WorldWideScience

Sample records for technetium 110

  1. New 2,2'-bipyridine and 1,10-phenanthroline oxohalide complexes of technetium(VII) and -(V)

    International Nuclear Information System (INIS)

    Davison, A.; Jones, A.G.; Abrams, M.J.

    1981-01-01

    Novel complexes of heptavalent technetium with the formulation TcO 3 XL (L = 2,2'-bipyridine, X = Cl, Br; L = 1,10-phenanthroline, X = Cl) have been prepared and characterized by elemental analysis and optical and vbrational spectroscopy. These complexes can be reduced to the pentavalent species, TcOX 3 L, by heating in ethanolic aqueous HX. TcOX 3 (2,2'-bipyridine) (X = Cl, Br) can be synthesized independently from n-Bu 4 NTcOX 4 and 2,2'-bipyridine in ethanolic aqueous HX

  2. Technetium and technetium alloys

    International Nuclear Information System (INIS)

    Ijdo, W.L.

    1993-10-01

    This report presents the results of a literature survey on technetium and technetium alloys. The literature has been searched through 1993. The survey was focused on technetium and (binary cubic) technetium alloys, but other important information on technetium has not been omitted from this survey. This report has been written with the aim to collect more information about phase systems which could be of importance in the transmutation process by neutrons of technetium. With the information presented in this report, it should be possible to select a suitable technetium alloy for further investigation regarding to the transmutation process. (orig.)

  3. The retention mechanism of technetium-99m-HM-PAO

    DEFF Research Database (Denmark)

    Neirinckx, R D; Burke, J F; Harrison, R C

    1988-01-01

    Preparations of d,l- and meso-hexamethylpropyleneamine oxime (HM-PAO) labeled with technetium-99m were added to rat brain homogenates diluted with phosphate buffer (1:10). The conversion of d,l-HM-PAO to hydrophilic forms took place with an initial rate constant of 0.12 min-1. Incubation of the b......Preparations of d,l- and meso-hexamethylpropyleneamine oxime (HM-PAO) labeled with technetium-99m were added to rat brain homogenates diluted with phosphate buffer (1:10). The conversion of d,l-HM-PAO to hydrophilic forms took place with an initial rate constant of 0.12 min-1. Incubation....... This correspondence of values supports the notion that GSH may be important for the in vivo conversion of 99mTc-labeled HM-PAO to hydrophilic forms and may be the mechanism of trapping in brain and other cells. A kinetic model for the trapping of d,l- and meso-HM-PAO in tissue is developed that is based on data...

  4. Technetium chemistry

    International Nuclear Information System (INIS)

    Burns, C.; Bryan, J.; Cotton, F.; Ott, K.; Kubas, G.; Haefner, S.; Barrera, J.; Hall, K.; Burrell, A.

    1996-01-01

    Technetium chemistry is a young and developing field. Despite the limited knowledge of its chemistry, technetium is the workhorse for nuclear medicine. Technetium is also a significant environmental concern because it is formed as a byproduct of nuclear weapons production and fission-power generators. Development of new technetium radio-pharmaceuticals and effective environmental control depends strongly upon knowledge of basic technetium chemistry. The authors performed research into the basic coordination and organometallic chemistry of technetium and used this knowledge to address nuclear medicine and environmental applications. This is the final report of a three-year Laboratory-Directed Research and Development (LDRD) project at the Los Alamos National Laboratory (LANL)

  5. Chemistry of Technetium

    International Nuclear Information System (INIS)

    Omori, Takashi

    2001-01-01

    Since the late 1970's the coordination chemistry of technetium has been developed remarkably. The background of the development is obviously related to the use of technetium radiopharmaceuticals for diagnosis in nuclear medicine. Much attention has also been denoted to the chemical behavior of environmental 99 Tc released from reprocessing plants. This review covers the several aspects of technetium chemistry, including production of radioisotopes, analytical chemistry and coordination chemistry. In the analytical chemistry, separation of technetium, emphasizing chromatography and solvent extraction, is described together with spectrophotometric determination of technetium. In the coordination chemistry of technetium, a characteristic feature of the chemistry of Tc(V) complexes is referred from the view point of the formation of a wide variety of highly stable complexes containing the Tc=O or Tc≡N bond. Kinetic studies of the preparation of Tc(III) complexes using hexakis (thiourea) technetium(III) ion as a starting material are summarized, together with the base hydrolysis reactions of Tc(III), Tc(IV) and Tc(V) complexes. (author)

  6. Technetium in environmental waters

    International Nuclear Information System (INIS)

    Malcolme-Lawes, D.J.; Robb, P.; Warwick, P.

    1983-01-01

    A method for the determination of technetium in a sample of environmental water is described. Technetium, in the TcO 4 - form, is extracted from the sample onto an anion-exchange resin from which it is removed subsequently by washing with 4 M sodium thiocyanate solution. The eluted technetium-thiocyanate complex is then subjected to solvent extraction, where the technetium is further concentrated into butan-2-one. The organic phase is evaporated onto a planchette and the β activity due to the technetium determined by an anticoincidence Geiger counter. Detection limits of 0.5 ng of technetium-99 have been obtained for the counter and sample volumes in excess of 500 cm 3 can be analysed readily. The sorption of several technetium compounds onto soil from a variety of water types has also been investigated. Preliminary results are presented and the importance of the chemical form of technetium used in such studies is discussed briefly. (author)

  7. Nitrosyl complexes of technetium; Nitrosylkomplexe des Technetiums

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, Janine

    2016-09-22

    The presented thesis describes syntheses and characterization of novel technetium nitrosyl compounds with various ligand systems. The main focus is the synthesis of low-valent technetium nitrosyl complexes with cyclopentadienyl ligands. [German] Gegenstand der vorliegenden Arbeit ist die Synthese und Charakterisierung neuer Technetiumnitrosylverbindungen mit unterschiedlichen Ligandensystemen. Hauptaugenmerk wurde dabei auf die Darstellung niedervalenter Tc(NO)-Verbindungen mit Cyclopentadienyl-Liganden gelegt.

  8. Technetium in chemistry and nuclear medicine

    International Nuclear Information System (INIS)

    Deutsch, E.; Nicolini, M.; Wagner, H.N.

    1983-01-01

    This volume explores the potential of technetium radiopharmaceuticals in clinical nuclear medicine. The authors examine the capabilities of synthetic inorganic chemists to synthesize technetium radiopharmaceuticals and the specific requirements of the nuclear medicine practitioner. Sections cover the chemistry of technetium, the production of radiopharmaceuticals labeled with technetium, and the use of technetium radiopharmaceuticals in nuclear medicine

  9. Technetium Behavior and Recovery in Soil

    Energy Technology Data Exchange (ETDEWEB)

    Meinken,G.E.

    1995-12-01

    Technetium-99 in soils is of great concern because of its long half-life and because it can not be detected readily. This work reviews the behavior of technetium in various types of soils. A method for extracting technetium from soil was developed with the use of technetium-95m and 99m to determine recoveries at each step. Technetium chemistry is very complicated and problem areas in the behavior and recovery have been highlighted. Technetium is widely used in nuclear medicine and a review of its chemistry pertaining to radiopharmaceuticals is relevant and helpful in environmental studies. The technetium behavior in the patented citric acid method for the removal of toxic metals in contaminated soils was studied. An innovative method using solid phase extraction media for the concentration of technetium extracted from soils, with water and hydrogen peroxide, was developed. This technique may have a useful environmental application for this type of remediation of technetium from contaminated soils.

  10. Technetium behavior and recovery in soil

    International Nuclear Information System (INIS)

    Meinken, G.E.

    1995-12-01

    Technetium-99 in soils is of great concern because of its long half-life and because it can not be detected readily. This work reviews the behavior of technetium in various types of soils. A method for extracting technetium from soil was developed with the use of technetium-95m and 99m to determine recoveries at each step. Technetium chemistry is very complicated and problem areas in the behavior and recovery have been highlighted. Technetium is widely used in nuclear medicine and a review of its chemistry pertaining to radiopharmaceuticals is relevant and helpful in environmental studies. The technetium behavior in the patented citric acid method for the removal of toxic metals in contaminated soils was studied. An innovative method using solid phase extraction media for the concentration of technetium extracted from soils, with water and hydrogen peroxide, was developed. This technique may have a useful environmental application for this type of remediation of technetium from contaminated

  11. Anomalous properties of technetium clusters

    International Nuclear Information System (INIS)

    Kryuchkov, S.V.

    1985-01-01

    On the basis of critical evaluation of literature data in the field of chemistry of technetium cluster compounds with ligands of a weak field a conclusion is made on specific, ''anomalous'' properties of technetium cluster complexes which consist in an increased ability of the given element to the formation of a series of binuclear and multinuclear clusters, similar in composition and structure and easily transforming in each other. The majority of technetium clusters unlike similar compounds of other elements are paramagnetic with one unpaired electron on ''metallic'' MO of loosening type. All theoretical conceptions known today on the electronic structure of technetium clusters are considered. It is pointed out, that the best results in the explanation of ''anomalous'' properties of technetium clusters can be obtained in the framework of nonempirical methods of self-consistent field taking into account configuration interactions. It is also shown, that certain properties of technetium clusters can be explained on the basis of qualitative model of Coulomb repulsion of metal atoms in clusters. The conclusion is made, that technetium position in the Periodic table, as well as recently detected technetium property to the decrease of effective charge on its atoms during M-M bond formation promote a high ability of the element to cluster formation both with weak field ligands and with strong field one

  12. Thermal conductivity of technetium

    International Nuclear Information System (INIS)

    Minato, K.; Serizawa, H.; Fukuda, K.

    1998-01-01

    The thermal diffusivity of technetium was measured on a disk sample of 5 mm in diameter and 1 mm in thickness by the laser flash method from room temperature to 1173 K, and the thermal conductivity was determined by the measured thermal diffusivity and density, and the reported specific heat capacity. The thermal diffusivity of technetium decreases with increasing temperature though it is almost constant above 600 K. The thermal conductivity of technetium shows a minimum around 400 K, above which the thermal conductivity increases with temperature. The electronic and phonon components of the thermal conductivity were evaluated approximately. The increase in the thermal conductivity of technetium with temperature is due to the increase in the electronic component. (orig.)

  13. Ligand-free, protein-bound technetium-99m iron-dextran enhancement of technetium pyrophosphate uptake in tumours

    International Nuclear Information System (INIS)

    Pojer, P.M.; Jakovljevic, A.C.; Wise, K.N.

    1985-01-01

    The biodistribution of technetium-99m was studied in T-cell lymphoma and selected organs of iron-dextran treated and control mice given technetium-99m pyrophosphate. The results showed that high serum iron levels increased tumour uptake of technetium pyrophosphate. This supports the hypothesis that technetium, in common with other metal-based tumour seeking radiopharmaceuticals, is transported to tumours as a ligand-free protein-bound cation. (U.K.)

  14. Behaviour of technetium in marine algae

    International Nuclear Information System (INIS)

    Bonotto, S.; Kirchmann, R.; Van Baelen, J.; Hurtger, C.; Cogneau, M.; Van der Ben, D.; Verthe, C.; Bouquegneau, J.M.

    1985-01-01

    Uptake and distribution of technetium were studied in several green (Acetabularia acetabulum, Boergesenia forbesii, Ulva lactuca) and brown (Ascophyllum nodosum, Fucus serratus, Fucus spiralis and Fucus vesiculosus) marine algae. Technetium was supplied to the algae as Tc-95m-pertechnetate. Under laboratory conditions, the algae were capable of accumulating technetium, with the exception, however, of Boergesenia, which showed concentration factors (C.F.) comprised between 0.28 and 0.71. The concentration of technetium-99 in Fucus spiralis, collected along the Belgian coast, was measured by a radiochemical procedure. The intracellular distribution of technetium was studied by differential centrifugation in Acetabularia and by the puncturing technique in Boergesenia. The chemical forms of technetium penetrated into the cells were investigated by selective chemical extractions, molecular sieving and thin layer chromatography

  15. Behaviour of technetium in marine algae

    International Nuclear Information System (INIS)

    Bonotto, S.; Kirchmann, R.; Baelen, J. van; Hurtgen, C.; Cogneau, M.; Ben, D. van der; Verthe, C.; Bouquegneau, J.M.

    1986-01-01

    Uptake and distribution of technetium were studied in several green (Acetabularia acetabulum, Boergesenia forbesii, Ulva lactuca) and brown (Ascophyllum nodosum, Fucus serratus, Fucus spiralis and Fucus vesiculosus) marine algae. Technetium was supplied to the algae as Tc-95-pertechnetate. Under laboratory conditions, the algae were capable of accumulating technetium, with the exception, however, of Boergesenia, which showed concentration factors (C.F.) comprised between 0.28 and 0.71. The concentration of technetium-99 in Fucus spiralis, collected along the Belgian coast, was measured by a radiochemical procedure. The intracellular distribution of technetium was studied by differential centrifugation in Acetabularia and by the puncturing technique in Boergesenia. The chemical forms of technetium penetrated into the cells were investigated by selective chemical extractions, molecular sieving and thin layer chromatography. (author)

  16. Technetium migration in natural clays; Migration von Technetium in natuerlichem Tongestein

    Energy Technology Data Exchange (ETDEWEB)

    Luebke, Maria

    2015-10-01

    The present work was performed within the joint research project ''Retention of repository relevant radionuclides in argillaceous rocks and saline systems'' (contract no.: 02E10981), funded by the Federal Ministry for Economic Affairs and Energy (BMWi). The aim was to obtain first insights into the interaction of the long-lived fission product technetium and natural clay with regard to a repository for high-level nuclear waste. For this purpose Opalinus Clay from Mont Terri (northern Switzerland) was used as a reference material. The nuclide technetium-99 will contribute to the radiotoxicity of spent nuclear fuel for more than thousand years due to its long half-live. In case of a leakage of the storage vessels, the geochemistry of technetium is determined by its oxidation state, at which only the oxidation states +IV and +VII are relevant. Because of the high solubility and low affinity to sorption on surfaces of minerals, Tc(VII) is considered to be very mobile and thus the most hazardous species. The focuses of this study therefore are diffusion experiments with this mobile species and investigations of the effect of ferrous iron on the mobility and speciation of technetium.rnThe interaction of technetium and Opalinus Clay was studied in sorption and diffusion experiments varying several parameters (pH value, addition of reducing agents, effect of oxygen, diffusion pathways). In the course of this study spatially resolved investigations of the speciation have been performed on Opalinus Clay thin sections and bore cores for the first time. In addition to the speciation, further information regarding elemental distributions and crystalline phases near technetium enrichments were obtained. Supplementary investigations of powder samples allowed determining the molecular structure of technetium on the clay surface.rnBoth the combination of sorption experiments with spectroscopic investigations and the diffusion experiment exhibit a reduction of Tc

  17. Technetium accumulation, fate, and behavior in plants

    International Nuclear Information System (INIS)

    Cataldo, D.A.; Wildung, R.E.; Garland, T.R.

    1978-01-01

    Technetium, a product of the nuclear fuel cycle, is highly soluble in water and mobile in soils as the pertechnetate ion (TcO - 4 ). Soluble ions in soil have the potential for competing with nutrient ions for membrane carrier sites involved in ion uptake by plants. A study was, therefore, undertaken to determine the availability, toxicity, and mechanism of pertechnetate uptake by soybean (Glycine max cv. Williams). Technetium was effectively accumulated by plants at soil concentrations of 0.01 to 0.1 μg/g and in nutrient culture at levels as low as 0.02 pg/ml. Plants grown on soils containing technetium at levels below 0.1 μg/g effectively removed up to 90% of the technetium from soil. Minimal mobilization of technetium from vegetative tissues to the seed occurred during senescence. Chemical analyses indicated that the xylem-mobile form of technetium was TcO 4 - . The uptake rate of technetium by intact plants was multiphasic over the concentration range of 0.01 to 10μM; this suggests active uptake and a specificity for technetium in the root absorption process. Because of the efficiency of technetium accumulation and the probability of its chemical toxicity, competition kinetic studies were undertaken to identify possible nutrient analogs. Nutrients effective in reducing technetium uptake included the Mn 2+ , SO 4 2- , H 2 PO 4 - , and MoO 4 2- ions

  18. Technetium compounds and their field of application

    International Nuclear Information System (INIS)

    Zaitseva, L.L.; Velichko, A.V.; Vinogradov, I.V.

    1988-02-01

    This chapter reviews the different applications of technetium and technetium compounds in catalysis, corrosion inhibition, superconductivity of technetium alloys, diagnostic techniques, radioisotope generators and radiopharmaceuticals. 649 refs [fr

  19. Sorption of radionuclide technetium on minerals

    International Nuclear Information System (INIS)

    Li Min; Fan Xianhua; Wei Liansheng; Zhang Yingjie; Jiao Haiyang

    2004-01-01

    The study on adsorption behavior of technetium on antimonial minerals is performed in batch experiments and the influence of adsorption time, mineral granularity, solid-liquid ratio, initial concentration, pH value and reducing ion. On technetium adsorption are considered according to adsorption ratios of hepta valent and quadrivalent technetium on stibnite and antimony ocher, the results show that reduction of technetium from heptavelence to quadrivalence could improve adsorption ratios, which provide reference data for selecting buffer-backfill materials in high level rad waste deep geological diplosal. (author)

  20. Radionuclide Basics: Technetium-99

    Science.gov (United States)

    Technetium-99 (chemical symbol Tc-99) is a silver-gray, radioactive metal. It occurs naturally in very small amounts in the earth's crust, but is primarily man-made. Technetium-99m is a short-lived form of Tc-99 that is used as a medical diagnostic tool.

  1. Recovery of technetium from nuclear fuel wastes

    International Nuclear Information System (INIS)

    Carlin, W.W.

    1975-01-01

    Technetium is removed from aqueous, acidic waste solutions. The acidic waste solution is mixed with a flocculant, e.g., an alkaline earth metal hydroxide or oxide, to precipitate certain fission products. Technetium remains in solution and in the resulting supernatant alkaline aqueous phase. The supernatant alkaline aqueous phase is made acidic and electrolyzed in an electrolytic cell under controlled cathodic potential conditions to deposit technetium on the cathode. Elemental technetium is removed from the cathode. Technetium is separated from other plated fission product metals by extraction from an alkaline solution with an organic extractant, such as pyridine, having affinity for technetium. Technetium is separated from the organic extractant by steam distillation and the resulting aqueous phase treated with ammoniacal reagent to precipitate technetium as ammonium pertechnetate. The precipitate may be acidified to form an aqueous acidic solution of fission product metal values and the solution electrolyzed in an electrolytic cell under controlled cathodic potential conditions and at a potential sufficiently negative to plate out from the solution those fission product metals desired. The metal deposit is stripped from the cathode and stored until its radioactivity has diminished. (U.S.)

  2. Electrochemistry of technetium

    International Nuclear Information System (INIS)

    Russell, C.D.; Alabama Univ., Birmingham

    1982-01-01

    Recent work on the electrochemistry of technetium is reviewed, covering the period 1973-1980. Topics include polarographic studies of aqueous pertechnetate, coulometric studies of aqueous pertechnetate at mercury cathodes, and electrochemistry of pertechnetate at solid electrodes. A review is also given of electrochemistry of other technetium compounds, non-aqueous systems, chemical redox reactions, and substitution reactions. Consideration is also given to studies of electrochemistry at tracer concentrations, electrolytic syntheses, standard electrode potentials, and electroanalytical methods. (author)

  3. Sample preparation and characterization of technetium metal

    International Nuclear Information System (INIS)

    Minato, Kazuo; Serizawa, Hiroyuki; Fukuda, Kousaku; Itoh, Mitsuo

    1997-10-01

    Technetium-99 is a long-lived fission product with a half-life of about 2.1 x 10 5 years, which decays by β-emission. For the transmutation of 99 Tc, research on solid technetium was started. Technetium metal powder purchased was analyzed by X-ray diffraction, γ-ray spectrometry, and inductively coupled plasma-atomic emission spectrometry and -mass spectrometry. The lattice parameters obtained were agreed with the reported values. The metallic impurity was about 15 ppm, where aluminum and iron contributed mainly. No impurity nuclide with γ-emission was found. Using the technetium metal powder, button-, rod-, and disk-shaped samples of technetium metal were prepared by arc-melting technique. Thermal diffusivity of technetium metal was measured on a disk sample from room temperature to 1173 K by laser flash method. The thermal diffusivity decreased with increasing temperature though it was almost constant above 600 K. (author)

  4. Determination of technetium-99 in environmental and radioactive waste samples

    International Nuclear Information System (INIS)

    Ferencova, M.; Peter Tkac, P.

