property and the natural environment. The objectives of the present study are to use remote sensing and Geographical Information System techniques to evaluate spatial and temporal changes in the shoreline and coastal land area of the Hatiya Island between the year of 1985 and 2016 from multi-temporal satellite images, i.e. assessing shifting of the shoreline position through digital shoreline analysis besides the erosion-accretion measurements. Study reveals that about 67 square kilometer areas has been lost between 1985 and 2016 which was about 17 percent of original area (1985). Erosion mainly took place in northern, north-western banks of the island. In these areas, the landward movement and rate of the shoreline were higher with a highest value of the net shoreline movement (NSM) around 6.2 km. Erosion rate is significant in exposed part of the island where tidal water pressure, shoreline configuration, loose bank materials and steep slope were observed. However, the accretion was noticed in recent years (2010-2016) in southern part of the island where slopes were gentle, perhaps due to backwash sediment deposition. As erosion process is prominent in this island, significant amounnt of usable land was lost. Therefore, local livelihood pattern has changed that has noticable effect on local economy. By quantifying the erosion-accretion rate, livelihood planning can be initiated in climatically threated vulnerable islands.

  3. The Crustal Dynamics Data Information System: A Resource to Support Scientific Analysis Using Space Geodesy

    Science.gov (United States)

    Noll. Carey E.

    2010-01-01

    Since 1982. the Crustal Dynamics Data Information System (CDDIS) has supported the archive and distribution of geodetic data products acquired by the National Aeronautics and Space Administration (NASA) as well as national and international programs. The CDDIS provides easy, timely, and reliable access to a variety of data sets, products, and information about these data. These measurements. obtained from a global network of nearly 650 instruments at more than 400 distinct sites, include DORIS (Doppler Orbitography and Radiopositioning Integrated by Satellite), GNSS (Global Navigation Satellite System), SLR and LLR (Satellite and Lunar Laser Ranging), and VLBI (Very Long Baseline Interferometry). The CDDIS data system and its archive have become increasingly important to many national and international science communities, particularly several of the operational services within the International Association of Geodesy (IAG) and its observing system the Global Geodetic Observing System (GGOS), including the International DORIS Service (IDS), the International GNSS Service (IGS). the International Laser Ranging Service (ILRS), the International VLBI Service for Geodesy and Astrometry (IVS). and the International Earth rotation and Reference frame Service (IERS), Investigations resulting from the data and products available through the CDDIS support research in many aspects of Earth system science and global change. Each month, the CDDIS archives more than one million data and derived product files totaling over 90 Gbytes in volume. In turn. the global user community downloads nearly 1.2 TBytes (over 10.5 million files) of data and products from the CDDIS each month. The requirements of analysts have evolved since the start of the CDDIS; the specialized nature of the system accommodates the enhancements required to support diverse data sets and user needs. This paper discusses the CDDIS. including background information about the system and its. user communities

  4. BAYESIAN TECHNIQUES FOR COMPARING TIME-DEPENDENT GRMHD SIMULATIONS TO VARIABLE EVENT HORIZON TELESCOPE OBSERVATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Junhan; Marrone, Daniel P.; Chan, Chi-Kwan; Medeiros, Lia; Özel, Feryal; Psaltis, Dimitrios, E-mail: junhankim@email.arizona.edu [Department of Astronomy and Steward Observatory, University of Arizona, 933 N. Cherry Avenue, Tucson, AZ 85721 (United States)

    2016-12-01

    The Event Horizon Telescope (EHT) is a millimeter-wavelength, very-long-baseline interferometry (VLBI) experiment that is capable of observing black holes with horizon-scale resolution. Early observations have revealed variable horizon-scale emission in the Galactic Center black hole, Sagittarius A* (Sgr A*). Comparing such observations to time-dependent general relativistic magnetohydrodynamic (GRMHD) simulations requires statistical tools that explicitly consider the variability in both the data and the models. We develop here a Bayesian method to compare time-resolved simulation images to variable VLBI data, in order to infer model parameters and perform model comparisons. We use mock EHT data based on GRMHD simulations to explore the robustness of this Bayesian method and contrast it to approaches that do not consider the effects of variability. We find that time-independent models lead to offset values of the inferred parameters with artificially reduced uncertainties. Moreover, neglecting the variability in the data and the models often leads to erroneous model selections. We finally apply our method to the early EHT data on Sgr A*.

  5. THE OPTICS OF REFRACTIVE SUBSTRUCTURE

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Michael D.; Narayan, Ramesh, E-mail: mjohnson@cfa.harvard.edu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2016-08-01

    Newly recognized effects of refractive scattering in the ionized interstellar medium have broad implications for very long baseline interferometry (VLBI) at extreme angular resolutions. Building upon work by Blandford and Narayan, we present a simplified, geometrical optics framework, which enables rapid, semi-analytic estimates of refractive scattering effects. We show that these estimates exactly reproduce previous results based on a more rigorous statistical formulation. We then derive new expressions for the scattering-induced fluctuations of VLBI observables such as closure phase, and we demonstrate how to calculate the fluctuations for arbitrary quantities of interest using a Monte Carlo technique.

  6. On the Long-Term "Hesitation Waltz" Between the Earth's Figure and Rotation Axes

    Science.gov (United States)

    Couhert, A.; Mercier, F.; Bizouard, C.

    2017-12-01

    The principal figure axis of the Earth refers to its axis of maximum inertia. In the absence of external torques, the latter should closely coincide with the rotation pole, when averaged over many years. However, because of tidal and non-tidal mass redistributions within the Earth system, the rotational axis executes a circular motion around the figure axis essentially at seasonal time scales. In between, it is not clear what happens at decadal time spans and how well the two axes are aligned. The long record of accurate Satellite Laser Ranging (SLR) observations to Lageos makes possible to directly measure the long time displacement of the figure axis with respect to the crust, through the determination of the degree 2 order 1 geopotential coefficients for the 34-year period 1983-2017. On the other hand, the pole coordinate time series (mainly from GNSS and VLBI data) yield the motion of the rotation pole with even a greater accuracy. This study is focused on the analysis of the long-term behavior of the two time series, as well as the derivation of possible explanations for their discrepancies.

  7. Thresholds of sea-level rise rate and sea-level rise acceleration rate in a vulnerable coastal wetland.

    Science.gov (United States)

    Wu, Wei; Biber, Patrick; Bethel, Matthew

    2017-12-01

    Feedbacks among inundation, sediment trapping, and vegetation productivity help maintain coastal wetlands facing sea-level rise (SLR). However, when the SLR rate exceeds a threshold, coastal wetlands can collapse. Understanding the threshold helps address key challenges in ecology-nonlinear response of ecosystems to environmental change, promotes communication between ecologists and resource managers, and facilitates decision-making in climate change policies. We studied the threshold of SLR rate and developed a new threshold of SLR acceleration rate on sustainability of coastal wetlands as SLR is likely to accelerate due to enhanced anthropogenic forces. Deriving these two thresholds depends on the temporal scale, the interaction of SLR with other environmental factors, and landscape metrics, which have not been fully accounted for before this study. We chose a representative marine-dominated estuary in the northern Gulf of Mexico, Grand Bay in Mississippi, to test the concept of SLR thresholds. We developed a mechanistic model to simulate wetland change and then derived the SLR thresholds for Grand Bay. The model results show that the threshold of SLR rate in Grand Bay is 11.9 mm/year for 2050, and it drops to 8.4 mm/year for 2100 using total wetland area as a landscape metric. The corresponding SLR acceleration rate thresholds are 3.02 × 10 -4  m/year 2 and 9.62 × 10 -5  m/year 2 for 2050 and 2100, respectively. The newly developed SLR acceleration rate threshold can help quantify the temporal lag before the rapid decline in wetland area becomes evident after the SLR rate threshold is exceeded, and cumulative SLR a wetland can adapt to under the SLR acceleration scenarios. Based on the thresholds, SLR that will adversely impact the coastal wetlands in Grand Bay by 2100 will fall within the likely range of SLR under a high warming scenario (RCP8.5), highlighting the need to avoid RCP8.5 to preserve these marshes.

  8. Capabilities and prospects of the East Asia Very Long Baseline Interferometry Network

    Science.gov (United States)

    An, T.; Sohn, B. W.; Imai, H.

    2018-02-01

    The very long baseline interferometry (VLBI) technique offers angular resolutions superior to any other instruments at other wavelengths, enabling unique science applications of high-resolution imaging of radio sources and high-precision astrometry. The East Asia VLBI Network (EAVN) is a collaborative effort in the East Asian region. The EAVN currently consists of 21 telescopes with diverse equipment configurations and frequency setups, allowing flexible subarrays for specific science projects. The EAVN provides the highest resolution of 0.5 mas at 22 GHz, allowing the fine imaging of jets in active galactic nuclei, high-accuracy astrometry of masers and pulsars, and precise spacecraft positioning. The soon-to-be-operational Five-hundred-meter Aperture Spherical radio Telescope (FAST) will open a new era for the EAVN. This state-of-the-art VLBI array also provides easy access to and crucial training for the burgeoning Asian astronomical community. This Perspective summarizes the status, capabilities and prospects of the EAVN.

  9. Understanding Coastal Wetland Vulnerability to Sea-Level Rise Enhanced Inundation Using Real-Time Stage Monitoring, LiDAR, and Monte Carlo Simulation in Everglades National Park

    Science.gov (United States)

    Cooper, H.; Zhang, C.

    2017-12-01

    Coastal wetlands are one of the most productive ecological systems in the world, providing critical habitat area and valuable ecosystem services such as carbon sequestration. However, due to their location in low lying areas, coastal wetlands are particularly vulnerable to sea-level rise (SLR). Everglades National Park (ENP) encompasses the southern-most portion of the Greater Everglades Ecosystem, and is the largest subtropical wetland in the USA. Water depths have shown to have a significant relationship to vegetation community composition and organization while also playing a crucial role in vegetation health throughout the Everglades. Live plants play a vital role in maintaining soil structure (i.e. elevation), and decreases in vegetation health can cause peat collapse or wetland loss resulting in dramatic habitat, organic soil, and elevation loss posing concerns for Everglades management and restoration. One suspected mechanism for peat collapse is enhanced inundation due to SLR, thus mapping and modeling water depths is a critical component to understanding the potential impacts of future SLR. Previous research in the Everglades focused on a conventional Water Depth Model (WDM) approach where a Digital Elevation Model (DEM) is subtracted from a Water Table Elevation Model (WTEM). In this study, the conventional WDM approach is extended to a more rigorous WDM technique so that the accuracy and precision of the underlying data may be considered. Monte Carlo simulation is used to propagate probability distributions through our SLR depth model using our Random Forest-based LiDAR DEM, Empirical Bayesian Kriging-based WTEMs, uncertainties in vertical datums, soil accretion projections, and regional sea-level rise projections. Water depth maps were produced for the wet and dry seasons in April and October, which successfully revealed the potential spatial and temporal water depth variations due to future SLR. It is concluded that a more rigorous WDM technique helps

  10. Application of space geodetic techniques for the determination of intraplate deformations and movements in relation with the postglacial rebound of Fennoscandia

    Energy Technology Data Exchange (ETDEWEB)

    Scherneck, H G; Johansson, J M; Elgered, G [Chalmers Univ. of Technology, Goeteborg (Sweden). Onsala Space Observatory

    1996-04-01

    This report introduces into space geodetic measurements of relative positions over distances ranging from tens to thousands of kilometers. Such measurements can routinely be carried out with repeatabilities on the order of a few millimeters. The techniques presented are Very Long Baseline Interferometry (VLBI), employing observations of radio-astronomical objects in the distant universe, and ranging measurements to satellites of the GPS, the Global Positioning System. These techniques have helped to trace plate tectonic motions. More recently, deformations within continents have been detected. We present the SWEPOS system of permanently operating GPS stations as one of the major geoscience investments starting in 1993. BIFROST (Baseline Interference for Fennoscandian Rebound Observations, Sea level, and Tectonics) is a project within SWEPOS with main purpose to detect crustal movements in Fennoscandia. First results are presented, indicating movements which generally support the notion of a dominating displacement pattern due to the postglacial rebound of Fennoscandia. However deviations exist. densification is indicated in those areas which are notable for an increased seismicity. 148 refs.

  11. Application of space geodetic techniques for the determination of intraplate deformations and movements in relation with the postglacial rebound of Fennoscandia

    International Nuclear Information System (INIS)

    Scherneck, H.G.; Johansson, J.M.; Elgered, G.

    1996-04-01

    This report introduces into space geodetic measurements of relative positions over distances ranging from tens to thousands of kilometers. Such measurements can routinely be carried out with repeatabilities on the order of a few millimeters. The techniques presented are Very Long Baseline Interferometry (VLBI), employing observations of radio-astronomical objects in the distant universe, and ranging measurements to satellites of the GPS, the Global Positioning System. These techniques have helped to trace plate tectonic motions. More recently, deformations within continents have been detected. We present the SWEPOS system of permanently operating GPS stations as one of the major geoscience investments starting in 1993. BIFROST (Baseline Interference for Fennoscandian Rebound Observations, Sea level, and Tectonics) is a project within SWEPOS with main purpose to detect crustal movements in Fennoscandia. First results are presented, indicating movements which generally support the notion of a dominating displacement pattern due to the postglacial rebound of Fennoscandia. However deviations exist. densification is indicated in those areas which are notable for an increased seismicity. 148 refs

  12. Thresholds of sea-level rise rate and sea-level acceleration rate in a vulnerable coastal wetland

    Science.gov (United States)

    Wu, W.; Biber, P.; Bethel, M.

    2017-12-01

    Feedback among inundation, sediment trapping, and vegetation productivity help maintain coastal wetlands facing sea-level rise (SLR). However, when the SLR rate exceeds a threshold, coastal wetlands can collapse. Understanding the threshold help address the key challenge in ecology - nonlinear response of ecosystems to environmental change, and promote communication between ecologists and policy makers. We studied the threshold of SLR rate and developed a new threshold of SLR acceleration rate on sustainability of coastal wetlands as SLR is likely to accelerate due to the enhanced anthropogenic forces. We developed a mechanistic model to simulate wetland change and derived the SLR thresholds for Grand Bay, MS, a micro-tidal estuary with limited upland freshwater and sediment input in the northern Gulf of Mexico. The new SLR acceleration rate threshold complements the threshold of SLR rate and can help explain the temporal lag before the rapid decline of wetland area becomes evident after the SLR rate threshold is exceeded. Deriving these two thresholds depends on the temporal scale, the interaction of SLR with other environmental factors, and landscape metrics, which have not been fully accounted for before this study. The derived SLR rate thresholds range from 7.3 mm/yr to 11.9 mm/yr. The thresholds of SLR acceleration rate are 3.02×10-4 m/yr2 and 9.62×10-5 m/yr2 for 2050 and 2100 respectively. Based on the thresholds developed, predicted SLR that will adversely impact the coastal wetlands in Grand Bay by 2100 will fall within the likely range of SLR under a high warming scenario (RCP8.5), and beyond the very likely range under a low warming scenario (RCP2.6 or 3), highlighting the need to avoid the high warming scenario in the future if these marshes are to be preserved.

  13. Optimizing estimates of annual variations and trends in geocenter motion and J2 from a combination of GRACE data and geophysical models

    Science.gov (United States)

    Sun, Yu; Riva, Riccardo; Ditmar, Pavel

    2016-11-01

    The focus of the study is optimizing the technique for estimating geocenter motion and variations in J2 by combining data from the Gravity Recovery and Climate Experiment (GRACE) satellite mission with output from an Ocean Bottom Pressure model and a Glacial Isostatic Adjustment (GIA) model. First, we conduct an end-to-end numerical simulation study. We generate input time-variable gravity field observations by perturbing a synthetic Earth model with realistically simulated errors. We show that it is important to avoid large errors at short wavelengths and signal leakage from land to ocean, as well as to account for self-attraction and loading effects. Second, the optimal implementation strategy is applied to real GRACE data. We show that the estimates of annual amplitude in geocenter motion are in line with estimates from other techniques, such as satellite laser ranging (SLR) and global GPS inversion. At the same time, annual amplitudes of C10 and C11 are increased by about 50% and 20%, respectively, compared to estimates based on Swenson et al. (2008). Estimates of J2 variations are by about 15% larger than SLR results in terms of annual amplitude. Linear trend estimates are dependent on the adopted GIA model but still comparable to some SLR results.

  14. Spin motion determination of the Envisat satellite through laser ranging measurements from a single pass measured by a single station

    Science.gov (United States)

    Pittet, Jean-Noël; Šilha, Jiří; Schildknecht, Thomas

    2018-02-01

    The Satellite Laser Ranging (SLR) technology is used to accurately determine the position of space objects equipped with so-called retro-reflectors or retro-reflector arrays (RRA). This type of measurement allows to measure the range to the spacecraft with high precision, which leads to determination of very accurate orbits for these targets. Non-active spacecraft, which are not attitude controlled any longer, tend to start to spin or tumble under influence of the external and internal torques and forces. If the return signal is measured for a non-spherical non-active rotating object, the signal in the range residuals with respect to the reference orbit is more complex. For rotating objects the return signal shows an oscillating pattern or patterns caused by the RRA moving around the satellite's centre of mass. This behaviour is projected onto the radial component measured by the SLR. In our work, we demonstrate how the SLR ranging technique from one sensor to a satellite equipped with a RRA can be used to precisely determine its spin motion during one passage. Multiple SLR measurements of one target over time allow to accurately monitor spin motion changes which can be further used for attitude predictions. We show our solutions of the spin motion determined for the non-active ESA satellite Envisat obtained from measurements acquired during years 2013-2015 by the Zimmerwald SLR station, Switzerland. All the necessary parameters are defined for our own so-called point-like model which describes the motion of a point in space around the satellite centre of mass.

  15. Results from the Geodetic Observatory TIGO due to the Mw 8.8 Earthquake

    Science.gov (United States)

    Hase, H.; Böer, A.; Sierk, B.; Ihde, J.; Weber, G.; Wilmes, H.; Falk, R.; Hessels, U.; Neumaier, P.; Söhne, W.; Wziontek, H.; Engelhard, G.; Sobarzo, S.; Cifuentes, O.; Guaitiao, C.; Cona, I.; Avendaño, M.; Herrera, C.; Mora, V.; Fernandez, A.; Oñate, E.; Zaror, P.; Pedreros, F.; Zapata, O.

    2010-12-01

    The Geodetic Observatory TIGO is unique in Latin America. With its sensors and instruments it defines a reference point in the time, space and gravity field domain. Its operation started in 2002, for which reason data series documented the preseismic situation very well. With the Mw 8.8 earthquake on February 27, 2010, the entire observatory was exposed to strong motions due to its closeness to the epicenter. Since then the postseismic behaviour of the subduction zone can be studied and compared with the preseismic situation. TIGO provided continuous GPS/GLONASS data with 1s samples which give an insight to the mechanism of the decoupling of the Nazca and the South-American plate. The displacement of more than 3m had a duration of 30s at the beginning of the 147s duration of the earthquake. The displacement could be confirmed afterwards with VLBI and SLR methods. TIGO used its absolute gravity meter in an unusual way with weekly measurements on the same monument. These data show an irregularity during the last 3 weeks before the earthquake. Finally the postseismic movement to the west triggered by the earthquake and registered by geodetic space techniques indicate that the western expansion of the South-American plate did not stop yet. The pre- and post-seismic displacement vectors differ by less than 180° which might be explained by a fractional strike slip in the mega thrust. The coincidence of the epicenter with one of the keystations for global reference frames showed deficiencies by the linear modelling of tectonical movements in terrestial reference frames. This problem calls for near-real time reference frames.

  16. Planetary Radio Interferometry and Doppler Experiment (PRIDE) for Planetary Atmospheric Studies

    Science.gov (United States)

    Bocanegra Bahamon, Tatiana; Cimo, Giuseppe; Duev, Dmitry; Gurvits, Leonid; Molera Calves, Guifre; Pogrebenko, Sergei

    2015-04-01

    The Planetary Radio Interferometry and Doppler Experiment (PRIDE) is a technique that allows the determination of the radial velocity and lateral coordinates of planetary spacecraft with very high accuracy (Duev, 2012). The setup of the experiment consists of several ground stations from the European VLBI Network (EVN) located around the globe, which simultaneously perform Doppler tracking of a spacecraft carrier radio signal, and are subsequently processed in a VLBI-style in phase referencing mode. Because of the accurate examination of the changes in phase and amplitude of the radio signal propagating from the spacecraft to the multiple stations on Earth, the PRIDE technique can be used for several fields of planetary research, among which planetary atmospheric studies, gravimetry and ultra-precise celestial mechanics of planetary systems. In the study at hand the application of this technique for planetary atmospheric investigations is demonstrated. As a test case, radio occultation experiments were conducted with PRIDE having as target ESA's Venus Express, during different observing sessions with multiple ground stations in April 2012 and March 2014. Once each of the stations conducts the observation, the raw data is delivered to the correlation center at the Joint Institute for VLBI in Europe (JIVE) located in the Netherlands. The signals are processed with a high spectral resolution and phase detection software package from which Doppler observables of each station are derived. Subsequently the Doppler corrected signals are correlated to derive the VLBI observables. These two sets of observables are used for precise orbit determination. The reconstructed orbit along with the Doppler observables are used as input for the radio occultation processing software, which consists of mainly two modules, the geometrical optics module and the ray tracing inversion module, from which vertical density profiles, and subsequently, temperature and pressure profiles of Venus

  17. Constraints on the Mass and Location of Planet 9 set by Range and VLBI Observations of Cassini

    Science.gov (United States)

    Jacobson, Robert Arthur; Folkner, William; Park, Ryan; Williams, James

    2018-04-01

    Batygin and Brown, 2016 AJ, found that Kuiper belt objects (KBOs) with well determined orbits having periods greater than 4000 years are apsidally aligned. They attribute this orbital clustering to the existence of a distant planet, Planet 9, well beyond Neptune, with a mass roughly ten times that of Earth. If such a planet exists, it would affect the motion of the known solar system planets, in particular Saturn, which is well observed with radiometric ranging from the Cassini spacecraft and VLBI observations of Cassini. The current planetary ephemerides do not account for the postulated Planet 9, yet their fit to the observational data shows no obvious effect that could be attributed to neglecting that planet. However, it is possible that the effect could be absorbed by the estimated parameters used to determine the ephemerides. Those parameters include the planetary orbital elements, mass of the Sun, and the masses of the asteroids that perturb the Martian orbit. We recently updated the Cassini data set and extended it through the end of the mssion in 2017 September. We analyze the sensitivity of these data to the tidal perturbations caused by the postulated Planet 9 for a range of positions on the sky and tidal parameters (the ratio of the mass of Planet 9 to the cube of its distance from Saturn). We determine an upper bound on the tidal parameter and the most probable directions consistent with the observational data.

  18. Can space ties on board GNSS satellites replace terrestrial ties in the implementation of Terrestrial Reference Frames?

    Science.gov (United States)

    Bruni, Sara; Zerbini, Susanna; Altamimi, Zuheir; Rebischung, Paul; Errico, Maddalena; Santi, Efisio

    2016-04-01

    The realization of Terrestrial Reference Frames (TRFs) must be periodically updated in order to account for newly acquired observations and for upgrades in data analysis procedures and/or combination techniques. Any innovative computation strategy should ameliorate the definition of the frame physical parameters, upon which a number of scientific applications critically rely. On the basis of the requirements of scientific cutting edge studies, the geodetic community has estimated that the present day challenge in the determination of TRFs is to provide a frame that is accurate and long-term stable at the level of 1 mm and 0.1 mm/y respectively. This work aims at characterizing the frame realized by a combination of Satellite Laser Ranging (SLR) and Global Navigation Satellite Systems (GNSS) observations via their co-location on board GNSS spacecrafts. In particular, it is established how such a frame compares to the traditional ITRF computation and what is the impact on the realization of the frame origin and scale. Four years of data from a global network encompassing about one hundred GNSS stations and all SLR sites have been analyzed. In order to ensure the highest possible consistency, the raw data of both techniques are treated with the same analysis Software (Bernese GNSS Software 5.2) following IERS2010 Conventions. Both weekly and long term solutions are carried out exploiting either the Bernese or the Combination and Analysis of Terrestrial Reference Frames (CATREF) Software packages. We present the results of a combination study involving GNSS data and SLR observations to the two LAGEOS and to the GNSS satellites equipped with retroreflector arrays. The latter type of measurements is currently not included in the computation of the official ITRF solutions. The assessment of the benefit that they could provide to the definition of the origin and scale of the ITRF is however worth investigating, as such data provide the potential for linking the GNSS and

  19. VLBI OBSERVATION OF MICROQUASAR CYG X-3 DURING AN X-RAY STATE TRANSITION FROM SOFT TO HARD IN THE 2007 MAY-JUNE FLARE

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jeong-Sook; Kim, Sang Joon [School of Space Science, Kyunghee University, Seocheon-dong, Giheung-si, Gyeonggi-do 446-701 (Korea, Republic of); Kim, Soon-Wook [Korea Astronomy and Space Science Institute, 776 Daedeokdaero, Yuseong, Daejeon 305-348 (Korea, Republic of); Kurayama, Tomoharu [Graduate School of Science and Engineering, Kagoshima University, 1-21-35 Korimoto, Kagoshima, Kagoshima 890-0065 (Japan); Honma, Mareki [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Sasao, Tetsuo, E-mail: evony@kasi.re.kr, E-mail: skim@kasi.re.kr [Yaeyama Star Club, Ookawa, Ishigaki, Okinawa 904-0022 (Japan)

    2013-07-20

    We present a radio observation of microquasar Cyg X-3 during an X-ray state transition from ultrasoft to hard state in the 2007 May-June flare using the VLBI Exploration of Radio Astrometry at 22 GHz. During the transition, a short-lived mini-flare of {approx}< 3 hr was detected prior to the major flare. In such a transition, a jet ejection is believed to occur, but there have been no direct observations to support it. An analysis of Gaussian fits to the observed visibility amplitudes shows a time variation of the source axis, or a structural change, during the mini-flare. Our model fits, together with other multiwavelength observations in the radio, soft, and hard X-rays, and the shock-in-jet models for other flaring activities at GHz wavebands, suggest a high possibility of synchrotron flares during the mini-flare, indicative of a predominant contribution from jet activity. Therefore, the mini-flare with an associated structural change is indicative of a jet ejection event in the state transition from ultrasoft to hard state.

  20. Hamstring Elongation Quantified Using Ultrasonography During the Straight Leg Raise Test in Individuals With Low Back Pain.

    Science.gov (United States)

    Kellis, Eleftherios; Ellinoudis, Athanasios; Kofotolis, Nikolaos

    2015-06-01

    Although the straight leg raise (SLR) test frequently is used to assess hamstring extensibility in individuals with low back pain (LBP), evidence relating LBP, SLR, and hamstring extensibility remains unclear. The SLR measures the angle between the lifted leg and the horizontal, however, and, as such, it is not a direct measure of the elongation capacity of the hamstrings. To examine the differences in hamstring elongation (quantified via ultrasonography) and SLR score between individuals with LBP and asymptomatic controls and to determine the relationship between hamstring elongation, SLR, and functional disability scores. Cross-sectional study. University laboratory. Forty men and women with chronic LBP (mean ± SD, age 43.51 ± 3.71 years and 40 control subjects (age 45.11 ± 4.01 years) participated in this study. Passive SLR, elongation assessed via ultrasonography, and functional disability. SLR score, elongation of tendinous tissue within the semitendinosus muscle, and Oswestry Disability Index. Two-way analysis of variance tests indicated a significantly lower SLR score and a greater Oswestry score in LBP group compared with control subjects (P hamstring elongation (P > .05). Gender did not have an effect on all dependent measures (P > .05). Hamstring elongation showed a low correlation with SLR score and a minimal correlation with Oswestry score. These results indicate that the SLR score is not determined by hamstring elongation (quantified via ultrasonography). Copyright © 2015 American Academy of Physical Medicine and Rehabilitation. Published by Elsevier Inc. All rights reserved.

  1. VLA and low-frequency VLBI observations of the radio source 0503 + 467 - Austere constraints on interstellar scattering in two media

    International Nuclear Information System (INIS)

    Spangler, S.R.; Fey, A.L.; Cordes, J.M.; Cornell Univ., Ithaca, NY)

    1987-01-01

    The radio source 0503 + 467 lies near the Galactic plane (l = 161.0 deg, b = 3.7 deg) and at the edge of the supernova remnant (SNR) HB 9. The VLA observations show that it has a spectrum typical of a compact extragalactic radio source. The resultant small angular size of the source makes it an excellent probe of turbulence in two media: the diffuse, or type A, component of interstellar turbulence and a hypothesized region of hydromagnetic turbulence upstream of the supernova remnant. An eight-station VLBI experiment at 326 MHz indicates that the source is less than about 20 milliarcseconds (mas) in angular diameter. A value of 16 mas is most appropriate as an upper limit to the interstellar scattering contribution to the measured angular size. The implications of this upper limit are twofold. First, the galactocentric radial scale to the type-A turbulence is probably less than or equal to about 6 kpc. Second, no evidence is seen for shock-associated turbulence upstream of HB 9. The measurements make it possible to constrain a parameter which is a function of the rms density fluctuation in the upstream region, the outer scale to the density turbulence, and the thickness of SNR foreshock region. 14 references

  2. Natural and Human-Induced Variability in Barrier-Island Response to Sea Level Rise

    Science.gov (United States)

    Miselis, Jennifer L.; Lorenzo-Trueba, Jorge

    2017-12-01

    Storm-driven sediment fluxes onto and behind barrier islands help coastal barrier systems keep pace with sea level rise (SLR). Understanding what controls cross-shore sediment flux magnitudes is critical for making accurate forecasts of barrier response to increased SLR rates. Here, using an existing morphodynamic model for barrier island evolution, observations are used to constrain model parameters and explore potential variability in future barrier behavior. Using modeled drowning outcomes as a proxy for vulnerability to SLR, 0%, 28%, and 100% of the barrier is vulnerable to SLR rates of 4, 7, and 10 mm/yr, respectively. When only overwash fluxes are increased in the model, drowning vulnerability increases for the same rates of SLR, suggesting that future increases in storminess may increase island vulnerability particularly where sediment resources are limited. Developed sites are more vulnerable to SLR, indicating that anthropogenic changes to overwash fluxes and estuary depths could profoundly affect future barrier response to SLR.

  3. Recording and Modelling of MONUMENTS' Interior Space Using Range and Optical Sensors

    Science.gov (United States)

    Georgiadis, Charalampos; Patias, Petros; Tsioukas, Vasilios

    2016-06-01

    Three dimensional modelling of artefacts and building interiors is a highly active research field in our days. Several techniques are being utilized to perform such a task, spanning from traditional surveying techniques and photogrammetry to structured light scanners, laser scanners and so on. New technological advancements in both hardware and software create new recording techniques, tools and approaches. In this paper we present a new recording and modelling approach based on the SwissRanger SR4000 range camera coupled with a Canon 400D dSLR camera. The hardware component of our approach consists of a fixed base, which encloses the range and SLR cameras. The two sensors are fully calibrated and registered to each other thus we were able to produce colorized point clouds acquired from the range camera. In this paper we present the initial design and calibration of the system along with experimental data regarding the accuracy of the proposed approach. We are also providing results regarding the modelling of interior spaces and artefacts accompanied with accuracy tests from other modelling approaches based on photogrammetry and laser scanning.

  4. Analysis of the GPS Observations of the Site Survey at Sheshan 25-m Radio Telescope in August 2008

    Science.gov (United States)

    Liu, L.; Cheng, Z. Y.; Li, J. L.

    2010-01-01

    The processing of the GPS observations of the site survey at Sheshan 25-m radio telescope in August 2008 is reported. Because each session in this survey is only about six hours, not allowing the subdaily high frequency variations in the station coordinates to be reasonably smoothed, and because there are serious cycle slips in the observations and a large volume of data would be rejected during the software automatic adjustment of slips, the ordinary solution settings of GAMIT needed to be adjusted by loosening the constraints in the a priori coordinates to 10 m, adopting the "quick" mode in the solution iteration, and combining Cview manual operation with GAMIT automatic fixing of cycle slips. The resulting coordinates of the local control polygon in ITRF2005 are then compared with conventional geodetic results. Due to large rotations and translations in the two sets of coordinates (geocentric versus quasi-topocentric), the seven transformation parameters cannot be solved for directly. With various trial solutions it is shown that with a partial pre-removal of the large parameters, high precision transformation parameters can be obtained with post-fit residuals at the millimeter level. This analysis is necessary to prepare the follow-on site and transformation survey of the VLBI and SLR telescopes at Sheshan

  5. Analysis of the performance of hydrogen maser clocks at the ...

    African Journals Online (AJOL)

    Hydrogen maser frequency standards are commonly utilised in various space geodetic techniques such as Very Long Baseline Interferometry (VLBI) as local reference clocks. The Hartebeesthoek Radio Astronomy Observatory in South Africa is currently operating two maser frequency standards i.e., an EFOS28 and an ...

  6. IVS: Current Status and Future Plans

    Science.gov (United States)

    Behrend, D.; Nothnagel, A.; Petrachenko, W. T.; Tuccari, G.

    2016-12-01

    The International VLBI Service for Geodesy and Astrometry (IVS) is a globally operating service that coordinates and performs Very Long Baseline Interferometry (VLBI) activities through its constituent components. The VLBI activities are associated with the creation, provision, dissemination, and archiving of relevant VLBI data and products. The products mostly pertain to the determination of the celestial and terrestrial reference frames, the Earth orientation parameters (EOP), atmospheric parameters as well as other ancillary parameters. The IVS observational network currently consists of about 40 radio telescopes worldwide. Subsets of these telescopes (8-12 stations) participate in 24-hour observing sessions that are run several times per week and in 1-hour intensive sessions for UT1 determination every day. The current VLBI network was developed mainly in the 1970s and 1980s. A number of factors, including aging infrastructure and demanding new scientific requirements, started to challenge its future sustainability and relevance. In response, the IVS and other groups developed and started implementing the next generation VLBI system, called VGOS (VLBI Global Observing System), at existing and new sites. The VGOS network is expected to reach maturity in the early 2020s. We describe the current status, progress, and anticipated prospects of geodetic/astrometric VLBI and the IVS.

  7. Development of a methodology for the assessment of sea level rise impacts on Florida's transportation modes and infrastructure : [summary].

    Science.gov (United States)

    2012-01-01

    In Florida, low elevations can make transportation infrastructure in coastal and low-lying areas potentially vulnerable to sea level rise (SLR). Becuase global SLR forecasts lack precision at local or regional scales, SLR forecasts or scenarios for p...

  8. Mechanosensitivity during lower extremity neurodynamic testing is diminished in individuals with Type 2 Diabetes Mellitus and peripheral neuropathy: a cross sectional study

    Directory of Open Access Journals (Sweden)

    Boyd Benjamin S

    2010-08-01

    Full Text Available Abstract Background Type 2 Diabetes Mellitus (T2DM and diabetic symmetrical polyneuropathy (DSP impact multiple modalities of sensation including light touch, temperature, position sense and vibration perception. No study to date has examined the mechanosensitivity of peripheral nerves during limb movement in this population. The objective was to determine the unique effects T2DM and DSP have on nerve mechanosensitivity in the lower extremity. Methods This cross-sectional study included 43 people with T2DM. Straight leg raise neurodynamic tests were performed with ankle plantar flexion (PF/SLR and dorsiflexion (DF/SLR. Hip flexion range of motion (ROM, lower extremity muscle activity and symptom profile, intensity and location were measured at rest, first onset of symptoms (P1 and maximally tolerated symptoms (P2. Results The addition of ankle dorsiflexion during SLR testing reduced the hip flexion ROM by 4.3° ± 6.5° at P1 and by 5.4° ± 4.9° at P2. Individuals in the T2DM group with signs of severe DSP (n = 9 had no difference in hip flexion ROM between PF/SLR and DF/SLR at P1 (1.4° ± 4.2°; paired t-test p = 0.34 or P2 (0.9° ± 2.5°; paired t-test p = 0.31. Movement induced muscle activity was absent during SLR with the exception of the tibialis anterior during DF/SLR testing. Increases in symptom intensity during SLR testing were similar for both PF/SLR and DF/SLR. The addition of ankle dorsiflexion induced more frequent posterior leg symptoms when taken to P2. Conclusions Consistent with previous recommendations in the literature, P1 is an appropriate test end point for SLR neurodynamic testing in people with T2DM. However, our findings suggest that people with T2DM and severe DSP have limited responses to SLR neurodynamic testing, and thus may be at risk for harm from nerve overstretch and the information gathered will be of limited clinical value.

  9. Combination of monthly gravity field solutions from different processing centers

    Science.gov (United States)

    Jean, Yoomin; Meyer, Ulrich; Jäggi, Adrian

    2015-04-01

    Currently, the official GRACE Science Data System (SDS) monthly gravity field solutions are generated independently by the Centre for Space Research (CSR) and the German Research Centre for Geosciences (GFZ). Additional GRACE SDS monthly fields are provided by the Jet Propulsion Laboratory (JPL) for validation and outside the SDS by a number of other institutions worldwide. Although the adopted background models and processing standards have been harmonized more and more by the various processing centers during the past years, notable differences still exist and the users are more or less left alone with a decision which model to choose for their individual applications. Combinations are well-established in the area of other space geodetic techniques, such as the Global Navigation Satellite Systems (GNSS), Satellite Laser Ranging (SLR), and Very Long Baseline Interferometry (VLBI), where regular comparisons and combinations of space-geodetic products have tremendously increased the usefulness of the products in a wide range of disciplines and scientific applications. In the frame of the recently started Horizon 2020 project European Gravity Service for Improved Emergency Management (EGSIEM), a scientific combination service shall therefore be established to deliver the best gravity products for applications in Earth and environmental science research based on the unified knowledge of the European GRACE community. In a first step the large variety of available monthly GRACE gravity field solutions shall be mutually compared spatially and spectrally. We assess the noise of the raw as well as filtered solutions and compare the secular and seasonal periodic variations fitted to the monthly solutions. In a second step we will explore ways to generate combined solutions, e.g., based on a weighted average of the individual solutions using empirical weights derived from pair-wise comparisons. We will also assess the quality of such a combined solution and discuss the

  10. Constraints on the Mass and Location of Planet 9 set by Range and VLBI Observations of Spacecraft at Saturn

    Science.gov (United States)

    Jacobson, Robert A.; Folkner, William M.; Park, Ryan S.; Williams, James G.

    2017-06-01

    Batygin and Brown, 2016 AJ, found that all Kuiper belt objects (KBOs) with well determined orbits having periods greater than 4000 years share nearly the same orbital plane and are apsidally aligned. They attribute this orbital clustering to the existence of a distant planet, Planet 9, well beyond Neptune, with a mass roughly ten times that of Earth. If such a planet exists, it would affect the motion of the known solar system planets, in particular Saturn, which is well observed with radiometric ranging from the Voyager and Cassini spacecraft and VLBI observations of Cassini. The current planetary ephemerides do not account for the postulated Planet 9, yet their fit to the observational data shows no obvious effect that could be attributed to neglecting that planet. However, it is possible that the effect could be absorbed by the estimated parameters used to determine the ephemerides. Those parameters include the planetary orbital elements, mass of the Sun, and the masses of the asteroids that perturb the Martian orbit. We recently updated the Voyager and Cassini data sets and extended the latter through 2017 March. We analyze the sensitivity of these data to the tidal perturbations caused by Planet 9 for a range of positions on the sky and tidal parameters (the ratio of the mass of Planet 9 to the cube of its distance from Saturn). We determine an upper bound on the tidal parameter and the most probable directions consistent with the observational data.

  11. Future climate change driven sea-level rise: secondary consequences from human displacement for island biodiversity.

    Science.gov (United States)

    Wetzel, Florian T; Kissling, W Daniel; Beissmann, Helmut; Penn, Dustin J

    2012-09-01

    Sea-level rise (SLR) due to global warming will result in the loss of many coastal areas. The direct or primary effects due to inundation and erosion from SLR are currently being assessed; however, the indirect or secondary ecological effects, such as changes caused by the displacement of human populations, have not been previously evaluated. We examined the potential ecological consequences of future SLR on >1,200 islands in the Southeast Asian and the Pacific region. Using three SLR scenarios (1, 3, and 6 m elevation, where 1 m approximates most predictions by the end of this century), we assessed the consequences of primary and secondary SLR effects from human displacement on habitat availability and distributions of selected mammal species. We estimate that between 3-32% of the coastal zone of these islands could be lost from primary effects, and consequently 8-52 million people would become SLR refugees. Assuming that inundated urban and intensive agricultural areas will be relocated with an equal area of habitat loss in the hinterland, we project that secondary SLR effects can lead to an equal or even higher percent range loss than primary effects for at least 10-18% of the sample mammals in a moderate range loss scenario and for 22-46% in a maximum range loss scenario. In addition, we found some species to be more vulnerable to secondary than primary effects. Finally, we found high spatial variation in vulnerability: species on islands in Oceania are more vulnerable to primary SLR effects, whereas species on islands in Indo-Malaysia, with potentially 7-48 million SLR refugees, are more vulnerable to secondary effects. Our findings show that primary and secondary SLR effects can have enormous consequences for human inhabitants and island biodiversity, and that both need to be incorporated into ecological risk assessment, conservation, and regional planning. © 2012 Blackwell Publishing Ltd.