    2007-01-01

    Technetium is known for its high mobility in a soil-water system in non-reducing aerobic condition and also high bio-availability for plants, because the most stable form of technetium in natural surface environment is pertechnetate which is highly soluble. The chemical form of technetium changes with environmental conditions. Concentration of technetium in the environment is very low, therefore many separation steps are needed for technetium determination. It has been developed a method for the routine determination of technetium-99 from environmental matrices and radioactive wastes using technetium-99m as an internal yield monitor. Technetium-99 is extracted from the soil samples with nitric acid. Many contaminants are co-precipitated with ferric hydroxide and technetium in the supernatant is pre-concentrated and further purified using anion exchange chromatography. Final separation of technetium was achieved by extraction with tetraphenylarsonium chloride in chloroform from sulphuric acid or pure water. The chemical yield is determined through the measurement of technetium-99m by scintillation counting system and the technetium-99 activity is measured using proportional counter after decay of the technetium-99m activity. Typical recoveries for this method are in the order 50-60 % (authors)

  5. Study of sorption of technetium on pyrrhotine

    International Nuclear Information System (INIS)

    Shen Dong; Fan Xianhua; Su Xiguang; Zeng Jishu

    2001-01-01

    The sorption behaviors of technetium on pyrrhotine are studied with batch experiment and dilute sulfuric acid is used to dissolve the technetium adsorbed on pyrrhotine. Sorption and desorption experiment are performed under aerobic and anaerobic conditions (inert gas box). The results show that a significant sorption of technetium on pyrrhotine is found under aerobic and anaerobic conditions, and the sorption on the mineral is supposed to be due to the reduction of TcO 4 - to insoluble TcO 2 ·nH 2 O. Desorption process of the sorbed technetium into dilute sulfuric acid is found to be different under aerobic and anaerobic conditions. On addition of H 2 O 2 to the leach solution a sudden increase of the technetium concentration is observed

  6. Final Report Technetium Monitor

    International Nuclear Information System (INIS)

    Spencer, W.A.

    2003-01-01

    The Hanford River Protection Project Waste Treatment Plant (WTP) is required by the current contract to remove radioactive technetium FR-om stored caustic nuclear waste solutions. The Savannah River Technology Center (SRTC) has worked with typical envelopes of these wastes to optimize the removal process. To support the studies, SRTC developed a rapid on-line remote analyzer to monitor technetium and rhenium levels in solutions as well as track other metals in the solutions through the process operations. Rhenium was used as a non-radioactive substitute for technetium in process development studies. The remote monitor was based on inductively coupled plasma emission spectroscopy (ICPES). Fiber optic cable and extended RF cabling removed the plasma source FR-om the spectrometer and instrument electronics

  7. Search for technetium in natural tin metallurgical residues

    Energy Technology Data Exchange (ETDEWEB)

    Parker, C.W.

    1996-07-01

    Possible instability of baryons inside the nuclei might result in accumulation of rare isotopes in natural ores. In this respect, isotopes of technetium have certain advantages that can be useful in the search for technetium in nonradioactive ores by chemical methods. In this paper, we review the history of technetium research and discuss a new approach to the search for natural technetium associated with tin ores which appears to offer a rare possibility of discovering a smelting operation by-product such as flue dust, in which the volatile technetium heptoxide (Tc{sub 2}O{sub 7}), like rhenium heptoxide (Re{sub 2}O{sub 7}), would be expected to concentrate. Our concept of a search for technetium in these materials would be based on the assumption that traces of rhenium could occur in the ore and could be traced most easily by neutron activation of small samples. Such a procedure would confirm that an enrichment from the ore to the flue dust actually occurs with the rhenium and therefore should occur with technetium. Furthermore, this occurrence should identify the best location to search for technetium.

  8. Technetium recovery from high alkaline solution

    Energy Technology Data Exchange (ETDEWEB)

    Nash, Charles A.

    2016-07-12

    Disclosed are methods for recovering technetium from a highly alkaline solution. The highly alkaline solution can be a liquid waste solution from a nuclear waste processing system. Methods can include combining the solution with a reductant capable of reducing technetium at the high pH of the solution and adding to or forming in the solution an adsorbent capable of adsorbing the precipitated technetium at the high pH of the solution.

  9. Sorption of radioactive technetium on pyrrhotine

    International Nuclear Information System (INIS)

    Shen, D.; Fan, X.H.; Su, X.G.; Zeng, J.S.; Dong, Y.

    2002-01-01

    The sorption behavior of technetium on pyrrhotine was studied with batch experiments and diluted sulfuric acid (less than 2.88 mol/l) was used to dissolve the technetium adsorbed on pyrrhotine. A significant sorption of technetium on pyrrhotine was observed under aerobic and anaerobic conditions, and the sorption on the mineral was supposed to be due to the reduction of TcO 4 - to insoluble TcO 2 x nH 2 O. Sorbed technetium on the mineral could be desorbed by diluted sulfuric acid. The maximum desorption ratio under aerobic conditions was much higher than that of under anaerobic conditions, meanwhile, the desorption rates under anaerobic conditions were higher than that of under aerobic conditions in the initial stage of the experiments. (author)

  10. Technetium electrodeposition from aqueous formate solutions: electrolysis kinetics and material balance study

    International Nuclear Information System (INIS)

    Maslennikov, A.; Peretroukhine, V.

    1998-01-01

    The kinetics of the Tc electrodeposition and the material balance of potentiostatic electrolysis of formate buffer solutions (pH = 1.79-8.5) containing 5*10 -4 - 1*10 -2 M Tc(VII) at graphite cathode has been studied. The deposition of Tc from the solution was found to become possible at E x *y H 2 O (x ≤ 2, 1.5 cath. ) towards more negative values and the augmentation of the electrolyte surface/volume ratio (S/V) were found to increase the yield of the electrolysis and the rate of the electrodeposition process. A maximum technetium recovery of 92-95% has been observed in the electrolysis of neutral HCOONa solutions (pH = 6.0-7.5, μ = 1.0) containing up to 5*10 -1 M Tc(VII) at potentials of the graphite cathode E 2 . A starting Tc concentration in the solution of [Tc(VII)] > 5 *10 -1 M and the presence of more than 0.05 M NO 3 - in the electrolyte were found to suppress the recovery of technetium from the solution. (orig.)

  11. Method of producing radioactive technetium-99M

    International Nuclear Information System (INIS)

    Karageozian, H.L.

    1979-01-01

    A chromatographic process of producing high purity and high yield radioactive Technetium-99m. A solution containing Molybdenum-99m and Technetium-99m is placed on a chromatographic column and eluted with a neutral solvent system comprising an organic solvent and from about 0.1 to less than about 10% of water or from about 1 to less than about 70% of a solvent selected from the group consisting of aliphatic alcohols having 1 to 6 carbon atoms. The eluted solvent system containing the Technetium-99m is then removed leaving the Technetium-99m as a dry, particulate residue

  12. Technetium in the geologic environment - a literature survey

    International Nuclear Information System (INIS)

    Torstenfelt, B.; Allard, B.; Andersson, K.; Olofsson, U.

    1981-07-01

    The authors present a literature survey of technetium, discussing, in particular, the oxidation states, the chemistry of technetium in connection with spent nuclear fuel storage, the sorption of technetium in rock, clay, soil and sea bottom sediments. (G.T.H.)

  13. Chemistry and structure of technetium complexes

    International Nuclear Information System (INIS)

    Baldas, J.; Boas, J.F.; Bonnyman, J.; Williams, G.A.

    1983-01-01

    The structures of tris(2-aminobenzenethiolato) technetium(VI) and dichlorobis(diethyldithiocarbamato) thionitrosyltechnetium(V) have been determined by single crystal x-ray diffraction analysis. The preparation and chemistry of thiocyanato complexes of technetium have been investigated

  14. X-ray electron investigation of technetium compounds

    International Nuclear Information System (INIS)

    Gerasimov, V.N.; Kryuchkov, S.V.; Kuzina, A.F.; Kulakov, V.M.; Pirozhkov, S.V.; Spitsyn, V.I.; Gosudarstvennyj Komitet po Ispol'zovaniyu Atomnoj Ehnergii SSSR, Moscow. Inst. Atomnoj Ehnergii)

    1982-01-01

    Investigation results of a number of technetium compounds using the method of X-ray electron spectroscopy have been presented for the first time. Calculation of effective charge for compounds without Tc-Tc bond and cluster complexes with strong Tc-Tc bond is made. Strong interdependence of effective charge and properties of technetium clusters is shown. Binding energies for certain cluster complexes of technetium with halides are given

  15. Environmental behavior of technetium-99

    International Nuclear Information System (INIS)

    Turcotte, M.D.S.

    1982-12-01

    This report presents a review of the literature on technetium-99. The chemical and physical properties of some technetium compounds are considered, and a discussion of possible source terms is included. Literature on the environmental behavior of technetium is presented, including its behavior in the bodies of animals and humans. The primary sources of Tc-99 in the environment are fallout from atomic detonations and releases from nuclear fuel reprocessing plants. The environmental behavior of technetium-99 has been studied predominantly with respect to movement in soil and accumulation in plants. There is a surprising scarcity of data on behavior of Tc-99 in the atmosphere and in aquatic systems. Additional work needs to be conducted in these two areas to determine behavior and to acquire baseline concentration data. Much of the soil work has produced contradictory results. In-depth studies of holdup mechanisms for Tc-99 in both geological repositories and soil need to be conducted. Since plants represent a potential bioaccumulation of Tc-99, plant uptake studies of Tc-99 under field conditions also need to be done

  16. Technetium behaviour under deep geological conditions

    International Nuclear Information System (INIS)

    Kumata, M.; Vandergraaf, T.T.

    1993-01-01

    The migration behaviour of technetium under deep geological conditions was investigated by performing column tests using groundwater and altered granitic rock sampled from a fracture zone in a granitic pluton at a depth of about 250 m. The experiment was performed under a pressure of about 0.7 MPa in a controlled atmosphere glove box at the 240 m level of the Underground Research Laboratory (URL) near Pinawa, Manitoba, Canada. The technetium was strongly sorbed on the dark mafic minerals in the column. With the exception of a very small unretarded fraction that was eluted with the tritiated water, no further breakthrough of technetium was observed. This strong sorption of technetium on the mineral surface was caused by reduction of Tc(VII), probably to Tc(IV) even though the groundwater was only mildly reducing. (author) 5 figs., 4 tabs., 15 refs

  17. Technetium migration in natural clays

    International Nuclear Information System (INIS)

    Luebke, Maria

    2015-01-01

    The present work was performed within the joint research project ''Retention of repository relevant radionuclides in argillaceous rocks and saline systems'' (contract no.: 02E10981), funded by the Federal Ministry for Economic Affairs and Energy (BMWi). The aim was to obtain first insights into the interaction of the long-lived fission product technetium and natural clay with regard to a repository for high-level nuclear waste. For this purpose Opalinus Clay from Mont Terri (northern Switzerland) was used as a reference material. The nuclide technetium-99 will contribute to the radiotoxicity of spent nuclear fuel for more than thousand years due to its long half-live. In case of a leakage of the storage vessels, the geochemistry of technetium is determined by its oxidation state, at which only the oxidation states +IV and +VII are relevant. Because of the high solubility and low affinity to sorption on surfaces of minerals, Tc(VII) is considered to be very mobile and thus the most hazardous species. The focuses of this study therefore are diffusion experiments with this mobile species and investigations of the effect of ferrous iron on the mobility and speciation of technetium.rnThe interaction of technetium and Opalinus Clay was studied in sorption and diffusion experiments varying several parameters (pH value, addition of reducing agents, effect of oxygen, diffusion pathways). In the course of this study spatially resolved investigations of the speciation have been performed on Opalinus Clay thin sections and bore cores for the first time. In addition to the speciation, further information regarding elemental distributions and crystalline phases near technetium enrichments were obtained. Supplementary investigations of powder samples allowed determining the molecular structure of technetium on the clay surface.rnBoth the combination of sorption experiments with spectroscopic investigations and the diffusion experiment exhibit a reduction of Tc

  18. Technetium discharges into the environment

    International Nuclear Information System (INIS)

    Luykx, F.

    1986-01-01

    Technetium-99 is the most important technetium isotope released to the environment because of its long life and its relatively high fission yield. Its release to date, mainly as a result of nuclear fuel reprocessing, is estimated to be of the order of 1000 TBq. The quantity from nuclear weapons testing would only be some 10-15% of this value. (author)

  19. The regulation of technetium-99 discharges at Sellafield

    International Nuclear Information System (INIS)

    Mayall, A.

    2002-01-01

    The reprocessing of spent Magnox fuel at BNFL Sellafield produces a liquid waste concentrate containing technetium-99 and other, more radiotoxic, radionuclides such as plutonium and americium. The concentrate is known as medium active concentrate (MAC). Prior to 1981, MAC was discharged to sea untreated after several years' storage, during which short-lived radionuclides underwent radioactive decay. In the early 1980s, discharges of MAC were suspended and it was retained in storage tanks, pending the construction of a plant to remove the radionuclides of greatest radiological concern (these did not include technetium- 99). The Enhanced Actinide Removal Plant started operation in 1994 and began to clear the backlog of stored waste MAC, as well as current arisings from Magnox reprocessing. As a consequence technetium-99 was once more discharged to sea. Subsequently, concentrations of this radionuclide in the marine environment increased. In particular, there was a significant increase in the concentration of technetium-99 in lobster in the Irish Sea. An increase in technetium-99 has also been detected at locations far distant from Sellafield, e.g. in Scandinavian coastal waters, albeit at very low concentrations. This dispersal of technetium- 99 throughout the Irish Sea and further afield has therefore caused concern, although the radiological impact is low. This paper examines the nature and source of the technetium-99 in sea discharges at Sellafield and the levels of past and current discharges as well as their impact. It goes on to describe the Environment Agency's recent proposals on the future regulation of technetium-99 discharges and how these should lead to substantial reductions in not only technetium-99 discharges, but also of other radionuclides such as caesium-137 and strontium-90. (author)

  20. Parallel critical magnetic fields of superconducting hyperthin films of vanadium and technetium

    International Nuclear Information System (INIS)

    Teplov, A.A.; Mikheeva, M.N.

    1980-01-01

    The nature of limiting parallel magnetic fields Hsub(c parallel) destroying a superconducting state in films of vanadium and technetium is found out. A dependence of Hsub(c parallel) on the thickness of films up to d approximately 60 A is studied. The |dHsub(c parallel)sup(2)/dT|sub(Tsub(c)) derivative, which increases in the region of large d with the increase of 1/d and achieves the maximum va;ue at d approximately 100 A, was determined, using the experimental data. For the most thin films this derivative tends to drop (the value of the derivative changes from 16 up to 20.00 kOe 2 /k and for technetium and from 4 up to 2100 kOe 2 /k for vanadium). Such stop at |dHsub(c11)sup(2)/ dT|sub(Tsub(c)) growth during the decrease of d is not explained in the framework of the theory taking into account only orbital effects. An account of the additional paramagnetic effect (spin effects) leads to a good agreement of the experiment with the theory in the whole range of thicknesses for vanadium. For technetium films in the d range <=110 A the value of Hsub(c parallel) exceeds several times Hsub(c parallel) calculated with provision of spin effects. For d approximately 80 A and d approximately 55 A this increase achieves the triple value. This effect is explained qualitatively by the spin-orbital scattering appearing with the increase of the atomic number

  1. Chemistry of technetium in the environment

    International Nuclear Information System (INIS)

    McFadden, K.M.

    1980-08-01

    Technetium release to the environment may occur during separation and recovery of spent nuclear fuels, or in disposal of aqueous waste from nuclear facilities, hospitals, or other users. The chemistry and sources of technetium are reviewed as a basis for prediction of its behavior in the environment

  2. Substitution reactions of technetium complexes

    International Nuclear Information System (INIS)

    Omori, T.

    1997-01-01

    Substitution reactions of a series of technetium complexes are considered in comparison with corresponding reactions of rhenium. Rhenium and technetium complexes are rather inert in substitution reactions, the latter are characterized by greater rate constants when they proceed according to dissociative mechanism. In rare cases when k Tc /k Re id little it is assumed that the reaction proceeds according to the associative mechanism. (author)

  3. Final Report, Research Program to Investigate the Fundamental Chemistry of Technetium

    International Nuclear Information System (INIS)

    Lukens, Wayne W. Jr.; Fickes, Michael J.; Bucher, Jerome J.; Burns, Carol J.; Edelstein, Norman M.; Shuh, David K.

    2000-01-01

    The purpose is to increase the basic scientific understanding of technetium chemistry to better understand the behavior of technetium in chemical environments relevant to DOE. Two important areas in need of study are the behavior of technetium in highly alkaline solutions similar to high-level nuclear waste, and its behavior in different waste forms. This research program addressed these two needs. Two separate approaches were used in this program. The first focus was to understand the basic solution chemistry of technetium, which underlies its behavior in the highly alkaline environment of the nuclear waste tanks located at the Savannah River and Hanford Sites. The specific problems at these sites are related to the anomalous oxidation state of technetium (Schroeder 1995). Although, at high pH, technetium should exist in its highest oxidation state as TcO 4 - , soluble, lower-valent technetium species have been observed in certain wastes. The specific unknowns that this program sought to answer are the nature of lower valent technetium species that can be formed in highly alkaline solution and whether pertechnetate undergoes radiolytic reduction in highly alkaline solution when nitrate is present in excess. The second focus area is the behavior of technetium immobilized in various waste forms. The behavior of technetium in cement wastes was examined to gain information about its long-term stability. Specifically, this research examined the oxidation of reduced technetium species by components present in high-level waste that are incorporated into cement waste along with technetium

  4. The performance of gel technetium-99m generator

    International Nuclear Information System (INIS)

    Liu Yishu

    2004-01-01

    Technetium-99m, as one of the important radionuclides in nuclear medical science, has been widely used for diseases diagnosis in both developed and developing countries for many years. Technetium-99m can be obtained from both fission-type and gel-type Tc-99m generator. Fission-type generator was prepared by Molybdenum-99 separated from fission products of uranium-235 and gel-type was prepared by irradiating nature MoO 3 in reactor, and a series of chemical and physical processes. This paper briefly describes the manufacturing technical process of gel-type Technetium-99 generator, including the preparation of target containing nature MoO 3 , the target irradiation in reactor, gel preparation, gel filtration and drying, dried gel cracking, generator loading and activity calibration of generator. The performances of gel-type Technetium-99m generator, such as elution efficiency, elution profile, the pH, Mo breakthrough, Zirconium content, radiochemical purity, radionuclidic purity, sterility and pyrogencity of eluate, are also expatiated in detail. Comparing with fission-type Technetium-99m generator, the defects of gel-type Technetium-99m generator are enumerated and their overcoming solutions are recommended in this paper. (author)

  5. Research program to investigate the fundamental chemistry of technetium

    Energy Technology Data Exchange (ETDEWEB)

    McKeown, David A.; Buechele, Andrew C.; Lukens, Wayne W.; Muller, Isabelle S.; Shuh, David K.; Pegg, Ian L.

    2007-10-12

    The objective of this research is to increase the knowledge of the fundamental technetium chemistry necessary to address challenges to the safe, long-term disposal of high-level nuclear waste posed by this element. The primary issues examined during the course of this project were the behavior of technetium and its surrogate rhenium during waste vitrification and glass corrosion. Since the redox behavior of technetium can play a large role in determining its volatility, one goal of this research was to better understand the behavior of technetium in glass as a function of the redox potential of the glass melt. In addition, the behavior of rhenium was examined, since rhenium is commonly used as a surrogate for technetium in waste vitrification studies. A number of glasses similar to Hanford Low Activity Waste (LAW) glasses were prepared under controlled atmospheres. The redox state of the glass was determined from the Fe(II)/Fe(III) ratio in the cooled glass, and the speciation of technetium and rhenium was determined by x-ray absorption fine structure (XAFS) spectroscopy. The behavior of rhenium and technetium during glass alteration was also examined using the vapor hydration test (VHT).

  6. Sources and behavior of technetium in the environment

    International Nuclear Information System (INIS)

    Schulte, E.H.; Scoppa, P.

    1987-01-01

    Technetium is a man-made element produced in increasing amounts during the last decades. The chemical and physical properties of some technetium compounds are considered, and a discussion of possible source terms is included. Literature on the environmental behavior of technetium is reviewed to evaluate its transfer and equilibrium distribution in aquatic and terrestrial ecosystems. Considerable effort has been expended in the last years in order to understand the biogeochemical processes responsible for the long-term behavior of technetium in the environment and its transfer through food chains as well as to identify critical pathways of the long-lived radioisotope Tc-99 from the environment to man. (Auth.)

  7. Final Report, Research Program to Investigate the Fundamental Chemistry of Technetium

    Energy Technology Data Exchange (ETDEWEB)

    Lukens Jr., Wayne W.; Fickes, Michael J.; Bucher, Jerome J.; Burns, Carol J.; Edelstein, Norman M.; Shuh, David K.

    2000-12-23

    The purpose is to increase the basic scientific understanding of technetium chemistry to better understand the behavior of technetium in chemical environments relevant to DOE. Two important areas in need of study are the behavior of technetium in highly alkaline solutions similar to high-level nuclear waste, and its behavior in different waste forms. This research program addressed these two needs. Two separate approaches were used in this program. The first focus was to understand the basic solution chemistry of technetium, which underlies its behavior in the highly alkaline environment of the nuclear waste tanks located at the Savannah River and Hanford Sites. The specific problems at these sites are related to the anomalous oxidation state of technetium (Schroeder 1995). Although, at high pH, technetium should exist in its highest oxidation state as TcO{sub 4}{sup {minus}}, soluble, lower-valent technetium species have been observed in certain wastes. The specific unknowns that this program sought to answer are the nature of lower valent technetium species that can be formed in highly alkaline solution and whether pertechnetate undergoes radiolytic reduction in highly alkaline solution when nitrate is present in excess. The second focus area is the behavior of technetium immobilized in various waste forms. The behavior of technetium in cement wastes was examined to gain information about its long-term stability. Specifically, this research examined the oxidation of reduced technetium species by components present in high-level waste that are incorporated into cement waste along with technetium.

  8. Corrosion and antifouling characteristics of technetium 99 in seawater

    International Nuclear Information System (INIS)

    Spitsyn, V.I.; Strekalov, P.V.; Balakhovskij, O.A.; Mikhajlovskij, Yu.N.

    1982-01-01

    The results are presented of studying the corrosive and antifouling properties of metallic technetium-99 in the Barents Sea and the Sea of Japan. Foil of 99 Tc glued on acrylic plastic served as a sample. High corrosion resistance and antifouling properties exhibited by 99 Tc in seawater point to favorable prospects of further studies aimed at development of new methods for protection against corrosion and fouling of metallic structures and parts with the use of technetium. The antifouling properties of technetium would evidently be used most efficiently when coating materials of high corrosion resistance to seawater (titanium, stainless steels, special alloys, etc.) with layers of technetium. The use of technetium for coating low-alloyed or carbon steels employed in seawater is yet problematic

  9. Research Program to Investigate the Fundamental Chemistry of Technetium

    International Nuclear Information System (INIS)

    Edelstein, Norman M.; Burns, Carol J.; Shuh, David D.; Lukens, Wayne

    2000-01-01

    Technetium (99Tc, half-life = 2.13x105 years, b-emitter) is one of the radionuclides of major concern for nuclear waste disposal. This concern is due to the long half-life of 99Tc, the ease with which pertechnetate, TcO4 -, migrates in the geosphere, and the corresponding regulatory considerations. The problem of mobility of pertechnetate in the environment is compounded by the fact that pertechnetate is the thermodynamically stable form of technetium in aerobic environments. These two factors present challenges for the safe, long term immobilization of technetium in waste forms. Because of the stability of pertechnetate, technetium has been assumed to exist as pertechnetate in the aqueous phase of nuclear waste tanks. However, recent studies indicate that a significant fraction of the technetium is in a different chemical form. This program addresses the fundamental solution chemistry of technetium in the waste tank environment, and in a second part, the stability of technetium in various waste forms. The chemistry of this element will be studied in aqueous solutions at high pH, with various added salts such as nitrate, nitrite, and organic complexants, and as a function of radiation dose, to determine whether radiolysis effects can reduce TcO4 -. A separate facet of this research is the search for chemical forms of technetium that may be thermodynamically and/or kinetically stable and may be incorporated in various waste forms for long term storage. This phase of the program will address the problem of the possible oxidation of lower valent technetium species in various waste form matrices and the subsequent leaching of the highly soluble TcO4 -

  10. Technetium-aspirin molecule complexes

    International Nuclear Information System (INIS)

    El-Shahawy, A.S.; Mahfouz, R.M.; Aly, A.A.M.; El-Zohry, M.

    1993-01-01

    Technetium-aspirin and technetium-aspirin-like molecule complexes were prepared. The structure of N-acetylanthranilic acid (NAA) has been decided through CNDO calculations. The ionization potential and electron affinity of the NAA molecule as well as the charge densities were calculated. The electronic absorption spectra of Tc(V)-Asp and Tc(V)-ATS complexes have two characteristic absorption bands at 450 and 600 nm, but the Tc(V)-NAA spectrum has one characteristic band at 450 nm. As a comparative study, Mo-ATS complex was prepared and its electronic absorption spectrum is comparable with the Tc-ATS complex spectrum. (author)

  11. Measurement and behaviour of technetium in fast reactor fuel reprocessing

    International Nuclear Information System (INIS)

    Ferguson, C.; Kyffin, T.W.

    1986-02-01

    A method is described for the spectrophotometric measurement of technetium in plant solutions from the reprocessing of fast reactor fuel. The technetium is selectively extracted using tri-iso-octylamine. After back extraction, thiocyanate is added, in the presence of tetrabutyl-ammonium hydroxide, to form the red hexa-thiocyanato anionic complex in a chloroform medium. The concentration of the technetium is then calculated from the spectrophotometric measurement of this complex. This method was applied to bulk samples, collected during a PFR fuel reprocessing campaign, to identify the main routes followed by technetium through the reprocessing plant. In order to understand the probable behaviour of technetium in the process plant streams, an investigation into the influence of plutonium IV nitrate on the extraction of Tc (VII) into 20%v/v tributyl phosphate/odourless kerosene solution from nitric acid solutions, was initiated. The results of this investigation, along with the known distribution coefficient for the extraction of the uranyl/technetium complex U0 2 (N0 3 )(Tc0 4 ).2TBP and the redox chemistry of technetium, are used to predict the probable behaviour of technetium in the process plant streams. This predicted behaviour is compared with the experimental results and reasonable agreement is obtained between experiment and theory, considering the history of the samples analysed. (author)

  12. Study of the synthesis of ammonia over technetium catalysts

    International Nuclear Information System (INIS)

    Spetsyn, V.I.; Mikhailenko, I.E.; Pokrovskaya, O.V.

    1982-01-01

    The catalytic properties of technetium in the synthesis of ammonia have been studied in the present work. Technetium catalysts according to specific yield surpass all know catalysts for the synthesis of ammonia. The enhanced catalytic activity of technetium compared to manganese and rhenium is apparently explained by the presence of the radioactivity of 99 Tc. The processes of adsorption, orientation of the adsorbed molecules, and their binding energies can differ during radiation action. Irradiation of the carrier, occurring through #betta#-emission of 99 Tc, with doses of 4-8 x 10 3 rad/day, increased the number of defects in the crystal structure where stabilization of technetium atoms was possible. The existence of charged centers can cause an increase in the dissociative chemisorption of nitrogen, which is the limiting stage of the process. Technetium catalysts possess a stable catalytic activity and do not require its restoration for several months. Results suggest that the use of technetium as a catalyst for the synthesis of ammonia has real advantages and potential possibilities

  13. Study of the chemical behaviour of technetium during irradiated fuels reprocessing

    International Nuclear Information System (INIS)

    Zelverte, A.

    1988-04-01

    This paper deals with the preparation of the lower oxidation states +III +IV and +V of technetium in nitric acid and its behaviour during the reprocessing of nuclear fuels (PUREX process). The first part of this work is a bibliographical study of this element in solution without any strong ligand. By chemical and electrochemical technics, pentavalent, tetravalent and trivalent technetium species, were prepared in nitric acid. The following chemical reactions are studied: - trivalent and tetravalent technetium oxidation by nitrate ion. - hydrazine and tetravalent uranium oxidation catalysed by technetium: in those reactions, we point out unequivocally the prominent part of trivalent and tetravalent technetium, - technetium behaviour towards hydroxylamine. Technetium should not cause any disturbance in the steps where hydroxylamine is employed to destroy nitrous acid and hydrazine replacement by hydroxylamine in uranium-plutonium partition could contribute to a best reprocessing of nuclear fuels [fr

  14. The chemical speciation of technetium in the environment: a literature survey

    International Nuclear Information System (INIS)

    Sparkes, S.T.; Long, S.E.

    1987-07-01

    This report reviews the current understanding of the chemical forms and behaviour of technetium in the environment. Technetium (VII) is the dominant species in most systems, however when reducing conditions arise technetium (IV) species predominate. Pertechnetate is a highly mobile ion in aqueous media and can exhibit significant environmental transfer. Technetium (IV) is readily sorbed by sediments and is able to complex with various ligands which subsequently determine its fate. Complexation with high molecular weight organic moieties reduces the availability of technetium although this is not necessarily the case with smaller molecules. In plants, technetium is absorbed as TcO 4 - and can become incorporated into organic molecules. The technetium present in such forms is generally considered less available for uptake by the ingesting animal than aqueous TcO 4 - , although significant transfer of this element has been reported from food into eggs. Areas of potential future interest are suggested. (author)

  15. Supplemental Report: Application of Emission Spectroscopy to Monitoring Technetium

    International Nuclear Information System (INIS)

    Spencer, W.A.

    2000-01-01

    This report provides supplemental information to an earlier report BNF-98-003-0199, ''Evaluation of Emission Spectroscopy for the On-Line Analysis of Technetium''. In this report data is included from real Hanford samples as well as for solutions spiked with technetium. This supplemental work confirms the ability of ICP-ES to monitor technetium as it breaks through an ion exchange process

  16. Synthesis and characterization of volatile technetium compound

    International Nuclear Information System (INIS)

    Childs, Bradley C.; Poineau, Frederic; Czerwinski, Ken R.

    2013-01-01

    Technetium-99 is an important fission (T 1/2 = 2.13.105 y) product of the nuclear industry. Technetium in its highest oxidation state (VII) is highly mobile and can represent a threat to the environment. There are over 55 million gallons of high level mixed waste located at the Hanford site. Waste tanks at the Hanford site contain Tc that could potentially leak, and in the context of management of technetium, a glass waste form was proposed to counteract the issue. In the process of synthesizing melt glass between the temperatures of 600°C and 1100°C, volatile technetium compounds were observed in the reaction tube. These compounds displayed characteristic colors based upon the reaction environments of either breathing air or nitrogen gas. A breathing air atmosphere produces a red compound that adheres to the walls of the reaction tube. An atmosphere of nitrogen gas produces a white compound that was observed on the walls of the reaction tube. (author)

  17. Concentration of technetium by marine organisms

    International Nuclear Information System (INIS)

    Koyanagi, T.; Suzuki, Y.; Nakamura, R.; Nakahara, M.

    1990-01-01

    Accumulation and excretion of technetium by marine organisms were observed in radioisotope tracer experiments to determine concentration factors for estimating radiation dose to humans from radioactive pollution of marine environments. Marine fish, crustaceans, mollusks, echinoderms, and seaweeds were reared in sea water labeled with 95m Tc to observe uptake from sea water. The organisms were then transferred into unlabeled sea water for depuration experiments. Concentration factors were calculated from uptake and excretion rates. Also considered was the contribution of food-chain transfer of technetium, observed by administering labeled seaweeds to mollusks or echinoderms. Low accumulations were shown by fish, crustaceans, pelecypods and cephalopods, whereas high concentration factors were observed in gastropods and seaweeds. Species specificity or specific accumulation in special organs or tissues was not evident except in seaweed, where the difference was clearly species-associated. Relatively high rates of technetium retention were observed in the organisms administered labeled seaweed. The higher concentrations observed in gastropods, compared to those in pelecypods, were thought to result from different feed habits. The adaptability of some species as indicator organisms for monitoring 99 Tc in sea water was recognized, but the contribution of technetium to radiation dose was considered insignificant

  18. Transfer of technetium from soil to paddy and upland rice

    International Nuclear Information System (INIS)

    Yanagisawa, Kei; Muramatsu, Yasuyuki

    1995-01-01

    Soil-plant transfer factors (concentration ratio between the plant and soil) of technetium in paddy and upland rice plants were obtained from laboratory experiments. The transfer factor is one of the most important parameters for environmental radiation dose assessment. Technetium tracer ( 95m TcO 4 - ) was added to the soil prior to rice cultivation. The transfer factor of technetium for the hulled grains (brown rice) of paddy rice (≤0.0002) was much lower than for that of upland rice (0.021). The transfer factors for both types of hulled grains were much lower than in the leaves. The technetium decontamination rate from hulled grains by polishing was 34%, the percentage of the weight decrease being 12%. The concentration of technetium in the soil solution collected from the paddy rice soil (flooded conditions) decreased rapidly with time due to its adsorption on the soil. In the upland rice soil (non-flooded) solution, the decrease in the technetium concentration was fairly slow. The low transfer factors for the paddy rice plants could be explained by the immobilization of technetium in the flooded soil. The oxidation-reduction potentials (Eh) in the flooded soil decreased rapidly with time. We conclude that technetium tracer added as TcO 4 - to flooded soil is readily transformed to an insoluble form (e.g.TcO 2 ) under the reducing conditions provided by flooding. (author)

  19. Technetium complexation by macrocyclic compounds

    International Nuclear Information System (INIS)

    Li Fan Yu.

    1983-01-01

    Research in nuclear medicine are directed towards the labelling of biological molecules, however, sup(99m)Tc does not show sufficient affinity for these molecules. The aim of this study was to evaluate the ability of macrocyclic compounds to bind strongly technetium in order to be used as complexation intermediate. The reducing agents used were a stannous complex and sodium dithionite. Cryptates and polyesters are not good complexing agents. They form two complexes: a 2:1 sandwich complex or 3:2 and a 1:1 complex. Cyclams are good complexing agents for technetium their complexations strength was determined by competition with pyrophosphate, gluconate and DTPA. Using the method of ligand exchange, the oxidation state of technetium in the Tc-cyclam complex was IV or V. They are 1:1 cationic complexes, the complex charge is +1. The biodistribution in rats of labelling solutions containing (cyclam 14 ane N 4 ) C 12 H 25 shows a good urinary excretion without intoxication risks [fr

  20. Process for producing radioactive technetium 99 m

    International Nuclear Information System (INIS)

    Karageozian, H.L.

    1979-01-01

    Active aluminium oxide containing Molybdenum 99 and technetium 99 m is treated with a neutral solvent consisting of water, methylethylketone and ethanol. Technetium 99 m remains on the chromatographic material after drying, in the form of a dry powder. Other aliphatic alcohols can also be utilised. (DG) [de

  1. Linkable thiocarbamoylbenzamidines as ligands for bioconjugation of Rhenium and Technetium; Kopplungsfaehige Thiocarbamoylbenzamidine als Liganden zur Biokonjugation von Rhenium und Technetium

    Energy Technology Data Exchange (ETDEWEB)

    Castillo Gomez, Juan Daniel

    2015-04-27

    Bioconjugation reactions with Rhenium and Technetium are of high importance for the development of novel radiopharmaceuticals for nuclear medicine. In this thesis the possibilities for bioconjugation using linkable Thiocarmbamoylbenzamidines as ligands for the complexation of Rhenium and Technetium were examined.

  2. Research program to investigate the fundamental chemistry of technetium

    International Nuclear Information System (INIS)

    Shuh, David K.; Lukens, Wayne W.; Burns, Carol J.

    2003-01-01

    The objective of this research is to increase the knowledge of the fundamental technetium chemistry that is necessary to address challenges to the safe, long-term remediation of high-level waste posed by this element. These challenges may be divided into two categories: unexpected behavior of technetium in high-level waste tanks at the Hanford and Savannah River Sites and the behavior of technetium in waste forms

  3. Research program to investigate the fundamental chemistry of technetium

    Energy Technology Data Exchange (ETDEWEB)

    Shuh, David K.; Lukens, Wayne W.; Burns, Carol J.

    2003-12-19

    The objective of this research is to increase the knowledge of the fundamental technetium chemistry that is necessary to address challenges to the safe, long-term remediation of high-level waste posed by this element. These challenges may be divided into two categories: unexpected behavior of technetium in high-level waste tanks at the Hanford and Savannah River Sites and the behavior of technetium in waste forms.

  4. A method for the determination of technetium in environmental waters

    International Nuclear Information System (INIS)

    Robb, P.; Warwick, P.; Malcolme-Lawes, D.J.

    1985-01-01

    A method is described which can be used to determine technetium-99 levels in a range of water types. Ruthenium isotopes which may interfere in the analysis are removed from the sample by precipitation before concentration of pertechnetate onto an ion-exchange column. Other nuclides can be removed from the column using NaOH before elution of the technetium using NaSCN. The technetium in the NaSNC eluent can then be extracted into butan-2-one which can be evaporated onto a planchette. Technetium-99m is used as a yield tracer and after this has decayed away to negligible levels. The amount of technetium on the planchette can be determined by measuring the rate of beta radiation emission from the final concentrate. (author)

  5. Control of technetium at the Portsmouth Gaseous Diffusion Plant

    International Nuclear Information System (INIS)

    Saraceno, A.J.

    1981-01-01

    Technetium-99 entered the gaseous diffusion complex as a volatile impurity in recycled uranium that was fed to the Paducah Gaseous Diffusion Plant. Subsequently, it entered the Oak Ridge and Portsmouth cascades as an impurity in Paducah product feed. Most of the technetium was adsorbed on cascade equipment in increasingly high concentrations as it moved up the cascade. Since the low energy beta radiation produced by technetium cannot penetrate cascade equipment, it presents no significant hazard to workers as long as it remains inside of equipment. However, when equipment that contains high concentrations of technetium is opened for maintenance or change-out, precautions are taken to ensure worker safety. Traps containing activated alumina are used at the plant vent streams to limit radioactive emissions as far as possible. Annual vent stream emissions have been well below DOE limits. To allow continued compliance, other potential trapping agents have been tested. Several that limit emissions more effectively than activated alumina have been found. Other traps containing magnesium fluoride are used in the upper cascade to reduce the technetium concentration. Waste solutions from decontamination can also contain technetium. These solutions must either be stored for controlled discharge or treated to remove the technetium. To allow the latter, an ion exchange facility is being installed for operation by the end of FY-1982. Liquid discharges at Portsmouth have usually been less than 5% of the DOE imposed limits

  6. Some aspects of the assay of technetium in environmental waters

    International Nuclear Information System (INIS)

    Robb, P.