  12. Modeling the Effects of Sea-Level Rise on Groundwater Levels in Coastal New Hampshire

    Science.gov (United States)

    Jacobs, J. M.; Knott, J. F.; Daniel, J.; Kirshen, P. H.

    2017-12-01

    Coastal communities with high population density and low topography are vulnerable from sea-level rise (SLR) caused by climate change. Groundwater in coastal communities will rise with sea level impacting water quality, the structural integrity of infrastructure, and natural ecosystem health. SLR-induced groundwater rise has been studied in areas of high aquifer transmissivity and in low-lying areas immediately along the coast. In this regional study, we investigate SLR-induced groundwater rise in a coastal area characterized by shallow unconsolidated deposits overlying fractured bedrock, typical of the glaciated northeast United States. MODFLOW, a numerical groundwater-flow model, is used with groundwater observations, lidar topography, surface-water hydrology, and groundwater withdrawals to investigate SLR-induced changes in groundwater levels and vadose-zone thickness in New Hampshire's Seacoast. The SLR groundwater signal is detected up to 5 km from the coast, more than 3 times farther inland than projected surface-water flooding associated with SLR. Relative groundwater rise ranges from 38 to 98% of SLR within 1 km of the shoreline and drops below 4% between 4 and 5 km from the coast. The largest magnitude of SLR-induced groundwater rise occurs in the marine and estuarine deposits and land areas with tidal water bodies on three sides. In contrast, groundwater rise is dampened near streams. Groundwater inundation caused by 2 m of SLR is projected to contribute 48% of the total land inundation area in the City of Portsmouth with consequences for built and natural resources. Freshwater wetlands are projected to expand 3% by year 2030 increasing to 25% by year 2100 coupled with water-depth increases. These results imply that underground infrastructure and natural resources in coastal communities will be impacted by rising groundwater much farther inland than previously thought when considering only surface-water flooding from SLR.

  13. Contributions of internal climate variability to mitigation of projected future regional sea level rise

    Science.gov (United States)

    Hu, A.; Bates, S. C.

    2017-12-01

    Observations indicate that the global mean surface temperature is rising, so does the global mean sea level. Sea level rise (SLR) can impose significant impacts on island and coastal communities, especially when SLR is compounded with storm surges. Here, via analyzing results from two sets of ensemble simulations from the Community Earth System Model version 1, we investigate how the potential SLR benefits through mitigating the future emission scenarios from business as usual to a mild-mitigation over the 21st Century would be affected by internal climate variability. Results show that there is almost no SLR benefit in the near term due to the large SLR variability due to the internal ocean dynamics. However, toward the end of the 21st century, the SLR benefit can be as much as a 26±1% reduction of the global mean SLR due to seawater thermal expansion. Regionally, the benefits from this mitigation for both near and long terms are heterogeneous. They vary from just a 11±5% SLR reduction in Melbourne, Australia to a 35±6% reduction in London. The processes contributing to these regional differences are the coupling of the wind-driven ocean circulation with the decadal scale sea surface temperature mode in the Pacific and Southern Oceans, and the changes of the thermohaline circulation and the mid-latitude air-sea coupling in the Atlantic.

  14. Physical and Biological Regulation of Carbon Sequestration in Tidal Marshes

    Science.gov (United States)

    Morris, J. T.; Callaway, J.

    2017-12-01

    The rate of carbon sequestration in tidal marshes is regulated by complex feedbacks among biological and physical factors including the rate of sea-level rise (SLR), biomass production, tidal amplitude, and the concentration of suspended sediment. We used the Marsh Equilibrium Model (MEM) to explore the effects on C-sequestration across a wide range of permutations of these variables. C-sequestration increased with the rate of SLR to a maximum, then down to a vanishing point at higher SLR when marshes convert to mudflats. An acceleration in SLR will increase C-sequestration in marshes that can keep pace, but at high rates of SLR this is only possible with high biomass and suspended sediment concentrations. We found that there were no feasible solutions at SLR >13 mm/yr for permutations of variables that characterize the great majority of tidal marshes, i.e., the equilibrium elevation exists below the lower vertical limit for survival of marsh vegetation. The rate of SLR resulting in maximum C-sequestration varies with biomass production. C-sequestration rates at SLR=1 mm/yr averaged only 36 g C m-2 yr-1, but at the highest maximum biomass tested (5000 g/m2) the mean C-sequestration reached 399 g C m-2 yr-1 at SLR = 14 mm/yr. The empirical estimate of C-sequestration in a core dated 50-years overestimates the theoretical long-term rate by 34% for realistic values of decomposition rate and belowground production. The overestimate of the empirical method arises from the live and decaying biomass contained within the carbon inventory above the marker horizon, and overestimates were even greater for shorter surface cores.

  15. Design and Development of High-Repetition-Rate Satellite Laser Ranging System

    Science.gov (United States)

    Choi, Eun-Jung; Bang, Seong-Cheol; Sung, Ki-Pyoung; Lim, Hyung-Chul; Jung, Chan-Gyu; Kim, In-Yeung; Choi, Jae-Seung

    2015-09-01

    The Accurate Ranging System for Geodetic Observation ? Mobile (ARGO-M) was successfully developed as the first Korean mobile Satellite Laser Ranging (SLR) system in 2012, and has joined in the International Laser Ranging Service (ILRS) tracking network, DAEdeoK (DAEK) station. The DAEK SLR station was approved as a validated station in April 2014, through the ILRS station ¡°data validation¡± process. The ARGO-M system is designed to enable 2 kHz laser ranging with millimeter-level precision for geodetic, remote sensing, navigation, and experimental satellites equipped with Laser Retroreflector Arrays (LRAs). In this paper, we present the design and development of a next generation high-repetition-rate SLR system for ARGO-M. The laser ranging rate up to 10 kHz is becoming an important issue in the SLR community to improve ranging precision. To implement high-repetition-rate SLR system, the High-repetition-rate SLR operation system (HSLR-10) was designed and developed using ARGO-M Range Gate Generator (A-RGG), so as to enable laser ranging from 50 Hz to 10 kHz. HSLR-10 includes both hardware controlling software and data post-processing software. This paper shows the design and development of key technologies of high-repetition-rate SLR system. The developed system was tested successfully at DAEK station and then moved to Sejong station, a new Korean SLR station, on July 1, 2015. HSLR-10 will begin normal operations at Sejong station in the near future.

  16. Improving Frozen Precipitation Density Estimation in Land Surface Modeling

    Science.gov (United States)

    Sparrow, K.; Fall, G. M.

    2017-12-01

    The Office of Water Prediction (OWP) produces high-value water supply and flood risk planning information through the use of operational land surface modeling. Improvements in diagnosing frozen precipitation density will benefit the NWS's meteorological and hydrological services by refining estimates of a significant and vital input into land surface models. A current common practice for handling the density of snow accumulation in a land surface model is to use a standard 10:1 snow-to-liquid-equivalent ratio (SLR). Our research findings suggest the possibility of a more skillful approach for assessing the spatial variability of precipitation density. We developed a 30-year SLR climatology for the coterminous US from version 3.22 of the Daily Global Historical Climatology Network - Daily (GHCN-D) dataset. Our methods followed the approach described by Baxter (2005) to estimate mean climatological SLR values at GHCN-D sites in the US, Canada, and Mexico for the years 1986-2015. In addition to the Baxter criteria, the following refinements were made: tests were performed to eliminate SLR outliers and frequent reports of SLR = 10, a linear SLR vs. elevation trend was fitted to station SLR mean values to remove the elevation trend from the data, and detrended SLR residuals were interpolated using ordinary kriging with a spherical semivariogram model. The elevation values of each station were based on the GMTED 2010 digital elevation model and the elevation trend in the data was established via linear least squares approximation. The ordinary kriging procedure was used to interpolate the data into gridded climatological SLR estimates for each calendar month at a 0.125 degree resolution. To assess the skill of this climatology, we compared estimates from our SLR climatology with observations from the GHCN-D dataset to consider the potential use of this climatology as a first guess of frozen precipitation density in an operational land surface model. The difference in

  17. Predicting sea-level rise vulnerability of terrestrial habitat and wildlife of the Northwestern Hawaiian Islands

    Science.gov (United States)

    Reynolds, Michelle H.; Berkowitz, Paul; Courtot, Karen N.; Krause, Crystal M.; Reynolds, Michelle H.; Berkowitz, Paul; Courtot, Karen N.; Krause, Crystal M.

    2012-01-01

    wildlife breeding habitats for each island. The subsequent chapter (chapter 2) details a study of the Laysan Island ecosystem, describing a quantitative model that incorporates SLR, storm wave, and rising groundwater inundation. Wildlife, storm, and oceanographic data allowed for an assessment of the phenological and spatial vulnerability of Laysan Island's breeding bird species to SLR and storms. Using remote sensing and geospatial techniques, we estimated topography, classified vegetation, modeled SLR, and evaluated a range of climate change scenarios. On the basis of high-resolution airborne data collected during 2010-11 (root-mean-squared error = 0.05-0.18 m), we estimated the maximum elevation of 20 individual islands extending from Kure Atoll to French Frigate Shoals (range: 1.8-39.7 m) and computed the mean elevation (1.7 m, standard deviation 1.1 m) across all low-lying islands. We also analyzed general climate models to describe rainfall and temperature scenarios expected to influence adaptation of some plants and animals for this region. Outcomes for the NWHI predicted an increase in temperature of 1.8-2.6 degrees Celsius (°C) and an annual decrease in precipitation of 24.7-76.3 millimeters (mm) across the NWHI by 2100. Our models of passive SLR (excluding wave-driven effects, erosion, and accretion) showed that approximately 4 percent of the total land area in the NWHI will be lost with scenarios of +1.0 m of SLR and 26 percent will be lost with +2.0 m of SLR. Some atolls are especially vulnerable to SLR. For example, at Pearl and Hermes Atoll our analysis indicated substantial habitat losses with 43 percent of the land area inundated at +1.0 m SLR and 92 percent inundated at +2.0 m SLR. Across the NWHI, seven islands will be completely submerged with +2.0 m SLR. The limited global ranges of some tropical nesting birds make them particularly vulnerable to climate change impacts in the NWHI. Climate change scenarios and potential SLR impacts presented here

  18. A New Model of the Mean Albedo of the Earth: Estimation and Validation from the GRACE Mission and SLR Satellites.

    Science.gov (United States)

    Deleflie, F.; Sammuneh, M. A.; Coulot, D.; Pollet, A.; Biancale, R.; Marty, J. C.

    2017-12-01

    This talk provides new results of a study that we began last year, and that was the subject of a poster by the same authors presented during AGU FM 2016, entitled « Mean Effect of the Albedo of the Earth on Artificial Satellite Trajectories: an Update Over 2000-2015. »The emissivity of the Earth, split into a part in the visible domain (albedo) and the infrared domain (thermic emissivity), is at the origin of non gravitational perturbations on artificial satellite trajectories. The amplitudes and periods of these perturbations can be investigated if precise orbits can be carried out, and reveal some characteristics of the space environment where the satellite is orbiting. Analyzing the perturbations is, hence, a way to characterize how the energy from the Sun is re-emitted by the Earth. When led over a long period of time, such an approach enables to quantify the variations of the global radiation budget of the Earth.Additionally to the preliminary results presented last year, we draw an assessment of the validity of the mean model based on the orbits of the GRACE missions, and, to a certain extent, of some of the SLR satellite orbits. The accelerometric data of the GRACE satellites are used to evaluate the accuracy of the models accounting for non gravitational forces, and the ones induced by the albedo and the thermic emissivity in particular. Three data sets are used to investigate the mean effects on the orbit perturbations: Stephens tables (Stephens, 1980), ECMWF (European Centre for Medium-Range Weather Forecasts) data sets and CERES (Clouds and the Earth's Radiant Energy System) data sets (publickly available). From the trajectography point of view, based on post-fit residual analysis, we analyze what is the data set leading to the lowest residual level, to define which data set appears to be the most suitable one to derive a new « mean albedo model » from accelerometric data sets of the GRACE mission. The period of investigation covers the full GRACE

  19. The ORF slr0091 of Synechocystis sp. PCC6803 encodes a high-light induced aldehyde dehydrogenase converting apocarotenals and alkanals

    KAUST Repository

    Trautmann, Danika

    2013-07-05

    Oxidative cleavage of carotenoids and peroxidation of lipids lead to apocarotenals and aliphatic aldehydes called alkanals, which react with vitally important compounds, promoting cytotoxicity. Although many enzymes have been reported to deactivate alkanals by converting them into fatty acids, little is known about the mechanisms used to detoxify apocarotenals or the enzymes acting on them. Cyanobacteria and other photosynthetic organisms must cope with both classes of aldehydes. Here we report that the Synechocystis enzyme SynAlh1, encoded by the ORF slr0091, is an aldehyde dehydrogenase that mediates oxidation of both apocarotenals and alkanals into the corresponding acids. Using a crude lysate of SynAlh1-expressing Escherichia coli cells, we show that SynAlh1 converts a wide range of apocarotenals and alkanals, with a preference for apocarotenals with defined chain lengths. As suggested by in vitro incubations and using engineered retinal-forming E. coli cells, we found that retinal is not a substrate for SynAlh1, making involvement in Synechocystis retinoid metabolism unlikely. The transcript level of SynAlh1 is induced by high light and cold treatment, indicating a role in the stress response, and the corresponding gene is a constituent of a stress-related operon. The assumptions regarding the function of SynAlh are further supported by the surprisingly high homology to human and plant aldehyde dehydrogenase that have been assigned to aldehyde detoxification. SynAlh1 is the first aldehyde dehydrogenase that has been shown to form both apocarotenoic and fatty acids. This dual function suggests that its eukaryotic homologs may also be involved in apocarotenal metabolism, a function that has not been considered so far. Aldehyde dehydrogenases play an important role in detoxification of reactive aldehydes. Here, we report on a cyanbacterial enzyme capable in converting two classes of lipid-derived aldehydes, apocaotenals and alkanals. The corresponding gene is a

  20. The impact of future sea-level rise on the global tides

    Science.gov (United States)

    Pickering, M. D.; Horsburgh, K. J.; Blundell, J. R.; Hirschi, J. J.-M.; Nicholls, R. J.; Verlaan, M.; Wells, N. C.

    2017-06-01

    Tides are a key component in coastal extreme water levels. Possible changes in the tides caused by mean sea-level rise (SLR) are therefore of importance in the analysis of coastal flooding, as well as many other applications. We investigate the effect of future SLR on the tides globally using a fully global forward tidal model: OTISmpi. Statistical comparisons of the modelled and observed tidal solutions demonstrate the skill of the refined model setup with no reliance on data assimilation. We simulate the response of the four primary tidal constituents to various SLR scenarios. Particular attention is paid to future changes at the largest 136 coastal cities, where changes in water level would have the greatest impact. Spatially uniform SLR scenarios ranging from 0.5 to 10 m with fixed coastlines show that the tidal amplitudes in shelf seas globally respond strongly to SLR with spatially coherent areas of increase and decrease. Changes in the M2 and S2 constituents occur globally in most shelf seas, whereas changes in K1 and O1 are confined to Asian shelves. With higher SLR tidal changes are often not proportional to the SLR imposed and larger portions of mean high water (MHW) changes are above proportional. Changes in MHW exceed ±10% of the SLR at 10% of coastal cities. SLR scenarios allowing for coastal recession tend increasingly to result in a reduction in tidal range. The fact that the fixed and recession shoreline scenarios result mainly in changes of opposing sign is explained by the effect of the perturbations on the natural period of oscillation of the basin. Our results suggest that coastal management strategies could influence the sign of the tidal amplitude change. The effect of a spatially varying SLR, in this case fingerprints of the initial elastic response to ice mass loss, modestly alters the tidal response with the largest differences at high latitudes.

  1. Assessment of the possible contribution of space ties on-board GNSS satellites to the terrestrial reference frame

    Science.gov (United States)

    Bruni, Sara; Rebischung, Paul; Zerbini, Susanna; Altamimi, Zuheir; Errico, Maddalena; Santi, Efisio

    2018-04-01

    The realization of the international terrestrial reference frame (ITRF) is currently based on the data provided by four space geodetic techniques. The accuracy of the different technique-dependent materializations of the frame physical parameters (origin and scale) varies according to the nature of the relevant observables and to the impact of technique-specific errors. A reliable computation of the ITRF requires combining the different inputs, so that the strengths of each technique can compensate for the weaknesses of the others. This combination, however, can only be performed providing some additional information which allows tying together the independent technique networks. At present, the links used for that purpose are topometric surveys (local/terrestrial ties) available at ITRF sites hosting instruments of different techniques. In principle, a possible alternative could be offered by spacecrafts accommodating the positioning payloads of multiple geodetic techniques realizing their co-location in orbit (space ties). In this paper, the GNSS-SLR space ties on-board GPS and GLONASS satellites are thoroughly examined in the framework of global reference frame computations. The investigation focuses on the quality of the realized physical frame parameters. According to the achieved results, the space ties on-board GNSS satellites cannot, at present, substitute terrestrial ties in the computation of the ITRF. The study is completed by a series of synthetic simulations investigating the impact that substantial improvements in the volume and quality of SLR observations to GNSS satellites would have on the precision of the GNSS frame parameters.

  2. In Vivo MRI Measurement of Spinal Cord Displacement in the Thoracolumbar Region of Asymptomatic Subjects with Unilateral and Sham Straight Leg Raise Tests.

    Directory of Open Access Journals (Sweden)

    M Rade

    Full Text Available Normal displacement of the conus medullaris with unilateral and bilateral SLR has been quantified and the "principle of linear dependence" has been described.Explore whether previously recorded movements of conus medullaris with SLRs are i primarily due to transmission of tensile forces transmitted through the neural tissues during SLR or ii the result of reciprocal movements between vertebrae and nerves.Controlled radiologic study.Ten asymptomatic volunteers were scanned with a 1.5T magnetic resonance (MR scanner using T2 weighted spc 3D scanning sequences and a device that permits greater ranges of SLR. Displacement of the conus medullaris during the unilateral and sham SLR was quantified reliably with a randomized procedure. Conus displacement in response to unilateral and sham SLRs was quantified and the results compared.The conus displaced caudally in the spinal canal by 3.54±0.87 mm (mean±SD with unilateral (p≤.001 and proximally by 0.32±1.6 mm with sham SLR (p≤.542. Pearson correlations were higher than 0.99 for both intra- and inter-observer reliability and the observed power was 1 for unilateral SLRs and 0.054 and 0.149 for left and right sham SLR respectively.Four relevant points emerge from the presented data: i reciprocal movements between the spinal cord and the surrounding vertebrae are likely to occur during SLR in asymptomatic subjects, ii conus medullaris displacement in the vertebral canal with SLR is primarily due to transmission of tensile forces through the neural tissues, iii when tensile forces are transmitted through the neural system as in the clinical SLR, the magnitude of conus medullaris displacement prevails over the amount of bone adjustment.

  3. Evaluation of Dynamic Coastal Response to Sea-level Rise Modifies Inundation Likelihood

    Science.gov (United States)

    Lentz, Erika E.; Thieler, E. Robert; Plant, Nathaniel G.; Stippa, Sawyer R.; Horton, Radley M.; Gesch, Dean B.

    2016-01-01

    Sea-level rise (SLR) poses a range of threats to natural and built environments, making assessments of SLR-induced hazards essential for informed decision making. We develop a probabilistic model that evaluates the likelihood that an area will inundate (flood) or dynamically respond (adapt) to SLR. The broad-area applicability of the approach is demonstrated by producing 30x30m resolution predictions for more than 38,000 sq km of diverse coastal landscape in the northeastern United States. Probabilistic SLR projections, coastal elevation and vertical land movement are used to estimate likely future inundation levels. Then, conditioned on future inundation levels and the current land-cover type, we evaluate the likelihood of dynamic response versus inundation. We find that nearly 70% of this coastal landscape has some capacity to respond dynamically to SLR, and we show that inundation models over-predict land likely to submerge. This approach is well suited to guiding coastal resource management decisions that weigh future SLR impacts and uncertainty against ecological targets and economic constraints.

  4. The Design Concept of the First Mobile Satellite Laser Ranging System (ARGO-M in Korea

    Directory of Open Access Journals (Sweden)

    Jung Hyun Jo

    2011-03-01

    Full Text Available Korea Astronomy and Space Science Institute (KASI launched the development project of two satellite laser ranging (SLR systems in early 2008 after the government fund approval of the SLR systems in 2007. One mobile SLR system and one permanent SLR station will be developed with the completion of the project. The main objectives of these systems will be focused on the Space Geodetic researches. A system requirement review was held in the second half of the same year. Through the following system design review meeting and other design reviews, many unsolved technical and engineering issues would be discussed and resolved. However, the design of the mobile SLR system is a corner stone of whole project. The noticeable characteristics of Korea’s first SLR system are 1 use of light weight main mirror, 2 design of compact optical assembly, 3 use of KHz laser pulse, 4 use of commercial laser generator, 5 remote operation capability, 6 automatic tracking, 7 state of art operation system, etc. In this paper, the major user requirement and pre-defined specification are presented and discussed.

  5. Differential responses of autonomic function in sea level residents, acclimatized lowlanders at >3500 m and Himalayan high altitude natives at >3500 m: A cross-sectional study.

    Science.gov (United States)

    Dhar, Priyanka; Sharma, Vijay K; Das, Saroj K; Barhwal, Kalpana; Hota, Sunil K; Singh, Shashi B

    2018-04-09

    We studied the differential responses of autonomic function in sea level residents (SLR), acclimatized lowlanders (ALH) in high altitude (HA) and HA natives (HAN) at >3500 m. Out of 771 male volunteers included in this cross-sectional study, SLR, ALH and HAN groups were comprised of 351, 307 and 113 volunteers, respectively. Our results showed persistent sympathetic dominance with significantly reduced (p < 0.05) parasympathetic response in ALH as compared to SLR and HAN populations. This may be attributed to significantly increased (p < 0.05) concentration of coronary risk factors and plasma catecholamines in ALH as compared to SLR and HAN. The ALH also showed significantly increased (p < 0.05) level of serum homocysteine as compared to SLR. The HAN exhibited no changes in autonomic function despite significantly elevated (p < 0.05) homocysteine level as compared to SLR. Our findings may have clinical relevance for assessment of susceptibility to cardiovascular risks in HA dwellers, native highlanders and patients with hypoxemia. Copyright © 2018 Elsevier B.V. All rights reserved.

  6. Triceps surae short latency stretch reflexes contribute to ankle stiffness regulation during human running.

    Directory of Open Access Journals (Sweden)

    Neil J Cronin

    Full Text Available During human running, short latency stretch reflexes (SLRs are elicited in the triceps surae muscles, but the function of these responses is still a matter of controversy. As the SLR is primarily mediated by Ia afferent nerve fibres, various methods have been used to examine SLR function by selectively blocking the Ia pathway in seated, standing and walking paradigms, but stretch reflex function has not been examined in detail during running. The purpose of this study was to examine triceps surae SLR function at different running speeds using Achilles tendon vibration to modify SLR size. Ten healthy participants ran on an instrumented treadmill at speeds between 7 and 15 km/h under 2 Achilles tendon vibration conditions: no vibration and 90 Hz vibration. Surface EMG from the triceps surae and tibialis anterior muscles, and 3D lower limb kinematics and ground reaction forces were simultaneously collected. In response to vibration, the SLR was depressed in the triceps surae muscles at all speeds. This coincided with short-lasting yielding at the ankle joint at speeds between 7 and 12 km/h, suggesting that the SLR contributes to muscle stiffness regulation by minimising ankle yielding during the early contact phase of running. Furthermore, at the fastest speed of 15 km/h, the SLR was still depressed by vibration in all muscles but yielding was no longer evident. This finding suggests that the SLR has greater functional importance at slow to intermediate running speeds than at faster speeds.

  7. Dynamic simulation and numerical analysis of hurricane storm surge under sea level rise with geomorphologic changes along the northern Gulf of Mexico

    Science.gov (United States)

    Bilskie, Matthew V.; Hagen, S.C.; Alizad, K.A.; Medeiros, S.C.; Passeri, Davina L.; Needham, H.F.; Cox, A.

    2016-01-01

    This work outlines a dynamic modeling framework to examine the effects of global climate change, and sea level rise (SLR) in particular, on tropical cyclone-driven storm surge inundation. The methodology, applied across the northern Gulf of Mexico, adapts a present day large-domain, high resolution, tide, wind-wave, and hurricane storm surge model to characterize the potential outlook of the coastal landscape under four SLR scenarios for the year 2100. The modifications include shoreline and barrier island morphology, marsh migration, and land use land cover change. Hydrodynamics of 10 historic hurricanes were simulated through each of the five model configurations (present day and four SLR scenarios). Under SLR, the total inundated land area increased by 87% and developed and agricultural lands by 138% and 189%, respectively. Peak surge increased by as much as 1 m above the applied SLR in some areas, and other regions were subject to a reduction in peak surge, with respect to the applied SLR, indicating a nonlinear response. Analysis of time-series water surface elevation suggests the interaction between SLR and storm surge is nonlinear in time; SLR increased the time of inundation and caused an earlier arrival of the peak surge, which cannot be addressed using a static (“bathtub”) modeling framework. This work supports the paradigm shift to using a dynamic modeling framework to examine the effects of global climate change on coastal inundation. The outcomes have broad implications and ultimately support a better holistic understanding of the coastal system and aid restoration and long-term coastal sustainability.

  8. Large scale identification and categorization of protein sequences using structured logistic regression.

    Directory of Open Access Journals (Sweden)

    Bjørn P Pedersen

    Full Text Available BACKGROUND: Structured Logistic Regression (SLR is a newly developed machine learning tool first proposed in the context of text categorization. Current availability of extensive protein sequence databases calls for an automated method to reliably classify sequences and SLR seems well-suited for this task. The classification of P-type ATPases, a large family of ATP-driven membrane pumps transporting essential cations, was selected as a test-case that would generate important biological information as well as provide a proof-of-concept for the application of SLR to a large scale bioinformatics problem. RESULTS: Using SLR, we have built classifiers to identify and automatically categorize P-type ATPases into one of 11 pre-defined classes. The SLR-classifiers are compared to a Hidden Markov Model approach and shown to be highly accurate and scalable. Representing the bulk of currently known sequences, we analysed 9.3 million sequences in the UniProtKB and attempted to classify a large number of P-type ATPases. To examine the distribution of pumps on organisms, we also applied SLR to 1,123 complete genomes from the Entrez genome database. Finally, we analysed the predicted membrane topology of the identified P-type ATPases. CONCLUSIONS: Using the SLR-based classification tool we are able to run a large scale study of P-type ATPases. This study provides proof-of-concept for the application of SLR to a bioinformatics problem and the analysis of P-type ATPases pinpoints new and interesting targets for further biochemical characterization and structural analysis.

  9. Structured decision making as a proactive approach to dealing with sea level rise in Florida

    Science.gov (United States)

    Martin, Julien; Fackler, Paul L.; Nichols, James D.; Lubow, Bruce C.; Eaton, Mitchell J.; Runge, Michael C.; Stith, Bradley M.; Langtimm, Catherine A.

    2011-01-01

    Sea level rise (SLR) projections along the coast of Florida present an enormous challenge for management and conservation over the long term. Decision makers need to recognize and adopt strategies to adapt to the potentially detrimental effects of SLR. Structured decision making (SDM) provides a rigorous framework for the management of natural resources. The aim of SDM is to identify decisions that are optimal with respect to management objectives and knowledge of the system. Most applications of SDM have assumed that the managed systems are governed by stationary processes. However, in the context of SLR it may be necessary to acknowledge that the processes underlying managed systems may be non-stationary, such that systems will be continuously changing. Therefore, SLR brings some unique considerations to the application of decision theory for natural resource management. In particular, SLR is expected to affect each of the components of SDM. For instance, management objectives may have to be reconsidered more frequently than under more stable conditions. The set of potential actions may also have to be adapted over time as conditions change. Models have to account for the non-stationarity of the modeled system processes. Each of the important sources of uncertainty in decision processes is expected to be exacerbated by SLR. We illustrate our ideas about adaptation of natural resource management to SLR by modeling a non-stationary system using a numerical example. We provide additional examples of an SDM approach for managing species that may be affected by SLR, with a focus on the endangered Florida manatee.

  10. Practical Tips and Techniques on the Process of Transdisciplinary Sea Level Rise Research

    Science.gov (United States)

    DeLorme, D.; Hagen, S. C.; Kidwell, D.; Stephens, S. H.

    2015-12-01

    There is increasing awareness of the need for transdisciplinary science to address complex climate change issues, yet practical guidance is lacking. This presentation describes the iterative planning, implementation, and evaluation process of an ongoing transdisciplinary sea level rise (SLR) research project. Observations, reflections, and recommendations from firsthand experience are shared, illustrated with examples, and placed within a transdisciplinary research framework. The NOAA-sponsored project, Ecological Effects of Sea Level Rise in the Northern Gulf of Mexico (EESLR-NGOM) is a six-year regional study involving a team of biology, ecology, civil/coastal engineering, and communication scholars working with government agency personnel and industry professionals; supervising students and post-doctoral researchers; and engaging a group of non-academic stakeholders (i.e., coastal resource managers). EESLR-NGOM's focus is on detailed assessment and process-based modeling to project SLR impacts on northern Gulf of Mexico coastal wetland habitats and flood plains. This presentation highlights collaboration, communication, and project management considerations, and explains knowledge co-production from a dynamic combination of natural and social scientific methods (secondary data analysis, computer modeling, field observations, field and laboratory experiments, focus group interviews, surveys) and interrelated stakeholder engagement mechanisms (advisory committee, project flow chart, workshops, focus groups, webinars) infused throughout the EESLR-NGOM project to improve accessibility and utility of the scientific results and products. Attention is also given to project evaluation including monitoring, multiple quantitative and qualitative measures, and recognition of challenges and limitations. This presentation should generate productive dialogue and direction for similar endeavors to find transformative solutions to pressing problems of climate change.

  11. Large scale identification and categorization of protein sequences using structured logistic regression

    DEFF Research Database (Denmark)

    Pedersen, Bjørn Panella; Ifrim, Georgiana; Liboriussen, Poul

    2014-01-01

    Abstract Background Structured Logistic Regression (SLR) is a newly developed machine learning tool first proposed in the context of text categorization. Current availability of extensive protein sequence databases calls for an automated method to reliably classify sequences and SLR seems well...... problem. Results Using SLR, we have built classifiers to identify and automatically categorize P-type ATPases into one of 11 pre-defined classes. The SLR-classifiers are compared to a Hidden Markov Model approach and shown to be highly accurate and scalable. Representing the bulk of currently known...... for further biochemical characterization and structural analysis....

  12. Language Recognition Using Latent Dynamic Conditional Random Field Model with Phonological Features

    Directory of Open Access Journals (Sweden)

    Sirinoot Boonsuk

    2014-01-01

    Full Text Available Spoken language recognition (SLR has been of increasing interest in multilingual speech recognition for identifying the languages of speech utterances. Most existing SLR approaches apply statistical modeling techniques with acoustic and phonotactic features. Among the popular approaches, the acoustic approach has become of greater interest than others because it does not require any prior language-specific knowledge. Previous research on the acoustic approach has shown less interest in applying linguistic knowledge; it was only used as supplementary features, while the current state-of-the-art system assumes independency among features. This paper proposes an SLR system based on the latent-dynamic conditional random field (LDCRF model using phonological features (PFs. We use PFs to represent acoustic characteristics and linguistic knowledge. The LDCRF model was employed to capture the dynamics of the PFs sequences for language classification. Baseline systems were conducted to evaluate the features and methods including Gaussian mixture model (GMM based systems using PFs, GMM using cepstral features, and the CRF model using PFs. Evaluated on the NIST LRE 2007 corpus, the proposed method showed an improvement over the baseline systems. Additionally, it showed comparable result with the acoustic system based on i-vector. This research demonstrates that utilizing PFs can enhance the performance.

  13. EFFECT OF SULFATE LOADING RATE AND ORGANIC LOADING RATE ON ANAEROBIC BAFFLED REACTORS USED FOR TREATMENT OF SANITARY LANDFILL LEACHATES

    Directory of Open Access Journals (Sweden)

    O. Burbano-Figueroa

    2015-06-01

    Full Text Available AbstractThis study investigated the effect of organic loading rate (OLR and sulfate loading rate (SLR on landfill leachate treatment by a lab-scale anaerobic baffled reactor (ABR. Landfill leachate contained a concentration of organic matter between 3966 and 5090 mg COD.L-1 and no detectable amounts of sulfate. Reactors were started-up by feeding them with iron-sulfate at a SLR of 0.05 g SO42-.L-1.day-1 (4 weeks. Factorial design and response surface techniques were used to evaluate and optimize the effects of these operating variables on COD removal. ABRs were operated at OLRs ranging from 0.30 up to 6.84 g COD.L-1.day-1 by changes in influent volumetric flow. SO42- was added to the influent at a SRL from 0.06 to 0.13 g SO42-.L-1.day-1. The highest value of COD removal (66% was reached at an OLR of 3.58 g COD.L-1.day-1 and SLR of 0.09 g SO4-2.L-1.day-1 with a COD/SO4-2 ratio of 40. Under these conditions sulfate is mainly used for molecular hydrogen consumption while organic matter is preferentially degraded via methanogesis.

  14. Allowances for evolving coastal flood risk under uncertain local sea-level rise

    Science.gov (United States)

    Buchanan, M. K.; Kopp, R. E.; Oppenheimer, M.; Tebaldi, C.

    2015-12-01

    Sea-level rise (SLR) causes estimates of flood risk made under the assumption of stationary mean sea level to be biased low. However, adjustments to flood return levels made assuming fixed increases of sea level are also inaccurate when applied to sea level that is rising over time at an uncertain rate. To accommodate both the temporal dynamics of SLR and their uncertainty, we develop an Average Annual Design Life Level (AADLL) metric and associated SLR allowances [1,2]. The AADLL is the flood level corresponding to a time-integrated annual expected probability of occurrence (AEP) under uncertainty over the lifetime of an asset; AADLL allowances are the adjustment from 2000 levels that maintain current risk. Given non-stationary and uncertain SLR, AADLL flood levels and allowances provide estimates of flood protection heights and offsets for different planning horizons and different levels of confidence in SLR projections in coastal areas. Allowances are a function primarily of local SLR and are nearly independent of AEP. Here we employ probabilistic SLR projections [3] to illustrate the calculation of AADLL flood levels and allowances with a representative set of long-duration tide gauges along U.S. coastlines. [1] Rootzen et al., 2014, Water Resources Research 49: 5964-5972. [2] Hunter, 2013, Ocean Engineering 71: 17-27. [3] Kopp et al., 2014, Earth's Future 2: 383-406.

  15. Simple motion correction strategy reduces respiratory-induced motion artifacts for k-t accelerated and compressed-sensing cardiovascular magnetic resonance perfusion imaging.

    Science.gov (United States)

    Zhou, Ruixi; Huang, Wei; Yang, Yang; Chen, Xiao; Weller, Daniel S; Kramer, Christopher M; Kozerke, Sebastian; Salerno, Michael

    2018-02-01

    Cardiovascular magnetic resonance (CMR) stress perfusion imaging provides important diagnostic and prognostic information in coronary artery disease (CAD). Current clinical sequences have limited temporal and/or spatial resolution, and incomplete heart coverage. Techniques such as k-t principal component analysis (PCA) or k-t sparcity and low rank structure (SLR), which rely on the high degree of spatiotemporal correlation in first-pass perfusion data, can significantly accelerate image acquisition mitigating these problems. However, in the presence of respiratory motion, these techniques can suffer from significant degradation of image quality. A number of techniques based on non-rigid registration have been developed. However, to first approximation, breathing motion predominantly results in rigid motion of the heart. To this end, a simple robust motion correction strategy is proposed for k-t accelerated and compressed sensing (CS) perfusion imaging. A simple respiratory motion compensation (MC) strategy for k-t accelerated and compressed-sensing CMR perfusion imaging to selectively correct respiratory motion of the heart was implemented based on linear k-space phase shifts derived from rigid motion registration of a region-of-interest (ROI) encompassing the heart. A variable density Poisson disk acquisition strategy was used to minimize coherent aliasing in the presence of respiratory motion, and images were reconstructed using k-t PCA and k-t SLR with or without motion correction. The strategy was evaluated in a CMR-extended cardiac torso digital (XCAT) phantom and in prospectively acquired first-pass perfusion studies in 12 subjects undergoing clinically ordered CMR studies. Phantom studies were assessed using the Structural Similarity Index (SSIM) and Root Mean Square Error (RMSE). In patient studies, image quality was scored in a blinded fashion by two experienced cardiologists. In the phantom experiments, images reconstructed with the MC strategy had higher

  16. Ensemble projection of the sea level rise impact on storm surge and inundation at the coast of Bangladesh

    Science.gov (United States)

    Jisan, Mansur Ali; Bao, Shaowu; Pietrafesa, Leonard J.

    2018-01-01

    The hydrodynamic model Delft3D is used to study the impact of sea level rise (SLR) on storm surge and inundation in the coastal region of Bangladesh. To study the present-day inundation scenario, the tracks of two known tropical cyclones (TC) were used: Aila (Category 1; 2009) and Sidr (Category 5; 2007). Model results were validated with the available observations. Future inundation scenarios were generated by using the strength of TC Sidr, TC Aila and an ensemble of historical TC tracks but incorporating the effect of SLR. Since future change in storm surge inundation under SLR impact is a probabilistic incident, a probable range of future change in the inundated area was calculated by taking into consideration the uncertainties associated with TC tracks, intensities and landfall timing. The model outputs showed that the inundated area for TC Sidr, which was calculated as 1860 km2, would become 31 % larger than the present-day scenario if a SLR of 0.26 m occurred during the mid-21st-century climate scenario. Similarly to that, an increasing trend was found for the end-21st-century climate scenario. It was found that with a SLR of 0.54 m, the inundated area would become 53 % larger than the present-day case. Along with the inundation area, the impact of SLR was examined for changes in future storm surge level. A significant increase of 14 % was found in storm surge level for the case of TC Sidr at Barisal station if a SLR of 0.26 m occurred in the mid-21st century. Similarly to that, an increase of 29 % was found at storm surge level with a SLR of 0.54 m in this location for the end-21st-century climate scenario. Ensemble projections based on uncertainties of future TC events also showed that, for a change of 0.54 m in SLR, the inundated area would range between 3500 and 3750 km2, whereas for present-day SLR simulations it was found within the range of 1000-1250 km2. These results revealed that even if the future TCs remain at the same strength as at present, the

  17. INTERFEROMETRIC MONITORING OF GAMMA-RAY BRIGHT AGNs. I. THE RESULTS OF SINGLE-EPOCH MULTIFREQUENCY OBSERVATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Sang-Sung; Wajima, Kiyoaki; Algaba, Juan-Carlos; Zhao, Guang-Yao; Hodgson, Jeffrey A.; Byun, Do-Young; Kang, Sincheol; Kim, Soon-Wook; Kino, Motoki [Korea Astronomy and Space Science Institute, 776 Daedeok-daero, Yuseong-gu, Daejeon 34055 (Korea, Republic of); Kim, Dae-Won; Park, Jongho; Kim, Jae-Young; Trippe, Sascha [Department of Physics and Astronomy, Seoul National University, 1 Gwanak-ro, Gwanak-gu, Seoul 08826 (Korea, Republic of); Miyazaki, Atsushi [Japan Space Forum, 3-2-1, Kandasurugadai, Chiyoda-ku, Tokyo 101-0062 Japan (Japan); Kim, Jeong-Sook, E-mail: sslee@kasi.re.kr [National Astronomical Observatory of Japan, 2211 Osawa, Mitaka, Tokyo 1818588 (Japan)

    2016-11-01

    We present results of single-epoch very long baseline interferometry (VLBI) observations of gamma-ray bright active galactic nuclei (AGNs) using the Korean VLBI Network (KVN) at the 22, 43, 86, and 129 GHz bands, which are part of a KVN key science program, Interferometric Monitoring of Gamma-Ray Bright AGNs. We selected a total of 34 radio-loud AGNs of which 30 sources are gamma-ray bright AGNs with flux densities of >6 × 10{sup −10} ph cm{sup −2} s{sup −1}. Single-epoch multifrequency VLBI observations of the target sources were conducted during a 24 hr session on 2013 November 19 and 20. All observed sources were detected and imaged at all frequency bands, with or without a frequency phase transfer technique, which enabled the imaging of 12 faint sources at 129 GHz, except for one source. Many of the target sources are resolved on milliarcsecond scales, yielding a core-jet structure, with the VLBI core dominating the synchrotron emission on a milliarcsecond scale. CLEAN flux densities of the target sources are 0.43–28 Jy, 0.32–21 Jy, 0.18–11 Jy, and 0.35–8.0 Jy in the 22, 43, 86, and 129 GHz bands, respectively. Spectra of the target sources become steeper at higher frequency, with spectral index means of −0.40, −0.62, and −1.00 in the 22–43 GHz, 43–86 GHz and 86–129 GHz bands, respectively, implying that the target sources become optically thin at higher frequencies (e.g., 86–129 GHz).

  18. Understanding extreme sea levels for broad-scale coastal impact and adaptation analysis

    Science.gov (United States)

    Wahl, T.; Haigh, I. D.; Nicholls, R. J.; Arns, A.; Dangendorf, S.; Hinkel, J.; Slangen, A. B. A.

    2017-07-01

    One of the main consequences of mean sea level rise (SLR) on human settlements is an increase in flood risk due to an increase in the intensity and frequency of extreme sea levels (ESL). While substantial research efforts are directed towards quantifying projections and uncertainties of future global and regional SLR, corresponding uncertainties in contemporary ESL have not been assessed and projections are limited. Here we quantify, for the first time at global scale, the uncertainties in present-day ESL estimates, which have by default been ignored in broad-scale sea-level rise impact assessments to date. ESL uncertainties exceed those from global SLR projections and, assuming that we meet the Paris agreement goals, the projected SLR itself by the end of the century in many regions. Both uncertainties in SLR projections and ESL estimates need to be understood and combined to fully assess potential impacts and adaptation needs.

  19. Geometrical Model of Solar Radiation Pressure Based on High-Performing Galileo Clocks - First Geometrical Mapping of the Yarkowsky effect

    Science.gov (United States)

    Svehla, Drazen; Rothacher, Markus; Hugentobler, Urs; Steigenberger, Peter; Ziebart, Marek

    2014-05-01

    depends on the orbit quality and should rather be called GNSS orbit bias instead of SLR bias. When LEO satellite orbits are estimated using GPS, this GPS orbit bias is mapped into the antenna phase center. All LEO satellites, such as CHAMP, GRACE and JASON-1/2, need an adjustment of the radial antenna phase center offset. GNSS orbit translations towards the Sun in the orbital plane do not only propagate into the estimated LEO orbits, but also into derived gravity field and altimetry products. Geometrical mapping of orbit perturbations using an on board GNSS clock is a new technique to monitor orbit perturbations along the orbit and was successfully applied in the modeling of Solar radiation pressure. We show that CODE Solar radiation pressure parameterization lacks dependency with the Sun's elevation, i.e. elongation angle (rotation of Solar arrays), especially at low Sun elevations (eclipses). Parameterisation with the Sun elongation angle is used in the so-called T30 model (ROCK-model) that includes thermal re-radiation. A preliminary version of Solar radiation pressure for the first five Galileo and the GPS-36 satellite is based on 2×180 days of the MGEX Campaign. We show that Galileo clocks map the Yarkowsky effect along the orbit, i.e. the lag between the Sun's illumination and thermal re-radiation. We present the first geometrical mapping of anisotropic thermal emission of absorbed sunlight of an illuminated satellite. In this way, the effects of Solar radiation pressure can be modelled with only two paramaters for all Sun elevations.

  20. The effect of age on result of straight leg raising test in patients suffering lumbar disc herniation and sciatica

    Directory of Open Access Journals (Sweden)

    Homayoun Tabesh

    2015-01-01

    Full Text Available Background: Ninety percent of all people sometimes during their lives experience low back pain, and 30-40% develops radicular leg pain with the sciatica characteristics. Although for clinical diagnosis of lumbar disc herniation (LDH straight leg raising (SLR test in 85-90% of cases indicates LDH, but in our practice with LDH patients this test is frequently negative despite radicular leg pain due to LDH. Hence, we decided to evaluate this test in LDH in different age groups. Materials and Methods: All patients with leg pain referring to neurosurgery clinic were enrolled. Those with a history of pain other than sciatica excluded and SLR test and magnetic resonance imaging (MRI of the lumbosacral spine performed. The patients with negative MRI findings excluded and finally 269 patients with true sciatica and positive MRI were included. SLR tests were performed for different age groups. Results: Of 269 patients, 167 were male. The age range was 16-80 years. The most involved levels were L5-S1 (47% and L4-L5 (42%, respectively. The rate of positive SLR result, which was 100%, 87% and 82% for 10-19, 20-29 and 30-39 years age group respectively. With an increment of age, the rate of positive test regularly declined . The chance of positive SLR in men is 1.3 times the women (odds ratio [OR] 2.4; 95% confidence interval [CI] = 1.265-4.557; P = 0.007. Increasing the age has suppression effect in positivity of SLR so that for each 1-year the chance of SLR become 0.27 times less to become positive and this is also statically meaningful (OR = 0.271;95% CI = 0.188-0.391; P,0.001. The chance of positive SLR for patients under 60 is 5.4 folds more than patients above 60 years old (OR = 5.4; 95% CI = 4-8.3; P, 0.001. Conclusion: Age, sex (male, and disk level had statistically the effect on SLR positive test.

  1. Analyzing extreme sea levels for broad-scale impact and adaptation studies

    Science.gov (United States)

    Wahl, T.; Haigh, I. D.; Nicholls, R. J.; Arns, A.; Dangendorf, S.; Hinkel, J.; Slangen, A.

    2017-12-01

    Coastal impact and adaptation assessments require detailed knowledge on extreme sea levels (ESL), because increasing damage due to extreme events is one of the major consequences of sea-level rise (SLR) and climate change. Over the last few decades, substantial research efforts have been directed towards improved understanding of past and future SLR; different scenarios were developed with process-based or semi-empirical models and used for coastal impact studies at various temporal and spatial scales to guide coastal management and adaptation efforts. Uncertainties in future SLR are typically accounted for by analyzing the impacts associated with a range of scenarios and model ensembles. ESL distributions are then displaced vertically according to the SLR scenarios under the inherent assumption that we have perfect knowledge on the statistics of extremes. However, there is still a limited understanding of present-day ESL which is largely ignored in most impact and adaptation analyses. The two key uncertainties stem from: (1) numerical models that are used to generate long time series of storm surge water levels, and (2) statistical models used for determining present-day ESL exceedance probabilities. There is no universally accepted approach to obtain such values for broad-scale flood risk assessments and while substantial research has explored SLR uncertainties, we quantify, for the first time globally, key uncertainties in ESL estimates. We find that contemporary ESL uncertainties exceed those from SLR projections and, assuming that we meet the Paris agreement, the projected SLR itself by the end of the century. Our results highlight the necessity to further improve our understanding of uncertainties in ESL estimates through (1) continued improvement of numerical and statistical models to simulate and analyze coastal water levels and (2) exploit the rich observational database and continue data archeology to obtain longer time series and remove model bias

  2. Impacts of sea level rise and climate change on coastal plant species in the central California coast

    Directory of Open Access Journals (Sweden)

    Kendra L. Garner

    2015-05-01

    Full Text Available Local increases in sea level caused by global climate change pose a significant threat to the persistence of many coastal plant species through exacerbating inundation, flooding, and erosion. In addition to sea level rise (SLR, climate changes in the form of air temperature and precipitation regimes will also alter habitats of coastal plant species. Although numerous studies have analyzed the effect of climate change on future habitats through species distribution models (SDMs, none have incorporated the threat of exposure to SLR. We developed a model that quantified the effect of both SLR and climate change on habitat for 88 rare coastal plant species in San Luis Obispo, Santa Barbara, and Ventura Counties, California, USA (an area of 23,948 km2. Our SLR model projects that by the year 2100, 60 of the 88 species will be threatened by SLR. We found that the probability of being threatened by SLR strongly correlates with a species’ area, elevation, and distance from the coast, and that 10 species could lose their entire current habitat in the study region. We modeled the habitat suitability of these 10 species under future climate using a species distribution model (SDM. Our SDM projects that 4 of the 10 species will lose all suitable current habitats in the region as a result of climate change. While SLR accounts for up to 9.2 km2 loss in habitat, climate change accounts for habitat suitability changes ranging from a loss of 1,439 km2 for one species to a gain of 9,795 km2 for another species. For three species, SLR is projected to reduce future suitable area by as much as 28% of total area. This suggests that while SLR poses a higher risk, climate changes in precipitation and air temperature represents a lesser known but potentially larger risk and a small cumulative effect from both.

  3. Sea level rise under the Shared Socioeconomic Pathways (SSPs)

    Science.gov (United States)

    Schleussner, C. F.; Nauels, A.; Rogelj, J.; Mengel, M.; Meinshausen, M.

    2017-12-01

    In order to assess future sea level rise and its impacts, we need to study climate change pathways combined with different scenarios of socioeconomic development. Here, we present Sea Level Rise (SLR) projections for the Shared Socioeconomic Pathway (SSP) storylines and different year-2100 radiative Forcing Targets (FTs). Future SLR is estimated with a comprehensive SLR emulator that accounts for latest research on additional Antarctic rapid discharge dynamics from hydrofracturing and ice cliff instability. Across all baseline scenario realizations (no dedicated climate mitigation), we find 2100 median SLR relative to 1986-2005 of 102 cm (likely range: 77 to 135 cm) for SSP1, 118 cm (90 to 151 cm) for SSP2, 118 cm (91 to 149 cm) for SSP3, 107 cm (81 to 137 cm) for SSP4, and 144 cm (112 to 184 cm) for SSP5. The 2100 sea level responses for combined SSP-FT scenarios is dominated by the mitigation targets and yield median estimates of 68 cm (56 to 87 cm) for FT 2.6 Wm-2, 76 cm (61 to 107 cm) for FT 3.4 Wm-2, 90 cm (68 to 120 cm) for FT 4.5 Wm-2, and 105 cm (79 to 136 cm) for FT 6.0 Wm-2. Average 2081-2100 annual rates of SLR are 6 mm/yr and 19 mm/yr for the FT 2.6 Wm-2 and the baseline scenarios, respectively. Our model setup allows linking scenario-specific emission and socioeconomic indicators to projected SLR. For limiting median 2100 SSP SLR projections to below 80 cm, we find that 2050 cumulative CO2 emissions since pre-industrial should not exceed around 860 GtC, with the global coal phase-out nearly completed. For SSP mitigation scenarios, the median 2050 carbon price of 90 US$2005 tCO2-1 would correspond to a median 2100 SLR of around 80 cm. Our results confirm that rapid and early emission reductions are essential for limiting 2100 SLR.

  4. LONG-TERM STABILITY OF THE LOCAL GROUND CONTROL NETWORK AT THE CO-LOCATION SITE OF MEDICINA

    Science.gov (United States)

    Abbondanza, C.; Sarti, P.; Legrand, J.

    2009-12-01

    ITRF combinations rely on the availability of accurate tie vectors linking reference points of space geodetic techniques. Co-located instruments are assumed to move consistently and no local relative motion is taken into account. Instabilities may degrade the quality of the co-location itself and perturb the result of ITRF combinations. This work aims to determine the stability of the local ground control network at Medicina (Italy) with independent surveying methods. The observatory hosts a co-location between a VLBI telescope and two GPS antennas, MEDI and MSEL. It is located in the Po Plain where thick layers of clays are the prevalent soil characteristics. Hence, provision of long term stability of geodetic monuments is a challenge and monitoring their stability is an issue. MEDI and the VLBI station regularly contribute to the determination of ITRF, while MSEL is part of the EUREF network. A set of five tie vectors observations linking the VLBI and MEDI reference points was acquired between 2001 and 2007. It is our main tool for performing local deformation analysis. Additionally, the GPS time series of MEDI and MSEL were used to cross check and confirm the local instability detected by terrestrial methods. To achieve a rigorous and reliable investigation of the local stability, multi-epoch terrestrial observations were homogeneously processed according to common parameterizations in a consistent reference frame. Similarly, continuous GPS observations from MEDI and MSEL were analysed according to the new EPN reprocessing strategy in order to monitor the short baseline between MEDI and MSEL; to spotlight any change in its length. Both approaches confirm differential motions at the site which can be related to monument instabilities originated by the particularly unfavourable local geological setting and the inapt design of the monuments foundation. The monuments move non homogeneously at rates reaching up to 1.6 mm/year, this value being comparable to intra

  5. IVS contribution to the next ITRF

    Science.gov (United States)

    Bachmann, Sabine; Messerschmitt, Linda; Thaller, Daniela

    2015-04-01

    Generating the contribution of the International VLBI Service (IVS) to the next ITRF (ITRF2013 or ITRF2014) was the main task of the IVS Combination Center at the Federal Agency for Cartography and Geodesy (BKG, Germany) in 2014. Starting with the ITRF2005, the IVS contribution to the ITRF is an intra-technique combined solution using multiple individual contributions from different institutions. For the upcoming ITRF ten international institutions submitted data files for a combined solution. The data files contain 24h VLBI sessions from the late 1970s until the end of 2014 in SINEX file format containing datum free normal equations with station coordinates and Earth Orientation Parameters (EOP). All contributions have to meet the IVS standards for ITRF contribution in order to guarantee a consistent combined solution. In the course of the generation of the intra-technique combined solution, station coordinate time series for each station as well as a Terrestrial Reference Frame based on the contributed VLBI data (VTRF) were generated and analyzed. Preliminary results using data until the end of 2013 show a scaling factor of -0.47 ppb resulting from a 7-parameter Helmert transformation of the VTRF w.r.t. ITRF2008, which is comparable to the scaling factor that was determined in the precedent ITRF generation. An internal comparison of the EOPs between the combined solution and the individual contributions as well as external comparisons of the EOP series were carried out in order to assure a consistent quality of the EOPs. The data analyses, the combination procedure and results of the combined solution for station coordinates and EOP will be presented.

  6. Episodic Spin-up and Spin-down Torque on Earth

    Science.gov (United States)

    Slabinski, Victor J.; Mendonca, Antonio A.

    2018-04-01

    Variations in Earth rotation angle are traditionally expressed by the time difference (ΔT=TT-UT1) between Terrestrial Time (TT) as told by atomic clocks and Universal Time UT1, the time variable used by the Earth-rotation formula. A plot of ΔT versus TT over the past 160 years shows a continuous curve with approximate straight-line segments with different spans of order ~20 years. Removing the tidal and seasonal variations from the data gives these line segments which represent the “decadal variations” in Earth rotation.The slope of a straight-line segment is proportional to the departure of Earth rotation rate from a reference value at the time. The change in slope over the relatively short time between segments indicates an episodic spin-up or spin-down in Earth rotation. The daily combination of VLBI, SLR, and other modern data available since 1973 gives us accurate, daily values of ΔT and the corresponding LOD (Length Of Day) values during these episodes. These allow us to determine the rotational acceleration occurring then.The three largest spin-speed changes found during the VLBI era have the following characteristics:Episode _____________ Duration__ ΔLOD__LOD Rate1983 Dec 30-1984 Jan 28 ... 29 d ...-0.65 ms ..-8.3 ms/y ..........spin-up1989 Mar 15-1989 May 23 ...69 d ....0.68 .......+3.6 ..............spin-down1994 Jan 21-2001 Apr 01 ... 6.5 y ...-2.2 .........-0.36 ..extended spin-upFor the first two episodes listed, we find the acceleration grows from zero (or at least a relatively small value) to its extreme value in ~1 day, stays approximately constant at this value for 29 or 69 days, and then decays back to zero over ~1 day. The acceleration, while it occurs, gives an LOD rate much greater than the 0.02 ms/y rate from tidal friction.The third episode shows that occasionally a several-year-long episode occurs. The acceleration magnitude is smaller but can make a larger total change in LOD (and spin rate). Tidal friction requires >100 y to equal

  7. UTC(SU) and EOP(SU) - the only legal reference frames of Russian Federation

    Science.gov (United States)

    Koshelyaevsky, Nikolay B.; Blinov, Igor Yu; Pasynok, Sergey L.

    2015-08-01

    institutes- processing GNSS, SLR and VLBI observation data for EOP evaluation- combination of GLONASS satellites orbit/clocks.The paper will deliver more detailed and particular information on Russian legal reference frames.

  8. Risk Prediction Using Genome-Wide Association Studies on Type 2 Diabetes

    Directory of Open Access Journals (Sweden)

    Sungkyoung Choi

    2016-12-01

    Full Text Available The success of genome-wide association studies (GWASs has enabled us to improve risk assessment and provide novel genetic variants for diagnosis, prevention, and treatment. However, most variants discovered by GWASs have been reported to have very small effect sizes on complex human diseases, which has been a big hurdle in building risk prediction models. Recently, many statistical approaches based on penalized regression have been developed to solve the “large p and small n” problem. In this report, we evaluated the performance of several statistical methods for predicting a binary trait: stepwise logistic regression (SLR, least absolute shrinkage and selection operator (LASSO, and Elastic-Net (EN. We first built a prediction model by combining variable selection and prediction methods for type 2 diabetes using Affymetrix Genome-Wide Human SNP Array 5.0 from the Korean Association Resource project. We assessed the risk prediction performance using area under the receiver operating characteristic curve (AUC for the internal and external validation datasets. In the internal validation, SLR-LASSO and SLR-EN tended to yield more accurate predictions than other combinations. During the external validation, the SLR-SLR and SLR-EN combinations achieved the highest AUC of 0.726. We propose these combinations as a potentially powerful risk prediction model for type 2 diabetes.

  9. Mapping Sea Level Rise Behavior in an Estuarine Delta System: A Case Study along the Shanghai Coast

    Directory of Open Access Journals (Sweden)

    H.Q. Cheng

    2018-02-01

    Full Text Available Sea level rise (SLR is a major projected threat of climate change that is expected to affect developing coastal cities located in estuarine delta regions. Shanghai is one such city, being located in the Yangtze River Delta (YRD. It is difficult, however, for decision-makers to implement adaptation due to the uncertain causes, magnitudes, and timings of SLR behaviors. This paper attempts to map the causes and magnitudes of SLR behaviors on a decadal scale. We analyze the tidal level records from 11 tidal gauge stations and the corresponding bathymetry measurements around these stations since 1921. We identify three new SLR behaviors along the Shanghai coast due to anthropogenic geomorphologic changes (AGCs, besides the well-known eustatic sea level rise (ESLR, tectonic subsidence (TS, and urban land subsidence (ULS. The first new behavior is regional sea level rise (RSLR, which occurs as a result of land reclamation and deep waterway regulation. The second is regional sea level fall (RSLF, which occurs because the channel bed is eroded due to sediment supply decline in the river catchment. The last SLR behavior is local tidal datum rise (LTDR. Thus, we project that the magnitude of SLR for the Shanghai coast ranges from 10 cm to 16 cm from 2011 to 2030. Clarifying SLR behaviors is important to aid local decision-makers in planning structural and non-structural measures to combat escalating flood damage costs in an estuarine delta system; this field is full of future challenges. Keywords: Sea level rise behavior, Anthropogenic geomorphologic change, Local tidal datum, Flood management, Adaptation

  10. HIGH-RESOLUTION LINEAR POLARIMETRIC IMAGING FOR THE EVENT HORIZON TELESCOPE

    Energy Technology Data Exchange (ETDEWEB)

    Chael, Andrew A.; Johnson, Michael D.; Narayan, Ramesh; Doeleman, Sheperd S. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Wardle, John F. C. [Brandeis University, Physics Department, Waltham, MA 02454 (United States); Bouman, Katherine L., E-mail: achael@cfa.harvard.edu [Massachusetts Institute of Technology, Computer Science and Artificial Intelligence Laboratory, 32 Vassar Street, Cambridge, MA 02139 (United States)

    2016-09-20

    Images of the linear polarizations of synchrotron radiation around active galactic nuclei (AGNs) highlight their projected magnetic field lines and provide key data for understanding the physics of accretion and outflow from supermassive black holes. The highest-resolution polarimetric images of AGNs are produced with Very Long Baseline Interferometry (VLBI). Because VLBI incompletely samples the Fourier transform of the source image, any image reconstruction that fills in unmeasured spatial frequencies will not be unique and reconstruction algorithms are required. In this paper, we explore some extensions of the Maximum Entropy Method (MEM) to linear polarimetric VLBI imaging. In contrast to previous work, our polarimetric MEM algorithm combines a Stokes I imager that only uses bispectrum measurements that are immune to atmospheric phase corruption, with a joint Stokes Q and U imager that operates on robust polarimetric ratios. We demonstrate the effectiveness of our technique on 7 and 3 mm wavelength quasar observations from the VLBA and simulated 1.3 mm Event Horizon Telescope observations of Sgr A* and M87. Consistent with past studies, we find that polarimetric MEM can produce superior resolution compared to the standard CLEAN algorithm, when imaging smooth and compact source distributions. As an imaging framework, MEM is highly adaptable, allowing a range of constraints on polarization structure. Polarimetric MEM is thus an attractive choice for image reconstruction with the EHT.

  11. Agile Methods from the Viewpoint of Information

    Directory of Open Access Journals (Sweden)

    Eder Junior Alves

    2017-10-01

    Full Text Available Introduction: Since Paul M. G. Otlet highlighted the term documentation in 1934, proposing how to collect and organize the world's knowledge, many scientific researches directed observations to the study of Information Science. Methods and techniques have come up with a world view from the perspective of information. Agile methods follow this trend. Objective: The purpose is to analyze the relevance of information flow to organizations adopting agile methods, understanding how the innovation process is influenced by this practice. Methodology: This is a bibliometric study with fundamentals of Systematic Literature Review (SLR. The integration between the SLR technique interacting with Summarize tool is a new methodological proposal. Results: Scrum appears with the highest number of publications in SPELL. In comparison, results of Google Scholar pointed out to the importance of practices and team behaviors. In Science Direct repository, critical success factors in project management and software development are highlighted. Introduction: Conclusions: It was evident that agile methods are being used as process innovations. The benefits and advantages are evident with internal and external occurrence of information flow. Due to the prevalence in the literature, Scrum deserves attention by firms.

  12. Protocol to assess the neurophysiology associated with multi-segmental postural coordination

    International Nuclear Information System (INIS)

    Lomond, Karen V; Henry, Sharon M; Jacobs, Jesse V; Hitt, Juvena R; Horak, Fay B; Cohen, Rajal G; Schwartz, Daniel; Dumas, Julie A; Naylor, Magdalena R; Watts, Richard; DeSarno, Michael J

    2013-01-01

    Anticipatory postural adjustments (APAs) stabilize potential disturbances to posture caused by movement. Impaired APAs are common with disease and injury. Brain functions associated with generating APAs remain uncertain due to a lack of paired tasks that require similar limb motion from similar postural orientations, but differ in eliciting an APA while also being compatible with brain imaging techniques (e.g., functional magnetic resonance imaging; fMRI). This study developed fMRI-compatible tasks differentiated by the presence or absence of APAs during leg movement. Eighteen healthy subjects performed two leg movement tasks, supported leg raise (SLR) and unsupported leg raise (ULR), to elicit isolated limb motion (no APA) versus multi-segmental coordination patterns (including APA), respectively. Ground reaction forces under the feet and electromyographic activation amplitudes were assessed to determine the coordination strategy elicited for each task. Results demonstrated that the ULR task elicited a multi-segmental coordination that was either minimized or absent in the SLR task, indicating that it would serve as an adequate control task for fMRI protocols. A pilot study with a single subject performing each task in an MRI scanner demonstrated minimal head movement in both tasks and brain activation patterns consistent with an isolated limb movement for the SLR task versus multi-segmental postural coordination for the ULR task. (note)

  13. Using Bi-Seasonal WorldView-2 Multi-Spectral Data and Supervised Random Forest Classification to Map Coastal Plant Communities in Everglades National Park

    Directory of Open Access Journals (Sweden)

    Kristie S. Wendelberger

    2018-03-01

    Full Text Available Coastal plant communities are being transformed or lost because of sea level rise (SLR and land-use change. In conjunction with SLR, the Florida Everglades ecosystem has undergone large-scale drainage and restoration, altering coastal vegetation throughout south Florida. To understand how coastal plant communities are changing over time, accurate mapping techniques are needed that can define plant communities at a fine-enough resolution to detect fine-scale changes. We explored using bi-seasonal versus single-season WorldView-2 satellite data to map three mangrove and four adjacent plant communities, including the buttonwood/glycophyte community that harbors the federally-endangered plant Chromolaena frustrata. Bi-seasonal data were more effective than single-season to differentiate all communities of interest. Bi-seasonal data combined with Light Detection and Ranging (LiDAR elevation data were used to map coastal plant communities of a coastal stretch within Everglades National Park (ENP. Overall map accuracy was 86%. Black and red mangroves were the dominant communities and covered 50% of the study site. All the remaining communities had ≤10% cover, including the buttonwood/glycophyte community. ENP harbors 21 rare coastal species threatened by SLR. The spatially explicit, quantitative data provided by our map provides a fine-scale baseline for monitoring future change in these species’ habitats. Our results also offer a method to monitor vegetation change in other threatened habitats.

  14. Using Bi-Seasonal WorldView-2 Multi-Spectral Data and Supervised Random Forest Classification to Map Coastal Plant Communities in Everglades National Park.

    Science.gov (United States)

    Wendelberger, Kristie S; Gann, Daniel; Richards, Jennifer H

    2018-03-09

    Coastal plant communities are being transformed or lost because of sea level rise (SLR) and land-use change. In conjunction with SLR, the Florida Everglades ecosystem has undergone large-scale drainage and restoration, altering coastal vegetation throughout south Florida. To understand how coastal plant communities are changing over time, accurate mapping techniques are needed that can define plant communities at a fine-enough resolution to detect fine-scale changes. We explored using bi-seasonal versus single-season WorldView-2 satellite data to map three mangrove and four adjacent plant communities, including the buttonwood/glycophyte community that harbors the federally-endangered plant Chromolaena frustrata . Bi-seasonal data were more effective than single-season to differentiate all communities of interest. Bi-seasonal data combined with Light Detection and Ranging (LiDAR) elevation data were used to map coastal plant communities of a coastal stretch within Everglades National Park (ENP). Overall map accuracy was 86%. Black and red mangroves were the dominant communities and covered 50% of the study site. All the remaining communities had ≤10% cover, including the buttonwood/glycophyte community. ENP harbors 21 rare coastal species threatened by SLR. The spatially explicit, quantitative data provided by our map provides a fine-scale baseline for monitoring future change in these species' habitats. Our results also offer a method to monitor vegetation change in other threatened habitats.

  15. Report for 2012 from the Bordeaux IVS Analysis Center

    Science.gov (United States)

    Charlot, Patrick; Bellanger, Antoine; Bouffet, Romuald; Bourda, Geraldine; Collioud, Arnaud; Baudry, Alain

    2013-01-01

    This report summarizes the activities of the Bordeaux IVS Analysis Center during the year 2012. The work focused on (i) regular analysis of the IVS-R1 and IVS-R4 sessions with the GINS software package; (ii) systematic VLBI imaging of the RDV sessions and calculation of the corresponding source structure index and compactness values; (iii) investigation of the correlation between astrometric position instabilities and source structure variations; and (iv) continuation of our VLBI observational program to identify optically-bright radio sources suitable for the link with the future Gaia frame. Also of importance is the 11th European VLBI Network Symposium, which we organized last October in Bordeaux and which drew much attention from the European and International VLBI communities.

  16. Italy INAF Analysis Center Report

    Science.gov (United States)

    Negusini, M.; Sarti, P.

    2013-01-01

    This report summarizes the activity of the Italian INAF VLBI Analysis Center. Our Analysis Center is located in Bologna, Italy and belongs to the Institute of Radioastronomy, which is part of the National Institute of Astrophysics. IRA runs the observatories of Medicina and Noto, where two 32-m VLBI AZ-EL telescopes are situated. This report contains the AC's VLBI data analysis activities and shortly outlines the investigations into the co-locations of space geodetic instruments.

  17. Decoupling capabilities of split-loop resonator structure for 7 Tesla MRI surface array coils

    Science.gov (United States)

    Hurshkainen, A.; Kurdjumov, S.; Simovski, C.; Glybovski, S.; Melchakova, I.; van den Berg, C. A. T.; Raaijmakers, A.; Belov, P.

    2017-09-01

    In this work we studied electromagnetic properties of one-dimentional periodic structures composed of split-loop res-onators (SLRs) and investigated their capabilities in decoupling of two dipole antennas for full-body magnetic resonance imaging (MRI). Two different finite structures comprising a single-SLR and a double-SLR constitutive elements were studied. Numerical simulations of the structures were performed to evaluate their decoupling capabilities. As it was demonstrated two dipole antennas equipped with either a single or a double-SLR structure exhibit high isolation even for an electrically short distance between the dipoles. Double-SLR structure while dramatically improving isolation of the dipoles keeps the field created by each of the decoupled dipoles comparable with one of a single dipole inside the target area.

  18. Linking sea level rise and socioeconomic indicators under the Shared Socioeconomic Pathways

    Science.gov (United States)

    Nauels, Alexander; Rogelj, Joeri; Schleussner, Carl-Friedrich; Meinshausen, Malte; Mengel, Matthias

    2017-11-01

    In order to assess future sea level rise and its societal impacts, we need to study climate change pathways combined with different scenarios of socioeconomic development. Here, we present sea level rise (SLR) projections for the Shared Socioeconomic Pathway (SSP) storylines and different year-2100 radiative forcing targets (FTs). Future SLR is estimated with a comprehensive SLR emulator that accounts for Antarctic rapid discharge from hydrofracturing and ice cliff instability. Across all baseline scenario realizations (no dedicated climate mitigation), we find 2100 median SLR relative to 1986-2005 of 89 cm (likely range: 57-130 cm) for SSP1, 105 cm (73-150 cm) for SSP2, 105 cm (75-147 cm) for SSP3, 93 cm (63-133 cm) for SSP4, and 132 cm (95-189 cm) for SSP5. The 2100 sea level responses for combined SSP-FT scenarios are dominated by the mitigation targets and yield median estimates of 52 cm (34-75 cm) for FT 2.6 Wm-2, 62 cm (40-96 cm) for FT 3.4 Wm-2, 75 cm (47-113 cm) for FT 4.5 Wm-2, and 91 cm (61-132 cm) for FT 6.0 Wm-2. Average 2081-2100 annual SLR rates are 5 mm yr-1 and 19 mm yr-1 for FT 2.6 Wm-2 and the baseline scenarios, respectively. Our model setup allows linking scenario-specific emission and socioeconomic indicators to projected SLR. We find that 2100 median SSP SLR projections could be limited to around 50 cm if 2050 cumulative CO2 emissions since pre-industrial stay below 850 GtC, with a global coal phase-out nearly completed by that time. For SSP mitigation scenarios, a 2050 carbon price of 100 US2005 tCO2 -1 would correspond to a median 2100 SLR of around 65 cm. Our results confirm that rapid and early emission reductions are essential for limiting 2100 SLR.

  19. VLBI observations of the quasars CTD20 (0234+285), OJ248 (0827+243), and 4C19.44 (1354+195), and the millimeter-x-ray connection

    International Nuclear Information System (INIS)

    Marscher, A.P.; Broderick, J.J.

    1983-01-01

    We have obtained limited VLBI data on the quasars CTD20, OJ248, and 4C19.44 at 2.8 cm. CTD20 was also observed at 6 and 18 cm. All three sources contain multicomponent structure, and rather large fractions of the 2.8-cm flux densities arise in unresolved regions. All of the radio flux density of CTD20 originates in compact components. 4C19.44 is dominated at low frequencies by a steep-spectrum component which exceeds about 7 mas in size. Above 2 GHz the spectrum is flat and variable owing to several compact components. CTD20 and OJ248 belong to a sample of millimeter-excess quasars which were shown by Owen, Helfand, and Spangler to have highly predictable ratios of 90 GHz to 2-keV flux densities. A self-Compton explanation of this relationship is supported by the existence of unresolved radio components. However, the rapid 90-GHz variability of OJ248 and other quasars with strong millimeter emission should destroy the observed tight correlation except under special circumstances. A synchrotron origin of the radio-to-x-ray emission requires that any variations in the radio should be time delayed relative to the x ray

  20. Earth rotation, station coordinates and orbit determination from satellite laser ranging

    Science.gov (United States)

    Murata, Masaaki

    The Project MERIT, a special program of international colaboration to Monitor Earth Rotation and Intercompare the Techniques of observation and analysis, has come to an end with great success. Its major objective was to evaluate the ultimate potential of space techniques such as VLBI and satellite laser ranging, in contrast with the other conventional techniques, in the determination of rotational dynamics of the earth. The National Aerospace Laboratory (NAL) has officially participated in the project as an associate analysis center for satellite laser technique for the period of the MERIT Main Campaign (September 1983-October 1984). In this paper, the NAL analysis center results are presented.

  1. Using satellite laser ranging to measure ice mass change in Greenland and Antarctica

    Directory of Open Access Journals (Sweden)

    J. A. Bonin

    2018-01-01

    Full Text Available A least squares inversion of satellite laser ranging (SLR data over Greenland and Antarctica could extend gravimetry-based estimates of mass loss back to the early 1990s and fill any future gap between the current Gravity Recovery and Climate Experiment (GRACE and the future GRACE Follow-On mission. The results of a simulation suggest that, while separating the mass change between Greenland and Antarctica is not possible at the limited spatial resolution of the SLR data, estimating the total combined mass change of the two areas is feasible. When the method is applied to real SLR and GRACE gravity series, we find significantly different estimates of inverted mass loss. There are large, unpredictable, interannual differences between the two inverted data types, making us conclude that the current 5×5 spherical harmonic SLR series cannot be used to stand in for GRACE. However, a comparison with the longer IMBIE time series suggests that on a 20-year time frame, the inverted SLR series' interannual excursions may average out, and the long-term mass loss estimate may be reasonable.

  2. Using satellite laser ranging to measure ice mass change in Greenland and Antarctica

    Science.gov (United States)

    Bonin, Jennifer A.; Chambers, Don P.; Cheng, Minkang

    2018-01-01

    A least squares inversion of satellite laser ranging (SLR) data over Greenland and Antarctica could extend gravimetry-based estimates of mass loss back to the early 1990s and fill any future gap between the current Gravity Recovery and Climate Experiment (GRACE) and the future GRACE Follow-On mission. The results of a simulation suggest that, while separating the mass change between Greenland and Antarctica is not possible at the limited spatial resolution of the SLR data, estimating the total combined mass change of the two areas is feasible. When the method is applied to real SLR and GRACE gravity series, we find significantly different estimates of inverted mass loss. There are large, unpredictable, interannual differences between the two inverted data types, making us conclude that the current 5×5 spherical harmonic SLR series cannot be used to stand in for GRACE. However, a comparison with the longer IMBIE time series suggests that on a 20-year time frame, the inverted SLR series' interannual excursions may average out, and the long-term mass loss estimate may be reasonable.

  3. Impact of quasar proper motions on the alignment between the International Celestial Reference Frame and the Gaia reference frame

    Science.gov (United States)

    Liu, J.-C.; Malkin, Z.; Zhu, Z.

    2018-03-01

    The International Celestial Reference Frame (ICRF) is currently realized by the very long baseline interferometry (VLBI) observations of extragalactic sources with the zero proper motion assumption, while Gaia will observe proper motions of these distant and faint objects to an accuracy of tens of microarcseconds per year. This paper investigates the difference between VLBI and Gaia quasar proper motions and it aims to understand the impact of quasar proper motions on the alignment of the ICRF and Gaia reference frame. We use the latest time series data of source coordinates from the International VLBI Service analysis centres operated at Goddard Space Flight Center (GSF2017) and Paris observatory (OPA2017), as well as the Gaia auxiliary quasar solution containing 2191 high-probability optical counterparts of the ICRF2 sources. The linear proper motions in right ascension and declination of VLBI sources are derived by least-squares fits while the proper motions for Gaia sources are simulated taking into account the acceleration of the Solar system barycentre and realistic uncertainties depending on the source brightness. The individual and global features of source proper motions in GSF2017 and OPA2017 VLBI data are found to be inconsistent, which may result from differences in VLBI observations, data reduction and analysis. A comparison of the VLBI and Gaia proper motions shows that the accuracies of the components of rotation and glide between the two systems are 2-4 μas yr- 1 based on about 600 common sources. For the future alignment of the ICRF and Gaia reference frames at different wavelengths, the proper motions of quasars must necessarily be considered.

  4. Will the Effects of Sea-Level Rise Create Ecological Traps for Pacific Island Seabirds?

    Directory of Open Access Journals (Sweden)

    Michelle H Reynolds

    Full Text Available More than 18 million seabirds nest on 58 Pacific islands protected within vast U.S. Marine National Monuments (1.9 million km2. However, most of these seabird colonies are on low-elevation islands and sea-level rise (SLR and accompanying high-water perturbations are predicted to escalate with climate change. To understand how SLR may impact protected islands and insular biodiversity, we modeled inundation and wave-driven flooding of a globally important seabird rookery in the subtropical Pacific. We acquired new high-resolution Digital Elevation Models (DEMs and used the Delft3D wave model and ArcGIS to model wave heights and inundation for a range of SLR scenarios (+0.5, +1.0, +1.5, and +2.0 m at Midway Atoll. Next, we classified vegetation to delineate habitat exposure to inundation and identified how breeding phenology, colony synchrony, and life history traits affect species-specific sensitivity. We identified 3 of 13 species as highly vulnerable to SLR in the Hawaiian Islands and quantified their atoll-wide distribution (Laysan albatross, Phoebastria immutabilis; black-footed albatross, P. nigripes; and Bonin petrel, Pterodroma hypoleuca. Our models of wave-driven flooding forecast nest losses up to 10% greater than passive inundation models at +1.0 m SLR. At projections of + 2.0 m SLR, approximately 60% of albatross and 44% of Bonin petrel nests were overwashed displacing more than 616,400 breeding albatrosses and petrels. Habitat loss due to passive SLR may decrease the carrying capacity of some islands to support seabird colonies, while sudden high-water events directly reduce survival and reproduction. This is the first study to simulate wave-driven flooding and the combined impacts of SLR, groundwater rise, and storm waves on seabird colonies. Our results highlight the need for early climate change planning and restoration of higher elevation seabird refugia to prevent low-lying protected islands from becoming ecological traps in the

  5. Multi-geodetic characterization of the seasonal signal at the CERGA geodetic reference, France

    Science.gov (United States)

    Memin, A.; Viswanathan, V.; Fienga, A.; Santamaría-Gómez, A.; Boy, J. P.

    2016-12-01

    Crustal deformations due to surface-mass loading account for a significant part of the variability in geodetic time series. A perfect understanding of the loading signal observed by geodetic techniques should help in improving terrestrial reference frame (TRF) realizations. Yet, discrepancies between crustal motion estimates from models of surface-mass loading and observations are still too large so that no model is currently recommended by the IERS for reducing the data. We investigate the discrepancy observed in the seasonal variations of the CERGA station, South of France.We characterize the seasonal motions of the reference geodetic station CERGA from GNSS, SLR and LLR. We compare the station motion observed with GNSS and SLR and we estimate changes in the station-to-the-moon distance using an improved processing strategy. We investigate the consistency between these geodetic techniques and compare the observed station motion with that estimated using models of surface-mass change. In that regard, we compute atmospheric loading effects using surface pressure fields from ECMWF, assuming an ocean response according to the classical inverted barometer (IB) assumption, considered to be valid for periods typically exceeding a week. We also used general circulation ocean models (ECCO and GLORYS) forced by wind, heat and fresh water fluxes. The continental water storage is described using GLDAS/Noah and MERRA-land models.Using the surface-mass models, we estimate the amplitude of the seasonal vertical motion of the CERGA station ranging between 5 and 10 mm with a maximum reached in August, mostly due to hydrology. The horizontal seasonal motion of the station may reach up to 3 mm. Such a station motion should induce a change in the distance to the moon reaching up to 10 mm, large enough to be detected in LLR time series and compared to GNSS- and SLR-derived motion.

  6. Protocol adaptations to conduct Systematic Literature Reviews in Software Engineering: a chronological study

    Directory of Open Access Journals (Sweden)

    Samuel Sepúlveda

    2015-09-01

    Full Text Available Systematic literature reviews (SLR have reached a considerable level of adoption in Software Engineering (SE, how-ever protocol adaptations for its implementation remain tangentially addressed. This work provides a chronological framework for the use and adaptation of the SLR protocol, including its current status. A systematic literature search was performed, reviewing a set of twelve articles being selected in accordance with the inclusion and exclusion criteria between 2004 and 2013, using digital data sources recognized by the SE community. A chronological framework is provided that includes the current state of the protocol adaptations to conduct SLR in SE. The results indicate areas where the quantity and quality of investigations needs to be increased and the identi- fication of the main proposals providing adaptations for the protocol conducting SLR in SE.

  7. The ILRS Reanalysis 1983 - 2009 Contributed To ITRF2008

    Science.gov (United States)

    Pavlis, E. C.; Luceri, V.; Sciarretta, C.; Kelm, R.

    2009-12-01

    For over two decades, Satellite Laser Ranging (SLR) data contribute to the definition of the Terrestrial Reference Frame (TRF). Until the development of ITRF2000, the contributions were submitted in the form of a set of normal equations or a covariance matrix of station coordinates and their linear rates at a standard epoch. The development of ITRF2005 ushered a new era with the use of weekly or session contributions, allowing greater flexibility in the relative weighting and the combination of information from various techniques. Moreover, the need of a unique, official, representative solution for each Technique Service, based on the rigorous combination of the various Analysis Centers’ contributions, gave the opportunity to all techniques to verify, as a first step, the intra-technique solution consistency and, immediately after, to engage in discussions and comparison of the internal procedures, leading to a harmonization and validation of these procedures and the adopted models in the inter-technique context. In many occasions, the time series approach joint with the intra- and inter-technique comparison steps also highlighted differences that previously went unnoticed, and corrected incompatibilities. During the past year we have been preparing the ILRS contribution to a second TRF developed in the same way, the ITRF2008. The ILRS approach is based strictly on the current IERS Conventions 2003 and our internal standards. The Unified Analysis Workshop in 2007 stressed a number of areas where each technique needed to focus more attention in future analyses. In the case of SLR, the primary areas of concern were tracking station biases, extending the data span used in the analysis, and target characteristics. The present re-analysis extends from 1983 to 2009, covering a 25-year period, the longest for any of the contributing techniques; although the network and data quality for the 1983-1993 period are significantly poorer than for the latter years, the overall

  8. The ILRS contribution to ITRF2008

    Science.gov (United States)

    Pavlis, E. C.; Luceri, V.; Sciarretta, C.; Kelm, R.