    1983-09-01

    Technetium, as 99 Tc, was rapidly concentrated from large sample volumes (> 500 cm 3 ) by use of an anion exchange column after removal of ruthenium isotopes by precipitation. The bulk of the technetium can be removed from the resin by elution with sodium thiocyanate followed by further concentration by extraction with butan-2-one. Evaporation of solvent onto a planchette followed by measurement of emitted beta radiation can determine technetium levels. Method is capable of removing between 10 -15 and 10 -6 g of technetium from 500 cm 3 of water. (author)

  7. Fluorido complexes of technetium

    International Nuclear Information System (INIS)

    Mariappan Balasekaran, Samundeeswari

    2013-01-01

    Fluorine chemistry has received considerable interest during recent years due to its significant role in the life sciences, especially for drug development. Despite the great nuclear medicinal importance of the radioactive metal technetium in radiopharmaceuticals, its coordination chemistry with the fluorido ligand is by far less explored than that of other ligands. Up to now, only a few technetium fluorides are known. This thesis contains the synthesis, spectroscopic and structural characterization of novel technetium fluorides in the oxidation states ''+1'', ''+2'', ''+4'' and ''+6''. In the oxidation state ''+6'', the fluoridotechnetates were synthesized either from nitridotechnetic(VI) acid or from pertechnetate by using reducing agent and have been isolated as cesium or tetraethylammonium salts. The compounds were characterized spectroscopically and structurally. In the intermediate oxidation state ''+4'', hexafluoridotechnetate(IV) was known for long time and studied spectroscopically. This thesis reports novel and improved syntheses and solved the critical issues of early publications such as the color, some spectroscopic properties and the structure of this key compound. Single crystal analyses of alkali metal, ammonium and tetramethylammonium salts of hexafluoridotechnetate(IV) are presented. In aqueous alkaline solutions, the ammonium salt of hexafluoridotechnetate(IV) undergoes hydrolysis and forms an oxido-bridged dimeric complex. It is the first step hydrolysis product of hexafluoridotechnetate(IV) and was characterized by spectroscopic and crystallographic methods. Low-valent technetium fluorides with the metal in the oxidation states of ''+2'' or ''+1'' are almost unknown. A detailed description of the synthesis and characterization of pentafluoridonitrosyltechnetate(II) is presented. The complex was isolated as alkali metal salts, and spectroscopic as well as structural features of the complexes are presented. Different salts of the trans

  8. TESTING GUIDELINES FOR TECHNETIUM-99 ADSORPTION ON ACTIVATED CARBON

    International Nuclear Information System (INIS)

    Byrnes, M.E.

    2010-01-01

    CH2M HILL Plateau Remediation Company (CHPRC) is currently evaluating the potential use of activated carbon adsorption for removing technetium-99 from groundwater as a treatment method for the Hanford Site's 200 West Area groundwater pump-and-treat system. The current pump-and-treat system design will include an ion-exchange (IX) system for selective removal of technetium-99 from selected wells prior to subsequent treatment of the water in the central treatment system. The IX resin selected for technetium-99 removal is Purolite A530E. The resin service life is estimated to be approximately 66.85 days at the design technetium-99 loading rate, and the spent resin must be replaced because it cannot be regenerated. The resulting operating costs associated with resin replacement every 66.85 days are estimated at $0.98 million/year. Activated carbon pre-treatment is being evaluated as a potential cost-saving measure to offset the high operating costs associated with frequent IX resin replacement. This document is preceded by the Literature Survey of Technetium-99 Groundwater Pre-Treatment Option Using Granular Activated Carbon (SGW-43928), which identified and evaluated prior research related to technetium-99 adsorption on activated carbon. The survey also evaluated potential operating considerations for this treatment approach for the 200 West Area. The preliminary conclusions of the literature survey are as follows: (1) Activated carbon can be used to selectively remove technetium-99 from contaminated groundwater. (2) Technetium-99 adsorption onto activated carbon is expected to vary significantly based on carbon types and operating conditions. For the treatment approach to be viable at the Hanford Site, activated carbon must be capable of achieving a designated minimum technetium-99 uptake. (3) Certain radionuclides known to be present in 200 West Area groundwater are also likely to adsorb onto activated carbon. (4) Organic solvent contaminants of concern (COCs) will

  9. TESTING GUIDELINES FOR TECHNETIUM-99 ABSORPTION ON ACTIVATED CARBON

    Energy Technology Data Exchange (ETDEWEB)

    BYRNES ME

    2010-09-08

    CH2M HILL Plateau Remediation Company (CHPRC) is currently evaluating the potential use of activated carbon adsorption for removing technetium-99 from groundwater as a treatment method for the Hanford Site's 200 West Area groundwater pump-and-treat system. The current pump-and-treat system design will include an ion-exchange (IX) system for selective removal of technetium-99 from selected wells prior to subsequent treatment of the water in the central treatment system. The IX resin selected for technetium-99 removal is Purolite A530E. The resin service life is estimated to be approximately 66.85 days at the design technetium-99 loading rate, and the spent resin must be replaced because it cannot be regenerated. The resulting operating costs associated with resin replacement every 66.85 days are estimated at $0.98 million/year. Activated carbon pre-treatment is being evaluated as a potential cost-saving measure to offset the high operating costs associated with frequent IX resin replacement. This document is preceded by the Literature Survey of Technetium-99 Groundwater Pre-Treatment Option Using Granular Activated Carbon (SGW-43928), which identified and evaluated prior research related to technetium-99 adsorption on activated carbon. The survey also evaluated potential operating considerations for this treatment approach for the 200 West Area. The preliminary conclusions of the literature survey are as follows: (1) Activated carbon can be used to selectively remove technetium-99 from contaminated groundwater. (2) Technetium-99 adsorption onto activated carbon is expected to vary significantly based on carbon types and operating conditions. For the treatment approach to be viable at the Hanford Site, activated carbon must be capable of achieving a designated minimum technetium-99 uptake. (3) Certain radionuclides known to be present in 200 West Area groundwater are also likely to adsorb onto activated carbon. (4) Organic solvent contaminants of concern (COCs

  10. Ion exchange removal of technetium from salt solutions

    International Nuclear Information System (INIS)

    Walker, D.D.

    1983-01-01

    Ion exchange methods for removing technetium from waste salt solutions have been investigated by the Savannah River Laboratory (SRL). These experiments have shown: Commercially available anion exchange resins show high selectivity and capacity for technetium. In column runs, 150 column volumes of salt solution were passed through an ion exchange column before 50% 99 Tc breakthrough was reached. The technetium can be eluted from the resin with nitric acid. Reducing resins (containing borohydride) work well in simple hydroxide solutions, but not in simulated salt solutions. A mercarbide resin showed a very high selectivity for Tc, but did not work well in column operation

  11. The radiopharmaceuticals labelled with technetium-99m and the radiopharmacy; Les radiopharmaceutiques marques au technetium-99m et la radiopharmacie

    Energy Technology Data Exchange (ETDEWEB)

    Bodenant, V

    1998-10-01

    In less than fifty years, the place of nuclear medicine is become primordial. Among all the radiopharmaceuticals used in nuclear medicine, the technetium-99m is the most used because of its physico-chemical properties and its great availability with the molybdenum-99m - technetium-99m generator. Since 1992, the radiopharmaceuticals, the packages, the generators are included in the pharmaceutic monopole. They are now under the reliability of the radio-pharmacist. This thesis has for object to introduce these different radiopharmaceuticals labelled with technetium-99m and to show the primordial place of the radio-pharmacist in a service of nuclear medicine. (N.C.)

  12. Uptake and distribution of technetium in several marine algae

    International Nuclear Information System (INIS)

    Bonotto, S.; Gerber, G.B.; Garten, C.T. Jr.; Vandecasteele, C.M.; Myttenaere, C.; Van Baelen, J.; Cogneau, M.; van der Ben, D.

    1983-01-01

    The uptake or chemical form of technetium in different marine algae (Acetabularia, Cystoseira, Fucus) has been examined and a simple model to explain the uptake of technetium in the unicellular alga, Acetabularia, has been conceptualized. At low concentrations in the external medium, Acetabularia can rapidly concentrate technetium. Concentration factors in excess of 400 can be attained after a time of about 3 weeks. At higher mass concentrations in the medium, uptake of technetium by Acetabularia becomes saturated resulting in a decreased concentration factor (approximately 10 after 4 weeks). Approximately 69% of the total radioactivity present in /sup 95m/Tc labelled Acetabularia is found in the cell cytosol. In Fucus vesiculosus, labelled with /sup 95m/Tc, a high percentage of technetium is present in soluble ionic forms while approximately 40% is bound, in this brown alga, in proteins and polysaccharides associated with cell walls. In the algal cytosol of Fucus vesiculosus, about 45% of the /sup 95m/Tc appears to be present as anionic TcO - 4 and the remainder is bound to small molecules. 8 references, 5 figures, 1 table

  13. The molybdenum-technetium solar neutrino experiment

    International Nuclear Information System (INIS)

    Schroeder, N.C.; Wolfsberg, K.; Rokop, D.J.

    1991-01-01

    The authors are attempting to measure the time-averaged 8 B solar-neutrino flux over 10 Myr by measuring 98 Tc produced through the 98 Mo( nu ,e - ) reaction in a deeply buried molybdenum deposit. This will test the prediction of periodic mixing of the Sun's core over long time intervals. To separate technetium from 10,000-ton quantities of Henderson ore, the authors have taken advantage of the commercial processing of molybdenite. Technetium, volatilized during roasting of molybdenite to MoO 3 , was scrubbed from the gas stream and collected on anion exchange columns. After sample reduction and chemical separation and purification they measured technetium, as TcO 4 - , using negative thermal ionization mass spectrometry. Measurement of 99 Tc in spiked and 98 Tc in unspiked fractions from one sample gives an apparent solar neutrino production rate of 95.8 SNU. However, roaster memory probably invalidates this result

  14. Insolubilization of technetium by microorganisms in waterlogged soils

    International Nuclear Information System (INIS)

    Ishii, Nobuyoshi; Tagami, Keiko

    2003-01-01

    In order to clarify the technetium behavior in paddy field ecosystem, insolubilization of technetium in the water covering waterlogged soils was studied. Fourteen soils collected from paddy fields (9 samples) and upland fields (5 samples) were waterlogged for 7 days. After the collection of water covering the waterlogged soils, a radio tracer 95m TcO 4 - was added to the water. After 4 days incubation of the water, the tracer was separated into four fractions: insoluble, pertechnetate, cationic, and other forms of technetium. On an average, 13% of the 95m TcO 4 - changed to insoluble forms and the maximum ratio of the insolubilization was 76%. This result shows that insolubilization of technetium can occur in the water covering the waterlogged soils. Subsequently, mechanisms of Tc insolubilization were studied using the sample that showed the maximum insolubilization of Tc among the soil samples. When microorganisms were removed from the water by filtration, insoluble forms of Tc decreased to 3.6%. In contrast, the insolubilization ratio increased to 86% by the addition of organic substrates. The insolubilization, therefore, was caused by microorganisms. Furthermore, the addition of antibiotics on bacteria resulted in 23% of the insolubilization, while the antibiotic on fungi did not affect on the insolubilization. If the insolubilization were caused by biosorption, the insolubilization ratio would not decrease for the sample added antibiotics on bacteria. Therefore, these results suggest that the insolubilization of technetium is caused by bioaccumulation of living bacteria. Because the cultures with 95m TcO 4 - were incubated under aerobic conditions, technetium-insolubilizing microorganisms would presumably be aerobic bacteria. (author)

  15. Experimental measurements of the solubility of technetium under near-field conditions

    International Nuclear Information System (INIS)

    Pilkington, N.J.; Wilkins, J.D.

    1988-05-01

    The solubility of technetium in contact with hydrated technetium dioxide under near-field conditions has been measured experimentally. The values obtained were changed little by a change in pH or in the filtration method used. The presence of organic degradation products increased slightly the solution concentration of technetium. (author)

  16. Technetium sorption by stibnite from natural water

    International Nuclear Information System (INIS)

    Peretroukhine, V.; Sergeant, C.; Deves, G.; Poulain, S.; Vesvres, M.H.; Thomas, B.; Simonoff, M.

    2006-01-01

    The sorption of technetium by powdered and polished mineral stibnite Sb 2 S 3 has been investigated in simulated and natural underground waters from the Meuse/Haute-Marne region (France). The sorption by powdered stibnite has been found to be complete under both aerobic and anaerobic conditions in batch experiments. The sorption rate is higher in the absence of oxygen than under aerobic condition. Increasing the temperature from 30 C to 60 C results in a rise of the sorption rate by 9.1 and 27 times under anaerobic and aerobic conditions, respectively. The observed differences in sorption kinetics in the presence and in absence of oxygen are explained by the interaction of oxygen with sulfide ion in aerobic conditions and by the reduction of technetium(VII) by iron(II) and by other impurities present in natural water and in the mineral, and by the subsequent sorption of Tc(IV) on stibnite under anaerobic conditions. The sorption on a polished mineral surface resulted in the formation of a technetium film, probably Tc 2 S 7 , with a thickness of 1-3 μg Tc/cm 2 pH 3-6 and 4-12 μg Tc/cm 2 at 9-12. The simultaneous formation of stibnite colloids with adsorbed technetium occurs at pH 9-12. The study of the technetium film on the mineral by proton induced X-ray emission analysis showed it to be at least one order of magnitude thinner on the SiO 2 impurities than on the main Sb 2 S 3 component and the iron impurities. (orig.)

  17. Sorption characteristics of technetium on crosslinked chitosan from aqueous solution

    International Nuclear Information System (INIS)

    Pivarciova, L.; Rosskopfova, O.; Galambos, M.; Rajec, P.

    2014-01-01

    Sorption of technetium on crosslinked chitosan was studied using batch techniques in static arrangement of experiment under aerobic conditions at laboratory temperature. The adsorption of technetium was rapid and the percentage of the technetium sorption was > 98 %. In the pH range of 3-11 adsorption of technetium on crosslinked chitosan was > 98 %. The competition effect of Fe 3+ towards TcO 4 - sorption on crosslinked chitosan was stronger than the competition effect of other observed cations. The selectivity of crosslinked chitosan for these cations in solution with the concentration above 1·10 -3 mol·dm -3 was in the order Fe 3+ > Ca 2+ > Na + > Fe 2+ . The competition effect of (ClO 4 ) - towards TcO 4 - sorption was stronger than the competition effect of (SO 4 ) 2 - ions. From these results it can be expected that crosslinked chitosan could be a suitable sorbent for the immobilization of technetium in the liquid radioactive waste. (authors)

  18. Assessment of Technetium in the Savannah River Site Environment

    International Nuclear Information System (INIS)

    Carlton, W.H.; Denham, M.; Evans, A.G.

    1993-07-01

    Assessment of Technetium in the Savannah River Site Environment is the last in a series of eight documents on individual radioisotopes released to the environment as a result of SRS operations. The earlier documents describe the environmental consequences of tritium cesium, iodine, uranium plutonium, strontium, and carbon. Technetium transport and metabolism have been studied by the nuclear industry because it is a fission product of uranium, and by the medical community because 99m Tc commonly is used as a diagnostic imaging agent in nuclear medicine. Technetium has been produced at SRS during the operation of five production reactors. The only isotope with environmental significance is 99 Tc. Because of the small activities of 99 Tc relative to other fission products, such as 90 Sr and 137 Cs, no measurements were made of releases to either the atmosphere or surface waters. Dose calculations were made in this document using conservative estimates of atmospheric releases and from a few measurements of 99 Tc concentrations in the Savannah River. Technetium in groundwater has been found principally in the vicinity of the separation areas seepage basins. Technetium is soluble in water and follows groundwater flow with little retardation. While most groundwater samples are negative or show little technetium a few samples have levels slightly above the limits set by the EPA for drinking water. The overall radiological impact of SRS 99 Tc releases on the offsite maximally exposed individual during 38 years of operations can be characterized by maximum individual doses of 0.1 mrem (atmospheric) and 0.8 mrem (liquid), compared with a dose of 13,680 mrem from non-SRS sources during the same time period. Technetium releases have resulted in a negligible risk to the environment and the population it supports

  19. Fluorido complexes of technetium

    Energy Technology Data Exchange (ETDEWEB)

    Mariappan Balasekaran, Samundeeswari

    2013-07-04

    Fluorine chemistry has received considerable interest during recent years due to its significant role in the life sciences, especially for drug development. Despite the great nuclear medicinal importance of the radioactive metal technetium in radiopharmaceuticals, its coordination chemistry with the fluorido ligand is by far less explored than that of other ligands. Up to now, only a few technetium fluorides are known. This thesis contains the synthesis, spectroscopic and structural characterization of novel technetium fluorides in the oxidation states ''+1'', ''+2'', ''+4'' and ''+6''. In the oxidation state ''+6'', the fluoridotechnetates were synthesized either from nitridotechnetic(VI) acid or from pertechnetate by using reducing agent and have been isolated as cesium or tetraethylammonium salts. The compounds were characterized spectroscopically and structurally. In the intermediate oxidation state ''+4'', hexafluoridotechnetate(IV) was known for long time and studied spectroscopically. This thesis reports novel and improved syntheses and solved the critical issues of early publications such as the color, some spectroscopic properties and the structure of this key compound. Single crystal analyses of alkali metal, ammonium and tetramethylammonium salts of hexafluoridotechnetate(IV) are presented. In aqueous alkaline solutions, the ammonium salt of hexafluoridotechnetate(IV) undergoes hydrolysis and forms an oxido-bridged dimeric complex. It is the first step hydrolysis product of hexafluoridotechnetate(IV) and was characterized by spectroscopic and crystallographic methods. Low-valent technetium fluorides with the metal in the oxidation states of ''+2'' or ''+1'' are almost unknown. A detailed description of the synthesis and characterization of pentafluoridonitrosyltechnetate(II) is presented. The

  20. Characterization of Vadose Zone Sediment: Borehole 299-E33-46 Near Tank B-110 in the B-BX-BY Waste Management Area

    International Nuclear Information System (INIS)

    Serne, R JEFFREY.; Bjornstad, Bruce N.; Gee, Glendon W.; Schaef, Herbert T.; Lanigan, David C.; Mccain, Richard G.; Lindenmeier, Clark W.; Orr, Robert D.; Legore, Virginia L.; Clayton, Ray E.; Lindberg, Michael J.; Kutnyakov, Igor V.; Baum, Steven R.; Geiszler, Keith N.; Valenta, Michelle M.; Vickerman, Tanya S.; Royack, Lisa J.

    2002-01-01

    WMA may have added significant amounts of spatially confined infiltration. Borehole soil characterization has identified strontium-90 and technetium-99 as the two main radionuclides underneath tank B-110. The Sr-90 data indicate limited future mobility unless abnormally high amounts of infiltration occur. Neither technetium-99 nor strontium-90 is expected to significantly impact groundwater in the current moisture and geochemical environment below the B Tank Farm. At borehole 299-E33-46 (near tank B-110), strontium 90 was found down to 26 m (85 ft) bgs with strontium 90 values up to 11,250 pCi/g of sediment. Other tank wastes contaminants (e.g., nitrate) were found down to 69 m (200 ft) bgs. The strontium-90 was immobile under the current ionic regime in the pore water. Technetium-99 releases into the vadose zone near tank B-110 from a transfer line leak appear to be inconsequential. Technetium-99 does not occur above detection limits in the upper parts of the vadose zone where other tank waste constituents (e.g., strontium-90, fluoride, carbonate, and nitrate) are present. Technetium-99 is present in a few soil samples in the PlioPleistocene unit. This unit appears to be an effective conduit for lateral migration and the presence of technetium-99 is postulated to have another source

  1. Nitrido-technetium(V) complexes with amino acids: Preparation and X-ray crystal structure of the L-cysteinate ethyl ester technetium(V) complex

    International Nuclear Information System (INIS)

    Marchi, A.; Rossi, R.; Marvelli, L.; Bertolasi, V.

    1993-01-01

    Technetium-99m is the radionuclide of choice in diagnostic nuclear medicine due to its ideal photon energy of 140 keV and half-life of 6 h. Neutral, stable, and lipophilic technetium complexes with diamino dithiol ligands (DADT) have been widely studied as potential brain perfusion agents and a 99m Tc complex of N,N'-1,2-ethylenediylbis(L-cysteine diethyl ester) (L,L-ECD) has been proposed as a marker of regional cerebral blood flow. It crosses the blood brain barrier (BBB) and is retained in the brain owing to enzymatic hydrolysis of one ester group yielding to a more polar species. More recently, 99m Tc-cysteine complex has been evaluated in animal distribution studies for tumor diagnosis, but its chemical structure has not been determined. A large number of transition metal complexes with amino acids and peptides have been synthesized and structurally characterized to understand their interactions with proteins and antibodies, as well as biocatalytic processes, but only a limited number of rhenium and technetium compounds have been reported. Up to now, the only technetium complex to be characterized by X-ray analysis that contains amino acids as ligand is [TcO(L,L-ECD)]. The author's interest in the nitrido-technetium chemistry is due to the discovery of a new method for preparing radiopharmaceuticals containing the [ 99m Tc triple-bond N] 2+ core. In this communication the authors report the synthesis and characterization of nitrido-technetium complexes with L-cysteine ethyl ester (CYS-OEt), L-cysteine (CYS) and cysteamine (CSA) and the first X-ray crystal structure of a [TcN] 2+ -amino acid complex

  2. Technetium-99m labeled radiodiagnostic agents and method of preparation

    International Nuclear Information System (INIS)

    Molinski, V.J.; Wilczewski, J.A.

    1977-01-01

    A method of preparing improved technetium-99m labeled radiodiagnostic agents by reducing technetium-99m with stannous tartrate is described. Such radiodiagnostic agents are useful in scintigraphic examinations of the bone and lung

  3. Technetium removal from aqueous wastes

    International Nuclear Information System (INIS)

    Fletcher, P.A.; Jones, C.P.; Junkison, A.R.; Turner, A.D.; Kavanagh, P.R.

    1992-03-01

    The research discussed in this report has compared several ''state of the art'' techniques for the removal of traces of the radionuclide, technetium, from aqueous wastes. The techniques investigated were: electrochemical reduction to an insoluble oxide, electrochemical ion exchange, seeded ultrafiltration and chemical reduction followed by filtration. Each technique was examined using a simulant based upon the waste generated by the Enhanced Actinide Removal Plant (EARP) at Sellafield. The technique selected for further investigation was direct electrochemical reduction which offers an ideal route for the removal of technetium from the stream (DFs 10-100) and can be operated continuously with a low power consumption 25 kW for the waste generated by EARP. Cell designs for scale up have been suggested to treat the 1000m 3 of waste produced every day. Future work is proposed to investigate the simultaneous removal of other key radionuclides, such as ruthenium, plutonium and cobalt as well as scale up of the resulting process and to investigate the effect of these other radionuclides on the efficiency of the electrochemical reduction technique for the removal of technetium. Total development and full scale plant costs are estimated to be of the order of 5 pounds - 10M, with a time scale of 5 -8 years to realisation. (author)

  4. Investigation on chemistry of model compounds of technetium radiopharmaceuticals

    International Nuclear Information System (INIS)

    Muenze, R.; Hartmann, E.

    1983-01-01

    The report summarized experimental and theoretical results concerning the chemical structures and the biodistribution of hydrophilic technetium chelates with hydroxycarboxylic and aminopolycarboxylic acids, thiol compounds and aliphatic and aromatic nitrogen compounds as ligands. Methods which are suitable for synthesizing and characterizing defined chelates of Tc(V), Tc(IV) and Tc(III) have been developed for crystlline substances and species in solution, respectively. For certain types of technetium chelates three dimensional structure models were calculated from atomic parameters. The electron energies and electron distribution of Tc(V) thiol compounds were calculated by quantum chemical methods in order to interprete physical properties of these substances. Biodistribution studies revealed relationships between the osteotropic behaviour and the structure of phosphorous and non-phosphorous technetium chelates and between the kidney uptake and ligand exchange ability of Tc(V) hydroxycarboxylates. Important parameters for the production of technetium-99m kits have been elaborated and used for the optimization of radiopharmaceuticals (bone-, kidney and hepatobiliaer agents). (author)

  5. Technetium SPECT agents for imaging heart and brain

    International Nuclear Information System (INIS)

    Linder, K.E.

    1990-01-01

    One major goal of radiopharmaceutical research has been the development of technetium-based perfusion tracers for SPECT imaging of the heart and brain. The recent clinical introduction of the technetium complexes HM-PAO, ECD and DMG-2MP for brain imaging, and of CDO-MEB and MIBI for heart imaging promises to revolutionize the field of nuclear medicine. All of these agents appear to localize in the target tissue in proportion to blood flow, but their mechanisms of localization and/or retention may differ quite widely. In this talk, a survey of the new technetium SPECT agents will be presented. The inorganic and biological chemistry of these complexes, mechanisms of uptake and retention, QSAR studies, and potential clinical applications are discussed

  6. Synthesis and Properties of Metallic Technetium and Technetium-Zirconium Alloys as Transmutation Target and Radioactive waste storage form in the UREX+1 Process

    Energy Technology Data Exchange (ETDEWEB)

    Hartmann, Thomas [Idaho State University/Idaho National Laboratory, 1776 Science Center Drive, Idaho Falls, ID 83402 (United States)]|[Harry Reid Center, University Nevada - Las Vegas, 4505 Maryland Parkway, Las Vegas, NV (United States); Poineau, Frederic; Czerwinski, Kenneth R. [Harry Reid Center, University Nevada - Las Vegas, 4505 Maryland Parkway, Las Vegas, NV (United States)

    2008-07-01

    In the application of UREX+1 process, technetium will be separated together with uranium and iodine within the first process step. After the separation of uranium, technetium and iodine must be immobilized by their incorporation in a suitable waste storage-form. Based on recent activities within the AFCI community, a potential candidate as waste storage form to immobilize technetium is to alloy the metal with excess zirconium. Alloys in the binary Tc-Zr system may act as potential transmutation targets in order to transmute Tc-99 into Ru-100. We are presenting first results in the synthesis of metallic technetium, and the synthesis of equilibrium phases in the binary Tc-Zr system at 1400 deg. C after arc-melting and isothermal annealing under inert conditions. Samples were analyzed using X-ray powder diffraction, Rietveld analysis, scanning electron microscopy, and electron probe micro-analysis, which allows us to construct the binary Tc-Zr phase diagram for the isothermal section at 1400 deg. C. (authors)

  7. Method of stably radiolabeling antibodies with technetium and rhenium

    International Nuclear Information System (INIS)

    Paik, C.H.; Reba, R.C.; Eckelman, W.C.

    1987-01-01

    A method is described for labeling antibodies or antibody fragments with radionuclides of technetium or rhenium to obtain stable labeling, comprising: reacting a reduced radioisotope of technetium or rhenium with an antibody or antibody fragment, or a diethylenetriaminepentaacetic acid conjugated antibody or antibody fragment, in the presence of free or carrier-bound diethylenetriaminepentaacetic acid (DTPA). The amount of DTPA is sufficient to substantially completely inhibit binding of the reduced technetium or rhenium to nonstable binding sites of the antibody or antibody fragment, or the DTPA-conjugated antibody or antibody fragment. The resultant stably labeled antibody or antibody fragment, or DTPA[conjugated antibody or antibody fragment is recovered

  8. Radiation decomposition of technetium-99m radiopharmaceuticals

    International Nuclear Information System (INIS)

    Billinghurst, M.W.; Rempel, S.; Westendorf, B.A.

    1979-01-01

    Technetium-99m radiopharmaceuticals are shown to be subject to autoradiation-induced decomposition, which results in increasing abundance of pertechnetate in the preparation. This autodecomposition is catalyzed by the presence of oxygen, although the removal of oxygen does not prevent its occurrence. The initial appearance of pertechnetate in the radiopharmaceutical is shown to be a function of the amount of radioactivity, the quantity of stannous ion used, and the ratio of /sup 99m/Tc to total technetium in the preparation

  9. Analysis of one thousand liver scans carried out using technetium phytate

    Energy Technology Data Exchange (ETDEWEB)

    Pasquier, J; de Laforte, C; Roux, F; Bisset, J P; Paulin, R [Centre Hospitalier Universitaire de la Timone, 13 - Marseille (France)

    1977-10-01

    One thousand liver scans were carried out using technetium phytate. This soluble compound is transformed in the circulating blood into a colloid by chelation of serum calcium, thereby forming a macromolecular phytate of calcium and technetium. The presenting symptoms are compared with the isotopic findings. This microcolloid has the advantages common to all technetium tracers and, in addition, is easy to prepare and has the advantage of a distribution between the liver, spleen, and bone of the same type as that seen with colloidal gold 198 without the dosimetric problems associated with the latter. Although it has a level of hepatic fixation which is less than that of certain sulphide complexes of technetium it appears to provide a better reflection of the colloidopexic function of the liver.

  10. The incorporation of technetium into a representative low-activity waste glass

    International Nuclear Information System (INIS)

    Ebert, W.L.; Bakel, A.J.; Bowers, D.L.; Buck, E.C.; Emery, J.W.

    1997-01-01

    A glass that has been tested to understand the corrosion behavior of waste glasses with high soda contents for immobilizing Hanford incidental wastes has been made by melting crushed glass with either TcO 2 or NaTcO 4 at 1,100--1,300 C. Incorporation of technetium in the glass was affected by solubility or kinetic effects. Metallic technetium inclusions formed in all the TcO 2 -doped glasses. Inclusions also formed in glasses with added NaTcO 4 that were melted at 1,100 C, but a glass melted at 1,200 C did not contain detectable inclusions. The presence of Tc-bearing inclusions complicates the interpretation of results from dissolution tests because of the simultaneous release of technetium from more than one phase, the unknown surface areas of each phase, and the possible incorporation of technetium that is released from one phase into another phase. A glass containing about 0.15 mass % Tc dissolved in the glass is being used in dissolution tests to study the release behavior of technetium

  11. Bronchoalveolar lavage and technetium-99m glucoheptonate imaging in chronic eosinophilic pneumonia

    International Nuclear Information System (INIS)

    Lieske, T.R.; Sunderrajan, E.V.; Passamonte, P.M.

    1984-01-01

    A patient with chronic eosinophilic pneumonia was evaluated using bronchoalveolar lavage, technetium-99m glucoheptonate, and transbronchial lung biopsy. Bronchoalveolar lavage revealed 43 percent eosinophils and correlated well with results of transbronchial lung biopsy. Technetium-99m glucoheptonate lung imaging demonstrated intense parenchymal uptake. After eight weeks of corticosteroid therapy, the bronchoalveolar lavage eosinophil population and the technetium-99m glucoheptonate uptake had returned to normal. We suggest that bronchoalveolar lavage, with transbronchial lung biopsy, is a less invasive way than open lung biopsy to diagnose chronic eosinophilic pneumonia. The mechanism of uptake of technetium-99m glucoheptonate in this disorder remains to be defined

  12. Accelerators for forming cationic technetium complexes useful as radiodiagnostic images

    International Nuclear Information System (INIS)

    Tweedle, M.F.

    1985-01-01

    This invention relates to compositions for making cationic radiodiagnostic agents and, in particular, to accelerator compounds for labelling such cationic radiodiagnostic agents, kits for preparing such 99m Tc-labelled cationic radiodiagnostic agents with technetium, and methods for labelling such cationic radiodiagnostic agents with technetium

  13. Highvalent and organometallic technetium and rhenium compounds

    International Nuclear Information System (INIS)

    Oehlke, Elisabeth

    2010-01-01

    Diagnostic methods in nuclear medicine allow a detailed description of morphological organ structures and their function. The beta emitting isotope Tc-99 has optimal physical properties (140 keV gamma rays, half-life 6 h) and is therefore used for radiopharmaceuticals. The thesis is concerned with the search for new technetium complexes and their reproducible production. The (TcO3) core is of main interest. The second part of the thesis deals with organometallic technetium and rhenium complexes with carbonyl ligands and N-heterocyclic carbenes that show stability in aerobic aqueous solutions.

  14. Absorption of technetium by plants in relation to soil type contamination level and time

    Energy Technology Data Exchange (ETDEWEB)

    Mousny, J.M.; Myttenaere, C. (Louvain Univ. (Belgium). Lab. de Physiologie Vegetale)

    1981-01-01

    Plants of Pisum sativum (var. Merveille de Kelvedon) were grown on seven typical european soils contaminated with different levels of /sup 99/Tc(0.17; 1.7 and 17 ..mu..Ci/kg). Added initially as pertechnetate, the technetium absorption has been studied for three successive cultures. The translocation of technetium from soil to plant leaves is high, but its transfer is reduced in soils rich in organic matter (Fen) or poorly drained (Braunerde). Aging reduces the technetium transfer and modify its relative distribution in plant (relatively more technetium is found in fruits); these results let suppose some modification of the technetium chemical form in soils with time.

  15. Analysis of one thousand liver scans carried out using technetium phytate

    International Nuclear Information System (INIS)

    Pasquier, J.; Laforte, C. de; Roux, F.; Bisset, J.P.; Paulin, R.

    1977-01-01

    One thousand liver scans were carried out using technetium phytate. This soluble compound is transformed in the circulating blood into a colloid by chelation of serum calcium, thereby forming a macromolecular phytate of calcium and technetium. The presenting symptoms are compared with the isotopic findings. This microcolloid has the advantages common to all technetium tracers and, in addition, is easy to prepare and has the advantage of a distribution between the liver, spleen and bone of the same type as that seen with colloidal gold 198 without the dosimetric problems associated with the latter. Although it has a level of hepatic fixation which is less than that of certain sulphide complexes of technetium it appears to provide a better reflection of the colloidopexic function of the liver [fr

  16. Binuclear complexes of technetium. Evidence for bis(terdentate)bidentate coordination by the bridging ligand 2,3,5,6-tetrakis(2-pyridyl)pyrazine to technetium(V)

    International Nuclear Information System (INIS)

    Du Preez, J.G.H.; Gerber, T.I.A.; Gibson, M.L.; Geyser, R.

    1990-01-01

    The authors have used the potentially bis(terdentate) nitrogen aromatic heterocyclic ligand 2,3,5,6-tetrakis(2-pyridyl)pyrazine (tppz) to prepare mono- and bimetallic technetium(V) complexes bound to tppz. The stimulus for the development of the coordination chemistry of the man-made element technetium is provided by the use of complexes of this element as anatomical imaging agents in nuclear medicine. Although the chemistry of technetium(V) with nitrogen donor ligands is well understood, no complexes have been prepared using potentially terdentate neutral nitrogen donor ligands of this metal in the +5 oxidation state

  17. Studies of technetium chemistry. Pt.8. The regularities of the bond length and configuration of rhenium and technetium complexes in crystals

    International Nuclear Information System (INIS)

    Liu Guozheng; Liu Boli

    1995-01-01

    Some bond length regularities in MO 6 , MO-4, MX 5 α and MX 4 αβ moieties of technetium and rhenium compounds are summarized and rationalized by cavity model. The chemical properties of technetium and rhenium are so similar that their corresponding complexes have almost the same configuration and M-X bond lengths when they are in cavity-controlled state. Technetium and Rhenium combine preferably with N, O, F, S, Cl and Br when they are in higher oxidation states (>3), but preferably with P, Se etc. when they are in lower oxidation states ( 4 αβ is approximately constant; (2) the average M-X bond length of MX 6 varies moderately with the oxidation state of M; (3) the bond length of M-X trans to M-α in MX 5 α has a linear relationship with the angle

  18. Technetium electrochemistry. 7. Electrochemical and spectroelectrochemical studies on technetium(III) and -(II) complexes containing polypyridyl ligands

    International Nuclear Information System (INIS)

    Wilcox, B.E.; Deutsch, E.

    1991-01-01

    The redox properties of a series of technetium(III/II) complexes of the general formula cis(X), trans(P)-[Tc III/II X 2 (PR w R') 2 L] 10+ , where X = Cl or Br, PR 2 R' = dimethylphenylphosphine or ethyldiphenylphosphine, and L = 2,2'-bipyridine (bpy), 4,4'-dimethyl-2,2'-bipyridine (Me 2 bpy), or 1,10-phenanthroline (phen), were investigated in 0.1 M TEAP/acetonitrile by cyclic voltammetry at a platinum-disk electrode. These complexes exhibit diffusion-controlled, 1-equiv Tc(IV)/Tc(III) redox couples and also Tc(III)/Tc(II) redox couples. Spectropotentiostatic experiments on three complexes of this class in 0.5 M TEAP/DMF confirm the 1-equiv character of the Tc(III)/Tc(II) couple. The electrochemical behavior of Tc(II) complexes of the general formula trans(P)-[TcX(PR 2 R') 2 terpy] + , terpy = 2,2':6',2 double-prime-terpyridine, was also investigated under the same conditions as above. These complexes exhibit diffusion-controlled, 1-equiv Tc(III)/Tc(II) redox couples and Tc(II)/Tc(I) redox couples. Spectropotentiostatic experiments on trans(P)-[TcCl(PMe 2 Ph) 2 terpy] + confirm the 1-equiv character of the Tc(III)/Tc(II) couple but show that the Tc(II)/Tc(I) couple is not reversible on the spectropotentiostatic time scale

  19. The quality control of technetium-99m radiopharmaceuticals produced at the AAEC Research Establishment

    International Nuclear Information System (INIS)

    Farrington, K.J.

    1983-08-01

    The methods of quality control used for technetium-99m radiopharmaceuticals produced at the AAEC Research Establishment are described for both non-fission and fission derived sources of sodium pertechnetate, technetium-99m labelled radipopharmaceuticals, and reagent kits produced for technetium-99m labelling

  20. The radiopharmaceuticals labelled with technetium-99m and the radiopharmacy

    International Nuclear Information System (INIS)

    Bodenant, V.

    1998-01-01

    In less than fifty years, the place of nuclear medicine is become primordial. Among all the radiopharmaceuticals used in nuclear medicine, the technetium-99m is the most used because of its physico-chemical properties and its great availability with the molybdenum-99m - technetium-99m generator. Since 1992, the radiopharmaceuticals, the packages, the generators are included in the pharmaceutic monopole. They are now under the reliability of the radio-pharmacist. This thesis has for object to introduce these different radiopharmaceuticals labelled with technetium-99m and to show the primordial place of the radio-pharmacist in a service of nuclear medicine. (N.C.)

  1. Electrochemical preparation of technetium hydroxyethylidene diphosphonate radiopharmaceuticals

    International Nuclear Information System (INIS)

    Scott, R.B.

    1984-01-01

    This work describes the liquid chromatographic and electrochemical analysis of electrogenerated technetium hydroxyethylidene diphosphonate (HEDP) complexes, and studies the effectiveness of the resulting bone imaging agents. Anion exchange High Performance Liquid Chromatography is used to separate components, and γ emission is used as the detection mode. The reaction mixtures were prepared at a series of reduction potentials and pH values, at both carrier added and no carrier added technetium levels. The results indicate that all three parameters affect the final complex composition to varying degrees. By optimizing the conditions, a preparation was made which results in a high percentage of a Tc-HEDP complex thought to be a very good home imager. This component was isolated chromatographically and injected into female Sprague-Dawley rats. Comparisons were run on the uptake for seven tissue types at two incubation times. Mercury and Reticulated Vitreous Carbon were used as the working electrode materials, and it is shown how reduced technetium will significantly alter the electrode characteristics, where a conditioned electrode will produce different complexes from those produced at fresh electrode material. By employing coulometric analysis as the preparation was reduced, an n value of 4 was calculated for a particular complex. This procedure involved tracking the radioactive technetium species carefully to account for all electrons used in the system. Finally, an electrochemical detection method for HEDP was explored, utilizing the property of mercury complexation. Anodic sweep Differential Pulse Polarography gives an analytical signal for HEDP at +0.250 V vs Ag/AgCl

  2. Determination of technetium-99 from complex matrix

    International Nuclear Information System (INIS)

    Lixiong Wang; Lei Tang; Tongzai Yang; Yanqiu Yang; Liang Yang

    2013-01-01

    This paper reports an approach that can be used for efficient separation and determination of 99 Tc (as pertechnetate) after contamination of the environment by nuclear materials. The samples were decomposed by fusion in a mixture of potassium hydroxide and potassium nitrate. After fusion, technetium remains as the pertechnetate anion (TcO 4 - ). The technetium was isolated from the sample by technique combining solvent extraction, anion exchange, then, again, solvent extraction. After separation, 99 Tc was measured by isotope-dilution mass spectrometry with 97 Tc as spike. This method yielded nanogram detection limits for 99 Tc. (author)

  3. Reduction And Sequestration Of Pertechnetate To Technetium Dioxide And Protection From Reoxidation

    International Nuclear Information System (INIS)

    Duncan, J. B.; Johnson, J. M.; Moore, R. C.; Hagerty, K.; Rhodes, R. N.; Huber, H. J.; Moore, W. P.