    2009-04-01

    Since over two decades, Satellite Laser Ranging (SLR) data contribute to the definition of the Terrestrial Reference Frame (TRF). Until the development of ITRF2000, the contributions were submitted in the form of a set of normal equations or a covariance matrix of station coordinates and their linear rates at a standard epoch. The development of ITRF2005 ushered a new era with the use of weekly or session contributions, allowing greater flexibility in the relative weighting and the combination of information from various techniques. Moreover, the need of a unique, official, representative solution for each Technique Service, based on the rigorous combination of the various Analysis Centers' contributions, gave the opportunity to all techniques to verify, as a first step, the intra-technique solution consistency and, immediately after, to engage in discussions and comparison of the internal procedures, leading to a harmonization and validation of these procedures and the adopted models in the inter-technique context. In many occasions, the time series approach joint with the intra- and inter-technique comparison steps also highlighted differences that previously went unnoticed, and corrected incompatibilities. During the past year we have been preparing the ILRS contribution to a second TRF developed in the same way, the ITRF2008. The ILRS approach is based strictly on the current IERS Conventions 2003 and our internal standards. The Unified Analysis Workshop in 2007 stressed a number of areas where each technique needed to focus more attention in future analyses. In the case of SLR, the primary areas of concern were tracking station biases, extending the data span used in the analysis, and target characteristics. The present re-analysis extends from 1983 to 2008, covering a 25-year period, the longest for any of the contributing techniques; although the network and data quality for the 1983-1993 period are significantly poorer than for the latter years, the overall

  9. The Global Geodetic Observing System: Space Geodesy Networks for the Future

    Science.gov (United States)

    Pearlman, Michael; Pavlis, Erricos; Ma, Chopo; Altamini, Zuheir; Noll, Carey; Stowers, David

    2011-01-01

    Ground-based networks of co-located space geodetic techniques (VLBI, SLR, GNSS. and DORIS) are the basis for the development and maintenance of the International Terrestrial Reference frame (ITRF), which is our metric of reference for measurements of global change, The Global Geodetic Observing System (GGOS) of the International Association of Geodesy (IAG) has established a task to develop a strategy to design, integrate and maintain the fundamental geodetic network and supporting infrastructure in a sustainable way to satisfy the long-term requirements for the reference frame. The GGOS goal is an origin definition at 1 mm or better and a temporal stability on the order of 0.1 mm/y, with similar numbers for the scale and orientation components. These goals are based on scientific requirements to address sea level rise with confidence, but other applications are not far behind. Recent studies including one by the US National Research Council has strongly stated the need and the urgency for the fundamental space geodesy network. Simulations are underway to examining accuracies for origin, scale and orientation of the resulting ITRF based on various network designs and system performance to determine the optimal global network to achieve this goal. To date these simulations indicate that 24 - 32 co-located stations are adequate to define the reference frame and a more dense GNSS and DORIS network will be required to distribute the reference frame to users anywhere on Earth. Stations in the new global network will require geologically stable sites with good weather, established infrastructure, and local support and personnel. GGOS wil seek groups that are interested in participation. GGOS intends to issues a Call for Participation of groups that would like to contribute in the network implementation and operation. Some examples of integrated stations currently in operation or under development will be presented. We will examine necessary conditions and challenges in

  10. Towards combined global monthly gravity field solutions

    Science.gov (United States)

    Jaeggi, Adrian; Meyer, Ulrich; Beutler, Gerhard; Weigelt, Matthias; van Dam, Tonie; Mayer-Gürr, Torsten; Flury, Jakob; Flechtner, Frank; Dahle, Christoph; Lemoine, Jean-Michel; Bruinsma, Sean

    2014-05-01

    Currently, official GRACE Science Data System (SDS) monthly gravity field solutions are generated independently by the Centre for Space Research (CSR) and the German Research Centre for Geosciences (GFZ). Additional GRACE SDS monthly fields are provided by the Jet Propulsion Laboratory (JPL) for validation and outside the SDS by a number of other institutions worldwide. Although the adopted background models and processing standards have been harmonized more and more by the various processing centers during the past years, notable differences still exist and the users are more or less left alone with a decision which model to choose for their individual applications. This procedure seriously limits the accessibility of these valuable data. Combinations are well established in the area of other space geodetic techniques, such as the Global Navigation Satellite Systems (GNSS), Satellite Laser Ranging (SLR), and Very Long Baseline Interferometry (VLBI). Regularly comparing and combining space-geodetic products has tremendously increased the usefulness of the products in a wide range of disciplines and scientific applications. Therefore, we propose in a first step to mutually compare the large variety of available monthly GRACE gravity field solutions, e.g., by assessing the signal content over selected regions, by estimating the noise over the oceans, and by performing significance tests. We make the attempt to assign different solution characteristics to different processing strategies in order to identify subsets of solutions, which are based on similar processing strategies. Using these subsets we will in a second step explore ways to generate combined solutions, e.g., based on a weighted average of the individual solutions using empirical weights derived from pair-wise comparisons. We will also assess the quality of such a combined solution and discuss the potential benefits for the GRACE and GRACE-FO user community, but also address minimum processing

  11. From Wagons to Race Cars, At Least Now We Have A Chassis

    Science.gov (United States)

    Morrow, A. L.

    2003-12-01

    For the past 30 years Very-Long-Baseline Interferometry (VLBI) has provided astronomers with the most accurate measurements to date of both distant radio sources as well as the tectonic plates. The resolutions attainable through VLBI are orders of magnitude better than other instruments. In order to transmit radio signals collected at different sites to a correlator for processing the VLBI data was stored on magnetic tapes, and then the magnetic tapes were shipped through the mail to the central processing site. This was not only arduous and inefficient, it was also costly. Now this means of shipment can be replaced by global high speed networks. This means of transmission is called e-VLBI. New protocols must be developed so e-VLBI can become a proficient high bandwidth background user. The protocol agreed upon uses a Real-time Transport Protocol (RTP) framework to preserve timing information and synchronization. The RTP is then transported using the Internet User Datagram Protocol (UDP) with RTP Control Protocol (RTCP) monitoring the networks performance. When this protocol is fully functional astronomers will be able to observe all over the world and receive results in real time.

  12. Multi-GNSS orbit determination using satellite laser ranging

    Science.gov (United States)

    Bury, Grzegorz; Sośnica, Krzysztof; Zajdel, Radosław

    2018-04-01

    Galileo, BeiDou, QZSS, and NavIC are emerging global navigation satellite systems (GNSSs) and regional navigation satellite systems all of which are equipped with laser retroreflector arrays for range measurements. This paper summarizes the GNSS-intensive tracking campaigns conducted by the International Laser Ranging Service and provides results from multi-GNSS orbit determination using solely SLR observations. We consider the whole constellation of GLONASS, all active Galileo, four BeiDou satellites: 1 MEO, 3 IGSO, and one QZSS. We analyze the influence of the number of SLR observations on the quality of the 3-day multi-GNSS orbit solution. About 60 SLR observations are needed for obtaining MEO orbits of sufficient quality with the root mean square (RMS) of 3 cm for the radial component when compared to microwave-based orbits. From the analysis of a minimum number of tracking stations, when considering the 3-day arcs, 5 SLR stations do not provide a sufficient geometry of observations. The solution obtained using ten stations is characterized with RMS of 4, 9, and 18 cm in the radial, along-track, and cross-track direction, respectively, for MEO satellites. We also investigate the impact of the length of orbital arc on the quality of SLR-derived orbits. Hence, 5- and 7-day arcs constitute the best solution, whereas 3-day arcs are of inferior quality due to an insufficient number of SLR observations and 9-day arcs deteriorate the along-track component. The median RMS from the comparison between 7-day orbital arcs determined using SLR data with microwave-based orbits assumes values in the range of 3-4, 11-16, and 15-27 cm in radial, along-track, and cross-track, respectively, for MEO satellites. BeiDou IGSO and QZSS are characterized by RMS values higher by a factor of 8 and 24, respectively, than MEO orbits.

  13. Effects of fatty acid activation on photosynthetic production of fatty acid-based biofuels in Synechocystis sp. PCC6803

    Directory of Open Access Journals (Sweden)

    Gao Qianqian

    2012-03-01

    Full Text Available Abstract Background Direct conversion of solar energy and carbon dioxide to drop in fuel molecules in a single biological system can be achieved from fatty acid-based biofuels such as fatty alcohols and alkanes. These molecules have similar properties to fossil fuels but can be produced by photosynthetic cyanobacteria. Results Synechocystis sp. PCC6803 mutant strains containing either overexpression or deletion of the slr1609 gene, which encodes an acyl-ACP synthetase (AAS, have been constructed. The complete segregation and deletion in all mutant strains was confirmed by PCR analysis. Blocking fatty acid activation by deleting slr1609 gene in wild-type Synechocystis sp. PCC6803 led to a doubling of the amount of free fatty acids and a decrease of alkane production by up to 90 percent. Overexpression of slr1609 gene in the wild-type Synechocystis sp. PCC6803 had no effect on the production of either free fatty acids or alkanes. Overexpression or deletion of slr1609 gene in the Synechocystis sp. PCC6803 mutant strain with the capability of making fatty alcohols by genetically introducing fatty acyl-CoA reductase respectively enhanced or reduced fatty alcohol production by 60 percent. Conclusions Fatty acid activation functionalized by the slr1609 gene is metabolically crucial for biosynthesis of fatty acid derivatives in Synechocystis sp. PCC6803. It is necessary but not sufficient for efficient production of alkanes. Fatty alcohol production can be significantly improved by the overexpression of slr1609 gene.

  14. Future Reef Growth Can Mitigate Physical Impacts of Sea-Level Rise on Atoll Islands

    Science.gov (United States)

    Beetham, Edward; Kench, Paul S.; Popinet, Stéphane

    2017-10-01

    We present new detail on how future sea-level rise (SLR) will modify nonlinear wave transformation processes, shoreline wave energy, and wave driven flooding on atoll islands. Frequent and destructive wave inundation is a primary climate-change hazard that may render atoll islands uninhabitable in the near future. However, limited research has examined the physical vulnerability of atoll islands to future SLR and sparse information are available to implement process-based coastal management on coral reef environments. We utilize a field-verified numerical model capable of resolving all nonlinear wave transformation processes to simulate how future SLR will modify wave dissipation and overtopping on Funafuti Atoll, Tuvalu, accounting for static and accretionary reef adjustment morphologies. Results show that future SLR coupled with a static reef morphology will not only increase shoreline wave energy and overtopping but will fundamentally alter the spectral composition of shoreline energy by decreasing the contemporary influence of low-frequency infragravity waves. "Business-as-usual" emissions (RCP 8.5) will result in annual wave overtopping on Funafuti Atoll by 2030, with overtopping at high tide under mean wave conditions occurring from 2090. Comparatively, vertical reef accretion in response to SLR will prevent any significant increase in shoreline wave energy and mitigate wave driven flooding volume by 72%. Our results provide the first quantitative assessment of how effective future reef accretion can be at mitigating SLR-associated flooding on atoll islands and endorse active reef conservation and restoration for future coastal protection.

  15. U.S. Pacific coastal wetland resilience and vulnerability to sea-level rise

    Science.gov (United States)

    Thorne, Karen M.; MacDonald, Glen M.; Guntenspergen, Glenn R.; Ambrose, Richard F.; Buffington, Kevin J.; Dugger, Bruce D.; Freeman, Chase; Janousek, Christopher; Brown, Lauren N.; Rosencranz, Jordan A.; Homquist, James; Smol, John P.; Hargan, Kathryn; Takekawa, John Y.

    2018-01-01

    We used a first-of-its-kind comprehensive scenario approach to evaluate both the vertical and horizontal response of tidal wetlands to projected changes in the rate of sea-level rise (SLR) across 14 estuaries along the Pacific coast of the continental United States. Throughout the U.S. Pacific region, we found that tidal wetlands are highly vulnerable to end-of-century submergence, with resulting extensive loss of habitat. Using higher-range SLR scenarios, all high and middle marsh habitats were lost, with 83% of current tidal wetlands transitioning to unvegetated habitats by 2110. The wetland area lost was greater in California and Oregon (100%) but still severe in Washington, with 68% submerged by the end of the century. The only wetland habitat remaining at the end of the century was low marsh under higher-range SLR rates. Tidal wetland loss was also likely under more conservative SLR scenarios, including loss of 95% of high marsh and 60% of middle marsh habitats by the end of the century. Horizontal migration of most wetlands was constrained by coastal development or steep topography, with just two wetland sites having sufficient upland space for migration and the possibility for nearly 1:1 replacement, making SLR threats particularly high in this region and generally undocumented. With low vertical accretion rates and little upland migration space, Pacific coast tidal wetlands are at imminent risk of submergence with projected rates of rapid SLR.

  16. MBE System for Antimonide Based Semiconductor Lasers

    National Research Council Canada - National Science Library

    Lester, Luke

    1999-01-01

    .... SLR-770 inductively coupled plasma (ICP) processing system. The SLR-770 has been invaluable in the study of plasma etching of AlGaAsSb and GaSb-materials that form the backbone of antimonide-based semiconductor lasers...

  17. Estimating the Potential Risks of Sea Level Rise for Public and Private Property Ownership, Occupation and Management

    Directory of Open Access Journals (Sweden)

    Georgia Warren-Myers

    2018-04-01

    Full Text Available The estimation of future sea level rise (SLR is a major concern for cities near coastlines and river systems. Despite this, current modelling underestimates the future risks of SLR to property. Direct risks posed to property include inundation, loss of physical property and associated economic and social costs. It is also crucial to consider the risks that emerge from scenarios after SLR. These may produce one-off or periodic events that will inflict physical, economic and social implications, and direct, indirect and consequential losses. Using a case study approach, this paper combines various forms of data to examine the implications of future SLR to further understand the potential risks. The research indicates that the financial implications for local government will be loss of rates associated with total property loss and declines in value. The challenges identified are not specific to this research. Other municipalities worldwide experience similar barriers (i.e., financial implications, coastal planning predicaments, data paucity, knowledge and capacity, and legal and political challenges. This research highlights the need for private and public stakeholders to co-develop and implement strategies to mitigate and adapt property to withstand the future challenges of climate change and SLR.

  18. Acclimatization to 4100 m does not change capillary density or mRNA expression of potential angiogenesis regulatory factors in human skeletal muscle

    DEFF Research Database (Denmark)

    Lundby, Carsten; Pilegaard, Henriette; Andersen, Jesper L.

    2004-01-01

    growth factor (VEGF), a known target gene for hypoxia inducible factor 1 (HIF-1). We hypothesised that prolonged exposure to high altitude increases muscle capillary density and that this can be explained by an enhanced HIF-1alpha expression inducing an increase in VEGF expression. We measured mRNA...... or VEGF mRNA was not changed with prolonged hypoxic exposure in SLR, and both genes were similarly expressed in SLR and HAN. In SLR, whole body mass, mean muscle fibre area and capillary to muscle fibre ratio remained unchanged during acclimatization. The capillary to fibre ratio was lower in HAN than...... in SLR (2.4+/-0.1 vs 3.6+/-0.2; PRNA expression and capillary density are not significantly increased by 8 weeks of exposure to high altitude and are not increased in Aymara high-altitude natives compared with sea level residents....

  19. Integrated Assessment of Coastal Areas

    Science.gov (United States)

    Nicholls, R. J.

    2016-12-01

    Coastal areas are experiencing change due to a range of natural and human-induced drivers. Of particular concern is climate change, particularly sea-level rise (SLR). In low gradient coastal areas, small changes in water levels can have profound consequences. Hence SLR is rightly considered a major threat. However, to properly diagnose a problem and find sustainable solutions, a systems approach is essential as the impacts of SLR will be modified by the other drivers. This paper will consider these issues from a multi-disciplinary perspective drawing on examples from around the world.

  20. The Green Book: Planning and design guidelines for adapting South African settlement to climate change

    CSIR Research Space (South Africa)

    Van Niekerk, Willemien

    2016-09-01

    Full Text Available climate Impact of CC on water resources Step 5: Develop risk profiles for different settlement types Se tt le m e n t ty p o lo gy Hazard footprint Risk profile Sea- level rise Flooding Heat waves Drought Landslide Fire Coastal settlements... Cities Richard’s Bay x x x Coastal area at risk of SLR, flooding and landslides Nelson Mandela Bay x x Coastal area at risk of SLR and flooding Regional centres George x x x x Coastal area at risk of SLR, flooding and landslides...

  1. COREDAR: COmmunicating Risk of sea level rise and Engaging stakeholDers in framing community based Adaptation stRategies

    Science.gov (United States)

    Amsad Ibrahim Khan, S. K.; Chen, R. S.; de Sherbinin, A. M.; Andimuthu, R.; Kandasamy, P.

    2015-12-01

    Accelerated sea-level rise (SLR) is a major long term outcome of climate change leading to increased inundation of low-lying areas. Particularly, global cities that are located on or near the coasts are often situated in low lying areas and these locations put global cities at greater risk to SLR. Localized flooding will profoundly impact vulnerable communities located in high-risk urban areas. Building community resilience and adapting to SLR is increasingly a high priority for cities. On the other hand, Article 6 of the United Nations Framework Convention on Climate Change addresses the importance of climate change communication and engaging stakeholders in decision making process. Importantly, Community Based Adaptation (CBA) experiences emphasize that it is important to understand a community's unique perceptions of their adaptive capacities to identify useful solutions and that scientific and technical information on anticipated coastal climate impacts needs to be translated into a suitable language and format that allows people to be able to participate in adaptation planning. To address this challenge, this study has put forth three research questions from the lens of urban community engagement in SLR adaptation, (1) What, if any, community engagement in addressing SLR occurring in urban areas; (2) What information do communities need and how does it need to be communicated, in order to be better prepared and have a greater sense of agency? and (3) How can government agencies from city to federal levels facilitate community engagement and action?. To answer these questions this study has evolved a framework "COREDAR" (COmmunicating Risk of sea level rise and Engaging stakeholDers in framing community based Adaptation StRategies) to communicate and transfer complex climate data and information such as projected SLR under different scenarios of IPCC AR5, predicted impact of SLR, prioritizing vulnerability, etc. to concerned stakeholders and local communities

  2. Mercury bioaccumulation assessment for the St. Louis River Area of Concern

    Science.gov (United States)

    Both Minnesota and Wisconsin have posted fish consumption advisories within the St. Louis River Area of Concern (SLR AOC), in part because fish have elevated mercury concentrations. To assess mercury concentrations in fish tissue within the SLR AOC relative to reference condition...

  3. Efficacy of glucocorticoids, conventional and targeted synthetic disease-modifying antirheumatic drugs: a systematic literature review informing the 2016 update of the EULAR recommendations for the management of rheumatoid arthritis

    NARCIS (Netherlands)

    Chatzidionysiou, Katerina; Emamikia, Sharzad; Nam, Jackie; Ramiro, Sofia; Smolen, Josef; van der Heijde, Désirée; Dougados, Maxime; Bijlsma, Johannes; Burmester, Gerd; Scholte, Marieke; van Vollenhoven, Ronald; Landewé, Robert

    2017-01-01

    To perform a systematic literature review (SLR) informing the 2016 update of the recommendations for the management of rheumatoid arthritis (RA). An SLR for the period between 2013 and 2016 was undertaken to assess the efficacy of glucocorticoids (GCs), conventional synthetic disease-modifying

  4. Accumulation of Carbonates Contributes to Coastal Vegetated Ecosystems Keeping Pace With Sea Level Rise in an Arid Region (Arabian Peninsula)

    KAUST Repository

    Saderne, Vincent; Cusack, Michael; Almahasheer, Hanan; Serrano, Oscar; Masqué , Pere; Arias-Ortiz, Ariane; Krishnakumar, Periyadan Kadinjappalli; Rabaoui, Lotfi; Qurban, Mohammad Ali; Duarte, Carlos M.

    2018-01-01

    Anthropogenic sea level rise (SLR) presents one of the greatest risks to human lives and infrastructures. Coastal vegetated ecosystems, that is, tidal marshes, seagrass meadows, and mangrove forests, elevate the seabed through soil accretion, providing a natural coastline protection against SLR. The soil accretion of these ecosystems has never been assessed in hot desert climate regions, where water runoff is negligible. However, tropical marine ecosystems are areas of intense calcification that may constitute an important source of sediment supporting seabed elevation, compensating for the lack of terrestrial inputs. We estimated the long-term (C-centennial) and short-term (Pb-20th century) soil accretion rates (SARs) and inorganic carbon (C) burial in coastal vegetated ecosystems of the Saudi coasts of the central Red Sea and the Arabian Gulf. Short-term SARs (±SE) in mangroves of the Red Sea (0.27 ± 0.22 cm/year) were twofold the SLR for that region since 1925 (0.13 cm/year). In the Arabian Gulf, only mangrove forest SAR is equivalent to local SLR estimates for the period 1979-2007 (0.21 ± 0.09 compared to 0.22 ± 0.05 cm/year, respectively). Long-term SARs are comparable or higher than the global estimates of SLR for the late Holocene (0.01 cm/year). In all habitats of the Red Sea and Arabian Gulf, SARs are supported by high carbonate accretion rates, comprising 40% to 60% of the soil volume. Further studies on the role of carbonates in coastal vegetated ecosystems are required to understand their role in adaptation to SLR.

  5. Impacts of representing sea-level rise uncertainty on future flood risks: An example from San Francisco Bay.

    Science.gov (United States)

    Ruckert, Kelsey L; Oddo, Perry C; Keller, Klaus

    2017-01-01

    Rising sea levels increase the probability of future coastal flooding. Many decision-makers use risk analyses to inform the design of sea-level rise (SLR) adaptation strategies. These analyses are often silent on potentially relevant uncertainties. For example, some previous risk analyses use the expected, best, or large quantile (i.e., 90%) estimate of future SLR. Here, we use a case study to quantify and illustrate how neglecting SLR uncertainties can bias risk projections. Specifically, we focus on the future 100-yr (1% annual exceedance probability) coastal flood height (storm surge including SLR) in the year 2100 in the San Francisco Bay area. We find that accounting for uncertainty in future SLR increases the return level (the height associated with a probability of occurrence) by half a meter from roughly 2.2 to 2.7 m, compared to using the mean sea-level projection. Accounting for this uncertainty also changes the shape of the relationship between the return period (the inverse probability that an event of interest will occur) and the return level. For instance, incorporating uncertainties shortens the return period associated with the 2.2 m return level from a 100-yr to roughly a 7-yr return period (∼15% probability). Additionally, accounting for this uncertainty doubles the area at risk of flooding (the area to be flooded under a certain height; e.g., the 100-yr flood height) in San Francisco. These results indicate that the method of accounting for future SLR can have considerable impacts on the design of flood risk management strategies.

  6. 210Pb sediment dating in coastal transition zones: tropical saltmarshes.

    Science.gov (United States)

    Ruiz-Fernandez, A. C.; Sanchez-Cabeza, J. A.; Carnero-Bravo, V.; Perez-Bernal, L. H.

    2016-12-01

    Sea level rise (SLR) is one of the climate change effects expected to have the largest impact on coastal environments. SLR rates are not uniform around the planet and, therefore, local and regional data and trends are needed for proper adaptation plans. As long term monitoring stations of SLR are very scarce in most of the world, SLR trends obtained from 210Pb-dated sediment cores from tropical saltmarshes have become a practical alternative to obtain SLR trends within the past century, under the assumption that these ecosystems accrete at a similar rate to SLR. However, tropical saltmarshes are challenging environments for 210Pb dating: they are regularly dry, intermittently covered by seawater only during the highest tides, and sedimentary records often reflect the transition between terrestrial and marine environments (e.g. changes in grain size distribution, organic matter content and elemental composition) with all these factors contributing for atypical 210Pb depth profiles. In addition, 137Cs, the chronostratigraphic marker most commonly used to corroborate 210Pb dating, fails to be preserved in the sedimentary record in tropical areas, owing to its solubility in marine waters, if at all detectable. The present study describes the challenges and proposed solutions for 210Pb dating saltmarsh sediment cores from two saltmarsh areas (southern Gulf of California and Yucatan Peninsula) including the use of plutonium isotopes for corroboration purposes. Acknowledgements: projects CONACYT CB2010/153492 and PDCPN201301/214349; UNAM PAPIIT-IN203313 and the PRODEP network "Aquatic contamination: levels and effects" (year 3).

  7. Impacts of representing sea-level rise uncertainty on future flood risks: An example from San Francisco Bay.

    Directory of Open Access Journals (Sweden)

    Kelsey L Ruckert

    Full Text Available Rising sea levels increase the probability of future coastal flooding. Many decision-makers use risk analyses to inform the design of sea-level rise (SLR adaptation strategies. These analyses are often silent on potentially relevant uncertainties. For example, some previous risk analyses use the expected, best, or large quantile (i.e., 90% estimate of future SLR. Here, we use a case study to quantify and illustrate how neglecting SLR uncertainties can bias risk projections. Specifically, we focus on the future 100-yr (1% annual exceedance probability coastal flood height (storm surge including SLR in the year 2100 in the San Francisco Bay area. We find that accounting for uncertainty in future SLR increases the return level (the height associated with a probability of occurrence by half a meter from roughly 2.2 to 2.7 m, compared to using the mean sea-level projection. Accounting for this uncertainty also changes the shape of the relationship between the return period (the inverse probability that an event of interest will occur and the return level. For instance, incorporating uncertainties shortens the return period associated with the 2.2 m return level from a 100-yr to roughly a 7-yr return period (∼15% probability. Additionally, accounting for this uncertainty doubles the area at risk of flooding (the area to be flooded under a certain height; e.g., the 100-yr flood height in San Francisco. These results indicate that the method of accounting for future SLR can have considerable impacts on the design of flood risk management strategies.

  8. Accumulation of Carbonates Contributes to Coastal Vegetated Ecosystems Keeping Pace With Sea Level Rise in an Arid Region (Arabian Peninsula)

    KAUST Repository

    Saderne, Vincent

    2018-04-12

    Anthropogenic sea level rise (SLR) presents one of the greatest risks to human lives and infrastructures. Coastal vegetated ecosystems, that is, tidal marshes, seagrass meadows, and mangrove forests, elevate the seabed through soil accretion, providing a natural coastline protection against SLR. The soil accretion of these ecosystems has never been assessed in hot desert climate regions, where water runoff is negligible. However, tropical marine ecosystems are areas of intense calcification that may constitute an important source of sediment supporting seabed elevation, compensating for the lack of terrestrial inputs. We estimated the long-term (C-centennial) and short-term (Pb-20th century) soil accretion rates (SARs) and inorganic carbon (C) burial in coastal vegetated ecosystems of the Saudi coasts of the central Red Sea and the Arabian Gulf. Short-term SARs (±SE) in mangroves of the Red Sea (0.27 ± 0.22 cm/year) were twofold the SLR for that region since 1925 (0.13 cm/year). In the Arabian Gulf, only mangrove forest SAR is equivalent to local SLR estimates for the period 1979-2007 (0.21 ± 0.09 compared to 0.22 ± 0.05 cm/year, respectively). Long-term SARs are comparable or higher than the global estimates of SLR for the late Holocene (0.01 cm/year). In all habitats of the Red Sea and Arabian Gulf, SARs are supported by high carbonate accretion rates, comprising 40% to 60% of the soil volume. Further studies on the role of carbonates in coastal vegetated ecosystems are required to understand their role in adaptation to SLR.

  9. An embedded circumnuclear disk in Mrk 273

    NARCIS (Netherlands)

    Klockner, HR; Baan, WA

    Radio observations using very long baseline interferometry (VLBI) and the Westerbork interferometer have been carried out to study the hydroxyl Megamaser emission in Mrk 273 at different spatial resolutions. Line and continuum observations were carried out by the European VLBI network (EVN) at 1.6

  10. Comparison of pulsar positions from timing and very long baseline astrometry

    Science.gov (United States)

    Wang, J. B.; Coles, W. A.; Hobbs, G.; Shannon, R. M.; Manchester, R. N.; Kerr, M.; Yuan, J. P.; Wang, N.; Bailes, M.; Bhat, N. D. R.; Dai, S.; Dempsey, J.; Keith, M. J.; Lasky, P. D.; Levin, Y.; Osłowski, S.; Ravi, V.; Reardon, D. J.; Rosado, P. A.; Russell, C. J.; Spiewak, R.; van Straten, W.; Toomey, L.; Wen, L.; You, X.-P.; Zhu, X.-J.

    2017-07-01

    Pulsar positions can be measured with high precision using both pulsar timing methods and very long baseline interferometry (VLBI). Pulsar timing positions are referenced to a solar-system ephemeris, whereas VLBI positions are referenced to distant quasars. Here, we compare pulsar positions from published VLBI measurements with those obtained from pulsar timing data from the Nanshan and Parkes radio telescopes in order to relate the two reference frames. We find that the timing positions differ significantly from the VLBI positions (and also differ between different ephemerides). A statistically significant change in the obliquity of the ecliptic of 2.16 ± 0.33 mas is found for the JPL ephemeris DE405, but no significant rotation is found in subsequent JPL ephemerides. The accuracy with which we can relate the two frames is limited by the current uncertainties in the VLBI reference source positions and in matching the pulsars to their reference source. Not only do the timing positions depend on the ephemeris used in computing them, but also different segments of the timing data lead to varying position estimates. These variations are mostly common to all ephemerides, but slight changes are seen at the 10 μas level between ephemerides.

  11. An ecological model of the habitat mosaic in estuarine nursery areas: Part II – Projecting effects of sea level rise on fish production

    Science.gov (United States)

    Understanding the response of fish populations to habitat change mediated by sea level rise (SLR) is a key component of ecosystem-based management. Yet, no direct link has been established between habitat change due to SLR and fish population production. Here we take a coupled ...

  12. Sea-level rise impacts on the temporal and spatial variability of extreme water levels: A case study for St. Peter-Ording, Germany

    Science.gov (United States)

    Santamaria-Aguilar, S.; Arns, A.; Vafeidis, A. T.

    2017-04-01

    Both the temporal and spatial variability of storm surge water level (WL) curves are usually not taken into account in flood risk assessments as observational data are often scarce. In addition, sea-level rise (SLR) can further affect the variability of WLs. We analyze the temporal and spatial variability of the WL curve of 75 historical storm surge events that have been numerically simulated for St. Peter-Ording at the German North Sea coast, considering the effects induced by three SLR scenarios (RCP 4.5, RCP 8.5, and a RCP 8.5 high end scenario). We assess potential impacts of these scenarios on two parameters related to flooding: overflow volumes and fullness. Our results indicate that due to both the temporal and spatial variability of those events the resulting overflow volume can be two or even three times greater. We observe a steepening of the WL curve with an increase of the tidal range under the three SLR scenarios, although SLR induced effects are relatively higher for the RCP 4.5. The steepening of the WL curve with SLR produces a reduction of the fullness, but the changes in overflow volumes also depend on the magnitude of the storm surge event.

  13. Coastal flood implications of 1.5°C, 2°C and 2.5°C global mean temperature stabilization targets for small island nations

    Science.gov (United States)

    Rasmussen, D.; Buchanan, M. K.; Kopp, R. E.; Oppenheimer, M.

    2017-12-01

    Sea-level rise (SLR) is magnifying the frequency and severity of flooding in coastal regions. The rate and amount of global-mean SLR is a function of the trajectory of the global mean surface temperature (GMST). Therefore, temperature stabilization targets (e.g., 1.5°C or 2°C, as from the Paris Agreement) have important implications for regulating coastal flood risk. Quantifying the differences in the impact from SLR between these and other GMST stabilization targets is necessary for assessing the benefits and harms of mitigation goals. Low-lying small island nations are particularly vulnerable to inundation and coastal flooding from SLR because building protective and resilient infrastructure may not be physically or economically feasible. For small island nations, keeping GMST below a specified threshold may be the only option for maintaining habitability. Here, we assess differences in the return levels of coastal floods for small island nations between 1.5°C, 2.0°C, and 2.5°C GMST stabilization. We employ probabilistic, localized SLR projections and long-term hourly tide gauge records to construct estimates of local flood risk. We then estimate the number of small island nations' inhabitants at risk for permanent inundation under different GMST stabilization targets.

  14. Microscopic theory of ultrafast spin linear reversal

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, G P, E-mail: gpzhang@indstate.edu [Department of Physics, Indiana State University, Terre Haute, IN 47809 (United States)

    2011-05-25

    A recent experiment (Vahaplar et al 2009 Phys. Rev. Lett. 103 117201) showed that a single femtosecond laser can reverse the spin direction without spin precession, or spin linear reversal (SLR), but its microscopic theory has been missing. Here we show that SLR does not occur naturally. Two generic spin models, the Heisenberg and Hubbard models, are employed to describe magnetic insulators and metals, respectively. We find analytically that the spin change is always accompanied by a simultaneous excitation of at least two spin components. The only model that has prospects for SLR is the Stoner single-electron band model. However, under the influence of the laser field, the orbital angular momenta are excited and are coupled to each other. If a circularly polarized light is used, then all three components of the orbital angular momenta are excited, and so are their spins. The generic spin commutation relation further reveals that if SLR exists, it must involve a complicated multiple state excitation.

  15. Assessing the role of internal climate variability in Antarctica's contribution to future sea-level rise

    Science.gov (United States)

    Tsai, C. Y.; Forest, C. E.; Pollard, D.

    2017-12-01

    The Antarctic ice sheet (AIS) has the potential to be a major contributor to future sea-level rise (SLR). Current projections of SLR due to AIS mass loss remain highly uncertain. Better understanding of how ice sheets respond to future climate forcing and variability is essential for assessing the long-term risk of SLR. However, the predictability of future climate is limited by uncertainties from emission scenarios, model structural differences, and the internal variability that is inherently generated within the fully coupled climate system. Among those uncertainties, the impact of internal variability on the AIS changes has not been explicitly assessed. In this study, we quantify the effect of internal variability on the AIS evolutions by using climate fields from two large-ensemble experiments using the Community Earth System Model to force a three-dimensional ice sheet model. We find that internal variability of climate fields, particularly atmospheric fields, among ensemble members leads to significantly different AIS responses. Our results show that the internal variability can cause about 80 mm differences of AIS contribution to SLR by 2100 compared to the ensemble-mean contribution of 380-450 mm. Moreover, using ensemble-mean climate fields as the forcing in the ice sheet model does not produce realistic simulations of the ice loss. Instead, it significantly delays the onset of retreat of the West Antarctic Ice Sheet for up to 20 years and significantly underestimates the AIS contribution to SLR by 0.07-0.11 m in 2100 and up to 0.34 m in the 2250's. Therefore, because the uncertainty caused by internal variability is irreducible, we seek to highlight a critical need to assess the role of internal variability in projecting the AIS loss over the next few centuries. By quantifying the impact of internal variability on AIS contribution to SLR, policy makers can obtain more robust estimates of SLR and implement suitable adaptation strategies.

  16. A Study on the Development of Playback Control Software for Mark5B VSI System

    Directory of Open Access Journals (Sweden)

    S. J. Oh

    2010-06-01

    Full Text Available We developed the playback control software for a high-speed playback system which is a component of the Korea-Japan Joint VLBI Correlator (KJJVC. The Mark5B system, which is a recorder and playback system used in the Korean VLBI Network (KVN, has two kinds of operation mode. That is to say, the station unit (SU mode, which is for the present Mark4 system, and the VSI mode, which is for the new VLBI standard interface (VSI system. The software for SU is already developed and widely used in the Mark4 type VLBI system, but the software for VSI has only been developed for recording. The new VLBI system is designed with a VSI interface for compatibility between different systems. Therefore, the playback control software development of the VSI mode is needed for KVN. In this work, we developed the playback control software of the Mark5B VSI mode. The developed playback control software consists of an application part for data playing back, a data input/output part for the VSI board, a module for the StreamStor RAID board, and a user interface part, including an observation time control part. To verify the performance of developed playback control software, the playback and correlation experiments were performed using the real observation data in Mark5B system and KJJVC. To check the observation time control, the data playback experiment was performed between the Mark5B and Raw VLBI Data Buffer (RVDB systems. Through the experimental results, we confirmed the performance of developed playback control software in the Mark5B VSI mode.

  17. Mallinckrodt's position on SLR production

    International Nuclear Information System (INIS)

    Lee, T.L.

    1985-01-01

    The potential of the short-lived radionuclides used in nuclear medicine applications and Mallinckrodt's position are discussed. An update of Mallinckrodt's activities and future plans are also given. The keen interest of Mallinckrodt, Inc., in the application and development of short-lived radionuclides for medical use is stressed, as well as envisioned innovations

  18. Correlation between SiO v = 3 J = 1 → 0 maser excitation and the light curve of a long-period variable star

    Science.gov (United States)

    Oyadomari, Miyako; Imai, Hiroshi; Nagayama, Takumi; Oyama, Tomoaki; Matsumoto, Naoko; Nakashima, Jun-ichi; Cho, Se-Hyung

    2018-03-01

    In order to understand the excitation mechanisms of silicon monoxide (SiO) masers around long-period variables (LPVs), we have investigated distributions of the SiO v = 2 and v = 3 J = 1 → 0 masers around 12 LPVs by very long baseline interferometry (VLBI) observations with the VLBI Exploration of Radio Astrometry (VERA) and the Nobeyama 45 m telescopes. VLBI fringes of the v = 3 maser emission were detected for five LPVs. The composite maps of the v = 2 and v = 3 masers were made for T Cep, W Hya, WX Psc, and R Leo using the spectral line phase-referencing technique. The v = 2 maser spots were distributed in a ring-like form around the central stars, while it is difficult to recognize any specific morphology in the v = 3 maser distributions due to the small number of v = 3 spots detected. However in T Cep, we find that the distribution of the v = 3 maser spots correlates well with the v = 2 masers within a few milliarcseconds (0.2-0.3 au) in position and 1 km s-1 in line-of-sight velocity at the light curve phase of ϕ = 0.28 (ϕ = 0.0 and 1.0 correspond to the visible light maxima). This correlation implies that the mechanism of line-overlapping between the mid-infrared lines of H2O and SiO molecules works in T Cep at ϕ = 0.28. We discuss the possibility that the line-overlapping may work at the limited duration from the maximum to the minimum of the stellar light curve.

  19. Very Long Baseline Interferometry with the SKA

    NARCIS (Netherlands)

    Paragi, Z.; Godfrey, L.; Reynolds, C.; Rioja, M. J.; Deller, A.; Zhang, B.; Gurvits, L.; Bietenholz, M.; Szomoru, A.; Bignall, H. E.; Boven, P.; Charlot, P.; Dodson, R.; Frey, S.; Garrett, M. A.; Imai, H.; Lobanov, A.; Reid, M. J.; Ros, E.; van Langevelde, H. J.; Zensus, A. J.; Zheng, X. W.; Alberdi, A.; Agudo, I.; An, T.; Argo, M.; Beswick, R.; Biggs, A.; Brunthaler, A.; Campbell, B.; Cimo, G.; Colomer, F.; Corbel, S.; Conway, J. E.; Cseh, D.; Deane, R.; Falcke, H. D. E.; Gawronski, M.; Gaylard, M.; Giovannini, G.; Giroletti, M.; Goddi, C.; Goedhart, S.; Gómez, J. L.; Gunn, A.; Kharb, P.; Kloeckner, H. R.; Koerding, E.; Kovalev, Y.; Kunert-Bajraszewska, M.; Lindqvist, M.; Lister, M.; Mantovani, F.; Marti-Vidal, I.; Mezcua, M.; McKean, J.; Middelberg, E.; Miller-Jones, J. C. A.; Moldon, J.; Muxlow, T.; O'Brien, T.; Perez-Torres, M.; Pogrebenko, S. V.; Quick, J.; Rushton, A.; Schilizzi, R.; Smirnov, O.; Sohn, B. W.; Surcis, G.; Taylor, G. B.; Tingay, S.; Tudose, V. M.; van der Horst, A.; van Leeuwen, J.; Venturi, T.; Vermeulen, R.; Vlemmings, W. H. T.; de Witt, A.; Wucknitz, O.; Yang, J.; Gabänyi, K.; Jung, T.

    2015-01-01

    Adding VLBI capability to the SKA arrays will greatly broaden the science of the SKA, and is feasible within the current specifications. SKA-VLBI can be initially implemented by providing phased-array outputs for SKA1-MID and SKA1-SUR and using these extremely sensitive stations with other radio

  20. Comparative study of PCA in classification of multichannel EMG signals.

    Science.gov (United States)

    Geethanjali, P

    2015-06-01

    Electromyographic (EMG) signals are abundantly used in the field of rehabilitation engineering in controlling the prosthetic device and significantly essential to find fast and accurate EMG pattern recognition system, to avoid intrusive delay. The main objective of this paper is to study the influence of Principal component analysis (PCA), a transformation technique, in pattern recognition of six hand movements using four channel surface EMG signals from ten healthy subjects. For this reason, time domain (TD) statistical as well as auto regression (AR) coefficients are extracted from the four channel EMG signals. The extracted statistical features as well as AR coefficients are transformed using PCA to 25, 50 and 75 % of corresponding original feature vector space. The classification accuracy of PCA transformed and non-PCA transformed TD statistical features as well as AR coefficients are studied with simple logistic regression (SLR), decision tree (DT) with J48 algorithm, logistic model tree (LMT), k nearest neighbor (kNN) and neural network (NN) classifiers in the identification of six different movements. The Kruskal-Wallis (KW) statistical test shows that there is a significant reduction (P PCA transformed features compared to non-PCA transformed features. SLR with non-PCA transformed time domain (TD) statistical features performs better in accuracy and computational power compared to other features considered in this study. In addition, the motion control of three drives for six movements of the hand is implemented with SLR using TD statistical features in off-line with TMSLF2407 digital signal controller (DSC).

  1. Retained gas inventory comparison

    International Nuclear Information System (INIS)

    BARTON, W.B.

    1999-01-01

    Gas volume data derived from four different analytical methods were collected and analyzed for comparison to volumes originally used in the technical basis for the Basis for Interim Operations (BIO). The original volumes came from Hodgson (1996) listed in the reference section of this document. Hodgson (1996) screened all 177 single and double-shell tanks for the presence of trapped gas in waste via two analytical methods: Surface Level Rise (SLR), and Barometric Pressure Effect (BPE). More recent gas volume projections have been calculated using different analytical techniques along with updates to the parameters used as input to the SLR and BPE models. Gas volumes derived from new analytical instruments include those as measured by the Void Fraction Instrument (VFI) and Retained Gas Sampler (RGS). The results of this comparison demonstrate that the original retained gas volumes of Hodgson (1996) used as a technical basis in developing the BIO were conservative, and were conservative from a safety analysis standpoint. These results represent only comparisons to the original reported volumes using the limited set of newly acquired data that is available

  2. Structured Literature Review of digital disruption literature

    DEFF Research Database (Denmark)

    Vesti, Helle; Rosenstand, Claus Andreas Foss; Gertsen, Frank

    2018-01-01

    Digital disruption is a term/phenomenon frequently appearing in innovation management literature. However, no academic consensus exists as to what it entails; conceptual nor theoretical. We use the SLR-method (Structured Literature Review) to investigate digital disruption literature. A SLR......-study conducted in 2017 revealed some useful information on how disruption and digital disruption literature has developed over a specific period. However, this study was less representative of papers addressing digital disruption; which is the in-depth subject of this paper. To accommodate this, we intend...... to conduct a similar SLR-study assembling a body literature having digital disruption as the only common denominator...

  3. Integration of space geodesy: A US National Geodetic Observatory

    Science.gov (United States)

    Yunck, Thomas P.; Neilan, Ruth E.

    2005-11-01

    In the interest of improving the performance and efficiency of space geodesy a diverse group in the US, in collaboration with IGGOS, has begun to establish a unified National Geodetic Observatory (NGO). To launch this effort an international team will conduct a multi-year program of research into the technical issues of integrating SLR, VLBI, and GPS geodesy to produce a unified set of global geodetic products. The goal is to improve measurement accuracy by up to an order of magnitude while lowering the cost to current sponsors. A secondary goal is to expand and diversify international sponsorship of space geodesy. Principal benefits will be to open new vistas of research in geodynamics and surface change while freeing scarce NASA funds for scientific studies. NGO will proceed in partnership with, and under the auspices of, the International Association of Geodesy (IAG) as an element of the Integrated Global Geodetic Observation System project. The collaboration will be conducted within, and will make full use of, the IAG's existing international services: the IGS, IVS, ILRS, and IERS. Seed funding for organizational activities and technical analysis will come from NASA's Solid Earth and Natural Hazards Program. Additional funds to develop an integrated geodetic data system known as Inter-service Data Integration for Geodetic Operations (INDIGO), will come from a separate NASA program in Earth science information technology. INDIGO will offer ready access to the full variety of NASA's space geodetic data and will extend the GPS Seamless Archive (GSAC) philosophy to all space geodetic data types.

  4. Emissions of Water and Carbon Dioxide from Fossil-Fuel Combustion Contribute Directly to Ocean Mass and Volume Increases

    Science.gov (United States)

    Skuce, A. G.

    2014-12-01

    The direct, non-climate, contribution of carbon dioxide and water emissions from fossil-fuel (FF) combustion to the volume and mass of the oceans has been omitted from estimates of sea-level rise (SLR) in IPCC reports. Following the method of Gornitz et al. (1997), H2O emissions are estimated using carbon emissions from the Carbon Dioxide Information Analysis Center, along with typical carbon and hydrogen contents of FF. Historic H2O emissions from 1750 to 2010 amount to 430 ±50 PgH2O, equivalent to 1.2 ±0.2 mmSLR. Sometime in this decade the volume of H2O from historic FF combustion will exceed the volume of Lake Erie (480 km3). CO2 dissolved in the ocean increases the seawater volume by 31-33 mL mol-1 CO2. From 1750 to 2010, 370 ±70 PgCO2 from FF combustion has dissolved in the oceans, causing 0.7 ±0.2 mmSLR. Combined H2O+CO2emissions from FF have therefore added 1.9 ±0.4 mm to sea levels in the Industrial Era. Combustion of FF in 2010 resulted in emissions of 32 PgCO2 and 12 ±1 PgH2O. SLR contributions for that year from FF emissions were 0.033 ±0.005 mm from H2O and 0.011±0.003 mm from dissolved CO2, a total rate of 0.044 ±0.008 mm yr-1. Emissions incorporated in socio-economic models underlying the RCP 8.5 and 2.6 scenarios are used along with concentration-driven CMIP5 Earth System Models results to estimate future sea-level rise from FF combustion. From 2010 to 2100, RCP8.5 and 2.6 models respectively produce 9 ±2 mmSLR and 5 ±1 mmSLR from FF H2O+CO2. For perspective, these amounts are larger than the modelled contributions from loss of glaciers in the Andes. The direct contribution of FF emissions to SLR is small (1-2%) relative to current rates and projected estimates under RCP scenarios up to 2100. The magnitude is similar to SLR estimates from other minor sources such as the melting of floating ice, land-use emissions and produced water from oil operations, none of which are currently included in SLR assessments. As uncertainties in

  5. Automated tracking for advanced satellite laser ranging systems

    Science.gov (United States)

    McGarry, Jan F.; Degnan, John J.; Titterton, Paul J., Sr.; Sweeney, Harold E.; Conklin, Brion P.; Dunn, Peter J.

    1996-06-01

    NASA's Satellite Laser Ranging Network was originally developed during the 1970's to track satellites carrying corner cube reflectors. Today eight NASA systems, achieving millimeter ranging precision, are part of a global network of more than 40 stations that track 17 international satellites. To meet the tracking demands of a steadily growing satellite constellation within existing resources, NASA is embarking on a major automation program. While manpower on the current systems will be reduced to a single operator, the fully automated SLR2000 system is being designed to operate for months without human intervention. Because SLR2000 must be eyesafe and operate in daylight, tracking is often performed in a low probability of detection and high noise environment. The goal is to automatically select the satellite, setup the tracking and ranging hardware, verify acquisition, and close the tracking loop to optimize data yield. TO accomplish the autotracking tasks, we are investigating (1) improved satellite force models, (2) more frequent updates of orbital ephemerides, (3) lunar laser ranging data processing techniques to distinguish satellite returns from noise, and (4) angular detection and search techniques to acquire the satellite. A Monte Carlo simulator has been developed to allow optimization of the autotracking algorithms by modeling the relevant system errors and then checking performance against system truth. A combination of simulator and preliminary field results will be presented.

  6. The Medicina Station Status Report

    Science.gov (United States)

    Orfei, Alessandro; Orlati, Andrea; Maccaferri, Giuseppe

    2013-01-01

    General information about the Medicina Radio Astronomy Station, the 32-m antenna status, and the staff in charge of the VLBI observations is provided. In 2012, the data from geodetic VLBI observations were acquired using the Mark 5A recording system with good results. Updates of the hardware were performed and are briefly described.

  7. A search for AGN activity in Infrared-Faint Radio Sources (IFRS)

    Science.gov (United States)

    Lenc, Emil; Middelberg, Enno; Norris, Ray; Mao, Minnie

    2010-04-01

    We propose to observe a large sample of radio sources from the ATLAS (Australia Telescope Large Area Survey) source catalogue with the LBA, to determine their compactness. The sample consists of 36 sources with no counterpart in the co-located SWIRE survey (3.6 um to 160 um), carried out with the Spitzer Space Telescope. This rare class of sources, dubber Infrared-Faint Radio Sources (IFRS), is inconsistent with current galaxy evolution models. VLBI observations are an essential way to obtain further clues on what these objects are and why they are hidden from infrared observations. We will measure the flux densities on long baselines to determine their compactness. Only five IFRS have been previously targeted with VLBI observations (resulting in two detections). We propose using single baseline (Parkes-ATCA) eVLBI observations with the LBA at 1 Gbps to maximise sensitivity. With the observations proposed here we will increase the number of VLBI-observed IFRS from 5 to 36, allowing us to draw statistical conclusions about this intriguing new class of objects.

  8. Jet outflow and gamma-ray emission correlations in S5 0716+714

    International Nuclear Information System (INIS)

    Rani, B.; Krichbaum, T. P.; Marscher, A. P.

    2014-01-01

    Here, using millimeter very long baseline interferometry (VLBI) observations of the BL Lac object S5 0716+714 from August 2008 to September 2013, we investigate variations in the core flux density and orientation of the sub-parsec scale jet, i.e. position angle. The γ-ray data obtained by the Fermi Large Area Telescope are used to investigate the high-energy flux variations over the same time period. For the first time in any blazar, we report a significant correlation between the γ-ray flux variations and the position angle variations in the VLBI jet. The cross-correlation analysis also indicates a positive correlation such that the mm-VLBI core flux density variations are delayed with respect to the γ-ray flux by 82±32 days. This suggests that the high-energy emission is coming from a region located ≥(3.8±1.9) parsecs upstream of the mm-VLBI core (closer to the central black hole). Lastly, these results imply that the observed inner jet morphology has a strong connection with the observed γ-ray flares.

  9. Pathomechanisms of sciatica in lumbar disc herniation: effect of periradicular adhesive tissue on electrophysiological values by an intraoperative straight leg raising test.

    Science.gov (United States)

    Kobayashi, Shigeru; Takeno, Kenichi; Yayama, Takafumi; Awara, Kousuke; Miyazaki, Tsuyoshi; Guerrero, Alexander; Baba, Hisatoshi

    2010-10-15

    This study is aimed to investigate the changes of nerve root functions during the straight leg raising (SLR) test in vivo. To investigate the relationship between nerve root movement and the electrophysiological values during an intraoperative SLR test. The SLR test is one of the most significant signs for making a clinical diagnosis of lumbar disc herniation. A recent study showed that intraradicular blood flow apparently decreased during the SLR test in patients with disc herniation. The study included 32 patients who underwent microdiscectomy. During the surgery, the nerve root motion affected by the hernia was observed during the SLR test. The patients' legs were allowed to hang down to the angle at which sciatica had occurred and the change of nerve root action potentials was measured. After removal of the hernia, a similar procedure was repeated. The periradicular specimens collected during surgery were examined by light and electron microscope. In all patients intraoperative microscopy revealed that the hernia was adherent to the dura mater of the nerve roots. During the SLR test, the limitation of nerve root movement occurred by periradicular adhesive tissue and amplitude of action potential showed a sharp decrease at the angle that produced sciatica. After removal of the hernia, all the patients showed smooth gliding of the nerve roots during the test, and there was no marked decrease of amplitude. Our data suggest that temporary ischemic changes in the nerve root cause transient conduction disturbances. Pathologic examination showed that the periradicular tissue consisted of the granulation with vascularization and many inflammatory cell infiltrations. The presence of periradicular fibrosis will compound the nerve root pain by fixing the nerve in one position, thereby increasing the susceptibility of the nerve root to tension or compression.

  10. Simulating the Effects of Sea Level Rise on the Resilience and Migration of Tidal Wetlands along the Hudson River.

    Directory of Open Access Journals (Sweden)

    Nava M Tabak

    Full Text Available Sea Level Rise (SLR caused by climate change is impacting coastal wetlands around the globe. Due to their distinctive biophysical characteristics and unique plant communities, freshwater tidal wetlands are expected to exhibit a different response to SLR as compared with the better studied salt marshes. In this study we employed the Sea Level Affecting Marshes Model (SLAMM, which simulates regional- or local-scale changes in tidal wetland habitats in response to SLR, and adapted it for application in a freshwater-dominated tidal river system, the Hudson River Estuary. Using regionally-specific estimated ranges of SLR and accretion rates, we produced simulations for a spectrum of possible future wetland distributions and quantified the projected wetland resilience, migration or loss in the HRE through the end of the 21st century. Projections of total wetland extent and migration were more strongly determined by the rate of SLR than the rate of accretion. Surprisingly, an increase in net tidal wetland area was projected under all scenarios, with newly-formed tidal wetlands expected to comprise at least 33% of the HRE's wetland area by year 2100. Model simulations with high rates of SLR and/or low rates of accretion resulted in broad shifts in wetland composition with widespread conversion of high marsh habitat to low marsh, tidal flat or permanent inundation. Wetland expansion and resilience were not equally distributed through the estuary, with just three of 48 primary wetland areas encompassing >50% of projected new wetland by the year 2100. Our results open an avenue for improving predictive models of the response of freshwater tidal wetlands to sea level rise, and broadly inform the planning of conservation measures of this critical resource in the Hudson River Estuary.

  11. Vulnerability of the Nile Delta coastal areas to inundation by sea level rise.

    Science.gov (United States)

    Hassaan, M A; Abdrabo, M A

    2013-08-01

    Sea level changes are typically caused by several natural phenomena, including ocean thermal expansion, glacial melt from Greenland and Antarctica. Global average sea level is expected to rise, through the twenty-first century, according to the IPCC projections by between 0.18 and 0.59 cm. Such a rise in sea level will significantly impact coastal area of the Nile Delta, consisting generally of lowland and is densely populated areas and accommodates significant proportion of Egypt's economic activities and built-up areas. The Nile Delta has been examined in several previous studies, which worked under various hypothetical sea level rise (SLR) scenarios and provided different estimates of areas susceptible to inundation due to SLR. The paper intends, in this respect, to identify areas, as well as land use/land cover, susceptible to inundation by SLR based upon most recent scenarios of SLR, by the year 2100 using GIS. The results indicate that about 22.49, 42.18, and 49.22 % of the total area of coastal governorates of the Nile Delta would be susceptible to inundation under different scenarios of SLR. Also, it was found that 15.56 % of the total areas of the Nile Delta that would be vulnerable to inundation due to land subsidence only, even in the absence of any rise in sea level. Moreover, it was found that a considerable proportion of these areas (ranging between 32.32 and 53.66 %) are currently either wetland or undeveloped areas. Furthermore, natural and/or man-made structures, such as the banks of the International Coastal Highway, were found to provide unintended protection to some of these areas. This suggests that the inundation impact of SLR on the Nile Delta is less than previously reported.

  12. NASA's Next Generation Space Geodesy Program

    Science.gov (United States)

    Merkowitz, S. M.; Desai, S. D.; Gross, R. S.; Hillard, L. M.; Lemoine, F. G.; Long, J. L.; Ma, C.; McGarry, J. F.; Murphy, D.; Noll, C. E.; hide

    2012-01-01

    Requirements for the ITRF have increased dramatically since the 1980s. The most stringent requirement comes from critical sea level monitoring programs: a global accuracy of 1.0 mm, and 0.1mm/yr stability, a factor of 10 to 20 beyond current capability. Other requirements for the ITRF coming from ice mass change, ground motion, and mass transport studies are similar. Current and future satellite missions will have ever-increasing measurement capability and will lead to increasingly sophisticated models of these and other changes in the Earth system. Ground space geodesy networks with enhanced measurement capability will be essential to meeting the ITRF requirements and properly interpreting the satellite data. These networks must be globally distributed and built for longevity, to provide the robust data necessary to generate improved models for proper interpretation of the observed geophysical signals. NASA has embarked on a Space Geodesy Program with a long-range goal to build, deploy and operate a next generation NASA Space Geodetic Network (SGN). The plan is to build integrated, multi-technique next-generation space geodetic observing systems as the core contribution to a global network designed to produce the higher quality data required to maintain the Terrestrial Reference Frame and provide information essential for fully realizing the measurement potential of the current and coming generation of Earth Observing spacecraft. Phase 1 of this project has been funded to (1) Establish and demonstrate a next-generation prototype integrated Space Geodetic Station at Goddard's Geophysical and Astronomical Observatory (GGAO), including next-generation SLR and VLBI systems along with modern GNSS and DORIS; (2) Complete ongoing Network Design Studies that describe the appropriate number and distribution of next-generation Space Geodetic Stations for an improved global network; (3) Upgrade analysis capability to handle the next-generation data; (4) Implement a modern

  13. The nature of extragalactic radio-jets from high-resolution radio-interferometric observations

    OpenAIRE

    Perucho, Manel

    2014-01-01

    Extragalactic jets are a common feature of radio-loud active galaxies. The nature of the observed jets in relation to the bulk flow is still unclear. In particular it is not clear whether the observations of parsec-scale jets using the very long baseline interferometric technique (VLBI) reveal wave-like structures that develop and propagate along the jet, or trace the jet flow itself. In this contribution I review the evidence collected during the last years showing that the ridge-lines of he...

  14. Investigating the environmental and socioeconomic impacts of sea level rise in the Galveston Bay, Texas region

    Science.gov (United States)

    Subedee, M.; Dotson, M.; Gibeaut, J. C.

    2016-02-01

    Anthropogenic effects throughout the twenty-first century, particularly greenhouse gas emissions, have contributed to global climatic and environmental changes. Sea level rise (SLR) is one of these changes which is occurring along the Texas Coast and is amplified by land subsidence. SLR along the northern Texas coast is impacting sensitive coastal environments as well as human populations, and industries and infrastructure supporting those populations. Sea level data from the NOAA gauge at Galveston Pier 21 has shown an increase of 2.08 feet in relative sea level in 100 years. Given an expected increase in the rate of sea level rise in the next decades, the purpose of this study is to provide an in-depth assessment on the effects of relative sea level rise on the habitat distribution of highly valuable coastal wetlands in the Galveston Bay region. This study also focuses on projecting the potential socioeconomic losses due to coastal flooding that is amplified by SLR in the region. In this study, three SLR scenarios are modeled: a scenario based on a linear extrapolation of satellite altimetry data (0.21 m by 2100); the IPCC's RCP8.5 mean scenario (0.74 m by 2100); and a high-end scenario (1.8 m by 2100) as proposed by Jevrejeva et al. (2014). A land subsidence rate calculated by developing a subsidence grid using GPS-measured subsidence monitoring and releveling data is added to all these scenarios. The Sea Level Affecting Marshes Model (SLAMM) is used to predict wetland conversion due to long-term SLR incorporating the processes of inundation, erosion, accretion, overwash, and saturation. Similarly, HAZUS-MH is used to evaluate the property damage to building stocks and the direct business interruption losses due to flooding caused by 100-year flood event scenario with three SLR scenarios. This coordinated research effort to assess the physical, environmental and policy impacts due to SLR is intended to enable policy-makers, managers, and the general public to

  15. Analysis of license renewal at U.S. Nuclear Power Plants

    International Nuclear Information System (INIS)

    Nagayama, Munehiro

    2017-01-01

    The U.S. NRC had implemented the rules for LR (License Renewal) of NPPs (Nuclear Power Plants) and the LR rules allow plus 20-year operation of NPPs adding to initial 40-year term for reactor license. The U.S. NRC has already issued ROL (Renewed Operating License) for over forty NPPs. The Atomic Energy Act do not limit the number of LR, so the fleet of U.S. Nuclear, including agency, industry and academy, is continuing efforts to develop rules for SLR (Subsequent License Renewal). The framework of SLR rules has been developed and there is a plan of implementation of SLR for a pilot plant on FY 2018. The total operating term of a SLR plant is 80-year. The LR/SLR of NPPs is effective for stable power supply, greenhouse gas suppression, maintenance of technology, and securing employment. These profits will return to society. It is important to maintain required function of SSCs (Structure, System, and Components) for period of long term operation of NPPs. The U.S. fleet has established integrated ageing management strategy and each NPPs is developing their maintenance plans for long term operation. These adequate maintenance plans may enable to achieve good capacity factor of LR applied NPPs. In this report, domestic LR position will be considered by referring the good performance of U.S. NPPs which entered long term operation beyond 40-year and some conditions such as energy security. (author)

  16. The Effects of Active Straight Leg Raising on Tonicity and Activity of Pelvic Stabilizer Muscles

    Directory of Open Access Journals (Sweden)

    Azadeh Shadmehr

    2011-01-01

    Full Text Available Objective: Active straight leg raising (SLR test is advocated as a valid diagnostic method in diagnosis of sacroiliac joint (SIJ dysfunction that can assess the quality of load transfer between trunk and lower limb. The aim of this study is Comparison of changes in tonicity and activity of pelvic stabilizer muscles during active SLR, between healthy individuals and patients with sacroiliac joint pain. Materials & Methods: A case – control study was designed in 26 women (19-50 years old. With use of simple sampling, surface electromyography from rectus abdominis, external oblique, internal oblique, adductor longus, erector spine, gluteus maximus and biceps femoris was recorded in 26 subjects (15 healthy females and 11 females with sacroiliac pain in resting position and during active SLR test. Resting muscle tonicity and rms during ramp time and hold time in active SLR test were assessed by non parametric-two independent sample test. Results: Biceps femoris activity in resting position was significantly larger in patients group (P<0.05. During the active SLR, the women with sacroiliac joint pain used much less activity in some pelvic stabilizer muscles compared to the healthy subjects (P<0.05. Conclusion: The increased resting tonicity of biceps femoris and decreased activity of pelvic stabilizer muscles in subjects with sacroiliac joint pain, suggests an alteration in the strategy for lumbopelvic stabilization that may disrupt load transference through the pelvis.

  17. A comparative study on trans-umbilical single-port laparoscopic approach versus conventional repair for incarcerated inguinal hernia in children.

    Science.gov (United States)

    Jun, Zhang; Juntao, Ge; Shuli, Liu; Li, Long

    2016-01-01

    The purpose of this study is to determine whether singleport laparoscopic repair (SLR) for incarcerated inguinal hernia in children is superior toconventional repair (CR) approaches. Between March 2013 and September 2013, 126 infants and children treatedwere retrospectively reviewed. All the patients were divided into three groups. Group A (48 patients) underwent trans-umbilical SLR, group B (36 patients) was subjected to trans-umbilical conventional two-port laparoscopic repair (TLR) while the conventional open surgery repair (COR) was performed in group C (42 patients). Data regarding the operating time, bleeding volume, post-operative hydrocele formation, testicular atrophy, cosmetic results, recurrence rate, and duration of hospital stay of the patients were collected. All the cases were completed successfully without conversion. The mean operative time for group A was 15 ± 3.9 min and 24 ± 7.2 min for unilateral hernia and bilateral hernia respectively, whereas for group B, it was 13 ± 6.7 min and 23 ± 9.2 min. The mean duration of surgery in group C was 35 ± 5.2 min for unilateral hernia. The recurrence rate was 0% in all the three groups. There were statistically significant differences in theoperating time, bleeding volume, post-operative hydrocele formation, cosmetic results and duration hospital stay between the three groups (P < 0.001). No statistically significant differences between SLR and TLR were observed except the more cosmetic result in SLR. SLR is safe and effective, minimally invasive, and is a new technology worth promoting.

  18. Stabilization of global temperature at 1.5°C and 2.0°C: implications for coastal areas.

    Science.gov (United States)

    Nicholls, Robert J; Brown, Sally; Goodwin, Philip; Wahl, Thomas; Lowe, Jason; Solan, Martin; Godbold, Jasmin A; Haigh, Ivan D; Lincke, Daniel; Hinkel, Jochen; Wolff, Claudia; Merkens, Jan-Ludolf

    2018-05-13

    The effectiveness of stringent climate stabilization scenarios for coastal areas in terms of reduction of impacts/adaptation needs and wider policy implications has received little attention. Here we use the Warming Acidification and Sea Level Projector Earth systems model to calculate large ensembles of global sea-level rise (SLR) and ocean pH projections to 2300 for 1.5°C and 2.0°C stabilization scenarios, and a reference unmitigated RCP8.5 scenario. The potential consequences of these projections are then considered for global coastal flooding, small islands, deltas, coastal cities and coastal ecology. Under both stabilization scenarios, global mean ocean pH (and temperature) stabilize within a century. This implies significant ecosystem impacts are avoided, but detailed quantification is lacking, reflecting scientific uncertainty. By contrast, SLR is only slowed and continues to 2300 (and beyond). Hence, while coastal impacts due to SLR are reduced significantly by climate stabilization, especially after 2100, potential impacts continue to grow for centuries. SLR in 2300 under both stabilization scenarios exceeds unmitigated SLR in 2100. Therefore, adaptation remains essential in densely populated and economically important coastal areas under climate stabilization. Given the multiple adaptation steps that this will require, an adaptation pathways approach has merits for coastal areas.This article is part of the theme issue 'The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. © 2018 The Authors.

  19. Stabilization of global temperature at 1.5°C and 2.0°C: implications for coastal areas

    Science.gov (United States)

    Nicholls, Robert J.; Brown, Sally; Goodwin, Philip; Wahl, Thomas; Lowe, Jason; Solan, Martin; Godbold, Jasmin A.; Haigh, Ivan D.; Lincke, Daniel; Hinkel, Jochen; Wolff, Claudia; Merkens, Jan-Ludolf

    2018-05-01

    The effectiveness of stringent climate stabilization scenarios for coastal areas in terms of reduction of impacts/adaptation needs and wider policy implications has received little attention. Here we use the Warming Acidification and Sea Level Projector Earth systems model to calculate large ensembles of global sea-level rise (SLR) and ocean pH projections to 2300 for 1.5°C and 2.0°C stabilization scenarios, and a reference unmitigated RCP8.5 scenario. The potential consequences of these projections are then considered for global coastal flooding, small islands, deltas, coastal cities and coastal ecology. Under both stabilization scenarios, global mean ocean pH (and temperature) stabilize within a century. This implies significant ecosystem impacts are avoided, but detailed quantification is lacking, reflecting scientific uncertainty. By contrast, SLR is only slowed and continues to 2300 (and beyond). Hence, while coastal impacts due to SLR are reduced significantly by climate stabilization, especially after 2100, potential impacts continue to grow for centuries. SLR in 2300 under both stabilization scenarios exceeds unmitigated SLR in 2100. Therefore, adaptation remains essential in densely populated and economically important coastal areas under climate stabilization. Given the multiple adaptation steps that this will require, an adaptation pathways approach has merits for coastal areas. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.

  20. Projected atoll shoreline and run-up changes in response to sea-level rise and varying large wave conditions at Wake and Midway Atolls, Northwestern Hawaiian Islands

    Science.gov (United States)

    Shope, James B.; Storlazzi, Curt; Hoeke, Ron

    2017-01-01

    Atoll islands are dynamic features that respond to seasonal alterations in wave conditions and sea level. It is unclear how shoreline wave run-up and erosion patterns along these low elevation islands will respond to projected sea-level rise (SLR) and changes in wave climate over the next century, hindering communities' preparation for the future. To elucidate how these processes may respond to climate change, extreme boreal winter and summer wave conditions under future sea-level rise (SLR) and wave climate scenarios were simulated at two atolls, Wake and Midway, using a shallow-water hydrodynamic model. Nearshore wave conditions were used to compute the potential longshore sediment flux along island shorelines via the CERC empirical formula and wave-driven erosion was calculated as the divergence of the longshore drift; run-up and the locations where the run-up exceed the berm elevation were also determined. SLR is projected to predominantly drive future island morphological change and flooding. Seaward shorelines (i.e., ocean fronted shorelines directly facing incident wave energy) were projected to experience greater erosion and flooding with SLR and in hypothetical scenarios where changes to deep water wave directions were altered, as informed by previous climate change forced Pacific wave modeling efforts. These changes caused nearshore waves to become more shore-normal, increasing wave attack along previously protected shorelines. With SLR, leeward shorelines (i.e., an ocean facing shoreline but sheltered from incident wave energy) became more accretive on windward islands and marginally more erosive along leeward islands. These shorelines became more accretionary and subject to more flooding with nearshore waves becoming more shore-normal. Lagoon shorelines demonstrated the greatest SLR-driven increase in erosion and run-up. They exhibited the greatest relative change with increasing wave heights where both erosion and run-up magnitudes increased. Wider

  1. Projected atoll shoreline and run-up changes in response to sea-level rise and varying large wave conditions at Wake and Midway Atolls, Northwestern Hawaiian Islands

    Science.gov (United States)

    Shope, James B.; Storlazzi, Curt D.; Hoeke, Ron K.

    2017-10-01

    Atoll islands are dynamic features that respond to seasonal alterations in wave conditions and sea level. It is unclear how shoreline wave run-up and erosion patterns along these low elevation islands will respond to projected sea-level rise (SLR) and changes in wave climate over the next century, hindering communities' preparation for the future. To elucidate how these processes may respond to climate change, extreme boreal winter and summer wave conditions under future sea-level rise (SLR) and wave climate scenarios were simulated at two atolls, Wake and Midway, using a shallow-water hydrodynamic model. Nearshore wave conditions were used to compute the potential longshore sediment flux along island shorelines via the CERC empirical formula and wave-driven erosion was calculated as the divergence of the longshore drift; run-up and the locations where the run-up exceed the berm elevation were also determined. SLR is projected to predominantly drive future island morphological change and flooding. Seaward shorelines (i.e., ocean fronted shorelines directly facing incident wave energy) were projected to experience greater erosion and flooding with SLR and in hypothetical scenarios where changes to deep water wave directions were altered, as informed by previous climate change forced Pacific wave modeling efforts. These changes caused nearshore waves to become more shore-normal, increasing wave attack along previously protected shorelines. With SLR, leeward shorelines (i.e., an ocean facing shoreline but sheltered from incident wave energy) became more accretive on windward islands and marginally more erosive along leeward islands. These shorelines became more accretionary and subject to more flooding with nearshore waves becoming more shore-normal. Lagoon shorelines demonstrated the greatest SLR-driven increase in erosion and run-up. They exhibited the greatest relative change with increasing wave heights where both erosion and run-up magnitudes increased. Wider

  2. Sinking ships: conservation options for endemic taxa threatened by sea level rise

    Science.gov (United States)

    Joyce Maschinski; Michael S. Ross; Hong Liu; Joe O' Brien; Erick J. von Wettberg; Kristin E. Haskins

    2011-01-01

    Low-elevation islands face threats from sea level rise (SLR) and increased storm intensity. Evidence of endangered species’ population declines and shifts in vegetation communities are already underway in the Florida Keys. SLR predictions indicate large areas of these habitats may be eliminated in the next century. Using the Florida Keys as a model system, we present a...

  3. Predicting Land-Ice Retreat and Sea-Level Rise with the Community Earth System Model

    Energy Technology Data Exchange (ETDEWEB)

    Lipscomb, William [Los Alamos National Laboratory

    2012-06-19

    Coastal stakeholders need defensible predictions of 21st century sea-level rise (SLR). IPCC assessments suggest 21st century SLR of {approx}0.5 m under aggressive emission scenarios. Semi-empirical models project SLR of {approx}1 m or more by 2100. Although some sea-level contributions are fairly well constrained by models, others are highly uncertain. Recent studies suggest a potential large contribution ({approx}0.5 m/century) from the marine-based West Antarctic Ice Sheet, linked to changes in Southern Ocean wind stress. To assess the likelihood of fast retreat of marine ice sheets, we need coupled ice-sheet/ocean models that do not yet exist (but are well under way). CESM is uniquely positioned to provide integrated, physics based sea-level predictions.

  4. A stepwise regression tree for nonlinear approximation: applications to estimating subpixel land cover

    Science.gov (United States)

    Huang, C.; Townshend, J.R.G.

    2003-01-01

    A stepwise regression tree (SRT) algorithm was developed for approximating complex nonlinear relationships. Based on the regression tree of Breiman et al . (BRT) and a stepwise linear regression (SLR) method, this algorithm represents an improvement over SLR in that it can approximate nonlinear relationships and over BRT in that it gives more realistic predictions. The applicability of this method to estimating subpixel forest was demonstrated using three test data sets, on all of which it gave more accurate predictions than SLR and BRT. SRT also generated more compact trees and performed better than or at least as well as BRT at all 10 equal forest proportion interval ranging from 0 to 100%. This method is appealing to estimating subpixel land cover over large areas.

  5. Photography in Medicine and Oral Mucosa

    Directory of Open Access Journals (Sweden)

    Uğur Ergin

    2012-12-01

    Full Text Available Increasing demand on aesthetic dental restorations, spreading of digital cameras, easily sharing of the digital images increased the tendency of dentists to take digital dental photographs. Usage of SLR cameras and macro lenses are standard for dental photographs. By learning simple techniques and with some practice, clinicians can have excellent intra oral and extra oral photographs. These photographs can be used for documentation, increasing communication with patients and colleagues and laboratory, can provide auto control, and could better defend themselves in legal matters.

  6. Evaluating the cascading impacts of sea level rise and coastal flooding on emergency response spatial accessibility in Lower Manhattan, New York City

    Science.gov (United States)

    Yin, Jie; Yu, Dapeng; Lin, Ning; Wilby, Robert L.

    2017-12-01

    This paper describes a scenario-based approach for evaluating the cascading impacts of sea level rise (SLR) and coastal flooding on emergency responses. The analysis is applied to Lower Manhattan, New York City, considering FEMA's 100- and 500-year flood scenarios and New York City Panel on Climate Change (NPCC2)'s high-end SLR projections for the 2050s and 2080s, using the current situation as the baseline scenario. Service areas for different response timeframes (3-, 5- and 8-min) and various traffic conditions are simulated for three major emergency responders (i.e. New York Police Department (NYPD), Fire Department, New York (FDNY) and Emergency Medical Service (EMS)) under normal and flood scenarios. The modelling suggests that coastal flooding together with SLR could result in proportionate but non-linear impacts on emergency services at the city scale, and the performance of operational responses is largely determined by the positioning of emergency facilities and the functioning of traffic networks. Overall, emergency service accessibility to the city is primarily determined by traffic flow speed. However, the situation is expected to be further aggravated during coastal flooding, with is set to increase in frequency and magnitude due to SLR.

  7. Collaboration and Development of Radio Astronomy in Australasia and South-Pacific Region: New Zealand Perspectives

    Science.gov (United States)

    Gulyaev, S.; Natusch, T.

    2006-08-01

    Radio telescopes in the Asia-Pacific region form a natural network for VLBI observations, similar to the very successful networks in North America (Network Users Group) and Europe (European VLBI Network). New Zealand's VLBI facility, which we are developing since 2005, has the potential to strengthen the Asian-Pacific VLBI network and its role in astronomy, geodesy and geoscience. It will positively influence regional and international activities in geoscience and geodesy that advance New Zealand's national interests. A self-contained radio astronomy system for VLBI, including a 1.658 GHz (centre frequency), 16 MHz bandwidth RF system (feed and downconversion system locked to a Rubidium maser and GPS clock), an 8-bit sampler/digitisation system, and a disk-based recording system built around a commodity PC was developed in New Zealand Centre for Radiophysics and Space Research. This was designed as a portable system for use on various radio telescopes. A number of Trans-Tasman tests has been conducted in 2005-2006 between the CRSR system installed on a 6 metre dish located in Auckland and the Australia Telescope Compact Array in Narrabri, Australia. This work has been successful, with fringes located from the recorded data and high resolution image of the quasar PKS1921-231 obtained. Experiments were recently conducted with Japan; new tests are planned with Korea and Fiji. Plans have been made to build a new 16.5 m antenna in New Zealand's North Island and to upgrade an 11 m dish in the South Island. A possible future of New Zealand's participation in the SKA is being discussed.

  8. Contribution of GNSS CORS Infrastructure to the Mission of Modern Geodesy and Status of GNSS CORS in Thailand

    Directory of Open Access Journals (Sweden)

    Chalermchon Satirapod

    2011-01-01

    Full Text Available Geodesy is the science of measuring and mapping the geometry, orientation and gravity field of the Earth including the associated variations with time. Geodesy has also provided the foundation for high accuracy surveying and mapping. Modern Geodesy involves a range of space and terrestrial technologies that contribute to our knowledge of the solid earth, atmosphere and oceans. These technologies include: Global Positioning System/Global Navigation Satellite Systems (GPS/GNSS, Satellite Laser Ranging (SLR, Very Long Baseline Interferometry (VLBI, Satellite Altimetry, Gravity Mapping Missions such as GRACE, CHAMP and GOCE, satelliteborne Differential Interferometric Synthetic Aperture Radar (DInSAR, Absolute and Relative Gravimetry, and Precise Terrestrial Surveying (Levelling and Traversing. A variety of services have been established in recent years to ensure high accuracy and reliable geodetic products to support geoscientific research. The reference frame defined by Modern Geodesy is now the basis for most national and regional datums. Furthermore, the GPS/GNSS technology is a crucial geopositioning tool for both Geodesy and Surveying. There is therefore a blurring of the distinction between geodetic and surveying GPS/GNSS techniques, and increasingly the ground infrastructure of continuously operating reference stations (CORS receivers attempts to address the needs of both geodesists and other positioning professionals. Yet Geodesy is also striving to increase the level of accuracy by a factor of ten over the next decade in order to address the demands of “global change” studies. The Global Geodetic Observing System (GGOS is an important component of the International Association of Geodesy. GGOS aims to integrate all geodetic observations in order to generate a consistent high quality set of geodetic parameters for monitoring the phenomena and processes within the “System Earth”. Integration implies the inclusion of all relevant

  9. The sensitivity of Bacillus subtilis to diverse antimicrobial compounds is influenced by Abh.

    Science.gov (United States)

    Murray, Ewan J; Stanley-Wall, Nicola R

    2010-12-01

    Abh is a transition state regulator of Bacillus subtilis that controls biofilm formation and the production of several diverse antimicrobial compounds. Using a high-throughput non-biased technique, we show for the first time that Abh influences the sensitivity of B. subtilis to diverse antimicrobial compounds. Following up on these findings with a combination of classical genetics and antibiotic susceptibility assays, we demonstrate that Abh influences cellular processes such as the remodelling of the cell wall. We present data demonstrating that the extracytoplasmic function sigma factor σ(X) controls resistance to β-lactam antibiotics by activating abh transcription. Downstream from Abh, activation of slrR expression by Abh is responsible for controlling the sensitivity of B. subtilis to such antibiotics due to the role that SlrR plays in regulating autolysin biosynthesis. The abh mutant additionally exhibits increased resistance to aminoglycoside antimicrobials. We confirm that aminoglycoside killing of B. subtilis is likely to be caused by oxidative damage but rule out the possibility that the increased resistance of the abh mutant to aminoglycosides is due to a general increase in resistance to oxidative stress.

  10. The rice YABBY4 gene regulates plant growth and development through modulating the gibberellin pathway.

    Science.gov (United States)

    Yang, Chao; Ma, Yamei; Li, Jianxiong

    2016-10-01

    YABBY genes encode seed plant-specific transcription factors that play pivotal roles in diverse aspects of leaf, shoot, and flower development. Members of the YABBY gene family are primarily expressed in lateral organs in a polar manner and function to specify abaxial cell fate in dicotyledons, but this polar expression is not conserved in monocotyledons. The function of YABBY genes is therefore not well understood in monocotyledons. Here we show that overexpression of the rice (Oryza sativa L.) YABBY4 gene (OsYABBY4) leads to a semi-dwarf phenotype, abnormal development in the uppermost internode, an increased number of floral organs, and insensitivity to gibberellin (GA) treatment. We report on an important role for OsYABBY4 in negative control of the expression of a GA biosynthetic gene by binding to the promoter region of the gibberellin 20-oxidase 2 gene (GA20ox2), which is a direct target of SLR1 (the sole DELLA protein negatively controlling GA responses in rice). OsYABBY4 also suppresses the expression level of SLR1 and interacts with SLR1 protein. The interaction inhibits GA-dependent degradation of SLR1 and therefore leads to GA insensitivity. These data together suggest that OsYABBY4 serves as a DNA-binding intermediate protein for SLR1 and is associated with the GA signaling pathway regulating gene expression during plant growth and development. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  11. A comparative study on trans-umbilical single-port laparoscopic approach versus conventional repair for incarcerated inguinal hernia in children

    Directory of Open Access Journals (Sweden)

    Zhang Jun

    2016-01-01

    Full Text Available Purpose: The purpose of this study is to determine whether singleport laparoscopic repair (SLR for incarcerated inguinal hernia in children is superior toconventional repair (CR approaches. Method: Between March 2013 and September 2013, 126 infants and children treatedwere retrospectively reviewed. All the patients were divided into three groups. Group A (48 patients underwent trans-umbilical SLR, group B (36 patients was subjected to trans-umbilical conventional two-port laparoscopic repair (TLR while the conventional open surgery repair (COR was performed in group C (42 patients. Data regarding the operating time, bleeding volume, post-operative hydrocele formation, testicular atrophy, cosmetic results, recurrence rate, and duration of hospital stay of the patients were collected. Result: All the cases were completed successfully without conversion. The mean operative time for group A was 15 ± 3.9 min and 24 ± 7.2 min for unilateral hernia and bilateral hernia respectively, whereas for group B, it was 13 ± 6.7 min and 23 ± 9.2 min. The mean duration of surgery in group C was 35 ± 5.2 min for unilateral hernia. The recurrence rate was 0% in all the three groups. There were statistically significant differences in theoperating time, bleeding volume, post-operative hydrocele formation, cosmetic results and duration hospital stay between the three groups (P < 0.001. No statistically significant differences between SLR and TLR were observed except the more cosmetic result in SLR. Conclusion: SLR is safe and effective, minimally invasive, and is a new technology worth promoting.