    2012-01-01

    This effort is part of the technetium management initiative and provides data for the handling and disposition of technetium. To that end, the objective of this effort was to challenge tin(lI)apatite (Sn(II)apatite) against double-shell tank 241-AN-105 simulant spiked with pertechnetate (TcO 4 ). The Sn(II)apatite used in this effort was synthesized on site using a recipe developed at and provided by Sandia National Laboratories; the synthesis provides a high quality product while requiring minimal laboratory effort. The Sn(ll)apatite reduces pertechnetate from the mobile +7 oxidation state to the non-mobile +4 oxidation state. It also sequesters the technetium and does not allow for re-oxidization to the mobile +7 state under acidic or oxygenated conditions within the tested period of time (6 weeks). Previous work indicated that the Sn(II) apatite can achieve an ANSI leachability index in Cast Stone of 12.8. The technetium distribution coefficient for Sn(lI)apatite exhibited a direct correlation with the pH of the technetium-spiked simulant media

  4. Geochemistry of natural technetium and plutonium

    International Nuclear Information System (INIS)

    Curtis, D.B.; Cappis, J.H.; Perrin, R.E.; Rokop, D.J.

    1987-01-01

    Technetium and plutonium in unprocessed nuclear reactor wastes are major concerns with regard to their containment in the geologic environment. Both nuclides have long half-lives; therefore, they will exist long after engineered barriers can be considered reliable. Consequently, strategies for the containment of these two elements depend on their retention in the geologic barrier until they have decayed to innocuous levels. Because these are the rarest elements in nature, there have been few direct observations of their geochemical behavior; predictions concerning their fate in the repository are based on properties that can be observed in the laboratory. The authors are attempting to complement the laboratory work by studying the geochemistry of natural plutonium and technetium. Ratios of anthropogenic to naturally occurring isotopes are discussed

  5. High pressure liquid chromatographic assay of technetium in solutions of sodium pertechnetate produced at the AAEC Research Establishment

    International Nuclear Information System (INIS)

    Farrington, K.J.

    1985-12-01

    High pressure liquid chromatography (HPLC) is used for the assay of nanogram quantities of technetium and to determine technetium in decayed pharmaceutical products, derived from three methods of manufacture. These methods of manufacture give comparably low levels of technetium-99, at the time of collection of the solution. However, when the solutions are used to produce ready-to-inject technetium-99m, high levels of technetium-99 are present at the time of calibration, which is the day after the collection date. Where sensitive reagent kits are to be labelled, freshly collected solutions of technetium-99m should be used. The HPLC assay is a valuable technique for the quality control of technetium-based radiopharmaceuticals, and for investigation of methods of manufacture of technetium-99m. Experimental studies confirmed the findings of previous workers

  6. Determination of a method to inhibit technetium migration at the repository

    International Nuclear Information System (INIS)

    Statler, V.; Tulenko, J.; Cloke, P.

    1990-01-01

    The long-term migration of 99 Tc (213,000-yr half-life) must be considered when examining the disposal of spent nuclear fuel in a geologic repository. This report outlines an investigation of the effects of iron, tin, stannous chloride, copper, manganese, and vanadium as reactants added to a mixture of technetium and J-13 well water to cause technetium precipitation. The J-13 well water was chosen because it is representative of the groundwater located at Yucca Mountain. A state-of-the-art computer software package, EQ3/6, was developed at Lawrence Livermore National Laboratory and was utilized in this study to project the result when metallic iron, tin, copper, manganese, and vanadium and the compound stannous chloride are individually added to a mixture of metallic technetium and J-13 well water. The computer codes in this study indicate that the problems associated with technetium migration at the federal repository are not insurmountable if a reactant capable of producing reducing conditions to the incoming groundwater is integrated into the waste package. Further work will focus on the laboratory experimentation to validate the computer results and to determine the best materials and configurations to inhibit technetium migration at the repository

  7. The Evaluation of Novel Tin Materials for the Removal of Technetium from Groundwater

    Energy Technology Data Exchange (ETDEWEB)

    Parker, Kent E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wellman, Dawn M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-06-30

    Technetium-99 (99Tc) is present at several U.S. Department of Energy (DOE) facilities, including the Hanford, Oak Ridge, Paducah, Portsmouth, and Savannah River sites. Due to its mobility, persistence, and toxicity in the environment, developing means to immobilize and/or remove technetium from the environment is currently a top priority for DOE. However, there are currently very few approaches that effectively manage the risks of technetium to human health and the environment. The objective of this study is to evaluate novel synthetic materials that could enable direct removal of technetium from groundwater. The following report •assesses the viability of existing methodologies for synthesis of tin (II) apatite for in situ formation and remediation of 99Tc within the subsurface environment •discusses the development of alternative methodologies for production of tin (II) apatite •evaluates nanoporous tin phosphate materials for removal of technetium from groundwater.

  8. Method for recovering palladium and technetium values from nuclear fuel reprocessing waste solutions

    Science.gov (United States)

    Horwitz, E. Philip; Delphin, Walter H.

    1979-07-24

    A method for recovering palladium and technetium values from nuclear fuel reprocessing waste solutions containing these and other values by contacting the waste solution with an extractant of tricaprylmethylammonium nitrate in an inert hydrocarbon diluent which extracts the palladium and technetium values from the waste solution. The palladium and technetium values are recovered from the extractant and from any other coextracted values with a strong nitric acid strip solution.

  9. Ligand-free, protein-bound technetium-99m. Evidence for tumour localisation

    International Nuclear Information System (INIS)

    Jakovljevic, A.C.; Pojer, P.M.

    1984-11-01

    An hypothesis that cations accumulate in tumours independent of ligand is tested. A preparation of technetium-99m known to be ligand-free (that is, the technetium is protein bound and no other ligand is injected) has been shown to accumulate in a T-cell lymphoma

  10. ASSESSMENT OF TECHNETIUM LEACHABILITY IN CEMENT-STABILIZED BASIN 43 GROUNDWATER BRINE

    International Nuclear Information System (INIS)

    Duncan, J.B.; Cooke, G.A.; Lockrem, L.L.

    2009-01-01

    This report documents the effort to sequester technetium by the use of getters, reductants (tin(II) apatite and ferrous sulfate), sorbents (A530E and A532E ion exchange resins), and cementitious waste form. The pertechnetate form of technetium is highly soluble and mobile in aerobic (oxidizing) environments.

  11. Technetium behaviour in Boom Clay - a laboratory and field study

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Ilett, D.J.; Cowper, M.M.; Pilkington, N.J.; Tweed, C.J.; Williams, S.J.; Canniere, P.R. de; Wang, L.

    2002-01-01

    This paper describes a study of technetium solubility and migration under chemical conditions representative of those prevailing in a Boom Clay environment. Laboratory and in situ measurements yielded similar aqueous concentrations of technetium, of about 1 x 10 -8 mol dm -3 , close to the concentrations measured for hydrated technetium(IV) oxide TcO 2 .1.6H 2 O in the solubility studies. From fitting the curves of the Tc concentrations as function of time, distribution coefficient (K d ) values were estimated to lie between 0.8 cm 3 g -1 and 1.8 cm 3 g -1 . Exposure of the system at 80 C and to γ-radiation dose rates of several hundred Gy h -1 resulted in only minor differences in behaviour. (orig.)

  12. Oscillator strengths for neutral technetium

    International Nuclear Information System (INIS)

    Garstang, R.H.

    1981-01-01

    Oscillator strengths have been calculated for most of the spectral lines of TcI which are of interest in the study of stars of spectral type S. Oscillator strengths have been computed for the corresponding transitions in MnI as a partial check of the technetium calculations

  13. Thermal neutron cross section measurements for technetium-99

    International Nuclear Information System (INIS)

    Yates, M.A.; Schroeder, N.C.; Fowler, M.M.

    1993-01-01

    Technetium, because of its long half-like (213,000 years) and ability to migrate in the environment, is a primary contributor to the long-term radioactivity related risk associated with geologic nuclear waste disposal. One proposal for converting technetium to an environmentally benign element investigating transmutation with an accelerator-based system, (i.e., Accelerator Transmutation of Waste, ATW). Planning for efficient processing of technetium through the transmuter will require knowledge of the thermal neutron cross section for the 99 Tc (n,γ) 100 Tc reaction. The authors have recently remeasured this cross section. Weighed aliquots (19-205 μg) of a NIST traceable 99 Tc standard were irradiated for 30-150 sec using the pneumatic open-quotes rabbitclose quotes system of LANL's Omega West Reactor. The two gamma rays from the 15.7-sec half-life product were measured immediately after irradiation on a high-resolution Ge detector. Thermal fluxes were measured using gold foils and Cd wrapped gold foils. The observation cross section is 19 ± 1 b. This agrees well with the 1977 value but has half the uncertainty

  14. Determination of technetium by graphite furnace atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Kaye, J.H.; Ballou, N.E.

    1978-01-01

    A detection limit of 6 x 10 -11 g has been achieved for measurement of technetium by graphite furnace atomic absorption spectrometry. A commercially available, demountable, hollow cathode lamp was used and both argon and neon were used as fill gases for the lamp. The range of applicability of the method, when the unresolved 2614.23 to 2615.87 A doublet is used for analysis, is from 60 pg to at least 3 ng of technetium per aliquot analyzed. 3 figures, 1 table

  15. Study of ammonia synthesis using technetium catalysts

    International Nuclear Information System (INIS)

    Spitsyn, V.I.; Mikhajlenko, I.E.; Pokrovskaya, O.V.

    1982-01-01

    A study was made on catalytic properties of technetium in ammonia synthesis reaction. The preparation of technetium catalysts on ν-Al 2 O 3 , BaTiO 3 , BaO-ν-Al 2 O 3 substrates is described. The investigation of catalytic activity of catalysts was carried out at a pressure of 1 atm. in vertical reactor with volume rate of 15000 h - 1 in the temperature range of 350-425 deg. The amount of catalyst was 0.5-1 g, the volume- 0.5 ml, the size of granules- 2-3 mm. Rate constants of ammonia synthesis reaction were calculated. Seeming activation energies of the process have meanings wihtin the limits of 40-50 kcal/mol. It was shown that with increase in concentration of Tc on BaTiO 3 the catalytic activity rises in comparison with pure Tc. The reduction of catalytic activity with increase of metal content on Al 2 O 3 begins in the limits of 3.5-6.7% Tc/ν-Al 2 O 3 . The catalyst of 5.3% Tc/4.1% Ba/ν -Al 2 O 3 compound has the maximum activity. Technetium catalysts possess the stable catalytic activity and don't requre its reduction during several months

  16. Gentc99m, computational system for the technetium-99m generator

    International Nuclear Information System (INIS)

    Suparman, I.

    1997-01-01

    The technetium-99m generator is one of the main products of the PPR, as the continuity of the technetium-99m generator production is important for supporting the development of nuclear medicine. GENTC99M has been made for computational for the technetium-99m generator and includes data processing, documentation and information GENTC99M is also very useful in quality control application especially for the determinations of yield and radionuclidic impurities which consume much time. microsoft visual basic for MS-DOS and visual basic for windows have been used for making GENTC99M. Microsoft visual basic has several features that make it an ideal development language for both MS-DOS and Microsoft Windows. These features not only increase productivity, they also provide all the tools and hooks needed to develop some very sophisticated applications. for a production centre like PPR, GENTC99M is very useful to support the data processing, documentation and information system of the technetium-99m generator and it can also be modified for other products

  17. Speciation and Oxidative Stability of Alkaline Soluble, Non-Pertechnetate Technetium

    Energy Technology Data Exchange (ETDEWEB)

    Levitskaia, Tatiana G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Rapko, Brian M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Anderson, Amity [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Peterson, James M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Chatterjee, Sayandev [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Walter, Eric D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Cho, Herman M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Washton, Nancy M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2014-09-30

    The long half-life, complex chemical behavior in tank waste, limited incorporation in mid- to high-temperature immobilization processes, and high mobility in subsurface environments make technetium (Tc) one of the most difficult contaminants to dispose of and/or remediate. Technetium exists predominantly in the liquid tank waste phase as the relatively mobile form of pertechnetate, TcO4-. However, based on experimentation to date a significant fraction of the soluble Tc cannot be effectively separated from the wastes and may be present as a non- pertechnetate species. The presence of a non-pertechnetate species significantly complicates disposition of low-activity waste (LAW), and the development of methods to either convert them to pertechnetate or to separate directly is needed. The challenge is the uncertainty regarding the chemical form of the alkaline-soluble low-valent non-pertechnetate species in the liquid tank waste. This report summarizes work done in fiscal year (FY) 2014 exploring the chemistry of a low-valence technetium(I) species, [(CO)3Tc(H2O)3]+, a compound of interest due to its implication in the speciation of alkaline-soluble technetium in several Hanford tank waste supernatants.

  18. Technetium behaviour in Boom Clay - a laboratory and field study

    Energy Technology Data Exchange (ETDEWEB)

    Baston, G.M.N.; Ilett, D.J.; Cowper, M.M.; Pilkington, N.J.; Tweed, C.J.; Williams, S.J. [AEA Technology plc, Harwell, Didcot, Oxfordshire (United Kingdom); Canniere, P.R. de; Wang, L. [SCK.CEN, Waste and Disposal Project, Boeretang, Mol (Belgium)

    2002-07-01

    This paper describes a study of technetium solubility and migration under chemical conditions representative of those prevailing in a Boom Clay environment. Laboratory and in situ measurements yielded similar aqueous concentrations of technetium, of about 1 x 10{sup -8} mol dm{sup -3}, close to the concentrations measured for hydrated technetium(IV) oxide TcO{sub 2}.1.6H{sub 2}O in the solubility studies. From fitting the curves of the Tc concentrations as function of time, distribution coefficient (K{sub d}) values were estimated to lie between 0.8 cm{sup 3} g{sup -1} and 1.8 cm{sup 3} g{sup -1}. Exposure of the system at 80 C and to {gamma}-radiation dose rates of several hundred Gy h{sup -1} resulted in only minor differences in behaviour. (orig.)

  19. Sorption of technetium and its analogue rhenium on bentonite material under aerobic conditions

    International Nuclear Information System (INIS)

    Vinsova, H.; Koudelkova, M.; Konirova, R.; Vecernik, P.; Jedinakova-Krizova, V.

    2003-01-01

    The uptake of technetium on bentonite materials has been studied from the point of view of characterization of long-term radioactive elements behavior in nuclear waste repository. Bentonite R (locality Rokle, Czech Republic) and two types of model groundwater (granitic and bentonite) were selected for the sorption experiments. It is generally known that bentonite materials show an excellent cation-exchange capacity and, on the other hand, a poor uptake of anions. Technetium occurs under aerobic conditions in its most stable oxidation state (+VII) as pertechnetate, which makes a question of its sorption on bentonite more complex when compared with e.g. Cs + or Sr 2+ . To increase the K d values for technetium sorption on bentonite, it is necessary to carry out the experiments under anaerobic conditions in the presence of reducing agent, which is capable to lower the oxidation state of technetium which enables its successful immobilization. The aim of our research has been to find out the conditions suitable for the technetium sorption on selected bentonite under oxidizing conditions. The sorption experiments with Tc-99 on bentonite have been carried out by batch method. The influence of the addition of different materials (e.g. activated carbon, graphite, Fe 2+ , Fe) with bentonite, the effect of solid:aqueous phase ratio and a pH value on the percentage of technetium uptake and on the K d values were tested. Perrhenate was selected as an analogue of pertechnetate in non-active experiments of capillary electrophoresis (CE) and isotachophoresis (ITP). The percentage of rhenium sorbed on bentonite material was determined from the decrease of perrhenate peak area (CE) and from the shortening of the ITP zone corresponding to perrhenate. Both electromigration methods provided comparable results. The results obtained in this study with non-active material were compared to those of technetium acquired by radiometry and polarography. (authors)

  20. Study of reduction and complexation of technetium in the presence of humate

    International Nuclear Information System (INIS)

    Tkac, P.

    2003-06-01

    Reduction of pertechnetate was studied by different reduction systems: Sn 2+ , Fe 2+ , ascorbic acid, mixture of ascorbic acid and Fe 3+ , and thiourea. Reduction of pertechnetate by Sn 2+ ions (5 · 10 -2 - 5 · 10 -7 mol.dm -3 ) was studied in pH range of 0.94-6.4. For effective reduction of Tc(VII) an acidic environment (pH 2+ ions higher than 1 · 10 -5 mol.dm-3 was necessary. Reduction of Tc(VII) by Fe 2+ (0.01 mol.dm -3 FeSO 4 ) was strongly dependent on pH and for reduction yield higher than 95 %, pH = 8 and higher was needed. In the presence of ascorbic acid (1 - 5 %) no significant reduction was observed. When a 5 % solution of ascorbic acid was prepared by dilution of ascorbic acid in 2 mol.dm -3 HCl, 60 % reduction after 30 minutes of reaction was observed. Reduction of Tc(VII) in the presence of ascorbic acid was most effectively observed in the presence of Fe 3+ ions. The yield of reduction was about 98 % after 20 minutes of reaction. Reduction of pertechnetate by thiourea was studied in acidic solution (HCl). Different conditions were used for reduction of 99m TcO 4 - and 99 TcO 4 - , respectively. The best yield for a routine preparation of [ 99 Tc(tu) 6 ] 3+ (tu = thiourea) was observed when 70 mg of thiourea was dissolved in 5 ml of 0.5 mol.dm -3 HCl and 0.2 - 0.5 ml of 6 · 10 -2 mol.dm -3 TcO 4 - was added. The mixture was allowed to react at least 20 hours. In the case of 99m Tc, 35 mg of thiourea was diluted in 5 ml of 2 mol.dm -3 HCl and 0.1 - 0.5 ml of pertechnetate generator solution was added. Reaction mixture was heated at 100 grad C for at least 30 minutes under nitrogen atmosphere. The yield of pertechnetate reduction for both preparation methods was about 99 %. The thiourea complex of technetium was chosen for preparation of technetium-humic complex, because it is well known as the most suitable precursor for preparation of new technetium complexes with Tc 3+ . Gel chromatography of natrium humate was carried out before preparation of

  1. Coordination chemistry of technetium as related to nuclear medicine

    International Nuclear Information System (INIS)

    Srivastava, S.C.; Richards, P.