  12. Coastal vertebrate exposure to predicted habitat changes due to sea level rise

    Science.gov (United States)

    Hunter, Elizabeth A.; Nibbelink, Nathan P.; Alexander, Clark R.; Barrett, Kyle; Mengak, Lara F.; Guy, Rachel; Moore, Clinton; Cooper, Robert J.

    2015-01-01

    Sea level rise (SLR) may degrade habitat for coastal vertebrates in the Southeastern United States, but it is unclear which groups or species will be most exposed to habitat changes. We assessed 28 coastal Georgia vertebrate species for their exposure to potential habitat changes due to SLR using output from the Sea Level Affecting Marshes Model and information on the species’ fundamental niches. We assessed forecasted habitat change up to the year 2100 using three structural habitat metrics: total area, patch size, and habitat permanence. Almost all of the species (n = 24) experienced negative habitat changes due to SLR as measured by at least one of the metrics. Salt marsh and ocean beach habitats experienced the most change (out of 16 categorical land cover types) across the three metrics and species that used salt marsh extensively (rails and marsh sparrows) were ranked highest for exposure to habitat changes. Species that nested on ocean beaches (Diamondback Terrapins, shorebirds, and terns) were also ranked highly, but their use of other foraging habitats reduced their overall exposure. Future studies on potential effects of SLR on vertebrates in southeastern coastal ecosystems should focus on the relative importance of different habitat types to these species’ foraging and nesting requirements. Our straightforward prioritization approach is applicable to other coastal systems and can provide insight to managers on which species to focus resources, what components of their habitats need to be protected, and which locations in the study area will provide habitat refuges in the face of SLR.

  13. Flooded! An Investigation of Sea-Level Rise in a Changing Climate

    Science.gov (United States)

    Gillette, Brandon; Hamilton, Cheri

    2011-01-01

    Explore how melting ice sheets affect global sea levels. Sea-level rise (SLR) is a rise in the water level of the Earth's oceans. There are two major kinds of ice in the polar regions: sea ice and land ice. Land ice contributes to SLR and sea ice does not. This article explores the characteristics of sea ice and land ice and provides some hands-on…

  14. Determining Coastal Hazards Risk Perception to Enhance Local Mitigation Planning through a Participatory Mapping Approach

    Science.gov (United States)

    Bethel, M.; Braud, D.; Lambeth, T.; Biber, P.; Wu, W.

    2017-12-01

    Coastal community leaders, government officials, and natural resource managers must be able to accurately assess and predict a given coastal landscape's sustainability and/or vulnerability as coastal habitat continues to undergo rapid and dramatic changes associated with natural and anthropogenic activities such as accelerated relative sea level rise (SLR). To help address this information need, a multi-disciplinary project team conducted Sea Grant sponsored research in Louisiana and Mississippi with traditional ecosystem users and natural resource managers to determine a method for producing localized vulnerability and sustainability maps for projected SLR and storm surge impacts, and determine how and whether the results of such an approach can provide more useful information to enhance hazard mitigation planning. The goals of the project are to develop and refine SLR visualization tools for local implementation in areas experiencing subsidence and erosion, and discover the different ways stakeholder groups evaluate risk and plan mitigation strategies associated with projected SLR and storm surge. Results from physical information derived from data and modeling of subsidence, erosion, engineered restoration and coastal protection features, historical land loss, and future land projections under SLR are integrated with complimentary traditional ecological knowledge (TEK) offered by the collaborating local ecosystem users for these assessments. The data analysis involves interviewing stakeholders, coding the interviews for themes, and then converting the themes into vulnerability and sustainability factors. Each factor is weighted according to emphasis by the TEK experts and number of experts who mention it to determine which factors are the highest priority. The priority factors are then mapped with emphasis on the perception of contributing to local community vulnerability or sustainability to SLR and storm surge. The maps are used by the collaborators to benefit

  15. A Novel Phonology- and Radical-Coded Chinese Sign Language Recognition Framework Using Accelerometer and Surface Electromyography Sensors.

    Science.gov (United States)

    Cheng, Juan; Chen, Xun; Liu, Aiping; Peng, Hu

    2015-09-15

    Sign language recognition (SLR) is an important communication tool between the deaf and the external world. It is highly necessary to develop a worldwide continuous and large-vocabulary-scale SLR system for practical usage. In this paper, we propose a novel phonology- and radical-coded Chinese SLR framework to demonstrate the feasibility of continuous SLR using accelerometer (ACC) and surface electromyography (sEMG) sensors. The continuous Chinese characters, consisting of coded sign gestures, are first segmented into active segments using EMG signals by means of moving average algorithm. Then, features of each component are extracted from both ACC and sEMG signals of active segments (i.e., palm orientation represented by the mean and variance of ACC signals, hand movement represented by the fixed-point ACC sequence, and hand shape represented by both the mean absolute value (MAV) and autoregressive model coefficients (ARs)). Afterwards, palm orientation is first classified, distinguishing "Palm Downward" sign gestures from "Palm Inward" ones. Only the "Palm Inward" gestures are sent for further hand movement and hand shape recognition by dynamic time warping (DTW) algorithm and hidden Markov models (HMM) respectively. Finally, component recognition results are integrated to identify one certain coded gesture. Experimental results demonstrate that the proposed SLR framework with a vocabulary scale of 223 characters can achieve an averaged recognition accuracy of 96.01% ± 0.83% for coded gesture recognition tasks and 92.73% ± 1.47% for character recognition tasks. Besides, it demonstrats that sEMG signals are rather consistent for a given hand shape independent of hand movements. Hence, the number of training samples will not be significantly increased when the vocabulary scale increases, since not only the number of the completely new proposed coded gestures is constant and limited, but also the transition movement which connects successive signs needs no

  16. Coastal hazards and groundwater salinization on low coral islands.

    Science.gov (United States)

    Terry, James P.; Chui, T. F. May

    2016-04-01

    Remote oceanic communities living on low-lying coral islands (atolls) without surface water rely for their survival on the continuing viability of fragile groundwater resources. These exist in the form of fresh groundwater lenses (FGLs) that develop naturally within the porous coral sand and gravel substrate. Coastal hazards such as inundation by high-energy waves driven by storms and continuing sea-level rise (SLR) are among many possible threats to viable FGL size and quality on atolls. Yet, not much is known about the combined effects of wave washover during powerful storms and SLR on different sizes of coral island, nor conversely how island size influences lens resilience against damage. This study investigates FGL damage by salinization (and resilience) caused by such coastal hazards using a modelling approach. Numerical modelling is carried out to generate steady-state FGL configurations at three chosen island sizes (400, 600 and 800 m widths). Steady-state solutions reveal how FGL dimensions are related in a non-linear manner to coral island size, such that smaller islands develop much more restricted lenses than larger islands. A 40 cm SLR scenario is then imposed. This is followed by transient simulations to examine storm-induced wave washover and subsequent FGL responses to saline damage over a 1 year period. Smaller FGLs display greater potential for disturbance by SLR, while larger and more robust FGLs tend to show more resilience. Further results produce a somewhat counterintuitive finding: in the post-SLR condition, FGL vulnerability to washover salinization may actually be reduced, owing to the thinner layer of unsaturated substrate lying above the water table into which saline water can infiltrate during a storm event. Nonetheless, combined washover and SLR impacts imply overall that advancing groundwater salinization may lead to some coral islands becoming uninhabitable long before they are completely submerged by sea-level rise, thereby calling

  17. Metre-wavelength fine structure in 30 extragalactic radio sources with sizes of a few arcsec

    International Nuclear Information System (INIS)

    Banhatti, D.G.; Ananthakrishnan, S.; Pramesh Rao, A.

    1983-01-01

    Interplanetary scintillation (IPS) observations at 327 MHz of an unbiased sample of 30 extragalactic radio sources having overall sizes between 1 and 4 arcsec, and flux densities greater than 1 Jy at 327 MHz are reported. From VLBI observations, these sources have been reported to contain compact components of sizes < approx.= to 0.02 arcsec contributing on an average about 25 per cent of the total emission at 5 HGz. The IPS observations show that about 45 per cent of the total emission at 327 MHz arises from structures of sizes between 0.05 and 0.5 arcsec (corresponding typically to 0.5 to 5 kpc). A comparison of the VLBI and IPS results indicates that the VLBI and IPS components probably refer to the same physical features in these sources. (author)

  18. Sea-level rise impacts on seawater intrusion in coastal aquifers: Review and integration

    Science.gov (United States)

    Ketabchi, Hamed; Mahmoodzadeh, Davood; Ataie-Ashtiani, Behzad; Simmons, Craig T.

    2016-04-01

    Sea-level rise (SLR) influences groundwater hydraulics and in particular seawater intrusion (SWI) in many coastal aquifers. The quantification of the combined and relative impacts of influential factors on SWI has not previously been considered in coastal aquifers. In the present study, a systematic review of the available literature on this topic is first provided. Then, the potential remaining challenges are scrutinized. Open questions on the effects of more realistic complexities such as gradual SLR, parameter uncertainties, and the associated influences in decision-making models are issues requiring further investigation. We assess and quantify the seawater toe location under the impacts of SLR in combination with recharge rate variations, land-surface inundation (LSI) due to SLR, aquifer bed slope variation, and changing landward boundary conditions (LWBCs). This is the first study to include all of these factors in a single analysis framework. Both analytical and numerical models are used for these sensitivity assessments. It is demonstrated that (1) LSI caused by SLR has a significant incremental impact on the seawater toe location, especially in the flatter coasts and the flux-controlled (FC) LWBCs, however this impact is less than the reported orders of magnitude differences which were estimated using only analytical solutions; (2) LWBCs significantly influence the SLR impacts under almost all conditions considered in this study; (3) The main controlling factors of seawater toe location are the magnitudes of fresh groundwater discharge to sea and recharge rate. Regional freshwater flux entering from the landward boundary and the groundwater hydraulic gradient are the major contributors of fresh groundwater discharge to sea for both FC and head-controlled (HC) systems, respectively; (4) A larger response of the aquifer and larger seawater toe location changes are demonstrable for a larger ratio of the aquifer thickness to the aquifer length particularly in

  19. Depositional Architecture of Late Pleistocene-Holocene Coastal Alluvial-fan System in the Coastal Range, Taiwan

    Science.gov (United States)

    Chen, S. T.; Chen, W. S.

    2016-12-01

    Since late Pleistocene, the Coastal Range (Philippine Sea plate) collided and overridden on the Central Range (Eurasian Plate) along the Longitudinal Valley Fault. Therefore, the Coastal Range is exposed widely the late Pleistocene-Holocene marine and fluvial terraces caused by the tectonic uplift. Based on the estimation of paleosea-level elevations (Δh), depositional paleodepth, altitude distribution of Holocene deposits (D), altitude of outcrops (H), and 14C dating of marine deposits (t), the uplift rate (=(Δh+H +d-D)/t) is about 5-10 mm/yr in the southern Coastal Range. In this study, we suggest through field logging that the deposits can be divided into alluvial, foreshore (intertidal), shoreface, and offshore environments. In Dulan area in the southern Coastal Range, the uplift rate was 6-7 mm/yr during 16,380-10,000 cal yr BP and 3-4 mm/yr after 7,000 cal yr BP. Results from the Dulan Coastal alluvial-fan system can be divided into five depositional stages: (1) 16,380-14,300 cal yr BP: The rate of global sea level rise (SLR) has averaged about 6-7 mm/yr, similar to the tectonic uplift rate. In this stage, the bedrock was eroded and formed a wide wave-cut platform. (2) 14,300-10,000 cal yr BP: SLR of about 14 mm/yr that was faster than tectonic uplift rate of 6-7 mm/yr. As a result of transgression, the beach-lagoon deposits about 5 m thick were unconformably overlain on the wave-cut platform. (3) 10,000-8,200 cal yr BP: The ongoing sea level rise (SLR: 11 mm/yr), the lagoon deposits were overlain by an offshore slump deposits representing a gradual deepening of the depositional environment. (4) 8,200-7,930 cal yr BP (SLR: 6-7 mm/yr): The tectonic uplift rate may occur at similar SLR. The alluvial-fan deposits have prograded over the shallow marine deposits. (5) After 7,000 cal yr BP (SLR: 1-0 mm/yr): SLR was much slower than tectonic uplift rate of 3-4 mm/yr. Thus, Holocene marine terraces are extensively developed in the coastal region, showing that the

  20. Vulnerability of marginal seas to sea level rise

    Science.gov (United States)

    Gomis, Damia; Jordà, Gabriel

    2017-04-01

    Sea level rise (SLR) is a serious thread for coastal areas and has a potential negative impact on society and economy. SLR can lead for instance to land loss, beach reduction, increase of the damage of marine storms on coastal infrastructures and to the salinization of underground water streams. It is well acknowledged that future SLR will be inhomogeneous across the globe, with regional differences of up to 100% with respect to global mean sea level (GMSL). Several studies have addressed the projections of SLR at regional scale, but most of them are based on global climate models (GCMs) that have a relatively coarse spatial resolution (>1°). In marginal seas this has proven to be a strong limitation, as their particular configurations require spatial resolutions that are not reachable by present GCMs. A paradigmatic case is the Mediterranean Sea, connected to the global ocean through the Strait of Gibraltar, a narrow passage of 14 km width. The functioning of the Mediterranean Sea involves a variety of processes including an overturning circulation, small-scale convection and a rich mesoscale field. Moreover, the long-term evolution of Mediterranean sea level has been significantly different from the global mean during the last decades. The observations of present climate and the projections for the next decades have lead some authors to hypothesize that the particular characteristics of the basin could allow Mediterranean mean sea level to evolve differently from the global mean. Assessing this point is essential to undertake proper adaptation strategies for the largely populated Mediterranean coastal areas. In this work we apply a new approach that combines regional and global projections to analyse future SLR. In a first step we focus on the quantification of the expected departures of future Mediterranean sea level from GMSL evolution and on the contribution of different processes to these departures. As a result we find that, in spite of its particularities

  1. Salinity tolerances and use of saline environments by freshwater turtles: implications of sea level rise.

    Science.gov (United States)

    Agha, Mickey; Ennen, Joshua R; Bower, Deborah S; Nowakowski, A Justin; Sweat, Sarah C; Todd, Brian D

    2018-03-25

    The projected rise in global mean sea levels places many freshwater turtle species at risk of saltwater intrusion into freshwater habitats. Freshwater turtles are disproportionately more threatened than other taxa; thus, understanding the role of salinity in determining their contemporary distribution and evolution should be a research priority. Freshwater turtles are a slowly evolving lineage; however, they can adapt physiologically or behaviourally to various levels of salinity and, therefore, temporarily occur in marine or brackish environments. Here, we provide the first comprehensive global review on freshwater turtle use and tolerance of brackish water ecosystems. We link together current knowledge of geographic occurrence, salinity tolerance, phylogenetic relationships, and physiological and behavioural mechanisms to generate a baseline understanding of the response of freshwater turtles to changing saline environments. We also review the potential origins of salinity tolerance in freshwater turtles. Finally, we integrate 2100 sea level rise (SLR) projections, species distribution maps, literature gathered on brackish water use, and a phylogeny to predict the exposure of freshwater turtles to projected SLR globally. From our synthesis of published literature and available data, we build a framework for spatial and phylogenetic conservation prioritization of coastal freshwater turtles. Based on our literature review, 70 species (∼30% of coastal freshwater turtle species) from 10 of the 11 freshwater turtle families have been reported in brackish water ecosystems. Most anecdotal records, observations, and descriptions do not imply long-term salinity tolerance among freshwater turtles. Rather, experiments show that some species exhibit potential for adaptation and plasticity in physiological, behavioural, and life-history traits that enable them to endure varying periods (e.g. days or months) and levels of saltwater exposure. Species that specialize on

  2. Review of decametric radio astronomy - instruments and science

    International Nuclear Information System (INIS)

    Erickson, W.C.; Cane, H.V.

    1987-01-01

    The techniques and instruments used in Galactic and extragalactic radio astronomy at dkm wavelengths are surveyed, and typical results are summarized. Consideration is given to the large specialized phased arrays used for early surveys, the use of wideband elements to increase frequency agility, experimental VLBI observations, and limitations on ground-based observations below about 10 MHz (where the proposed LF Space Array, with resolution 0.5-5 arcmin, could make a major contribution). Observations discussed cover the Galactic center, the Galactic background radiation, SNRs, compact Galactic sources, the ISM, and large extragalactic sources. 38 references

  3. DiFX: A software correlator for very long baseline interferometry using multi-processor computing environments

    OpenAIRE

    Deller, A. T.; Tingay, S. J.; Bailes, M.; West, C.

    2007-01-01

    We describe the development of an FX style correlator for Very Long Baseline Interferometry (VLBI), implemented in software and intended to run in multi-processor computing environments, such as large clusters of commodity machines (Beowulf clusters) or computers specifically designed for high performance computing, such as multi-processor shared-memory machines. We outline the scientific and practical benefits for VLBI correlation, these chiefly being due to the inherent flexibility of softw...

  4. Fortaleza Station Report for 2012

    Science.gov (United States)

    Kaufmann, Pierre; Pereira de Lucena, A. Macilio; Sombra da Silva, Adeildo

    2013-01-01

    This is a brief report about the activities carried out at the Fortaleza geodetic VLBI station (ROEN: R´adio Observat´orio Espacial do Nordeste), located in Eus´ebio, CE, Brazil, during the period from January until December 2012. The observing activities were resumed in May after the major maintenance that comprised the azimuth bearing replacement. The total observational experiments consisted of 103 VLBI sessions and continuous GPS monitoring recordings.

  5. Kinetics of the isothermal decomposition of zirconium hydride: terminal solid solubility for precipitation and dissolution

    Science.gov (United States)

    Denisov, E. A.; Kompaniets, T. N.; Voyt, A. P.

    2018-05-01

    The hydrogen permeation technique in the surface-limited regime (SLR) was first used to study the isothermal decomposition of zirconium hydride. It is shown that under isothermal conditions, the hydrogen terminal solid solubility in the α-phase for hydride precipitation (TSSp) and dissolution (TSSd) differ only by 6%, in contrast to the 20-30% indicated in the available literature. It is demonstrated that even the minimum heating/cooling rate (1 C/min) used in the traditional methods of studying TSSp and TSSd is too high to exclude the effect of kinetics on the results obtained.

  6. A comparative study on trans-umbilical single-port laparoscopic approach versus conventional repair for incarcerated inguinal hernia in children

    OpenAIRE

    Jun, Zhang; Juntao, Ge; Shuli, Liu; Li, Long

    2016-01-01

    Purpose: The purpose of this study is to determine whether singleport laparoscopic repair (SLR) for incarcerated inguinal hernia in children is superior toconventional repair (CR) approaches. Method: Between March 2013 and September 2013, 126 infants and children treatedwere retrospectively reviewed. All the patients were divided into three groups. Group A (48 patients) underwent trans-umbilical SLR, group B (36 patients) was subjected to trans-umbilical conventional two-port laparoscopic rep...

  7. Overview of past activities for the use of short-lived radionuclides and the role of the Bureau of Radiological Health

    International Nuclear Information System (INIS)

    Paras, P.

    1985-01-01

    The Bureau of Radiological Health has developed a national program to control unnecessary medical radiation exposures to man and to assure the safe and effective use of radiation. The continuing interest and the role of the Bureau in the use of short-lived radionuclides (SLR's) are emphasized. An overview of the Bureau's SLR program, past accomplishments, and the status of production and use of iodine-123 are presented

  8. CONSTRAINING THE STRUCTURE OF SAGITTARIUS A*'s ACCRETION FLOW WITH MILLIMETER VERY LONG BASELINE INTERFEROMETRY CLOSURE PHASES

    Energy Technology Data Exchange (ETDEWEB)

    Broderick, Avery E [Canadian Institute for Theoretical Astrophysics, 60 St. George Street, Toronto, ON M5S 3H8 (Canada); Fish, Vincent L; Doeleman, Sheperd S [Massachusetts Institute of Technology, Haystack Observatory, Route 40, Westford, MA 01886 (United States); Loeb, Abraham [Institute for Theory and Computation, Harvard University, Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2011-09-01

    Millimeter wave very long baseline interferometry (mm-VLBI) provides access to the emission region surrounding Sagittarius A* (Sgr A*), the supermassive black hole at the center of the Milky Way, on sub-horizon scales. Recently, a closure phase of 0{sup 0} {+-} 40{sup 0} was reported on a triangle of Earth-sized baselines (SMT-CARMA-JCMT) representing a new constraint upon the structure and orientation of the emission region, independent from those provided by the previously measured 1.3 mm-VLBI visibility amplitudes alone. Here, we compare this to the closure phases associated with a class of physically motivated, radiatively inefficient accretion flow models and present predictions for future mm-VLBI experiments with the developing Event Horizon Telescope (EHT). We find that the accretion flow models are capable of producing a wide variety of closure phases on the SMT-CARMA-JCMT triangle and thus not all models are consistent with the recent observations. However, those models that reproduce the 1.3 mm-VLBI visibility amplitudes overwhelmingly have SMT-CARMA-JCMT closure phases between {+-}30{sup 0}, and are therefore broadly consistent with all current mm-VLBI observations. Improving station sensitivity by factors of a few, achievable by increases in bandwidth and phasing together multiple antennas at individual sites, should result in physically relevant additional constraints upon the model parameters and eliminate the current 180{sup 0} ambiguity on the source orientation. When additional stations are included, closure phases of order 45{sup 0}-90{sup 0} are typical. In all cases, the EHT will be able to measure these with sufficient precision to produce dramatic improvements in the constraints upon the spin of Sgr A*.

  9. Automated Simultaneous Local Ties with GNSS and Robot Tacheometer

    Science.gov (United States)

    Kallio, Ulla; Lösler, Michael; Bergstrand, Sten; Haas, Rüdiger; Eschelbach, Cornelia

    2016-12-01

    We have used GPS-based local-tie measurements simultaneously with geo-VLBI observations since 2008 during every geodetic VLBI session at Metsähovi. This system uses gimbal-mounted GNSS antennas that are mounted on the reflector of the Metsähovi 14-m radio telescope. A similar system was installed in 2013 at the Onsala 20-m radio telescope and has been used for a large number of VLBI sessions, including, e.g., the 15-day-long CONT14 campaign. In order to verify the results of the two systems, we performed a dedicated measurement campaign in the framework of the SIB60 project, involving both Metsähovi and Onsala. During this campaign the local ties at the two stations were measured simultaneously during two VLBI sessions in August and September 2015 where both stations participated. The robot tacheometer monitoring system HEIMDALL was used for the automated classical monitoring of the telescopes at both stations. Moreover, additional local terrestrial measurements were performed several times to derive the full IVS-IGS local ties at both sites. The kinematic GPS measurements at the two stations were analyzed with two independently developed analysis programs. We present here the preparations of the campaign, the measurement process, and preliminary results.

  10. Joint projections of sea level and storm surge using a flood index

    Science.gov (United States)

    Little, C. M.; Lin, N.; Horton, R. M.; Kopp, R. E.; Oppenheimer, M.

    2016-02-01

    Capturing the joint influence of sea level rise (SLR) and tropical cyclones (TCs) on future coastal flood risk poses significant challenges. To address these difficulties, Little et al. (2015) use a proxy of tropical cyclone activity and a probabilistic flood index that aggregates flood height and duration over a wide area (the US East and Gulf coasts). This technique illuminates the individual impacts of TCs and SLR and their correlation across different coupled climate models. By 2080-2099, changes in the flood index relative to 1986-2005 are substantial and positively skewed: a 10th-90th percentile range of 35-350x higher for a high-end business-as-usual emissions scenario (see figure). This aggregated flood index: 1) is a means to consistently combine TC-driven storm surges and SLR; 2) provides a more robust description of historical surge-climate relationships than is available at any one location; and 3) allows the incorporation of a larger climate model ensemble - which is critical to uncertainty characterization. It does not provide a local view of the complete spectrum of flood severity (i.e. return curves). However, alternate techniques that provide localized return curves (e.g. Lin et al., 2012) are computationally intensive, limiting the set of large-scale climate models that can be incorporated, and require several linked statistical and dynamical models, each with structural uncertainties that are difficult to quantify. Here, we present the results of Little et al. (2015) along with: 1) alternate formulations of the flood index; 2) strategies to localize the flood index; and 3) a comparison of flood index projections to those provided by model-based return curves. We look to this interdisciplinary audience for feedback on the advantages and disadvantages of each tool for coastal planning and decision-making. Lin, N., K. Emanuel, M. Oppenheimer, and E. Vanmarcke, 2012: Physically based assessment of hurricane surge threat under climate change. Nature

  11. Transfer from blue light or green light to white light partially reverses changes in ocular refraction and anatomy of developing guinea pigs.

    Science.gov (United States)

    Qian, Yi-Feng; Liu, Rui; Dai, Jin-Hui; Chen, Min-Jie; Zhou, Xing-Tao; Chu, Ren-Yuan

    2013-09-26

    Relative to the broadband white light (BL), postnatal guinea pigs develop myopia in a monochromic middle-wavelength light (ML, 530 nm) environment and develop hyperopia in a monochromic short-wavelength light (SL, 430 nm) environment. We investigated whether transfer from SL or ML to BL leads to recuperation of ocular refraction and anatomy of developing guinea pigs. Two-week-old guinea pigs were given (a) SL for 20 weeks, (b) SL recuperation (SLR, SL for 10 weeks then BL for 10 weeks), (c) ML for 20 weeks, (d) ML recuperation (MLR, ML for 10 weeks then BL for 10 weeks), or (e) BL for 20 weeks. Two weeks after transfer from ML to BL (MLR group), ocular refraction increased from 1.95 ± 0.35 D to 2.58 ± 0.24 D, and vitreous length decreased from 3.48 ± 0.06 mm to 3.41 ± 0.06 mm. Two weeks after transfer from SL to BL (SLR group), ocular refraction decreased from 5.65 ± 0.61 D to 4.33 ± 0.49 D, and vitreous length increased from 3.18 ± 0.07 mm to 3.26 ± 0.11 mm. The MLR and SLR groups had final ocular refractions that were significantly different from those of the ML and SL groups at 20 weeks (ML vs. MLR: p < 0.0001; SL vs. SLR: p < 0.0001) but were still significantly different from the BL group (BL vs. MLR: p = 0.0120; BL vs. SLR: p = 0.0010). These results suggest that recuperation was not complete after return to BL for 10 weeks.

  12. Accelerated ice-sheet mass loss in Antarctica from 18-year satellite laser ranging measurements

    Directory of Open Access Journals (Sweden)

    Shuanggen Jin

    2016-02-01

    Full Text Available Accurate estimate of the ice-sheet mass balance in Antarctic is very difficult due to complex ice sheet condition and sparse in situ measurements. In this paper, the low-degree gravity field coefficients of up to degree and order 5 derived from Satellite Laser Ranging (SLR measurements are used to determine the ice mass variations in Antarctica for the period 1993–2011. Results show that the ice mass is losing with -36±13 Gt/y in Antarctica, -42±11 Gt/y in the West Antarctica and 6±10 Gt/y in the East Antarctica from 1993 to 2011. The ice mass variations from the SLR 5×5 have a good agreement with the GRACE 5×5, GRACE 5×5 (1&2 and GRACE (60×60 for the entire continent since 2003, but degree 5 from SLR is not sufficient to quantify ice losses in West and East Antarctica, respectively. The rate of ice loss in Antarctica is -28±17 Gt/y for 1993-2002 and -55±17 Gt/y for 2003-2011, indicating significant accelerated ice mass losses since 2003. Furthermore, the results from SLR are comparable with GRACE measurements.

  13. The Water Maser in II Zw 96: Scientific Justification

    Energy Technology Data Exchange (ETDEWEB)

    Wiggins, Brandon Kerry [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-08-06

    We propose a VLBI search to image and locate the water emission in II Zw 96. We propose 3 sites within II Zw 96 for VLBI followup (see the proposed target listing below). We request 2.5 hours of on-source integration time with the VLBA per source. The array will achieve ~ 65µJy sensitivity in K band in this time which will be sufficient to detect luminous water maser features.

  14. Effect of horizontal displacements due to ocean tide loading on the determination of polar motion and UT1

    Science.gov (United States)

    Scherneck, Hans-Georg; Haas, Rüdiger

    We show the influence of horizontal displacements due to ocean tide loading on the determination of polar motion and UT1 (PMU) on the daily and subdaily timescale. So called ‘virtual PMU variations’ due to modelling errors of ocean tide loading are predicted for geodetic Very Long Baseline Interferometry (VLBI) networks. This leads to errors of subdaily determination of PMU. The predicted effects are confirmed by the analysis of geodetic VLBI observations.

  15. Planning for Sea Level Rise: An AGU Talk in the Form of a Co-Production Experiment Exploring Recent Science

    Science.gov (United States)

    Behar, D. H.; Kopp, R. E.; DeConto, R.; Weaver, C. P.; White, K. D.; May, K.; Bindschadler, R.

    2017-12-01

    Global sea level rise (SLR) may present the most urgent climate change adaptation challenge facing coastal communities today. The direction is clear, impacts are manifesting now, and the pace of rise is likely to accelerate. As a result, many coastal communities have begun planning their adaptation response and some are quite far along in the process. At the same time, evolving science provides new observations, models, and understanding of land-ocean dynamics that can increase clarity while also in many ways increase uncertainty about the scope, timing, and regional nature of SLR. The planning, design, and construction of water infrastructure has a relatively long timeline (up to 30 years), and thus the evolution of scientific knowledge presents challenges for communities already planning for SLR based on previous information. When does science become actionable for decision-makers? Are there characteristics or thresholds that could cause communities decide to move from one set of scenarios to another, or change approaches altogether? This talk focuses on two important studies different in kind but dominating the conversation about SLR adaptation planning today. First, DeConto and Pollard (2016) have suggested significantly higher upper end projections for Antarctic ice sheet melt, which increase both global and regional SLR above most previously assumed upper limits. Second, probabilistic projections using model output and expert elicitation as presented in Kopp et al (2014) are increasingly appearing in federal reports and planning-related documents. These two papers are pushing the boundaries of the science-to-planning interface, while the application of this work as actionable science is far from settled. This talk will present the outcome of recent conversations among our diverse author team. The authors are engaged in SLR planning related contexts from many angles and perspectives and include the aforementioned Kopp and DeConto as well as representatives of

  16. Importance of biogeomorphic and spatial properties in assessing a tidal salt marsh vulnerability to sea-level rise

    Science.gov (United States)

    Thorne, Karen M.; Elliott-Fisk, Deborah L.; Wylie, Glenn D.; Perry, William M.; Takekawa, John Y.

    2014-01-01

    We evaluated the biogeomorphic processes of a large (309 ha) tidal salt marsh and examined factors that influence its ability to keep pace with relative sea-level rise (SLR). Detailed elevation data from 1995 and 2008 were compared with digital elevation models (DEMs) to assess marsh surface elevation change during this time. Overall, 37 % (113 ha) of the marsh increased in elevation at a rate that exceeded SLR, whereas 63 % (196 ha) of the area did not keep pace with SLR. Of the total area, 55 % (169 ha) subsided during the study period, but subsidence varied spatially across the marsh surface. To determine which biogeomorphic and spatial factors contributed to measured elevation change, we collected soil cores and determined percent and origin of organic matter (OM), particle size, bulk density (BD), and distance to nearest bay edge, levee, and channel. We then used Akaike Information Criterion (AICc) model selection to assess those variables most important to determine measured elevation change. Soil stable isotope compositions were evaluated to assess the source of the OM. The samples had limited percent OM by weight (-3, indicating that the soils had high mineral content with a relatively low proportion of pore space. The most parsimonious model with the highest AICc weight (0.53) included distance from bay's edge (i.e., lower intertidal) and distance from levee (i.e., upper intertidal). Close proximity to sediment source was the greatest factor in determining whether an area increased in elevation, whereas areas near landward levees experienced subsidence. Our study indicated that the ability of a marsh to keep pace with SLR varied across the surface, and assessing changes in elevation over time provides an alternative method to long-term accretion monitoring. SLR models that do not consider spatial variability of biogeomorphic and accretion processes may not correctly forecast marsh drowning rates, which may be especially true in modified and urbanized

  17. Quantifying Changes in Los Angeles River Breakout Triggered by Sea Level Rise Using a Hydrodynamic Model

    Science.gov (United States)

    Mallakpour, I.; Shakeri Majd, M.; AghaKouchak, A.; Moftakhari, H.; Sadegh, M.; Vahedifard, F.

    2017-12-01

    Sea Level Rise (SLR) has been identified as a global phenomenon that will challenge coastal communities and infrastructures through escalating risk of erosion and subsidence, as well as elevating storm surge heights. Overall, SLR not only increases frequency of future coastal flooding in low-land coastal areas, but also changes flow dynamics in rivers connected to oceans. Changes in flow dynamics (e.g., peaks, flow intensities) can elevate water surface profile locally, leading to river breakout and flooding. Quantifying river breakout provides invaluable information to local authorities when it comes to SLR mitigation and adaptation efforts. Los Angeles River (LAR) which is located in southern part of California is protected with levee systems. The focus of this study is about 18 miles of the river, starting from Pacific Ocean to Downtown Los Angeles, which protects residence and major infrastructures. We use the Hydrologic Engineering Center's River Analysis System (HEC-RAS) to simulate flow and its interactions with coastal water levels. HEC-RAS is capable of simulating flow in one- and two-dimensional systems, resolving Diffusive Wave Equation and Shallow Water Equation, respectively. In this study, the hydraulic model consists of one- and two-dimensional models connected through the LAR's levee system. This approach enables us to identify the onset of river breakout location alongside the LAR. The inflow data incorporated into the model obtained from a gage records and represents a significant event occurred in February 2005. This model utilizes a detail terrain model with 0.3 m LiDAR data. In order to explore effects of SLR associated with future climate changes on LAR and its levee system, two Representative Concentration Pathways (RCP of 4.5 and 8.5) are considered. Based on our RCPs, 24 projected SLRs are computed for future years (2030, 2050, and 2100) for three different quantiles. Our simulation results show SLR, which varies from 0.05 to 2.8 m, causes

  18. Predicting habitat distribution to conserve seagrass threatened by sea level rise

    Science.gov (United States)

    Saunders, M. I.; Baldock, T.; Brown, C. J.; Callaghan, D. P.; Golshani, A.; Hamylton, S.; Hoegh-guldberg, O.; Leon, J. X.; Lovelock, C. E.; Lyons, M. B.; O'Brien, K.; Mumby, P.; Phinn, S. R.; Roelfsema, C. M.

    2013-12-01

    Sea level rise (SLR) over the 21st century will cause significant redistribution of valuable coastal habitats. Seagrasses form extensive and highly productive meadows in shallow coastal seas support high biodiversity, including economically valuable and threatened species. Predictive habitat models can inform local management actions that will be required to conserve seagrass faced with multiple stressors. We developed novel modelling approaches, based on extensive field data sets, to examine the effects of sea level rise and other stressors on two representative seagrass habitats in Australia. First, we modelled interactive effects of SLR, water clarity and adjacent land use on estuarine seagrass meadows in Moreton Bay, Southeast Queensland. The extent of suitable seagrass habitat was predicted to decline by 17% by 2100 due to SLR alone, but losses were predicted to be significantly reduced through improvements in water quality (Fig 1a) and by allowing space for seagrass migration with inundation. The rate of sedimentation in seagrass strongly affected the area of suitable habitat for seagrass in sea level rise scenarios (Fig 1b). Further research to understand spatial, temporal and environmental variability of sediment accretion in seagrass is required. Second, we modelled changes in wave energy distribution due to predicted SLR in a linked coral reef and seagrass ecosystem at Lizard Island, Great Barrier Reef. Scenarios where the water depth over the coral reef deepened due to SLR and minimal reef accretion, resulted in larger waves propagating shoreward, changing the existing hydrodynamic conditions sufficiently to reduce area of suitable habitat for seagrass. In a scenario where accretion of the coral reef was severely compromised (e.g. warming, acidification, overfishing), the probability of the presence of seagrass declined significantly. Management to maintain coral health will therefore also benefit seagrasses subject to SLR in reef environments. Further

  19. Impact of sea-level rise on Everglades carbon storage capacity in the Holocene

    Science.gov (United States)

    Jones, M.; Bernhardt, C. E.; Wingard, G. L. L.; Keller, K.; Stackhouse, B.; Landacre, B.

    2017-12-01

    Sea-level rise (SLR) and climate have driven environmental changes in South Florida over time. Florida Bay, a shallow carbonate bay located to the south of the Florida Peninsula, contains carbonate islands and mudbanks that formed over the last few thousand years and once comprised the freshwater Everglades. The islands, often ringed with mangroves, provide wildlife habitat, physical barriers to storm surge, tidal flux, and wave development along South Florida's coastline. Because most of South Florida is only 1-2 m above mean sea level, and IPCC AR5 projections of 0.26 to 0.98 m of SLR by 2100, vertical accommodation space could outpace sediment accretion in the southern freshwater Everglades and Florida Bay islands, impacting carbon (C) storage, as well as wildlife habitat and the ability to protect shorelines from coastal storms. We analyzed sediment cores that reached the Plio-Pleistocene limestone bedrock from four islands in Florida Bay to determine how floral and faunal communities and source C change in response to Holocene sea level transgression. We used pollen and mollusk assemblages, δ13C, and C/N ratios, along with radiometric dating, bulk density, and organic C content to calculate changes in C accumulation rates (CAR) over the last 4 ka, as deposition transitioned from freshwater peat to estuarine carbonate mud, to mangrove peat and ultimately to the hyper-saline playa-like carbonate sediments deposited today. Results show that CAR are more than twice as high in the basal freshwater Everglades peat than in the overlying estuarine sediments and slightly greater than the short-lived period of Rhizophora (red mangrove) peat accumulation. Avicennia (black mangrove) and playa-like environments have similar CAR as the estuarine carbonate mud and hypersaline carbonate sediments but accretion rates are less than the current rate of SLR. These results suggest that with current rates of accretion and SLR, these islands could disappear in <200 years, and the C

  20. Hurricane Matthew (2016) and its Storm Surge Inundation under Global Warming Scenarios: Application of an Interactively Coupled Atmosphere-Ocean Model

    Science.gov (United States)

    Jisan, M. A.; Bao, S.; Pietrafesa, L.; Pullen, J.

    2017-12-01

    An interactively coupled atmosphere-ocean model was used to investigate the impacts of future ocean warming, both at the surface and the layers below, on the track and intensity of a hurricane and its associated storm surge and inundation. The category-5 hurricane Matthew (2016), which made landfall on the South Carolina coast of the United States, was used for the case study. Future ocean temperature changes and sea level rise (SLR) were estimated based on the projection of Inter-Governmental Panel on Climate Change (IPCC)'s Representative Concentration Pathway scenarios RCP 2.6 and RCP 8.5. After being validated with the present-day observational data, the model was applied to simulate the changes in track, intensity, storm surge and inundation that Hurricane Matthew would cause under future climate change scenarios. It was found that a significant increase in hurricane intensity, storm surge water level, and inundation area for Hurricane Matthew under future ocean warming and SLR scenarios. For example, under the RCP 8.5 scenario, the maximum wind speed would increase by 17 knots (14.2%), the minimum sea level pressure would decrease by 26 hPa (2.85%), and the inundated area would increase by 401 km2 (123%). By including the effect of SLR for the middle-21st-century scenario, the inundated area will further increase by up to 49.6%. The increase in the hurricane intensity and the inundated area was also found for the RCP 2.6 scenario. The response of sea surface temperature was analyzed to investigate the change in intensity. A comparison was made between the impacts when only the sea surface warming is considered versus when both the sea surface and the underneath layers are considered. These results showed that even without the effect of SLR, the storm surge level and the inundated area would be higher due to the increased hurricane intensity under the influence of the future warmer ocean temperature. The coupled effect of ocean warming and SLR would cause the

  1. Actionable Science for Sea Level Rise and Coastal Flooding to Help Avoid Maladaptation

    Science.gov (United States)

    Buchanan, M. K.

    2017-12-01

    Rising sea levels increase the frequency of flooding at all levels, from nuisance to extreme, along coastlines across the world. Although recent flooding has increased the saliency of sea level rise (SLR) and the risks it presents to governments and communities, the effect of SLR on coastal hazards is complex and filled with uncertainty that is often uncomfortable for decision-makers. Although it is certain that SLR is occurring and will continue, its rate remains ambiguous. Because extreme flooding is by definition rare, there is also uncertainty in the effect of natural variability on flood frequency. These uncertainties pose methodological obstacles for integrating SLR into flood hazard projections and risk management. A major challenge is how to distill this complexity into information geared towards public sectors to help inform adaptation decision-making. Because policy windows are limited, budgets are tight, and decisions may have long-term consequences, it is especially important that this information accounts for uncertainty to help avoid damage and maladaptation. The U.S. Global Research Program, and others, describe this type of science—data and tools that help decision-makers plan for climate change impacts—as actionable [1]. We produce actionable science to support decision-making for adaptation to coastal impacts, despite uncertainty in projections of SLR and flood frequency. We found that SLR will boost the occurrence of minor rather than severe flooding in some regions of the U.S., while in other regions the reverse is true. For many cities, the current ten-year flood level will become a regular occurrence as the century progresses and by 2100 will occur every few days for some cities. This creates a mismatch with current planning in some cases. For example, a costly storm surge barrier may be built to protect parts of New York City from extreme flood levels but these are not often used because they are expensive to operate and obstructive to

  2. Open versus closed kinetic chain exercises for patellar chondromalacia.

    Science.gov (United States)

    Bakhtiary, A H; Fatemi, E

    2008-02-01

    Conservative treatment of patellar chondromalacia has been the subject of several studies. One recommended treatment is a strengthening exercise of the quadriceps muscle, which may be performed in closed or open kinetic chains. This study was designed to compare the effect of straight leg raise (SLR) and semi-squat exercises on the treatment of patellar chondromalacia, which has not been done to date. 32 female university students with a diagnosis of patellar chondromalacia were randomly assigned to two experimental groups: SLR and semi-squat exercise. Before starting exercise protocols, Q angle, maximal isometric voluntary contraction force (MIVCF) of quadriceps, crepitation, circumference of thigh 5 and 10 cm above the patella and patellofemoral pain according to the visual analogue scale (VAS) were assessed. Both groups then followed a 3-week programme of quadriceps muscle strengthening exercises (SLR or semi-squat) starting with 20 exercises twice a day and increasing each session by 5 exercises every 2 days. All measurements were repeated at the end of each week and then again 2 weeks after the 3-week exercise programme. Reduced Q angle (mean differences (SD) 0.8 (0.3), p = 0.016) and crepitation (19.9 (8.5), p = 0.04), and an increase in the MIVCF of the quadriceps (15.8 (5.6), p = 0.01) and thigh circumference (1.5 (0.3), p = 0.001) were found in semi-squat group compared with SLR group. However, patellofemoral pain was decreased significantly in both groups. The results of this study indicate that semi-squat exercises (closed kinetic chain) are more effective than SLR exercise (open kinetic chain) in the treatment of patellar chondromalacia. More studies are needed to investigate the long-term effect of these types of exercise.

  3. Predicting Impacts of tropical cyclones and sea-Level rise on beach mouse habitat

    Science.gov (United States)

    Chen, Qin; Wang, Hongqing; Wang, Lixia; Tawes, Robert; Rollman, Drew

    2014-01-01

    Alabama beach mouse (ABM) (Peromyscus polionotus ammobates) is an important component of the coastal dune ecosystem along the Gulf of Mexico. Due to habitat loss and degradation, ABM is federally listed as an endangered species. In this study, we examined the impacts of storm surge and wind waves, which are induced by hurricanes and sea-level rise (SLR), on the ABM habitat on Fort Morgan Peninsula, Alabama, using advanced storm surge and wind wave models and spatial analysis tools in geographic information systems (GIS). Statistical analyses of the long-term historical data enabled us to predict the extreme values of winds, wind waves, and water levels in the study area at different return periods. We developed a series of nested domains for both wave and surge modeling and validated the models using field observations of surge hydrographs and high watermarks of Hurricane Ivan (2004). We then developed wave atlases and flood maps corresponding to the extreme wind, surge and waves without SLR and with a 0.5 m of SLR by coupling the wave and surge prediction models. The flood maps were then merged with a map of ABM habitat to determine the extent and location of habitat impacted by the 100-year storm with and without SLR. Simulation results indicate that more than 82% of ABM habitat would be inundated in such an extreme storm event, especially under SLR, making ABM populations more vulnerable to future storm damage. These results have aided biologists, community planners, and other stakeholders in the identification, restoration and protection of key beach mouse habitat in Alabama. Methods outlined in this paper could also be used to assist in the conservation and recovery of imperiled coastal species elsewhere.

  4. Modeled Sea Level Rise Impacts on Coastal Ecosystems at Six Major Estuaries on Florida's Gulf Coast: Implications for Adaptation Planning.

    Science.gov (United States)

    Geselbracht, Laura L; Freeman, Kathleen; Birch, Anne P; Brenner, Jorge; Gordon, Doria R

    2015-01-01

    The Sea Level Affecting Marshes Model (SLAMM) was applied at six major estuaries along Florida's Gulf Coast (Pensacola Bay, St. Andrews/Choctawhatchee Bays, Apalachicola Bay, Southern Big Bend, Tampa Bay and Charlotte Harbor) to provide quantitative and spatial information on how coastal ecosystems may change with sea level rise (SLR) and to identify how this information can be used to inform adaption planning. High resolution LiDAR-derived elevation data was utilized under three SLR scenarios: 0.7 m, 1 m and 2 m through the year 2100 and uncertainty analyses were conducted on selected input parameters at three sites. Results indicate that the extent, spatial orientation and relative composition of coastal ecosystems at the study areas may substantially change with SLR. Under the 1 m SLR scenario, total predicted impacts for all study areas indicate that coastal forest (-69,308 ha; -18%), undeveloped dry land (-28,444 ha; -2%) and tidal flat (-25,556 ha; -47%) will likely face the greatest loss in cover by the year 2100. The largest potential gains in cover were predicted for saltmarsh (+32,922 ha; +88%), transitional saltmarsh (+23,645 ha; na) and mangrove forest (+12,583 ha; +40%). The Charlotte Harbor and Tampa Bay study areas were predicted to experience the greatest net loss in coastal wetlands The uncertainty analyses revealed low to moderate changes in results when some numerical SLAMM input parameters were varied highlighting the value of collecting long-term sedimentation, accretion and erosion data to improve SLAMM precision. The changes predicted by SLAMM will affect exposure of adjacent human communities to coastal hazards and ecosystem functions potentially resulting in impacts to property values, infrastructure investment and insurance rates. The results and process presented here can be used as a guide for communities vulnerable to SLR to identify and prioritize adaptation strategies that slow and/or accommodate the changes underway.

  5. Constraining the radio jet proper motion of the high-redshift quasar J2134-0419 at z = 4.3

    Science.gov (United States)

    Perger, Krisztina; Frey, Sándor; Gabányi, Krisztina É.; An, Tao; Britzen, Silke; Cao, Hong-Min; Cseh, Dávid; Dennett-Thorpe, Jane; Gurvits, Leonid I.; Hong, Xiao-Yu; Hook, Isobel M.; Paragi, Zsolt; Schilizzi, Richard T.; Yang, Jun; Zhang, Yingkang

    2018-06-01

    To date, PMN J2134-0419 (at a redshift z = 4.33) is the second most distant quasar known with a milliarcsecond-scale morphology permitting direct estimates of the jet proper motion. Based on two-epoch observations, we constrained its radio jet proper motion using the very long baseline interferometry (VLBI) technique. The observations were conducted with the European VLBI Network (EVN) at 5 GHz on 1999 November 26 and 2015 October 6. We imaged the central 10-pc scale radio jet emission and modelled its brightness distribution. By identifying a jet component at both epochs separated by 15.86 yr, a proper motion of μ = 0.035 ± 0.023 mas yr-1 is found. It corresponds to an apparent superluminal speed of βa = 4.1 ± 2.7 c. Relativistic beaming at both epochs suggests that the jet viewing angle with respect to the line of sight is smaller than 20°, with a minimum bulk Lorentz factor Γ = 4.3. The small value of the proper motion is in good agreement with the expectations from the cosmological interpretation of the redshift and the current cosmological model. Additionally we analysed archival Very Large Array observations of J2143-0419 and found indication of a bent jet extending to ˜30 kpc.

  6. Separation of atmospheric, oceanic and hydrological polar motion excitation mechanisms based on a combination of geometric and gravimetric space observations

    Science.gov (United States)

    Göttl, F.; Schmidt, M.; Seitz, F.; Bloßfeld, M.

    2015-04-01

    The goal of our study is to determine accurate time series of geophysical Earth rotation excitations to learn more about global dynamic processes in the Earth system. For this purpose, we developed an adjustment model which allows to combine precise observations from space geodetic observation systems, such as Satellite Laser Ranging (SLR), Global Navigation Satellite Systems, Very Long Baseline Interferometry, Doppler Orbit determination and Radiopositioning Integrated on Satellite, satellite altimetry and satellite gravimetry in order to separate geophysical excitation mechanisms of Earth rotation. Three polar motion time series are applied to derive the polar motion excitation functions (integral effect). Furthermore we use five time variable gravity field solutions from Gravity Recovery and Climate Experiment to determine not only the integral mass effect but also the oceanic and hydrological mass effects by applying suitable filter techniques and a land-ocean mask. For comparison the integral mass effect is also derived from degree 2 potential coefficients that are estimated from SLR observations. The oceanic mass effect is also determined from sea level anomalies observed by satellite altimetry by reducing the steric sea level anomalies derived from temperature and salinity fields of the oceans. Due to the combination of all geodetic estimated excitations the weaknesses of the individual processing strategies can be reduced and the technique-specific strengths can be accounted for. The formal errors of the adjusted geodetic solutions are smaller than the RMS differences of the geophysical model solutions. The improved excitation time series can be used to improve the geophysical modeling.

  7. The most remote point method for the site selection of the future GGOS network

    Science.gov (United States)

    Hase, Hayo; Pedreros, Felipe

    2014-10-01

    The Global Geodetic Observing System (GGOS) proposes 30-40 geodetic observatories as global infrastructure for the most accurate reference frame to monitor the global change. To reach this goal, several geodetic observatories have upgrade plans to become GGOS stations. Most initiatives are driven by national institutions following national interests. From a global perspective, the site distribution remains incomplete and the initiatives to improve this are up until now insufficient. This article is a contribution to answer the question on where to install new GGOS observatories and where to add observation techniques to existing observatories. It introduces the iterative most remote point (MRP) method for filling in the largest gaps in existing technique-specific networks. A spherical version of the Voronoi-diagram is used to pick the optimal location of the new observatory, but practical concerns determine its realistic location. Once chosen, the process is iterated. A quality and a homogeneity parameter of global networks measure the progress of improving the homogeneity of the global site distribution. This method is applied to the global networks of VGOS, and VGOS co-located with SLR to derive some clues about where additional observatory sites or additional observation techniques at existing observatories will improve the GGOS network configuration. With only six additional VGOS-stations, the homogeneity of the global VGOS-network could be significantly improved by more than . From the presented analysis, 25 known or new co-located VGOS and SLR sites are proposed as the future GGOS backbone: Colombo, Easter Island, Fairbanks, Fortaleza, Galapagos, GGAO, Hartebeesthoek, Honiara, Ibadan, Kokee Park, La Plata, Mauritius, McMurdo, Metsahövi, Ny Alesund, Riyadh, San Diego, Santa Maria, Shanghai, Syowa, Tahiti, Tristan de Cunha, Warkworth, Wettzell, and Yarragadee.

  8. Assessing sea-level rise impact on saltwater intrusion into the root zone of a geo-typical area in coastal east-central Florida.

    Science.gov (United States)

    Xiao, Han; Wang, Dingbao; Medeiros, Stephen C; Hagen, Scott C; Hall, Carlton R

    2018-07-15

    Saltwater intrusion (SWI) into root zone in low-lying coastal areas can affect the survival and spatial distribution of various vegetation species by altering plant communities and the wildlife habitats they support. In this study, a baseline model was developed based on FEMWATER to simulate the monthly variation of root zone salinity of a geo-typical area located at the Cape Canaveral Barrier Island Complex (CCBIC) of coastal east-central Florida (USA) in 2010. Based on the developed and calibrated baseline model, three diagnostic FEMWATER models were developed to predict the extent of SWI into root zone by modifying the boundary values representing the rising sea level based on various sea-level rise (SLR) scenarios projected for 2080. The simulation results indicated that the extent of SWI would be insignificant if SLR is either low (23.4cm) or intermediate (59.0cm), but would be significant if SLR is high (119.5cm) in that infiltration/diffusion of overtopping seawater in coastal low-lying areas can greatly increase root zone salinity level, since the sand dunes may fail to prevent the landward migration of seawater because the waves of the rising sea level can reach and pass over the crest under high (119.5cm) SLR scenario. Copyright © 2018 Elsevier B.V. All rights reserved.

  9. Joint Projections of US East Coast Sea Level and Storm Surge

    Science.gov (United States)

    Little, Christopher M.; Horton, Radley M.; Kopp, Robert E.; Oppenheimer, Michael; Vecchi, Gabriel A.; Villarini, Gabriele

    2015-01-01

    Future coastal flood risk will be strongly influenced by sea-level rise (SLR) and changes in the frequency and intensity of tropical cyclones. These two factors are generally considered independently. Here, we assess twenty-first century changes in the coastal hazard for the US East Coast using a flood index (FI) that accounts for changes in flood duration and magnitude driven by SLR and changes in power dissipation index (PDI, an integrated measure of tropical cyclone intensity, frequency and duration). Sea-level rise and PDI are derived from representative concentration pathway (RCP) simulations of 15 atmosphere- ocean general circulation models (AOGCMs). By 2080-2099, projected changes in the FI relative to 1986-2005 are substantial and positively skewed: a 10th-90th percentile range 4-75 times higher for RCP 2.6 and 35-350 times higher for RCP 8.5. High-end Fl projections are driven by three AOGCMs that project the largest increases in SLR, PDI and upper ocean temperatures. Changes in PDI are particularly influential if their intra-model correlation with SLR is included, increasing the RCP 8.5 90th percentile FI by a further 25%. Sea-level rise from other, possibly correlated, climate processes (for example, ice sheet and glacier mass changes) will further increase coastal flood risk and should be accounted for in comprehensive assessments.

  10. Synthesis imaging in radio astronomy

    International Nuclear Information System (INIS)

    Perley, R.A.; Schwab, F.R.; Bridle, A.H.

    1989-01-01

    Recent advances in techniques and instrumentation for radio synthesis imaging in astronomy are discussed in a collection of review essays. Topics addressed include coherence in radio astronomy, the interferometer in practice, primary antenna elements, cross correlators, calibration and editing, sensitivity, deconvolution, self-calibration, error recognition, and image analysis. Consideration is given to wide-field imaging (bandwidth and time-average smearing, noncoplanar arrays, and mosaicking), high-dynamic-range imaging, spectral-line imaging, VLBI, solar imaging with a synthesis telescope, synthesis imaging of spatially coherent objects, noise in images of very bright sources, synthesis observing strategies, and the design of aperture-synthesis arrays

  11. Radio propagation through the turbulent interstellar plasma

    International Nuclear Information System (INIS)

    Rickett, B.J.

    1990-01-01

    The current understanding of interstellar scattering is reviewed, and its impact on radio astronomy is examined. The features of interstellar plasma turbulence are also discussed. It is concluded that methods involving the investigation of the flux variability of pulsars and extragalactic sources and the VLBI visibility curves constitute new techniques for probing the ISM. However, scattering causes a seeing limitation in radio observations. It is now clear that variation due to RISS (refractive interstellar scintillations) is likely to be important for several classes of variable sources, especially low-frequency variables and centimeter-wave flickering. 168 refs

  12. Empirical model of subdaily variations in the Earth rotation from GPS and its stability

    Science.gov (United States)

    Panafidina, N.; Kurdubov, S.; Rothacher, M.

    2012-12-01

    The model recommended by the IERS for these variations at diurnal and semidiurnal periods has been computed from an ocean tide model and comprises 71 terms in polar motion and Universal Time. In the present study we compute an empirical model of variations in the Earth rotation on tidal frequencies from homogeneously re-processed GPS-observations over 1994-2007 available as free daily normal equations. We discuss the reliability of the obtained amplitudes of the ERP variations and compare results from GPS and VLBI data to identify technique-specific problems and instabilities of the empirical tidal models.

  13. Radio emission from Supernovae and High Precision Astrometry

    Science.gov (United States)

    Perez-Torres, M. A.

    1999-11-01

    The present thesis work makes contributions in two scientific fronts: differential astrometry over the largest angular scales ever attempted (approx. 15 arcdegrees) and numerical simulations of radio emission from very young supernovae. In the first part, we describe the results of the use of very-long-baseline interferometry (VLBI) in one experiment designed to measure with very high precision the angular distance between the radio sources 1150+812 (QSO) and 1803+784 (BL Lac). We observed the radio sources on 19 November 1993 using an intercontinental array of radio telescopes, which simultaneously recorded at 2.3 and 8.4 GHz. VLBI differential astrometry is capable, Nature allowing, of yielding source positions with precisions well below the milliarcsecond level. To achieve this precision, we first had to accurately model the rotation of the interferometric fringes via the most precise models of Earth Orientation Parameters (EOP; precession, polar motion and UT1, nutation). With this model, we successfully connected our phase delay data at both frequencies and, using difference astrometric techniques, determined the coordinates of 1803+784 relative to those of 1150+812-within the IERS reference frame--with an standard error of about 0.6 mas in each coordinate. We then corrected for several effects including propagation medium (mainly the atmosphere and ionosphere), and opacity and source-structure effects within the radio sources. We stress that our dual-frequency measurements allowed us to accurately subtract the ionosphere contribution from our data. We also used GPS-based TEC measurements to independently find the ionosphere contribution, and showed that these contributions agree with our dual-frequency measurements within about 2 standard deviations in the less favorables cases (the longest baselines), but are usually well within one standard deviation. Our estimates of the relative positions, whether using dual-frequency-based or GPS-based ionosphere

  14. Mass loss of the Greenland Ice Sheet since the Little Ice Age, implications on sea level

    DEFF Research Database (Denmark)

    Kjeldsen, K. K.; Bjork, A. A.; Khan, Shfaqat Abbas

    The impact of mass loss from the Greenland Ice Sheet (GrIS) on 20th Century sea level rise (SLR) has long been subject to intense discussions. While globally distributed tide gauges suggest a global mean SLR of 15-20 cm, quantifying the separate components is of great concern - in particular...... for modeling sea level projections into the 21st Century. Estimates of the past GrIS contribution to SLR have been derived using a number of different approaches, e.g. surface mass balance (SMB) calculations combined with estimates of ice discharge found by in correlating SMB anomalies and calving rates. Here......-2010, NASA's Ice, Cloud, and land Elevation Satellite (ICESat) from 2003-2009, and NASA's Land, Vegetation, and Ice Sensor (LVIS) from 2010, to estimate mass loss throughout the 20th and early 21st Century. We present mass balance estimates of the GrIS since retreat commence from the maximum extent...

  15. Short-term pressure induced suppression of the short-latency response: a new methodology for investigating stretch reflexes

    DEFF Research Database (Denmark)

    Leukel, Christian; Lundbye-Jensen, Jesper; Gruber, Markus

    2009-01-01

    During experiments involving ischemic nerve block, we noticed that the short-latency response (SLR) of evoked stretches in m. soleus decreased immediately following inflation of a pneumatic cuff surrounding the lower leg. The present study aimed to investigate this short-term effect of pressure......) were recorded. Additionally, stretches were applied with different velocities and amplitudes. Finally, the SLR was investigated during hopping and in two protocols that modified the ability of the muscle-tendon complex distal to the cuff to stretch. All measurements were performed with deflated...

  16. VizieR Online Data Catalog: The VLBA Extragalactic Proper Motion Catalog (Truebenbach+, 2017)

    Science.gov (United States)

    Truebenbach, A. E.; Darling, J.

    2017-11-01

    We created our catalog of extragalactic radio proper motions using the 2017a Goddard VLBI global solution. The 2017a solution is computed from more than 30 years of dual-band VLBI observations --1979 August 3 to 2017 March 27. We also observed 28 objects with either no redshift or a "questionable" Optical Characteristic of Astrometric Radio Sources (OCARS; Malkin 2016ARep...60..996M) redshift at the Apache Point Observatory (APO) 3.5m telescope and/or at Gemini North. We conducted observations on the 3.5m telescope at Apache Point Observatory with the Dual Imaging Spectrograph (DIS) from 2015 April 18 to 2016 June 30. We chose two objects for additional observations with the Gemini Multi-Object Spectrograph-North (GMOS-N) at Gemini North Observatory. 2021+317 was observed on 2016 June 26 and 28, while 0420+417 was observed on 2016 November 8 and 26. We also observed 42 radio sources with the Very Long Baseline Array (VLBA) in the X-band (3.6cm/8.3GHz). Our targets had all been previously observed by VLBI. Our VLBA observations were conducted in two campaigns from 2015 September to 2016 January and 2016 October to November. The final extragalactic proper motion catalog (created primarily from archival Goddard VLBI data, with redshifts obtained from OCARS) contains 713 proper motions with average uncertainties of 24μas/yr. (5 data files).

  17. Atmospheric pressure loading parameters from very long baseline interferometry observations

    Science.gov (United States)

    Macmillan, D. S.; Gipson, John M.

    1994-01-01

    Atmospheric mass loading produces a primarily vertical displacement of the Earth's crust. This displacement is correlated with surface pressure and is large enough to be detected by very long baseline interferometry (VLBI) measurements. Using the measured surface pressure at VLBI stations, we have estimated the atmospheric loading term for each station location directly from VLBI data acquired from 1979 to 1992. Our estimates of the vertical sensitivity to change in pressure range from 0 to -0.6 mm/mbar depending on the station. These estimates agree with inverted barometer model calculations (Manabe et al., 1991; vanDam and Herring, 1994) of the vertical displacement sensitivity computed by convolving actual pressure distributions with loading Green's functions. The pressure sensitivity tends to be smaller for stations near the coast, which is consistent with the inverted barometer hypothesis. Applying this estimated pressure loading correction in standard VLBI geodetic analysis improves the repeatability of estimated lengths of 25 out of 37 baselines that were measured at least 50 times. In a root-sum-square (rss) sense, the improvement generally increases with baseline length at a rate of about 0.3 to 0.6 ppb depending on whether the baseline stations are close to the coast. For the 5998-km baseline from Westford, Massachusetts, to Wettzell, Germany, the rss improvement is about 3.6 mm out of 11.0 mm. The average rss reduction of the vertical scatter for inland stations ranges from 2.7 to 5.4 mm.

  18. Increasing Public Access to Scientific Research through Stakeholder Involvement: Ecological Effects of Sea Level Rise in the Northern Gulf of Mexico

    Science.gov (United States)

    Hagen, S. C.; Stephens, S. H.; DeLorme, D. E.; Ruple, D.; Graham, L.

    2013-12-01

    Sea level rise (SLR) has the potential to have a myriad of deleterious effects on coastal ecology and human infrastructure. Stakeholders, including managers of coastal resources, must be aware of potential consequences of SLR and adjust their plans accordingly to protect and preserve the resources under their care. Members of the public, particularly those who live or work in coastal areas, should also be informed about the results of scientific research on the effects of SLR. However, research results are frequently published in venues or formats to which resource managers and the broader public have limited access. It is imperative for scientists to move beyond traditional publication venues in order to more effectively disseminate the results of their research (Dennison, W. 2007, Estu. Coast. Shelf Sci. 77, 185). One potentially effective way to advance public access to research is to incorporate stakeholder involvement into the research project process in order to target study objectives and tailor communication products toward stakeholder needs (Lemos, M. & Morehouse, B. 2005, Glob. Env. Chg. 15, 57). However, it is important to manage communication and clarify participant expectations during this type of research (Gawith, M. et al. 2009, Glob. Env. Chg. 19, 113). This presentation describes the process being undertaken by an ongoing 5-year multi-disciplinary NOAA-funded project, Ecological Effects of Sea Level Rise in the Northern Gulf of Mexico (EESLR-NGOM), to improve accessibility and utility of scientific research results through stakeholder engagement. The EESLR-NGOM project is assessing the ecological risks from SLR along the Mississippi, Alabama and Florida Panhandle coasts, coastal habitats, and floodplains. It has incorporated stakeholder involvement throughout the research process so as to better target and tailor the emerging research products to meet resource managers' needs, as well as to facilitate eventual public dissemination of results. An

  19. Acute effect of different time periods of passive static stretching on the hamstring flexibility.

    Science.gov (United States)

    Cini, Anelize; de Vasconcelos, Gabriela Souza; Lima, Claudia Silveira

    2017-01-01

    Several factors are associated with the presence of chronic low back pain; one of them is the flexibility of the hamstring muscles that influences the posture of the pelvic spine. Investigate the influence of two different time periods of passive static stretching on the flexibility of the hamstring. Forty-six physiotherapy students were divided into two groups performing stretching exercises: 30 s and 60 s duration. The collections consisted of: (1) pre-test: evaluation of the flexibility of the hip and knee, using a manual goniometer by means of the following tests: Straight Leg Raise Test (SLR), Passive Hip Flexion Test (PHFT) and Modified Knee Extension Test (MKET), (2) intervention: stretching with different runtimes, (3) post-test: reappraisal of flexibility, conducted immediately after the intervention. Significant difference was observed intra groups, group that did stretching exercises lasting 30 seconds (G30) (SLR p = 0.000. PHFT p = 0.003 and MKET p = 0.000) and group that did stretching exercises lasting 60 seconds (G60) (SLR p = 0.000. PHFT p = 0.001 and MKET p = 0.002). Comparing the groups, no significant difference was found (SLR p = 0.307; PHFT p = 0.904; MKET p = 0.132). Thus it can be inferred that 30 seconds are sufficient for increased flexibility of young women. Therefore the time-treatment sessions can be optimized. Only the acute effect of stretching was observed; further investigation of the long-term effect is required.

  20. A Case Study of Preliminary Cost-Benefit Analysis of Building Levees to Mitigate the Joint Effects of Sea Level Rise and Storm Surge

    Directory of Open Access Journals (Sweden)

    Binbin Peng

    2018-02-01

    Full Text Available Sea-level rise (SLR will magnify the impacts of storm surge; the resulting severe flooding and inundation can cause huge damage to coastal communities. Community leaders are considering implementing adaptation strategies, typically hard engineering projects, to protect coastal assets and resources. It is important to understand the costs and benefits of the proposed project before any decision is made. To mitigate the flooding impact of joint effects of storm surge and SLR, building levee segments is chosen to be a corresponding adaptation strategy to protect the real estate assets in the study area—the City of Miami, FL, USA. This paper uses the classic Cost-Benefit Analysis (CBA to assess the cost efficiency and proposes corresponding improvements in the benefit estimation, by estimating the avoided damages of implementing levee projects. Results show that the city will benefit from implementing levee projects along the Miami River in both a one-time 10 year storm event with SLR and cumulative long-term damage scenarios. This study also suggests that conducting CBA is a critical process before making coastal adaptation planning investment. A more meaningful result of cost effectiveness is estimated by accounting for the appreciation and time value. In addition, a sensitivity analysis is conducted to verify how the choice of discount rate influences the result. Uncertain factors including the rate of SLR, storm intensification, land use changes, and real estate appreciation are further analyzed.

  1. Brackish marsh zones as a waterfowl habitat resource in submerged aquatic vegetation beds in the northern Gulf of Mexico

    Science.gov (United States)

    DeMarco, Kristin; Hillmann, Eva R.; Brasher, Michael G.; LaPeyre, Megan K.

    2016-01-01

    Submerged aquatic vegetation (SAV) beds are shallow coastal habitats that are increasingly exposed to the effects of sea-level rise (SLR). In the northern Gulf of Mexico (nGoM), an area especially vulnerable to SLR, the abundance and distribution of SAV food resources (seeds, rhizomes, and tissue) can influence the carrying capacity of coastal marshes to support wintering waterfowl. Despite the known importance of SAV little is known about their distribution across coastal landscapes and salinity zones or how they may be impacted by SLR. We estimated SAV cover and seed biomass in coastal marshes from Texas to Alabama from 1 June – 15 September 2013 to assess variation in SAV and seed resource distribution and abundance across the salinity gradient. Percent cover of SAV was similar among salinity zones (10%–20%) although patterns of distribution differed. Specifically, SAV occurred less frequently in saline zones, but when present the percent coverage was greater than in fresh, intermediate and brackish. Mean seed biomass varied greatly and did not differ significantly among salinity zones. However, when considering only seed species identified as waterfowl foods, the mean seed biomass was lower in saline zones (1.2 g m–2). Alteration of nGoM marshes due to SLR will likely shift the distribution and abundance of SAV resources, and these shifts may affect carrying capacity of coastal marshes for waterfowl and other associated species.

  2. Systematic effects in LOD from SLR observations

    Science.gov (United States)

    Bloßfeld, Mathis; Gerstl, Michael; Hugentobler, Urs; Angermann, Detlef; Müller, Horst

    2014-09-01

    Beside the estimation of station coordinates and the Earth’s gravity field, laser ranging observations to near-Earth satellites can be used to determine the rotation of the Earth. One parameter of this rotation is ΔLOD (excess Length Of Day) which describes the excess revolution time of the Earth w.r.t. 86,400 s. Due to correlations among the different parameter groups, it is difficult to obtain reliable estimates for all parameters. In the official ΔLOD products of the International Earth Rotation and Reference Systems Service (IERS), the ΔLOD information determined from laser ranging observations is excluded from the processing. In this paper, we study the existing correlations between ΔLOD, the orbital node Ω, the even zonal gravity field coefficients, cross-track empirical accelerations and relativistic accelerations caused by the Lense-Thirring and deSitter effect in detail using first order Gaussian perturbation equations. We found discrepancies due to different a priories by using different gravity field models of up to 1.0 ms for polar orbits at an altitude of 500 km and up to 40.0 ms, if the gravity field coefficients are estimated using only observations to LAGEOS 1. If observations to LAGEOS 2 are included, reliable ΔLOD estimates can be achieved. Nevertheless, an impact of the a priori gravity field even on the multi-satellite ΔLOD estimates can be clearly identified. Furthermore, we investigate the effect of empirical cross-track accelerations and the effect of relativistic accelerations of near-Earth satellites on ΔLOD. A total effect of 0.0088 ms is caused by not modeled Lense-Thirring and deSitter terms. The partial derivatives of these accelerations w.r.t. the position and velocity of the satellite cause very small variations (0.1 μs) on ΔLOD.

  3. The intelligent brake: SBS brakes safely and comfortably in all situations; Die intelligente Bremse: SBS verzoegert stets sicher und komfortabel

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1999-07-01

    The Vision SLR study demonstrates the technology with which DaimlerChrysler vehicles will be equipped in the next century. The car that won the Gran Turismo incorporates the Sensortronic Brake System (SBS), an electrohydraulic braking system for optimum safety and comfort even in critical situations. [German] Die Fahrzeugstudie Vision SLR demonstriert eindrucksvoll die Technik, mit der DaimlerChrysler Fahrzeuge des kommenden Jahrhunderts ausstatten wird. Eine Besonderheit des Gran Turismo-Silberpfeils: das Sensortronic Brake System (SBS), ein elektrohydraulisches Bremssystem, das auch in kritischen Situationen optimale Fahrsicherheit und Komfort bietet. (orig.)

  4. Sea level rise in the Arctic Ocean

    OpenAIRE

    Proshutinsky, Andrey; Pavlov, Vladimir; Bourke, Robert H.

    2001-01-01

    The article of record as published may be found at http://dx.doi.org/10.1029/2000GL012760 About 60 tide-gauge stations in the Kara, Laptev, East-Siberian and Chukchi Seas have recorded the sea level change from the 1950s through 1990s. Over this 40-year period, most of these stations show a significant sea level rise (SLR). In light of global change, this SLR could be a manifestation of warming in the Artic coupled with a decrease of sea ice extent, warming of Atlantic waters, changes in...

  5. Modeling tidal freshwater marsh sustainability in the Sacramento-San Joaquin Delta under a broad suite of potential future scenarios

    Science.gov (United States)

    Swanson, Kathleen M.; Drexler, Judith Z.; Fuller, Christopher C.; Schoellhamer, David H.

    2015-01-01

    In this paper, we report on the adaptation and application of a one-dimensional marsh surface elevation model, the Wetland Accretion Rate Model of Ecosystem Resilience (WARMER), to explore the conditions that lead to sustainable tidal freshwater marshes in the Sacramento–San Joaquin Delta. We defined marsh accretion parameters to encapsulate the range of observed values over historic and modern time-scales based on measurements from four marshes in high and low energy fluvial environments as well as possible future trends in sediment supply and mean sea level. A sensitivity analysis of 450 simulations was conducted encompassing a range of eScholarship provides open access, scholarly publishing services to the University of California and delivers a dynamic research platform to scholars worldwide. porosity values, initial elevations, organic and inorganic matter accumulation rates, and sea-level rise rates. For the range of inputs considered, the magnitude of SLR over the next century was the primary driver of marsh surface elevation change. Sediment supply was the secondary control. More than 84% of the scenarios resulted in sustainable marshes with 88 cm of SLR by 2100, but only 32% and 11% of the scenarios resulted in surviving marshes when SLR was increased to 133 cm and 179 cm, respectively. Marshes situated in high-energy zones were marginally more resilient than those in low-energy zones because of their higher inorganic sediment supply. Overall, the results from this modeling exercise suggest that marshes at the upstream reaches of the Delta—where SLR may be attenuated—and high energy marshes along major channels with high inorganic sediment accumulation rates will be more resilient to global SLR in excess of 88 cm over the next century than their downstream and low-energy counterparts. However, considerable uncertainties exist in the projected rates of sea-level rise and sediment avail-ability. In addition, more research is needed to constrain future

  6. Status of Precise Orbit Determination for Jason-2 Using GPS

    Science.gov (United States)

    Melachroinos, S.; Lemoine, F. G.; Zelensky, N. P.; Rowlands, D. D.; Pavlis, D. E.

    2011-01-01

    The JASON-2 satellite, launched in June 2008, is the latest follow-on to the successful TOPEX/Poseidon (T/P) and JASON-I altimetry missions. JASON-2 is equipped with a TRSR Blackjack GPS dual-frequency receiver, a laser retroreflector array, and a DORIS receiver for precise orbit determination (POD). The most recent time series of orbits computed at NASA GSFC, based on SLR/DORIS data have been completed using both ITRF2005 and ITRF2008. These orbits have been shown to agree radially at 1 cm RMS for dynamic vs SLRlDORIS reduced-dynamic orbits and in comparison with orbits produced by other analysis centers (Lemoine et al., 2010; Zelensky et al., 2010; Cerri et al., 2010). We have recently upgraded the GEODYN software to implement model improvements for GPS processing. We describe the implementation of IGS standards to the Jason2 GEODYN GPS processing, and other dynamical and measurement model improvements. Our GPS-only JASON-2 orbit accuracy is assessed using a number of tests including analysis of independent SLR and altimeter crossover residuals, orbit overlap differences, and direct comparison to orbits generated at GSFC using SLR and DORIS tracking, and to orbits generated externally at other centers. Tests based on SLR and the altimeter crossover residuals provide the best performance indicator for independent validation of the NASAlGSFC GPS-only reduced dynamic orbits. For the ITRF2005 and ITRF2008 implementation of our GPS-only obits we are using the IGS05 and IGS08 standards. Reduced dynamic versus dynamic orbit differences are used to characterize the remaining force model error and TRF instability. We evaluate the GPS vs SLR & DORIS orbits produced using the GEODYN software and assess in particular their consistency radially and the stability of the altimeter satellite reference frame in the Z direction for both ITRF2005 and ITRF2008 as a proxy to assess the consistency of the reference frame for altimeter satellite POD.

  7. Modeled Sea Level Rise Impacts on Coastal Ecosystems at Six Major Estuaries on Florida’s Gulf Coast: Implications for Adaptation Planning

    Science.gov (United States)

    Birch, Anne P.; Brenner, Jorge; Gordon, Doria R.

    2015-01-01

    The Sea Level Affecting Marshes Model (SLAMM) was applied at six major estuaries along Florida’s Gulf Coast (Pensacola Bay, St. Andrews/Choctawhatchee Bays, Apalachicola Bay, Southern Big Bend, Tampa Bay and Charlotte Harbor) to provide quantitative and spatial information on how coastal ecosystems may change with sea level rise (SLR) and to identify how this information can be used to inform adaption planning. High resolution LiDAR-derived elevation data was utilized under three SLR scenarios: 0.7 m, 1 m and 2 m through the year 2100 and uncertainty analyses were conducted on selected input parameters at three sites. Results indicate that the extent, spatial orientation and relative composition of coastal ecosystems at the study areas may substantially change with SLR. Under the 1 m SLR scenario, total predicted impacts for all study areas indicate that coastal forest (-69,308 ha; -18%), undeveloped dry land (-28,444 ha; -2%) and tidal flat (-25,556 ha; -47%) will likely face the greatest loss in cover by the year 2100. The largest potential gains in cover were predicted for saltmarsh (+32,922 ha; +88%), transitional saltmarsh (+23,645 ha; na) and mangrove forest (+12,583 ha; +40%). The Charlotte Harbor and Tampa Bay study areas were predicted to experience the greatest net loss in coastal wetlands The uncertainty analyses revealed low to moderate changes in results when some numerical SLAMM input parameters were varied highlighting the value of collecting long-term sedimentation, accretion and erosion data to improve SLAMM precision. The changes predicted by SLAMM will affect exposure of adjacent human communities to coastal hazards and ecosystem functions potentially resulting in impacts to property values, infrastructure investment and insurance rates. The results and process presented here can be used as a guide for communities vulnerable to SLR to identify and prioritize adaptation strategies that slow and/or accommodate the changes underway. PMID:26207914

  8. Performance Evaluation of Thermographic Cameras for Photogrammetric Measurements

    Science.gov (United States)

    Yastikli, N.; Guler, E.

    2013-05-01

    The aim of this research is the performance evaluation of the termographic cameras for possible use for photogrammetric documentation and deformation analyses caused by moisture and isolation problem of the historical and cultural heritage. To perform geometric calibration of the termographic camera, the 3D test object was designed with 77 control points which were distributed in different depths. For performance evaluation, Flir A320 termographic camera with 320 × 240 pixels and lens with 18 mm focal length was used. The Nikon D3X SLR digital camera with 6048 × 4032 pixels and lens with 20 mm focal length was used as reference for comparison. The size of pixel was 25 μm for the Flir A320 termographic camera and 6 μm for the Nikon D3X SLR digital camera. The digital images of the 3D test object were recorded with the Flir A320 termographic camera and Nikon D3X SLR digital camera and the image coordinate of the control points in the images were measured. The geometric calibration parameters, including the focal length, position of principal points, radial and tangential distortions were determined with introduced additional parameters in bundle block adjustments. The measurement of image coordinates and bundle block adjustments with additional parameters were performed using the PHIDIAS digital photogrammetric system. The bundle block adjustment was repeated with determined calibration parameter for both Flir A320 termographic camera and Nikon D3X SLR digital camera. The obtained standard deviation of measured image coordinates was 9.6 μm and 10.5 μm for Flir A320 termographic camera and 8.3 μm and 7.7 μm for Nikon D3X SLR digital camera. The obtained standard deviation of measured image points in Flir A320 termographic camera images almost same accuracy level with digital camera in comparison with 4 times bigger pixel size. The obtained results from this research, the interior geometry of the termographic cameras and lens distortion was modelled efficiently

  9. Evaluating tidal marsh sustainability in the face of sea-level rise: a hybrid modeling approach applied to San Francisco Bay.