    1982-01-01

    Significant advances have been made in the area of technetium coordination chemistry during the last five years. The main driving force behind this recent surge of interest in the field has been due to the practical application of technetium-99m in the rapidly growing speciality of nuclear medicine. Technetium-99 is one of the products of nuclear fission reactions, but it was the development of the molybdenum-99-technetium-99m generator about two decades ago that provided the basis for the development of radiopharmaceuticals routinely used in modern diagnostic applications. The chemistry of this element has proven to be quite rich owing to its multiple oxidation states and variable geometry. This can be attributed to its position in the middle of the periodic table. Diagnostic radiopharmaceuticals comprise predominantly III, IV and V oxidation states of Tc and involve a variety of coordination complexes. Even though the chemistry of Tc has been slow to evolve, recent synthetic advances have provided a more scientific basis for the study of a number of compounds with diverse coordination geometries and structures. Ligands with oxygen, nitrogen and sulfur donor atoms have been utilized to elucidate various aspects of the coordination chemistry of Tc. Single crystal X-ray structural analysis has been extensively used to characterize Tc complexes and thus construct a firm foundation for the study of synthetic and mechanistic aspects of the chemistry of this element. (author)

  2. Investigation of the interaction of hydroxyapatite with technetium in association with stannous pyrophosphate

    International Nuclear Information System (INIS)

    Billinghurst, M.W.; Jette, D.; Somers, E.

    1981-01-01

    The individual components of technetium-99m stannous pyrophosphate were studied with respect to their interaction with hydroxyapatite. It is demonstrated that the role of the pyrophosphate molecule is one of a solubilizing and transporting molecule to carry the technetium atom to the site of the hydroxyapatite where the chelate disassociates and both the pyrophosphate and the technetium individually bind to the hydroxyapatite. The stannous ion is shown to associate with the hydroxyapatite also and although also solubilized by the pyrophosphate appears to be less strongly associated with the pyrophosphate. (author)

  3. 10 CFR 110.110 - Default.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Default. 110.110 Section 110.110 Energy NUCLEAR REGULATORY COMMISSION (CONTINUED) EXPORT AND IMPORT OF NUCLEAR EQUIPMENT AND MATERIAL Hearings § 110.110 Default. When a participant fails to act within a specified time, the presiding officer may consider him in default, issue an...

  4. Behavior of technetium in nuclear waste vitrification processes.

    Science.gov (United States)

    Pegg, Ian L

    Nearly 100 tests were performed with prototypical melters and off-gas system components to investigate the extents to which technetium is incorporated into the glass melt, partitioned to the off-gas stream, and captured by the off-gas treatment system components during waste vitrification. The tests employed several simulants, spiked with 99m Tc and Re (a potential surrogate), of the low activity waste separated from nuclear wastes in storage in the Hanford tanks, which is planned for immobilization in borosilicate glass. Single-pass technetium retention averaged about 35 % and increased significantly with recycle of the off-gas treatment fluids. The fraction escaping the recycle loop was very small.

  5. Analysis of Technetium Species and Fractions in Natural Seaweed Using Biochemical Separation and ICP-MS Measurement

    DEFF Research Database (Denmark)

    Shi, Keliang; Hou, Xiaolin; Qiao, Jixin

    2016-01-01

    An extremely high accumulation and retention of technetium in marine plants, especially brown seaweed, makes it a unique bioindicator of technetium. In the present work, a novel approach was developed for the speciation analysis of technetium in seaweed, wherein a series of biochemical separations....... Besides the inorganic species of TcO4-, most of technetium (>75%) combined with organic components of seaweed such as algin, cellulose, and pigment. This investigation could provide important fundamental knowledge for studying the processes and mechanisms of 99Tc accumulation in the natural seaweed....

  6. Technetium-99 m generator safety simulation

    International Nuclear Information System (INIS)

    Kang, Sang Koo; Kim, Chong Yeal

    2008-01-01

    Technetium ( 99m Tc) is one of the most widely used radioactive isotopes for diagnosis in the world. In general, 99m Tc is produced inside the so called technetium generator where 99Mo decays to 99m Tc. And the generator is usually made out of lead to shield relatively high energy radiation from 99m Tc and 99 Mo. In this paper, a GEANT4 simulation is carried out to test the safety of the 99m Tc generators, taking domestic and Japanese products with radioactivity of 18.50 GBq (500 mCi) for example. According to the domestic regulation on radiation safety, the dose at 10 cm and 100 cm away from the surface of radiation shielder should not exceed 2 mSv∙h -1 and 0.02 mSv∙h -1 , respectively. The simulated dose turned out about only 10% of the limit, satisfying the domestic regulation

  7. Non-Pertechnetate Technetium Sensor Research and Development

    Energy Technology Data Exchange (ETDEWEB)

    Bryan, Samuel A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Crawford, Amanda D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Heineman, William R. [Univ. of Cincinnati, OH (United States); Rapko, Brian M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Branch, Shirmir D. [Univ. of Cincinnati, OH (United States)

    2014-09-01

    There remain several significant uncertainties in the understanding and modeling of the fate and speciation of 99Tc in Hanford waste tanks, glass, and low-temperature waste forms. A significant (2% to 25%) fraction of the 99Tc in the water-soluble portion of the tank waste may be present as a non-pertechnetate species that has not been identified and, based on experimentation to date, cannot be effectively separated from the wastes. This task will provide a sensor specifically tuned to detect the Tc(I)-carbonyl species believed to constitute the main fraction of the non-pertechnetate form of technetium. By direct measurement of the non-pertechnetate species, such a sensor will help reduce the uncertainties in the modeling of the fate and speciation of 99Tc in Hanford tanks and waste forms. This report summarizes work done in FY 2014 exploring the chemistry of a low-valence technetium species, [Tc(CO)3(H2O)3]+, a compound of interest due to its implication in the speciation of alkaline-soluble technetium in several Hanford tank waste supernatants. Progress made in FY 2014 was sponsored by the Department of Energy’s Office of Environmental Management and is summarized in this report.

  8. Determination of Technetium-99 in Environmental Samples by Solvent Extraction at Controlled Valence

    DEFF Research Database (Denmark)

    Chen, Q.J.; Aarkrog, A.; Dahlgaard, H.

    1989-01-01

    Distribution coefficients of technetium and ruthenium are determined under different conditions with CCl4, cyclohexanone, and 5% tri-isooctylamine (TIOA)/xylene. A method for analyzing 99Tc in environmental samples has been developed by solvent extraction in which the valences of technetium...

  9. Separation, Concentration, and Immobilization of Technetium and Iodine from Alkaline Supernate Waste

    Energy Technology Data Exchange (ETDEWEB)

    James Harvey; Michael Gula

    1998-12-07

    Development of remediation technologies for the characterization, retrieval, treatment, concentration, and final disposal of radioactive and chemical tank waste stored within the Department of Energy (DOE) complex represents an enormous scientific and technological challenge. A combined total of over 90 million gallons of high-level waste (HLW) and low-level waste (LLW) are stored in 335 underground storage tanks at four different DOE sites. Roughly 98% of this waste is highly alkaline in nature and contains high concentrations of nitrate and nitrite salts along with lesser concentrations of other salts. The primary waste forms are sludge, saltcake, and liquid supernatant with the bulk of the radioactivity contained in the sludge, making it the largest source of HLW. The saltcake (liquid waste with most of the water removed) and liquid supernatant consist mainly of sodium nitrate and sodium hydroxide salts. The main radioactive constituent in the alkaline supernatant is cesium-137, but strontium-90, technetium-99, and transuranic nuclides are also present in varying concentrations. Reduction of the radioactivity below Nuclear Regulatory Commission (NRC) limits would allow the bulk of the waste to be disposed of as LLW. Because of the long half-life of technetium-99 (2.1 x 10 5 y) and the mobility of the pertechnetate ion (TcO 4 - ) in the environment, it is expected that technetium will have to be removed from the Hanford wastes prior to disposal as LLW. Also, for some of the wastes, some level of technetium removal will be required to meet LLW criteria for radioactive content. Therefore, DOE has identified a need to develop technologies for the separation and concentration of technetium-99 from LLW streams. Eichrom has responded to this DOE-identified need by demonstrating a complete flowsheet for the separation, concentration, and immobilization of technetium (and iodine) from alkaline supernatant waste.

  10. Diffusion of 99-technetium in bentonite under aerobic and anaerobic conditions

    International Nuclear Information System (INIS)

    Vecernik, P.; Jedinakova-Krizova, V.; Vokal, A.

    2006-01-01

    Diffusion experiments were performed with 99 Tc and Re (a model of technetium) in the form of pertechnetate and perrhenate in bentonite from the Rokle locality (Czech Republic). The through diffusion method was used, and the apparent diffusion coefficients (D a ) were evaluated. The effects of the particle mesh-size, bulk densities, and aerobic or anaerobic conditions on the diffusion were studied in view of the fact that oxidizing or reducing conditions influence the chemical forms of technetium and rhenium. In the presence of oxygen, technetium and rhenium occur in oxidation state VII, as anions which are soluble and mobile in the environment, whereas in reducing conditions they occur in lower oxidation states, mainly as insoluble oxides or hydroxides. Aerobic experiments were carried out in common laboratory conditions, anaerobic experiments were performed under nitrogen

  11. Experimental studies on the uptake of technetium-99 to terrestrial crops

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Joanne; Ewers, Leon [Centre for Radiation, Chemical and Environmental Hazards, Public Health England (United Kingdom)

    2014-07-01

    Technetium-99 has been dispersed in the environment from many sources such as nuclear weapons testing, releases from medical or industrial processes, nuclear power plants and nuclear fuel processing facilities. The pertechnetate ion, {sup 99}TcO{sub 4}{sup -} is the form produced during the nuclear fuel cycle and the most likely to be released into the environment. A recent review published by Public Health England (formerly the Health Protection Agency) found that the availability for the root uptake of technetium into crops depends on whether the technetium is in a chemically non-reduced more plant available form, such as TcO{sub 4}{sup -} or a chemically reduced less plant available form, such as TcO{sub 2}. Based on the review, generic soil to crop transfer factor (TF) values for use in non-site specific UK based radiological assessments were proposed, with the TF value for the reduced form of technetium in crops around a factor of 10 lower than that for the non-reduced form. The implications of the use of different TF values on the activity concentrations in crops and animal products predicted by PHE's food chain model, FARMLAND, for both routine and accidental release situations were explored. Recommendations on the best choice of TF values for use in the model have been given for a range of contamination scenarios. A small scale experimental study has been carried out to provide further evidence that the generic assumption made on the difference between soil-crop TF values for non-reduced and reduced forms of technetium is valid. The study was also designed to establish likely time periods over which the chemical reduction of technetium takes place and to provide additional soil-crop TF values for use in UK based radiological assessments. Soil to crop TFs for crops harvested from loam and peat soils up to 4 months after contamination are about a factor of 10 higher than those seen in soil contaminated more than a year previously, indicating that the

  12. Transmutation of technetium into stable ruthenium in high flux conceptual research reactor

    International Nuclear Information System (INIS)

    Amrani, N.; Boucenna, A.

    2007-01-01

    The effectiveness of transmutation for the long lived fission product technetium-99 in high flux research reactor, considering its large capture cross section in thermal and epithermal region is evaluated. The calculation of Ruthenium concentration evolution under irradiation was performed using Chain Solver 2.20 code. The approximation used for the transmutation calculation is the assumption that the influence of change in irradiated materials structures on the reactor operator mode characteristics is insignificant. The results on Technetium transmutation in high flux research reactor suggested an effective use of this kind of research reactors. The evaluation brings a new concept of multi-recycle Technetium transmutation using HFR T RAN (High Flux Research Reactor for Transmutation)

  13. Technetium 99-m labeled radio-diagnostic agents employing stannous tartrate and method of preparation

    International Nuclear Information System (INIS)

    Molinski, V.J.; Wilczewski, J.A.

    1976-01-01

    A method of preparing improved technetium-99m labeled radiodiagnostic agents by reducing technetium-99m with stannous tartrate. Such radiodiagnostic agents are useful in scintigraphic examinations of the bone and lung. 31 claims, no drawings

  14. The radiochemical purity of technetium-99m-tin-diethylene-triamino-pentaacetic acid (DTPA) complex

    International Nuclear Information System (INIS)

    Besnard, M.; Costerousse, O.; Merlin, L.; Coehn, Y.

    1975-01-01

    The effect on radiochemical purity was studied as a function of the storage period of tin-DTPA solution and of the technetium-complex solution. The quantity of the pertechnetate ions present in the solution is determined by ascending paper chromatography, and an attempt was made to clarify the bond type of technetium by a spectrophotometric method. The tin-DTPA solutions for complexing of the reduced technetium are stable over a period of 8 weeks. The yield of the radiopharmaceutical product is better than 95%. (G.Gy.)

  15. Preparation of a generator of technetium-99m

    International Nuclear Information System (INIS)

    Jimeno de Osso, F.

    1981-01-01

    Practical description is given of equipment and operations necessary in the preparation of an isotopic generator of technetium-99m. The preparation and application of the active solution and throughly washed of the chromatographic column have been studied in order to allow molibdenum-99 to be adsorbed on a small band, and the solution of tectium-99m to be eluted with high efficiency and purity. The equipment and accesories used are easy and safety to manage, simplifying operations to be carried out with the active product, eliminating the sterile environment in the shielded cell, and facilitating the preparation of the solution of technetium-99m in sterile and pyrogen-free conditions.(author) [es

  16. Importance of methodology on (99m)technetium dimercapto-succinic acid scintigraphic image quality: imaging pilot study for RIVUR (Randomized Intervention for Children With Vesicoureteral Reflux) multicenter investigation.

    Science.gov (United States)

    Ziessman, Harvey A; Majd, Massoud

    2009-07-01

    We reviewed our experience with (99m)technetium dimercapto-succinic acid scintigraphy obtained during an imaging pilot study for a multicenter investigation (Randomized Intervention for Children With Vesicoureteral Reflux) of the effectiveness of daily antimicrobial prophylaxis for preventing recurrent urinary tract infection and renal scarring. We analyzed imaging methodology and its relation to diagnostic image quality. (99m)Technetium dimercapto-succinic acid imaging guidelines were provided to participating sites. High-resolution planar imaging with parallel hole or pinhole collimation was required. Two core reviewers evaluated all submitted images. Analysis included appropriate views, presence or lack of patient motion, adequate magnification, sufficient counts and diagnostic image quality. Inter-reader agreement was evaluated. We evaluated 70, (99m)technetium dimercapto-succinic acid studies from 14 institutions. Variability was noted in methodology and image quality. Correlation (r value) between dose administered and patient age was 0.780. For parallel hole collimator imaging good correlation was noted between activity administered and counts (r = 0.800). For pinhole imaging the correlation was poor (r = 0.110). A total of 10 studies (17%) were rejected for quality issues of motion, kidney overlap, inadequate magnification, inadequate counts and poor quality images. The submitting institution was informed and provided with recommendations for improving quality, and resubmission of another study was required. Only 4 studies (6%) were judged differently by the 2 reviewers, and the differences were minor. Methodology and image quality for (99m)technetium dimercapto-succinic acid scintigraphy varied more than expected between institutions. The most common reason for poor image quality was inadequate count acquisition with insufficient attention to the tradeoff between administered dose, length of image acquisition, start time of imaging and resulting image

  17. Effect of humic acid on sorption of technetium by alumina

    International Nuclear Information System (INIS)

    Kumar, S.; Rawat, N.; Kar, A.S.; Tomar, B.S.; Manchanda, V.K.

    2011-01-01

    Highlights: → Tc sorption on alumina has been studied under aerobic as well anaerobic condition over pH 3-10. → Effect of humic acid on sorption of Tc by alumina has been investigated. → Linear additive modeling and surface complexation modeling were carried out to delineate the role of humic acid in Tc(IV) sorption in ternary system of Tc(IV)-humic acid-alumina. → Sorption of humic acid onto alumina and strong complexation of Tc(IV) with humic acid were found to govern the sorption of Tc(IV) in the ternary system. - Abstract: Sorption of technetium by alumina has been studied in absence as well as in presence of humic acid using 95 Tc m as a tracer. Measurements were carried out at fixed ionic strength (0.1 M NaClO 4 ) under varying pH (3-10) as well as redox (aerobic and reducing anaerobic) conditions. Under aerobic conditions, negligible sorption of technetium was observed onto alumina both in absence and in presence of humic acid. However, under reducing conditions (simulated with [Sn(II)] = 10 -6 M), presence of humic acid enhanced the sorption of technetium in the low pH region significantly and decreased at higher pH with respect to that in absence of humic acid. Linear additive as well as surface complexation modeling of Tc(IV) sorption in presence of humic acid indicated the predominant role of sorbed humic acid in deciding technetium sorption onto alumina.

  18. Chemical form of technetium in corn (Zea mays) and the gastrointestinal absorption of plant-incorporated Tc by laboratory rats

    Energy Technology Data Exchange (ETDEWEB)

    Garten, C.T. Jr.; Myttenaere, C.; Vandecasteele, C.M.; Kirchmann, R.; Van Bruwaene, R.

    1984-01-01

    The food chain availability of technetium incorporated into plant tissue, its chemical form in corn leaves, and the potential for gastrointestinal absorption of plant-incorporated technetium was investigated. Technetium-95m was incorporated into corn leaves via root uptake. Chemical fractionation of the /sup 95m/Tc in leaves showed that 60% was extractable with boiling ethanol and weak mineral acids. The remainder was associated with cell walls and was extractable by harsh chemical treatment. Gel permeation chromatography of the cytosol, indicated that 50% of the /sup 95m/Tc co-chromatographed with anionic pertechnetate; however, it was impossible to distinguish if this pure pertechnetate or technetium complexed with organic molecules. Technetium-95m was administered to laboratory rats in a single dose as: (1) intravenous injection of pertechnetate, (2) pertechnetate mixed with standard laboratory food, and (3) a meal containing /sup 95m/Tc biologically incorporated into corn leaves. High concentrations of /sup 95m/Tc were found in the thyroids, hair, kidneys, and liver of rats. Technetium rapidly disappeared from the liver, kidneys, and other tissues, but remained in the thyroids and hair. Urinary excretion of technetium decreased, and fecal excretion increased when technetium was fed to rats as a /sup 95m/Tc incorporated into corn leaves. The percent of the administered dose absorbed into thyroid gland and the kidneys was less when technetium was biologically incorporated into corn leaves than when pertechnetate was mixed with food. Biological incorporation of technetium into plants appears to reduce its potential for food chain transfer by decreasing its availability for gastrointestinal absorption. 5 references, 4 figures, 3 tables.

  19. Chemical form of technetium in corn (Zea mays) and the gastrointestinal absorption of plant-incorporated Tc by laboratory rats

    International Nuclear Information System (INIS)

    Garten, C.T. Jr.; Myttenaere, C.; Vandecasteele, C.M.; Kirchmann, R.; Van Bruwaene, R.

    1984-01-01

    The food chain availability of technetium incorporated into plant tissue, its chemical form in corn leaves, and the potential for gastrointestinal absorption of plant-incorporated technetium was investigated. Technetium-95m was incorporated into corn leaves via root uptake. Chemical fractionation of the /sup 95m/Tc in leaves showed that 60% was extractable with boiling ethanol and weak mineral acids. The remainder was associated with cell walls and was extractable by harsh chemical treatment. Gel permeation chromatography of the cytosol, indicated that 50% of the /sup 95m/Tc co-chromatographed with anionic pertechnetate; however, it was impossible to distinguish if this pure pertechnetate or technetium complexed with organic molecules. Technetium-95m was administered to laboratory rats in a single dose as: (1) intravenous injection of pertechnetate, (2) pertechnetate mixed with standard laboratory food, and (3) a meal containing /sup 95m/Tc biologically incorporated into corn leaves. High concentrations of /sup 95m/Tc were found in the thyroids, hair, kidneys, and liver of rats. Technetium rapidly disappeared from the liver, kidneys, and other tissues, but remained in the thyroids and hair. Urinary excretion of technetium decreased, and fecal excretion increased when technetium was fed to rats as a /sup 95m/Tc incorporated into corn leaves. The percent of the administered dose absorbed into thyroid gland and the kidneys was less when technetium was biologically incorporated into corn leaves than when pertechnetate was mixed with food. Biological incorporation of technetium into plants appears to reduce its potential for food chain transfer by decreasing its availability for gastrointestinal absorption. 5 references, 4 figures, 3 tables

  20. Evolution of technetium speciation in reducing grout

    Energy Technology Data Exchange (ETDEWEB)

    Lukens, Wayne W.; Bucher, Jerome J.; Shuh, David K.; Edelstein,Norman M.