    Directory of Open Access Journals (Sweden)

    Diana Stralberg

    Full Text Available Tidal marshes will be threatened by increasing rates of sea-level rise (SLR over the next century. Managers seek guidance on whether existing and restored marshes will be resilient under a range of potential future conditions, and on prioritizing marsh restoration and conservation activities.Building upon established models, we developed a hybrid approach that involves a mechanistic treatment of marsh accretion dynamics and incorporates spatial variation at a scale relevant for conservation and restoration decision-making. We applied this model to San Francisco Bay, using best-available elevation data and estimates of sediment supply and organic matter accumulation developed for 15 Bay subregions. Accretion models were run over 100 years for 70 combinations of starting elevation, mineral sediment, organic matter, and SLR assumptions. Results were applied spatially to evaluate eight Bay-wide climate change scenarios.Model results indicated that under a high rate of SLR (1.65 m/century, short-term restoration of diked subtidal baylands to mid marsh elevations (-0.2 m MHHW could be achieved over the next century with sediment concentrations greater than 200 mg/L. However, suspended sediment concentrations greater than 300 mg/L would be required for 100-year mid marsh sustainability (i.e., no elevation loss. Organic matter accumulation had minimal impacts on this threshold. Bay-wide projections of marsh habitat area varied substantially, depending primarily on SLR and sediment assumptions. Across all scenarios, however, the model projected a shift in the mix of intertidal habitats, with a loss of high marsh and gains in low marsh and mudflats.Results suggest a bleak prognosis for long-term natural tidal marsh sustainability under a high-SLR scenario. To minimize marsh loss, we recommend conserving adjacent uplands for marsh migration, redistributing dredged sediment to raise elevations, and concentrating restoration efforts in sediment-rich areas

  10. Low degree Earth's gravity coefficients determined from different space geodetic observations and climate models

    Science.gov (United States)

    Wińska, Małgorzata; Nastula, Jolanta

    2017-04-01

    Large scale mass redistribution and its transport within the Earth system causes changes in the Earth's rotation in space, gravity field and Earth's ellipsoid shape. These changes are observed in the ΔC21, ΔS21, and ΔC20 spherical harmonics gravity coefficients, which are proportional to the mass load-induced Earth rotational excitations. In this study, linear trend, decadal, inter-annual, and seasonal variations of low degree spherical harmonics coefficients of Earth's gravity field, determined from different space geodetic techniques, Gravity Recovery and Climate Experiment (GRACE), satellite laser ranging (SLR), Global Navigation Satellite System (GNSS), Earth rotation, and climate models, are examined. In this way, the contribution of each measurement technique to interpreting the low degree surface mass density of the Earth is shown. Especially, we evaluate an usefulness of several climate models from the Coupled Model Intercomparison Project phase 5 (CMIP5) to determine the low degree Earth's gravity coefficients using GRACE satellite observations. To do that, Terrestrial Water Storage (TWS) changes from several CMIP5 climate models are determined and then these simulated data are compared with the GRACE observations. Spherical harmonics ΔC21, ΔS21, and ΔC20 changes are calculated as the sum of atmosphere and ocean mass effect (GAC values) taken from GRACE and a land surface hydrological estimate from the selected CMIP5 climate models. Low degree Stokes coefficients of the surface mass density determined from GRACE, SLR, GNSS, Earth rotation measurements and climate models are compared to each other in order to assess their consistency. The comparison is done by using different types of statistical and signal processing methods.

  11. Astrometrically registered simultaneous observations of the 22 GHz H{sub 2}O and 43 GHz SiO masers toward R Leonis Minoris using KVN and source/frequency phase referencing

    Energy Technology Data Exchange (ETDEWEB)

    Dodson, Richard; Rioja, María J.; Jung, Tae-Hyun; Sohn, Bong-Won; Byun, Do-Young; Cho, Se-Hyung; Lee, Sang-Sung; Kim, Jongsoo; Kim, Kee-Tae; Oh, Chung-Sik; Han, Seog-Tae; Je, Do-Heung; Chung, Moon-Hee; Wi, Seog-Oh; Kang, Jiman; Lee, Jung-Won; Chung, Hyunsoo; Kim, Hyo-Ryoung; Kim, Hyun-Goo; Lee, Chang-Hoon, E-mail: rdodson@kasi.re.kr [Korea Astronomy and Space Science Institute, Daedeokdae-ro 776, Yuseong-gu, Daejeon 305-348 (Korea, Republic of); and others

    2014-11-01

    Oxygen-rich asymptotic giant branch (AGB) stars can be intense emitters of SiO (v = 1 and 2, J = 1 → 0) and H{sub 2}O maser lines at 43 and 22 GHz, respectively. Very long baseline interferometry (VLBI) observations of the maser emission provide a unique tool to probe the innermost layers of the circumstellar envelopes in AGB stars. Nevertheless, the difficulties in achieving astrometrically aligned H{sub 2}O and v = 1 and v = 2 SiO maser maps have traditionally limited the physical constraints that can be placed on the SiO maser pumping mechanism. We present phase-referenced simultaneous spectral-line VLBI images for the SiO v = 1 and v = 2, J = 1 → 0, and H{sub 2}O maser emission around the AGB star R LMi, obtained from the Korean VLBI Network (KVN). The simultaneous multi-channel receivers of the KVN offer great possibilities for astrometry in the frequency domain. With this facility, we have produced images with bona fide absolute astrometric registration between high-frequency maser transitions of different species to provide the positions of the H{sub 2}O maser emission and the center of the SiO maser emission, hence reducing the uncertainty in the proper motions for R LMi by an order of magnitude over that from Hipparcos. This is the first successful demonstration of source frequency phase referencing for millimeter VLBI spectral-line observations and also where the ratio between the frequencies is not an integer.

  12. Measuring Sea Level Rise-Induced Shoreline Changes and Inundation in Real Time

    Science.gov (United States)

    Shilling, F.; Waetjen, D.; Grijalva, E.

    2016-12-01

    We describe a method to monitor shoreline inundation and changes in response to sea level rise (SLR) using a network of time-lapse cameras. We found for coastal tidal marshes that this method was sensitive to vertical changes in sea level of 20 cm has occurred in the San Francisco Bay and other US coastal areas and is likely to rise by another 30-45 cm by mid-century, which will flood and erode many coastal ecosystems, highways, and urban areas. This rapid degree of rise means that it is imperative to co-plan for natural and built systems. Many public facilities are adjacent to shoreline ecosystems, which both protect infrastructure from wave and tide energy and are home to regulated species and habitats. Accurate and timely information about the actual extent of SLR impacts to shorelines will be critical during built-system adaptation. Currently, satellite-sourced imagery cannot provide the spatial or temporal resolution necessary to investigate fine-scale shoreline changes, leaving a gap between predictive models and knowing how, where and when these changes are occurring. The method described is feasible for near-term (1 to 10 years) to long-term application and can be used for measuring fine-resolution shoreline changes (organize photographs that could be combined with related external data (e.g., gauged water levels) to create an information mashup. This information could be used to validate models predicting shoreline inundation and loss, inform SLR-adaptation planning, and to visualize SLR impacts to the public.

  13. Does the reason for discontinuation of a first TNF inhibitor influence the effectiveness of a second TNF inhibitor in axial spondyloarthritis? Results from the Swiss Clinical Quality Management Cohort.

    Science.gov (United States)

    Ciurea, Adrian; Exer, Pascale; Weber, Ulrich; Tamborrini, Giorgio; Steininger, Beate; Kissling, Rudolf O; Bernhard, Jürg; Scherer, Almut

    2016-03-22

    With regard to switching tumor necrosis factor inhibitors (TNFi) in axial spondyloarthritis (axSpA), conflicting results have been reported as to whether the effectiveness of a second TNFi depends on the reason for discontinuation of the first TNFi. Patients with a clinical diagnosis of axSpA starting a second TNFi in the Swiss Clinical Quality Management cohort were included. Effectiveness of treatment at 1 year, as well as drug survival, was compared between subgroups having discontinued the first TNFi because of lack of response, adverse events (AEs), or other reasons. Lack of response was further divided into primary or secondary lack of response (PLR or SLR, respectively), depending on whether the first TNFi was stopped before or after 6 months of treatment. Among 632 patients with axSpA, median survival of a second TNFi was 1.1 years after PLR and 3.8 years after SLR (p = 0.003). At least moderate disease activity as defined by an Ankylosing Spondylitis Disease Activity Score using the erythrocyte sedimentation rate (ASDAS-ESR) reasons, respectively (p = 0.01). Only 4 % of patients achieved an ASDAS-ESR inactive disease state after PLR, in comparison to 22 % of those after SLR. Similar results were demonstrated in patients fulfilling the Assessment of SpondyloArthritis international Society classification criteria for axSpA (n = 488): ASDAS-ESR reasons, respectively (p = 0.01). The effectiveness of a second TNFi is significantly impaired in patients with axSpA after PLR to a first TNFi compared with SLR.

  14. A measurement error approach to assess the association between dietary diversity, nutrient intake, and mean probability of adequacy.

    Science.gov (United States)

    Joseph, Maria L; Carriquiry, Alicia

    2010-11-01

    Collection of dietary intake information requires time-consuming and expensive methods, making it inaccessible to many resource-poor countries. Quantifying the association between simple measures of usual dietary diversity and usual nutrient intake/adequacy would allow inferences to be made about the adequacy of micronutrient intake at the population level for a fraction of the cost. In this study, we used secondary data from a dietary intake study carried out in Bangladesh to assess the association between 3 food group diversity indicators (FGI) and calcium intake; and the association between these same 3 FGI and a composite measure of nutrient adequacy, mean probability of adequacy (MPA). By implementing Fuller's error-in-the-equation measurement error model (EEM) and simple linear regression (SLR) models, we assessed these associations while accounting for the error in the observed quantities. Significant associations were detected between usual FGI and usual calcium intakes, when the more complex EEM was used. The SLR model detected significant associations between FGI and MPA as well as for variations of these measures, including the best linear unbiased predictor. Through simulation, we support the use of the EEM. In contrast to the EEM, the SLR model does not account for the possible correlation between the measurement errors in the response and predictor. The EEM performs best when the model variables are not complex functions of other variables observed with error (e.g. MPA). When observation days are limited and poor estimates of the within-person variances are obtained, the SLR model tends to be more appropriate.

  15. How Much Are Floridians Willing to Pay for Protecting Sea Turtles from Sea Level Rise?

    Science.gov (United States)

    Hamed, Ahmed; Madani, Kaveh; Von Holle, Betsy; Wright, James; Milon, J Walter; Bossick, Matthew

    2016-01-01

    Sea level rise (SLR) is posing a great inundation risk to coastal areas. Some coastal nesting species, including sea turtle species, have experienced diminished habitat from SLR. Contingent valuation method (CVM) was used in an effort to assess the economic loss impacts of SLR on sea turtle nesting habitats for Florida coasts; and to elicit values of willingness to pay (WTP) of Central Florida residents to implement certain mitigation strategies, which would protect Florida's east coast sea turtle nesting areas. Using the open-ended and dichotomous choice CVM, we sampled residents of two Florida communities: Cocoa Beach and Oviedo. We estimated the WTP of households from these two cities to protect sea turtle habitat to be between $42 and $57 per year for 5 years. Additionally, we attempted to assess the impact of the both the respondents' demographics and their perception toward various situations on their WTP value. Findings include a negative correlation between the age of a respondent and the probability of an individual willing to pay the hypothetical WTP amount. We found that WTP of an individual was not dependent on prior knowledge of the effects of SLR on sea turtle habitat. The greatest indicators of whether or not an individual was willing to pay to protect sea turtle habitat were the respondents' perception regarding the trustworthiness and efficiency of the party which will implement the conservation measures and their confidence in the conservation methods used. Respondents who perceive sea turtles having an effect on their life were also more likely to pay.

  16. A photogrammetry-based system for 3D surface reconstruction of prosthetics and orthotics.

    Science.gov (United States)

    Li, Guang-kun; Gao, Fan; Wang, Zhi-gang

    2011-01-01

    The objective of this study is to develop an innovative close range digital photogrammetry (CRDP) system using the commercial digital SLR cameras to measure and reconstruct the 3D surface of prosthetics and orthotics. This paper describes the instrumentation, techniques and preliminary results of the proposed system. The technique works by taking pictures of the object from multiple view angles. The series of pictures were post-processed via feature point extraction, point match and 3D surface reconstruction. In comparison with the traditional method such as laser scanning, the major advantages of our instrument include the lower cost, compact and easy-to-use hardware, satisfactory measurement accuracy, and significantly less measurement time. Besides its potential applications in prosthetics and orthotics surface measurement, the simple setup and its ease of use will make it suitable for various 3D surface reconstructions.

  17. Exploring the Variability of the Flat-spectrum Radio Source 1633+382. II. Physical Properties

    Science.gov (United States)

    Algaba, Juan-Carlos; Lee, Sang-Sung; Rani, Bindu; Kim, Dae-Won; Kino, Motoki; Hodgson, Jeffrey; Zhao, Guang-Yao; Byun, Do-Young; Gurwell, Mark; Kang, Sin-Cheol; Kim, Jae-Young; Kim, Jeong-Sook; Kim, Soon-Wook; Park, Jong-Ho; Trippe, Sascha; Wajima, Kiyoaki

    2018-06-01

    The flat-spectrum radio quasar 1633+382 (4C 38.41) showed a significant increase of its radio flux density during the period 2012 March–2015 August, which correlates with γ-ray flaring activity. Multi-frequency simultaneous very long baseline interferometry (VLBI) observations were conducted as part of the interferometric monitoring of gamma-ray bright active galactic nuclei (iMOGABA) program and supplemented with additional radio monitoring observations with the OVRO 40 m telescope, the Boston University VLBI program, and the Submillimeter Array. The epochs of the maxima for the two largest γ-ray flares coincide with the ejection of two respective new VLBI components. Analysis of the spectral energy distribution indicates a higher turnover frequency after the flaring events. The evolution of the flare in the turnover frequency-turnover flux density plane probes the adiabatic losses in agreement with the shock-in-jet model. The derived synchrotron self-absorption magnetic fields, of the order of 0.1 mG, do not seem to change dramatically during the flares, and are much weaker, by a factor 104, than the estimated equipartition magnetic fields, indicating that the source of the flare may be associated with a particle-dominated emitting region.

  18. Software Correlator for Radioastron Mission

    Science.gov (United States)

    Likhachev, Sergey F.; Kostenko, Vladimir I.; Girin, Igor A.; Andrianov, Andrey S.; Rudnitskiy, Alexey G.; Zharov, Vladimir E.

    In this paper, we discuss the characteristics and operation of Astro Space Center (ASC) software FX correlator that is an important component of space-ground interferometer for Radioastron project. This project performs joint observations of compact radio sources using 10m space radio telescope (SRT) together with ground radio telescopes at 92, 18, 6 and 1.3 cm wavelengths. In this paper, we describe the main features of space-ground VLBI data processing of Radioastron project using ASC correlator. Quality of implemented fringe search procedure provides positive results without significant losses in correlated amplitude. ASC Correlator has a computational power close to real time operation. The correlator has a number of processing modes: “Continuum”, “Spectral Line”, “Pulsars”, “Giant Pulses”,“Coherent”. Special attention is paid to peculiarities of Radioastron space-ground VLBI data processing. The algorithms of time delay and delay rate calculation are also discussed, which is a matter of principle for data correlation of space-ground interferometers. During five years of Radioastron SRT successful operation, ASC correlator showed high potential of satisfying steady growing needs of current and future ground and space VLBI science. Results of ASC software correlator operation are demonstrated.

  19. Development and Application of Percent Annual Chance Coastal Inundation Maps to Support Decision-Making in the Northern Gulf of Mexico

    Science.gov (United States)

    Bilskie, M. V.; Hagen, S. C.; Irish, J. L.; Yoskowitz, D.; Del Angel, D. C.

    2017-12-01

    Rising sea levels increase the vulnerability, exposure, probability, and thus risk associated with hurricane storm surge flooding across low-gradient coastal landscapes. In the U.S., flood risk assessments commonly employ the delineation of the 1% annual chance flood (100-year return period) that guide coastal policy and planning. As many coastal communities now include climate change effects on future development activities, the need to provide scientifically sound and scenario-based data products are becoming increasingly essential. Implementing bio-geo-physical models to study the effects of sea level rise (SLR) on coastal flooding under a variety of scenarios can be a powerful tool. However, model results alone are not appropriate for use by the broader coastal management community and thus must be further refined. For example, developing return period inundations maps or examining the potential economic damages are vital to translate scientific finding and extend their practicality to coastal resources managers, stakeholders, and governmental agencies. This work employs a collection of high-resolution wind-wave and hurricane storm surge models forced by a suite of synthetic storms to derive the 1% and 0.2% annual chance floodplain under four SLR scenarios (0.2, m, 0.5 m, 1.2 m, and 2.0 m) across the northern Gulf of Mexico (NGOM) coast, which include Mississippi, Alabama, and the Florida panhandle. The models represent the potential outlook of the coastal landscape for each of the scenarios and contains changes to the salt marsh, barrier islands, shoreline position, dune elevations, and land use land cover. Simulated surge data are fed into a hazard assessment tool that provides estimates of potential future damages and costs for each SLR scenario. Results provide evidence that the present 500-year floodplain becomes the 100-year floodplain under the 0.5 m SLR scenario by the end of the century along the Alabama and the Florida panhandle coast. Across

  20. PERFORMANCE EVALUATION OF THERMOGRAPHIC CAMERAS FOR PHOTOGRAMMETRIC MEASUREMENTS

    Directory of Open Access Journals (Sweden)

    N. Yastikli

    2013-05-01

    Full Text Available The aim of this research is the performance evaluation of the termographic cameras for possible use for photogrammetric documentation and deformation analyses caused by moisture and isolation problem of the historical and cultural heritage. To perform geometric calibration of the termographic camera, the 3D test object was designed with 77 control points which were distributed in different depths. For performance evaluation, Flir A320 termographic camera with 320 × 240 pixels and lens with 18 mm focal length was used. The Nikon D3X SLR digital camera with 6048 × 4032 pixels and lens with 20 mm focal length was used as reference for comparison. The size of pixel was 25 μm for the Flir A320 termographic camera and 6 μm for the Nikon D3X SLR digital camera. The digital images of the 3D test object were recorded with the Flir A320 termographic camera and Nikon D3X SLR digital camera and the image coordinate of the control points in the images were measured. The geometric calibration parameters, including the focal length, position of principal points, radial and tangential distortions were determined with introduced additional parameters in bundle block adjustments. The measurement of image coordinates and bundle block adjustments with additional parameters were performed using the PHIDIAS digital photogrammetric system. The bundle block adjustment was repeated with determined calibration parameter for both Flir A320 termographic camera and Nikon D3X SLR digital camera. The obtained standard deviation of measured image coordinates was 9.6 μm and 10.5 μm for Flir A320 termographic camera and 8.3 μm and 7.7 μm for Nikon D3X SLR digital camera. The obtained standard deviation of measured image points in Flir A320 termographic camera images almost same accuracy level with digital camera in comparison with 4 times bigger pixel size. The obtained results from this research, the interior geometry of the termographic cameras and lens distortion was

  1. The impact of local land subsidence and global sea level rise on flood severity in Houston-Galveston caused by Hurricane Harvey

    Science.gov (United States)

    Miller, M. M.; Shirzaei, M.

    2017-12-01

    Category-4 Hurricane Harvey had devastating socioeconomic impacts to Houston, with flooding far past the 100-year flood zones published by FEMA. In recent decades, frequency and intensity of coastal flooding are escalating, correlated with sea level rise (SLR). Moreover, Local land subsidence (LLS) due to groundwater and hydrocarbon extraction and natural compaction changes surface elevation and slope, potentially altering drainage patterns. GPS data show a mm broad co-cyclonic subsidence due to elastic loading from the water mass measured by GPS, which is inverted to solve for the total fluid volume of 2.73x1010 m3. We additionally investigate the joint impact of an SLR and pre-cyclonic LLS on the flooding of Houston-Galveston during Hurricane Harvey. We examine vertical land motion within North American Vertical Datum 2012 for the period 2007 until the cyclone by investigating SAR imaged acquired by ALOS and Sentinel-1A/B radar satellites combined with GPS data. We find patchy, LLS bowls resulting in sinks where floodwater can collect. We map the flooding extent by comparing amplitudes of Sentinal1-A/B pixels' backscattered radar signal from pre- and post-Harvey acquisitions and estimate 782 km2 are submerged within the area of 3478 km2 of pixels covered by Sentinel frame. Comparing with the LLS map, 89% of the flooded pixels exhibit -3 mm/yr or greater vertical motion. Flooding attributed to the storm surge is determined with high-resolution LiDAR digital elevation models (DEM) and a 0.75 m storm tide inundation model, which engulfs only 195 km2 and nearby the shorelines. We estimate future inundation hazard by combining LiDAR DEMs with our InSAR derived subsidence map, projecting LLS rates forward 100 years, and modeling projected SLR from 0.4 to 1.2 meters. Were subsidence to continue unabated, the total flooded area is 281 km2 with a 0.4 m and 394 km2 with a 1.2 m SLR. Next, we add a modest storm tide (0.752 m), which increases the flooded area to 389 - 480

  2. Development of a model to simulate groundwater inundation induced by sea-level rise and high tides in Honolulu, Hawaii.

    Science.gov (United States)

    Habel, Shellie; Fletcher, Charles H; Rotzoll, Kolja; El-Kadi, Aly I

    2017-05-01

    Many of the world's largest cities face risk of sea-level rise (SLR) induced flooding owing to their limited elevations and proximities to the coastline. Within this century, global mean sea level is expected to reach magnitudes that will exceed the ground elevation of some built infrastructure. The concurrent rise of coastal groundwater will produce additional sources of inundation resulting from narrowing and loss of the vertical unsaturated subsurface space. This has implications for the dense network of buried and low-lying infrastructure that exists across urban coastal zones. Here, we describe a modeling approach that simulates narrowing of the unsaturated space and groundwater inundation (GWI) generated by SLR-induced lifting of coastal groundwater. The methodology combines terrain modeling, groundwater monitoring, estimation of tidal influence, and numerical groundwater-flow modeling to simulate future flood scenarios considering user-specified tide stages and magnitudes of SLR. We illustrate the value of the methodology by applying it to the heavily urbanized and low-lying Waikiki area of Honolulu, Hawaii. Results indicate that SLR of nearly 1 m generates GWI across 23% of the 13 km 2 study area, threatening $5 billion of taxable real estate and 48 km of roadway. Analysis of current conditions reveals that 86% of 259 active cesspool sites in the study area are likely inundated. This suggests that cesspool effluent is currently entering coastal groundwater, which not only leads to degradation of coastal environments, but also presents a future threat to public health as GWI would introduce effluent at the ground surface. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. A NOVEL FUZZY PARAMETER FOR GROUND FLASH DENSITY

    Directory of Open Access Journals (Sweden)

    CAMILO YOUNES

    2013-01-01

    Full Text Available Algunos parámetros del rayo, tales como la densidad de descargas a tierra DDT se han determinado usando principalmente métodos determinísticos y en los últimos 20 años la principal fuente de información han sido los datos de los sistemas de localización de rayos (SLR. La DDT tiene algunos problemas como la dependencia del área de la malla que se va a estudiar, las fuertes variaciones entre los datos en puntos cercanos de la malla y su baja capacidad descriptiva. Adicionalmente los SLR introducen más problemas debidos a la precisión en la localización que debe estar en acuerdo con el área de la malla que se va a estudiar. Este artículo presenta un parámetro difuso novedoso para calcular la densidad de descargas a tierra usando técnicas computacionales modernas. El nuevo parámetro llamado Densidad Difusa de Descargas a Tierra (DDDT puede tratar con los problemas relacionados al parámetro de DDT en sí y con la precisión en la localización de los SLR. La DDDT proporciona una mejor representación del fenómeno y es más adecuado para problemas prácticos, especialmente en temas de ingeniería tales como diseño de sistemas de localización de rayos y evaluación de riesgos por rayo. Algunos ejemplos fueron creados para demostrar la validez del nuevo parámetro y se muestra también un caso real usando datos de un SLR Colombiano.

  4. Effect of hamstring flexibility on hip and lumbar spine joint excursions during forward-reaching tasks in participants with and without low back pain.

    Science.gov (United States)

    Johnson, Erica N; Thomas, James S

    2010-07-01

    To examine the correlation between hamstring flexibility and hip and lumbar spine joint excursions during standardized reaching and forward-bending tasks. Retrospective analysis of data obtained during 2 previous prospective studies that examined kinematics and kinetics during forward-reaching tasks in participants with and without low back pain (LBP). The 2 previous studies were conducted in the Motor Control Lab at Ohio University and the Orthopaedic Ergonomics Laboratory at The Ohio State University. Data from a total of 122 subjects from 2 previous studies: study 1: 86 subjects recovered from an episode of acute LBP (recovered) and study 2 (A.I. McCallum, unpublished data): 18 chronic LBP subjects and 18 healthy-matched controls (healthy). Not applicable. Correlation values between hamstring flexibility as measured by straight leg raise (SLR) and amount of hip and lumbar spine joint excursions used during standardized reaching and forward-bending tasks. No significant correlation was found between hamstring flexibility and hip and lumbar joint excursions during forward-bending tasks in the LBP or recovered groups. The SLR had a significant negative correlation with lumbar spine excursions during reaching tasks to a low target in the healthy group (right SLR: P=.011, left SLR: P=.004). Hamstring flexibility is not strongly related to the amount of lumbar flexion used to perform forward-reaching tasks in participants who have chronic LBP or who have recovered from LBP. More research needs to be conducted to examine the influence of hamstring flexibility on observed movement patterns to further evaluate the efficacy of flexibility training in the rehabilitation of patients with LBP. Copyright 2010 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.

  5. Common y-intercept and single compound regressions of gas-particle partitioning data vs 1/T

    Science.gov (United States)

    Pankow, James F.

    Confidence intervals are placed around the log Kp vs 1/ T correlation equations obtained using simple linear regressions (SLR) with the gas-particle partitioning data set of Yamasaki et al. [(1982) Env. Sci. Technol.16, 189-194]. The compounds and groups of compounds studied include the polycylic aromatic hydrocarbons phenanthrene + anthracene, me-phenanthrene + me-anthracene, fluoranthene, pyrene, benzo[ a]fluorene + benzo[ b]fluorene, chrysene + benz[ a]anthracene + triphenylene, benzo[ b]fluoranthene + benzo[ k]fluoranthene, and benzo[ a]pyrene + benzo[ e]pyrene (note: me = methyl). For any given compound, at equilibrium, the partition coefficient Kp equals ( F/ TSP)/ A where F is the particulate-matter associated concentration (ng m -3), A is the gas-phase concentration (ng m -3), and TSP is the concentration of particulate matter (μg m -3). At temperatures more than 10°C from the mean sampling temperature of 17°C, the confidence intervals are quite wide. Since theory predicts that similar compounds sorbing on the same particulate matter should possess very similar y-intercepts, the data set was also fitted using a special common y-intercept regression (CYIR). For most of the compounds, the CYIR equations fell inside of the SLR 95% confidence intervals. The CYIR y-intercept value is -18.48, and is reasonably close to the type of value that can be predicted for PAH compounds. The set of CYIR regression equations is probably more reliable than the set of SLR equations. For example, the CYIR-derived desorption enthalpies are much more highly correlated with vaporization enthalpies than are the SLR-derived desorption enthalpies. It is recommended that the CYIR approach be considered whenever analysing temperature-dependent gas-particle partitioning data.

  6. Cogeneration techniques; Les techniques de cogeneration

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-10-01

    This dossier about cogeneration techniques comprises 12 parts dealing successively with: the advantages of cogeneration (examples of installations, electrical and thermal efficiency); the combustion turbine (principle, performances, types); the alternative internal combustion engines (principle, types, rotation speed, comparative performances); the different configurations of cogeneration installations based on alternative engines and based on steam turbines (coal, heavy fuel and natural gas-fueled turbines); the environmental constraints of combustion turbines (pollutants, techniques of reduction of pollutant emissions); the environmental constraints of alternative internal combustion engines (gas and diesel engines); cogeneration and energy saving; the techniques of reduction of pollutant emissions (pollutants, unburnt hydrocarbons, primary and secondary (catalytic) techniques, post-combustion); the most-advanced configurations of cogeneration installations for enhanced performances (counter-pressure turbines, massive steam injection cycles, turbo-chargers); comparison between the performances of the different cogeneration techniques; the tri-generation technique (compression and absorption cycles). (J.S.)

  7. Random Forest-Based Recognition of Isolated Sign Language Subwords Using Data from Accelerometers and Surface Electromyographic Sensors.

    Science.gov (United States)

    Su, Ruiliang; Chen, Xiang; Cao, Shuai; Zhang, Xu

    2016-01-14

    Sign language recognition (SLR) has been widely used for communication amongst the hearing-impaired and non-verbal community. This paper proposes an accurate and robust SLR framework using an improved decision tree as the base classifier of random forests. This framework was used to recognize Chinese sign language subwords using recordings from a pair of portable devices worn on both arms consisting of accelerometers (ACC) and surface electromyography (sEMG) sensors. The experimental results demonstrated the validity of the proposed random forest-based method for recognition of Chinese sign language (CSL) subwords. With the proposed method, 98.25% average accuracy was obtained for the classification of a list of 121 frequently used CSL subwords. Moreover, the random forests method demonstrated a superior performance in resisting the impact of bad training samples. When the proportion of bad samples in the training set reached 50%, the recognition error rate of the random forest-based method was only 10.67%, while that of a single decision tree adopted in our previous work was almost 27.5%. Our study offers a practical way of realizing a robust and wearable EMG-ACC-based SLR systems.

  8. Sea, Lake, and Overland Surge from Hurricanes (SLOSH) Inundation for Categories 2 and 4

    Science.gov (United States)

    The file geodatabase (fgdb) contains the Sea, Lake, and Overland Surge from Hurricanes (SLOSH) Maximum of Maximums (MOM) model for hurricane categories 2 and 4. The EPA Office of Research & Development (ORD) modified the original model from NOAA to fit the model parameters for the Buzzards Bay region. The models show storm surge extent for the Mattapoisett area and therefore the flooding area was reduced to the study area. Areas of flooding that were not connected to the main water body were removed. The files in the geodatabase are:Cat2_SLR0_Int_Feet_dissolve_Mattapoisett: Current Category 2 hurricane with 0 ft sea level riseCat4_SLR0_Int_Feet_dissolve_Mattapoisett: Current Category 4 hurricane with 0 ft sea level riseCat4_SLR4_Int_Feet_dissolve_Mattapoisett: Future Category 4 hurricane with 4 feet sea level riseThe features support the Weather Ready Mattapoisett story map, which can be accessed via the following link:https://epa.maps.arcgis.com/apps/MapJournal/index.html?appid=1ff4f1d28a254cb689334799d94b74e2

  9. Elevated CO2 stimulates marsh elevation gain, counterbalancing sea-level rise.

    Science.gov (United States)

    Langley, J Adam; McKee, Karen L; Cahoon, Donald R; Cherry, Julia A; Megonigal, J Patrick

    2009-04-14

    Tidal wetlands experiencing increased rates of sea-level rise (SLR) must increase rates of soil elevation gain to avoid permanent conversion to open water. The maximal rate of SLR that these ecosystems can tolerate depends partly on mineral sediment deposition, but the accumulation of organic matter is equally important for many wetlands. Plant productivity drives organic matter dynamics and is sensitive to global change factors, such as rising atmospheric CO(2) concentration. It remains unknown how global change will influence organic mechanisms that determine future tidal wetland viability. Here, we present experimental evidence that plant response to elevated atmospheric [CO(2)] stimulates biogenic mechanisms of elevation gain in a brackish marsh. Elevated CO(2) (ambient + 340 ppm) accelerated soil elevation gain by 3.9 mm yr(-1) in this 2-year field study, an effect mediated by stimulation of below-ground plant productivity. Further, a companion greenhouse experiment revealed that the CO(2) effect was enhanced under salinity and flooding conditions likely to accompany future SLR. Our results indicate that by stimulating biogenic contributions to marsh elevation, increases in the greenhouse gas, CO(2), may paradoxically aid some coastal wetlands in counterbalancing rising seas.

  10. Effects of hamstring stretch with pelvic control on pain and work ability in standing workers.

    Science.gov (United States)

    Han, Hyun-Il; Choi, Ho-Suk; Shin, Won-Seob

    2016-11-21

    Hamstring tightness induces posterior pelvic tilt and decreased lumbar lordosis, which can result in low back painOBJECTIVE: We investigated effects of hamstring stretch with pelvic control on pain and work ability in standing workers. One hundred adult volunteers from a standing workers were randomly assigned to pelvic control hamstring stretching (PCHS) (n = 34), general hamstring stretching (GHS) (n = 34), control (n = 32) groups. The control group was performed self-home exercise. All interventions were conducted 3 days per week for 6 weeks, and included in the hamstring stretching and lumbopelvic muscle strengthening. Outcomes were evaluated through the visual analog scale (VAS), straight leg raise test (SLR), sit and reach test (SRT), Oswestry disability index (ODI), and work ability index (WAI). Significant difference in VAS, SLR, SRT, ODI, and WAI were found in the PCHS and GHS groups. The control group was a significant difference only in ODI. The PCHS group showed a greater difference than the GHS group and control group in VAS, SLR, SRT, and ODI. The pelvic control hamstring stretch exercise would be more helpful in back pain reduction and improvement of work ability in an industrial setting.

  11. Elevated CO2 stimulates marsh elevation gain, counterbalancing sea-level rise

    Science.gov (United States)

    Langley, J. Adam; McKee, Karen L.; Cahoon, Donald R.; Cherry, Julia A.; Megonigal, J. Patrick

    2009-01-01

    Tidal wetlands experiencing increased rates of sea-level rise (SLR) must increase rates of soil elevation gain to avoid permanent conversion to open water. The maximal rate of SLR that these ecosystems can tolerate depends partly on mineral sediment deposition, but the accumulation of organic matter is equally important for many wetlands. Plant productivity drives organic matter dynamics and is sensitive to global change factors, such as rising atmospheric CO2 concentration. It remains unknown how global change will influence organic mechanisms that determine future tidal wetland viability. Here, we present experimental evidence that plant response to elevated atmospheric [CO2] stimulates biogenic mechanisms of elevation gain in a brackish marsh. Elevated CO2 (ambient + 340 ppm) accelerated soil elevation gain by 3.9 mm yr−1 in this 2-year field study, an effect mediated by stimulation of below-ground plant productivity. Further, a companion greenhouse experiment revealed that the CO2 effect was enhanced under salinity and flooding conditions likely to accompany future SLR. Our results indicate that by stimulating biogenic contributions to marsh elevation, increases in the greenhouse gas, CO2, may paradoxically aid some coastal wetlands in counterbalancing rising seas. PMID:19325121

  12. Review and comparison of recent methods in space geodesy

    International Nuclear Information System (INIS)

    Varga, M.

    1983-01-01

    The study of geodynamic processes requires the application of new space-born geodesic measuring methods. A terrestrial reference system (TRS) is required for describing geodynamic processes. For this purpose satisfactory knowledge of polar motions, Earth rotation and tidal forces determined by laser, global positioning system (GPS) and VLBI measurements are needed. In addition, gravity and magnetic field of the Earth have to be known, modelled by using satellite to satellite traching (SST), altimetry, gradiometry and magnetometry results. Motions of the Earth-Moon system, as well as the relation between the terrestrial reference system and the inertial system can be determined by means of VLBI measurements. (author)

  13. A digital gigapixel large-format tile-scan camera.

    Science.gov (United States)

    Ben-Ezra, M

    2011-01-01

    Although the resolution of single-lens reflex (SLR) and medium-format digital cameras has increased in recent years, applications for cultural-heritage preservation and computational photography require even higher resolutions. Addressing this issue, a large-format cameras' large image planes can achieve very high resolution without compromising pixel size and thus can provide high-quality, high-resolution images.This digital large-format tile scan camera can acquire high-quality, high-resolution images of static scenes. It employs unique calibration techniques and a simple algorithm for focal-stack processing of very large images with significant magnification variations. The camera automatically collects overlapping focal stacks and processes them into a high-resolution, extended-depth-of-field image.

  14. The Impact of Sea Level Rise on Developing Countries: A Comparative Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Dasgupta, S. [World Bank, Washington, DC (United States)

    2008-07-01

    Sea-level rise (SLR) due to climate change is a serious global threat: The scientific evidence is now overwhelming. In this paper, Geographic Information System software has been used to overlay the best available, spatially-disaggregated global data on land, population, agriculture, urban extent, wetlands, and GDP, to assess the consequences of continued SLR for 84 coastal developing countries. Estimates suggest that even a one-meter rise in sea level in coastal countries of the developing world would submerge 194,000 square kilometers of land area, and turn at least 56 million people into environmental refugees. At the country level results are extremely skewed.

  15. The Impact of Sea Level Rise on Developing Countries: A Comparative Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Dasgupta, Susmita (World Bank, Washington, DC (United States))

    2008-07-01

    Sea-level rise (SLR) due to climate change is a serious global threat: The scientific evidence is now overwhelming. In this paper, Geographic Information System software has been used to overlay the best available, spatially-disaggregated global data on land, population, agriculture, urban extent, wetlands, and GDP, to assess the consequences of continued SLR for 84 coastal developing countries. Estimates suggest that even a one-meter rise in sea level in coastal countries of the developing world would submerge 194,000 square kilometers of land area, and turn at least 56 million people into environmental refugees. At the country level results are extremely skewed

  16. Spin-lattice relaxation in phosphorescent triplet state molecules

    International Nuclear Information System (INIS)

    Verbeek, P.J.F.

    1979-01-01

    The present thesis contains the results of a study of spin-lattice relaxation (SLR) in the photo-excited triplet state of aromatic molecules, dissolved in a molecular host crystal. It appears that SLR in phosphorescent triplet state molecules often is related to the presence of so-called (pseudo) localized phonons in the molecular mixed crystals. These local phonons can be thought to correspond with vibrations (librations) of the guest molecule in the force field of the surrounding host molecules. Since the intermolecular forces are relatively weak, the frequencies corresponding with these vibrations are relatively low and usually are of the order of 10-30 cm -1 . (Auth.)

  17. Controlling the shapes and sizes of metallic nanoantennas for detection of biological molecules using hybridization phase of plasmon resonances and photonic lattice modes

    Science.gov (United States)

    Gutha, Rithvik R.; Sharp, Christina; Wing, Waylin J.; Sadeghi, Seyed M.

    2018-02-01

    Chemical sensing based on Localized Surface Plasmonic Resonances (LSPR) and the ultra-sharp optical features of surface lattice resonances (SLR) of arrays of metallic nanoantennas have attracted much attention. Recently we studied biosensing based on the transition between LSPR and SLR (hybridization phase), demonstrating significantly higher refractive index sensitivity than each of these resonances individually. In this contribution we study the impact of size and shape of the metallic nanoantennas on the hybridization process and the way they influence application of this process for biosensing, wherein miniscule variation of the refractive index of the environment leads to dramatic changes in the spectral properties of the arrays.

  18. Earth rotation parameter and variation during 2005–2010 solved with LAGEOS SLR data

    Directory of Open Access Journals (Sweden)

    Yi Shen

    2015-01-01

    Full Text Available Time series of Earth rotation parameters were estimated from range data measured by the satellite laser ranging technique to the Laser Geodynamics Satellites (LAGEOS-1/2 through 2005 to 2010 using the dynamic method. Compared with Earth orientation parameter (EOP C04, released by the International Earth Rotation and Reference Systems Service, the root mean square errors for the measured X and Y of polar motion (PM and length of day (LOD were 0.24 and 0.25 milliarcseconds (mas, and 0.068 milliseconds (ms, respectively. Compared with ILRSA EOP, the X and Y of PM and LOD were 0.27 and 0.30 mas, and 0.054 ms, respectively. The time series were analyzed using the wavelet transformation and least squares methods. Wavelet analysis showed obvious seasonal and interannual variations of LOD, and both annual and Chandler variations of PM; however, the annual variation could not be distinguished from the Chandler variation because the two frequencies were very close. The trends and periodic variations of LOD and PM were obtained in the least squares sense, and PM showed semi-annual, annual, and Chandler periods. Semi-annual, annual, and quasi-biennial cycles for LOD were also detected. The trend rates of PM in the X and Y directions were 3.17 and −1.60 mas per year, respectively, and the North Pole moved to 26.8°E relative to the crust during 2005–2010. The trend rate of the LOD change was 0.028 ms per year.

  19. Long-Term Evaluation of Ocean Tidal Variation Models of Polar Motion and UT1

    Science.gov (United States)

    Karbon, Maria; Balidakis, Kyriakos; Belda, Santiago; Nilsson, Tobias; Hagedoorn, Jan; Schuh, Harald

    2018-04-01

    Recent improvements in the development of VLBI (very long baseline interferometry) and other space geodetic techniques such as the global navigation satellite systems (GNSS) require very precise a-priori information of short-period (daily and sub-daily) Earth rotation variations. One significant contribution to Earth rotation is caused by the diurnal and semi-diurnal ocean tides. Within this work, we developed a new model for the short-period ocean tidal variations in Earth rotation, where the ocean tidal angular momentum model and the Earth rotation variation have been setup jointly. Besides the model of the short-period variation of the Earth's rotation parameters (ERP), based on the empirical ocean tide model EOT11a, we developed also ERP models, that are based on the hydrodynamic ocean tide models FES2012 and HAMTIDE. Furthermore, we have assessed the effect of uncertainties in the elastic Earth model on the resulting ERP models. Our proposed alternative ERP model to the IERS 2010 conventional model considers the elastic model PREM and 260 partial tides. The choice of the ocean tide model and the determination of the tidal velocities have been identified as the main uncertainties. However, in the VLBI analysis all models perform on the same level of accuracy. From these findings, we conclude that the models presented here, which are based on a re-examined theoretical description and long-term satellite altimetry observation only, are an alternative for the IERS conventional model but do not improve the geodetic results.

  20. ORF Alignment: NC_000911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... slr2001 [Synechocystis sp. PCC 6803] ... Length = 228 ... Query: 10 ... LIIGGAEDKVHGREILQTFWSRSGGNDAIIGIIPSAS...REPLLIGERYQTIFSDMGVKELK 69 ... LIIGGAEDKVHGREILQTFWSRSGGNDAIIGIIPSAS...REPLLIGERYQTIFSDMGVKELK Sbjct: 1 ... LIIGGAEDKVHGREILQTFWSRSGGNDAIIGIIPSASREPLLIGERYQTIFSDMGVKELK 60 ... Quer