    2003-11-24

    Cementitious waste forms (CWFs) are an important component of the strategy to immobilize high-level nuclear waste resulting from plutonium production by the U.S. Department of Energy (DOE). Technetium (99Tc) is an abundant fission product of particular concern in CWFs due to the high solubility and mobility of pertechnetate, TcO4-, the stable form of technetium in aerobic environments. CWFs can more effectively immobilize 99Tc if they contain additives that reduce mobile TcO4- to immobile Tc(IV) species. Leaching of 99Tc from reducing CWFs that contain Tc(IV) is much slower than for CWFs containing TcO4-. Previous X-ray absorption fine structure (XAFS) studies showed that the Tc(IV) species were oxidized to TcO4- in reducing grout samples prepared on a laboratory scale. Whether the oxidizer was atmospheric O2 or NO3- in the waste simulant was not determined. In actual CWFs, rapid oxidation of Tc(IV) by NO3- would be a concern, whereas oxidation by atmospheric O2 would be of less concern due to the slow diffusion and reaction of O2 with the reducing CWF. To address this uncertainty, two series of reducing grouts were prepared using TcO4- containing waste simulants with and without NO3-. In the first series of samples, the TcO4- was completely reduced using Na2S, and the samples were placed in containers that permitted O2 diffusion. In these samples, all of the technetium was initially present as aTc(IV) sulfide compound, TcSx, which was characterized using extended X-ray absorption fine structure (EXAFS) spectroscopy, and is likely Tc2S7. The TcSx initially present in the grout samples was steadily oxidized over 4 years. In the second series of samples, all of the TcO4- was not initially reduced, and the grout samples were placed in airtight containers. In these samples, the remaining TcO4- continued to be reduced as the samples aged, presumably due to the presence of reducing blast furnace slag. When samples in the second series were exposed to atmosphere, the

  1. Sorption behaviour of radioactive technetium in soils

    International Nuclear Information System (INIS)

    Xia Deying

    1996-01-01

    The sorption behaviour of technetium in different soils has been studied by batch experiments under aerobic conditions. The soil samples have been taken to study the characteristics and to derive the pH-Eh values. In addition, the activated carbon and reduced iron powder have been selected as additives to the JAERI sand according to the former research work, so that the technetium sorption behaviour in the artificial soils can be studied under similar conditions. The experimental results show that all these soil samples except for the gluey soil have a very small distribution coefficient for Tc, while the artificial soils have a very large distribution coefficient for Tc. Besides, for artificial soils, the distribution coefficient (R d ) values will become larger and larger when more additive is added and more contact time is allowed. The physico-chemical fixation processes and possible sorption modes have been discussed as well

  2. Technetium-labeled HM-PAO studies in patients with cerebrovascular disease

    International Nuclear Information System (INIS)

    Smith, F.W.; Sharp, P.F.; Gemmell, H.; Evans, N.T.; MacDonald, A.F.

    1986-01-01

    Technetium-labeled hexamethyl-propyleneamineoxime (HM-PAO) is a promising radiopharmaceutical for the demonstration of cerebral blood flow. Twenty-four patients who had experienced either acute stroke (AS) or transient ischemic attack (TIA) were studied by x-ray CT and SPECT using technetium-labeled HM-PAO total of 26 studies. HM-PAO has a cerebral distribution similar to that of iodoamphetamine, but labeling with technetium allows good SPECT imaging on demand in any nuclear medicine department. In ten of the 16 patients who had experienced AS, findings on HM-PAO and CT studies correlated well. In six patients reduced cortical perfusion was detected on HM-PAO imaging, but only small infarcts in the internal capsule were seen on CT. In four of the eight patients who had experienced TIA, neither study revealed any abnormality. In the remaining four, areas of cortical underperfusion were seen on HM-PAO imaging, whereas the CT examination was normal. The findings in this study suggest that HM-PAO imaging is a more sensitive method for demonstrating the extent of cerebral underperfusion in cases of cerebrovascular accident

  3. An investigation of the effect of the quantity of stannous ion on the quality of technetium-99m labelled albumin

    International Nuclear Information System (INIS)

    Billinghurst, M.W.; Rempel, S.; Westendorf, B.A.

    1981-01-01

    The importance of maintaining a low ratio of stannous ion to albumin molecules in order to obtain a high quality technetium-99m labelled albumin is demonstrated. It is further shown that the direct preparation of technetium-99m albumin by reduction of the technetium-99m pertechnetate with stannous ion inevitably leads to the contamination of the product with a certain amount of tin colloid which is also labelled with technetium-99m. It is demonstrated that this can be avoided by utilizing labelling techniques involving the initial formation of other technetium chelates which are less stable than the albumin complex under certain conditions, adding the albumin to that preparation, adjusting the conditions and thus allowing the albumin to become labelled with technetium-99m via an exchange with the original chelating agent. (author)

  4. A method for the preparation of lipophilic macrocyclic technetium-99m complexes

    International Nuclear Information System (INIS)

    Troutner, D.E.; Volkert, W.A.

    1991-01-01

    A procedure for the preparation of technetium complexes applicable as diagnostic radiopharmaceuticals is suggested and documented with 27 examples. Technetium-99m is reacted with a suitable complexant selected from the class of alkylenamine oximes containing 2 or 3 carbon atoms in the alkylene group. The lipophilic macrocyclic complexes possess an amine, amide, carboxy, carboxy ester, hydroxy or alkoxy group or a suitable electron acceptor group. (M.D.). 7 tabs

  5. Measurement of glomerular filtration rate in children using technetium-99m diethylenetriamine penta-acetic acid

    International Nuclear Information System (INIS)

    Aaronson, I.A.; Mann, M.D.

    1985-01-01

    During the past 5 years, we have measured the glomerular filtration rate (GFR) by the slope-clearance method using technetium-99m diethylenetriamine penta-acetic acid technetium-99m-DTPA in 130 infants and children. The results in 22 children have been compared with inulin clearance, and a very good correlation between the two methods of measurement of GFR was demonstrated (r = 0,9616; P less than 0,0001). This study provides further evidence that technetium-99m-DTPA is a satisfactory agent for the clinical measurement of GFR in children

  6. Molybdenum and technetium cycle in the environment. Physical chemical evolution and mobility in soils and plants

    International Nuclear Information System (INIS)

    Saas, A.; Denardi, J.L.; Colle, C.; Quinault, J.M.

    1980-01-01

    Molybdenum 99 and technetium 99 from liquid discharges of base nuclear installations (reactors, reprocessing plants, UF 6 treatment, etc.) can reach the environment via irrigation waters and atmospheric deposits. The contribution to the soil by irrigation results in a physical-chemical transformation, the results of which, in the case of technetium 99, could be volatilization via microbes. The changes in the physical-chemical forms of technetium in different soils reveals the preponderant effect of the initial amount deposited. The determination of the rate of technetium and molybdenum assimilation shows a certain similarity in behaviour; yet the localization of these isotopes is not the same. The transfer of molybdenum and technetium via the root system is different in its intensity; this is mainly due to different physical-chemical forms. Finally, each isotope has an optimum assimilation threshold and a toxicity threshold. The study of the physical-chemical evolution and the mobility in the soil-plant-water table system of these two isotopes shows a new aspect with respect to certain transfer channels to the human being [fr

  7. Study on interference of technetium in spectrophotometric estimation of uranium

    International Nuclear Information System (INIS)

    Revathi, P.; Saipriya, K.; Madhavan Kutty, V.K.; Srinivasa Rao, G.; Vijayakumar, N.; Kumar, T.

    2015-01-01

    Estimation of uranium is essential for process control purposes as well as to arrive optimum parameters for further waste management in reprocessing industry. Uranium estimation is done by spectrophotometry using ammonium thiocyanate, DBM, PAR and Br-PADAP as chromogenic reagents for colour development. Extractive spectrophotometry can also be used to eliminate some of the interfering ions. During inter method comparison, technetium was found to be interfering in the thiocyanate spectrophotometry. This study is an effort to find out the extent of technetium interference in the estimation of uranium by spectrophotometry using the above said chromogenic reagents. (author)

  8. Performance testing of blast furnace slag for immobilization of technetium in grout

    International Nuclear Information System (INIS)

    Gilliam, T.M.; Spence, R.D.; Evans-Brown, B.S.; Morgan, I.L.; Shoemaker, J.L.; Bostick, W.D.

    1988-01-01

    This paper presents preliminary results of a grout development effort to identify grout formulas that can satisfactorily sequester 99 Tc contained in an existing Portsmouth Gaseous Diffusion Plant waste. Technetium is of particular concern to the US Nuclear Regulatory Commission (NRC) because of its mobility and biological activity. The mobility of technetium results in large part from the movement of the pertechnate anion [prevalent in low-level radioactive waste (LLW)] through soil and geologic strata with little or no interaction with the surrounding matrix. Ground blast furnace slag has been shown to improve the leach resistance of cement-based waste forms, particularly in regard to technetium. This improved performance has been attributed to fewer and smaller pores in the solidified slags (versus a neat cement paste) and to the reduction of the pertechnate ion to a less soluble form. 9 refs., 2 tabs

  9. Obtention of scintillography images by low density lipoproteins labelled with technetium 99

    International Nuclear Information System (INIS)

    Silva, S.; Coelho, I.; Zanardo, E.; Pileggi, F.; Meneguethi, C.; Maranhao, R.C.

    1992-01-01

    The low density lipoproteins carry the most part of the cholesterol in the blood plasma. These lipoproteins are labelled with technetium-99-m and have been used for obtaining images in nuclear medicine. The introduction of this technique is presented, aiming futures clinical uses. Scintillographic images are obtained 25 minutes and 24 hours after the injection of 3 m Ci of low density lipoproteins - technetium-99 m in rabbits. (C.G.C.)

  10. Technetium cyanide chemistry: synthesis and characterization of technetium(III) and -(V) cyanide complexes

    International Nuclear Information System (INIS)

    Trop, H.S.; Jones, A.G.; Davison, A.

    1980-01-01

    Several new technetium cyanide complexes have been prepared and characterized. The reaction of ammonium hexaiodotechnetate(IV) with potassium cyanide in refluxing aqueous methanol under nitrogen yields potassium heptacyanotechnetate(III) dihydrate, K 4 Tc(CN) 7 .2H 2 O (1). Infrared and Raman measurements indicate that 1 has a pentagonal bipyramidal structure (D/sub 5h/) in both solid and solution. Aqueous solutions of 1 are air sensitive, decomposing to potassium oxopentacyanotechnetate(V) tetrahydrate, K 2 TcO(CN) 5 .4H 2 O (2). This species can also be prepared from the reaction of TcO 2 .xH 2 O with hot aqueous potassium cyanide solutions. Hydrolysis of 2 in water yields potassium trans-dioxo-tetracyanotechnetate(V), K 3 TcO 2 (CN) 4 (3). Preparation of 3 can also be achieved from the treatment of [TcO 2 (Py) 4 ]ClO 4 .2H 2 O with aqueous potassium cyanide. Infrared and Raman measurements on 3 are consistent with the proposed trans-dioxo (D/sub 4h/) structure. Reaction of the oxotetrachlorotechnetate(V) anion, TcOCl 4 , with potassium cyanide in methanol produces trans-oxomethoxytetracyanotechnetate(V). [TcO(OMe)(CN) 4 ] (4). The full details of the synthesis and characterization of these interesting technetium(III) and -(V) complexes, as well as observations on the infrared and Raman spectra of trans-dioxo metal complexes and the hydrolysis of species 2, are presented

  11. Fluoridonitrosyl complexes of technetium(I) and technetium(II). Synthesis, characterization, reactions, and DFT calculations.

    Science.gov (United States)

    Balasekaran, Samundeeswari Mariappan; Spandl, Johann; Hagenbach, Adelheid; Köhler, Klaus; Drees, Markus; Abram, Ulrich

    2014-05-19

    A mixture of [Tc(NO)F5](2-) and [Tc(NO)(NH3)4F](+) is formed during the reaction of pertechnetate with acetohydroxamic acid (Haha) in aqueous HF. The blue pentafluoridonitrosyltechnetate(II) has been isolated in crystalline form as potassium and rubidium salts, while the orange-red ammine complex crystallizes as bifluoride or PF6(-) salts. Reactions of [Tc(NO)F5](2-) salts with HCl give the corresponding [Tc(NO)Cl4/5](-/2-) complexes, while reflux in neat pyridine (py) results in the formation of the technetium(I) cation [Tc(NO)(py)4F](+), which can be crystallized as hexafluoridophosphate. The same compound can be synthesized directly from pertechnetate, Haha, HF, and py or by a ligand-exchange procedure starting from [Tc(NO)(NH3)4F](HF2). The technetium(I) cation [Tc(NO)(NH3)4F](+) can be oxidized electrochemically or by the reaction with Ce(SO4)2 to give the corresponding Tc(II) compound [Tc(NO)(NH3)4F](2+). The fluorido ligand in [Tc(NO)(NH3)4F](+) can be replaced by CF3COO(-), leaving the "[Tc(NO)(NH3)4](2+) core" untouched. The experimental results are confirmed by density functional theory calculations on [Tc(NO)F5](2-), [Tc(NO)(py)4F](+), [Tc(NO)(NH3)4F](+), and [Tc(NO)(NH3)4F](2+).

  12. Adsorption of technetium-99m tetrofosmin and technetium-99m furifosmin on plastic syringes

    International Nuclear Information System (INIS)

    Bartosch, R.; Granegger, S.; Sinzinger, H.

    1998-01-01

    Some groups have reported that adsorption of radiopharmaceuticals on disposable plastic syringes can reach levels of almost 50%. This high loss of radioactivity stimulated us to carry out similar studies. Our measurements were done in combination with patient studies. Therefore, we used 2-ml syringes, all of the same brand. The radioactivity in the syringe was measured immediately before and after injection. a total of 500-600 MBq technetium-99m labelled tetrofosmin or technetium-99m furifosmin was administered to 48 patients using four different injection techniques (n = 6 for each technique with each tracer): with needles, 1 min blood incubation at 22 C, 10 or 30 min after preparation of the tracer; with butterflies, 1 min blood incubation at 22 C, 10 or 30 min after preparation of the tracer. Neither in syringes nor in needles or butterflies did more than 7% of the initial radioactivity remain. The entire residual activity in syringe plus needle or syringe plus butterfly together never exceeded the 9% limit. Furthermore, in a pilot study we measured the remaining radioactivity in the vial; here, too, we found no more than 14% of total radioactivity. These findings indicate that total retention of radioactivity during elution and application of 99m Tc-tetrofosmin and 99m Tc-furifosmin with material used in our setting does not approach relevant amounts. (orig.)

  13. Purification of alkaline solutions and wastes from actinides and technetium by coprecipitation with some carriers using the method of appearing reagents: Final Report

    International Nuclear Information System (INIS)

    Peretrukhin, V.F.; Silin, V.I.; Kareta, A.V.; Gelis, A.V.; Shilov, V.P.; German, K.E.; Firsova, E.V.; Maslennikov, A.G.; Trushina, V.E.

    1998-09-01

    The coprecipitation of transuranium elements (TRU) and technetium from alkaline solutions and from simulants of Hanford Site tank wastes has been studied in reducing and oxidizing conditions on uranium(IV,VI) hydroxocompounds, tetraalkylammonium perrhenate and perchlorate, and on hydroxides of Fe(III), Co(III), Mn(II), and Cr(III) using the method of appearing reagents (MAR). Coprecipitations in alkaline solution have been shown to give high decontamination factors (DF) at low content of carrier and in the presence of high salt concentrations. Uranium(IV) hydroxide in concentrations higher than 3 x 10 -3 M coprecipitates Pu and Cm in any oxidation state from 0.2 to 4 M NaOH with DFs of 110 to 1000 and Np and Tc with DFs of 51 to 176. Technetium (VII) coprecipitates with (5 to 8) x 10 -4 M tetrabutylammonium (TBA) perrhenate in 0.01 to 0.02 M TBA hydroxide from 0.5 to 1.5 M NaOH to give DFs of 150 to 200. Coprecipitations of Np and Pu with Co(OH) 3 , Fe(OH) 3 , Cr(OH) 3 , and Mn(OH) 2 obtained by the MAR from precursors in the range from pH 10.5 to 0.4 M NaOH give DFs from 80 to 400

  14. Comparison between hemosiderin and Technetium-99 in sentinel lymph node biopsy in human breast cancer

    International Nuclear Information System (INIS)

    Vasques, Paulo Henrique Diogenes; Aquino, Ranniere Gurgel Furtado de; Pinheiro, Luiz Gonzaga Porto; Torres, Roberto Vitor Almeida; Bezerra, Jose Lucas Martins; Brasileiro, Luis Porto

    2015-01-01

    Purpose: To assess the safety and potential equivalence of the use of hemosiderin compared to the Technetium-99 in sentinel lymph node biopsy in human breast cancer. Methods: Non-random sample of 14 volunteer women diagnosed with breast cancer with primary tumors (T1/T2) and clinically tumor-free axilla were submitted to the identification of sentinel lymph node using hemosiderin obtained from autologous blood injected in the periareolar region 24h before surgery on an outpatient basis. Patients received preoperative subareolar intradermal injection of Technetium-99 in the immediate preoperative period. Patients were submitted to sentinel lymph node biopsy, with incision in the axillary fold guided by Gamma-Probe, dissection by planes until the identification of the point of maximum uptake of Technetium-99, identifying the marked nodes and their colors. All surgical specimens were sent for pathological and immunohistochemical study. Results: The results showed no evidence of side effects and/or allergic and non-allergic reactions in patients submitted to SLNB with hemosiderin. The SLN identification rate per patient was 100%. SLNB identification rate per patient with hemosiderin was the same as that of Technetium, with a concordance rate of 100% between the methods. Conclusion: Hemosiderin is a safe dye that is equivalent to Technetium in breast sentinel lymph node biopsy. (author)

  15. Comparison between hemosiderin and Technetium-99 in sentinel lymph node biopsy in human breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Vasques, Paulo Henrique Diogenes; Aquino, Ranniere Gurgel Furtado de; Pinheiro, Luiz Gonzaga Porto, E-mail: luizgporto@uol.com.br [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Departamento de Cirurgia; Alves, Mayara Maia [Rede Nordeste de Biotecnologia (RENORBIO/UFC), Fortaleza, CE (Brazil); Torres, Roberto Vitor Almeida; Bezerra, Jose Lucas Martins [Universidade Federal do Ceara (UFC), Fortaleza, CE (Brazil). Faculdade de Medicina; Brasileiro, Luis Porto [Faculdades INTA, Sobral, CE (Brazil). Faculdade de Medicina

    2015-11-15

    Purpose: To assess the safety and potential equivalence of the use of hemosiderin compared to the Technetium-99 in sentinel lymph node biopsy in human breast cancer. Methods: Non-random sample of 14 volunteer women diagnosed with breast cancer with primary tumors (T1/T2) and clinically tumor-free axilla were submitted to the identification of sentinel lymph node using hemosiderin obtained from autologous blood injected in the periareolar region 24h before surgery on an outpatient basis. Patients received preoperative subareolar intradermal injection of Technetium-99 in the immediate preoperative period. Patients were submitted to sentinel lymph node biopsy, with incision in the axillary fold guided by Gamma-Probe, dissection by planes until the identification of the point of maximum uptake of Technetium-99, identifying the marked nodes and their colors. All surgical specimens were sent for pathological and immunohistochemical study. Results: The results showed no evidence of side effects and/or allergic and non-allergic reactions in patients submitted to SLNB with hemosiderin. The SLN identification rate per patient was 100%. SLNB identification rate per patient with hemosiderin was the same as that of Technetium, with a concordance rate of 100% between the methods. Conclusion: Hemosiderin is a safe dye that is equivalent to Technetium in breast sentinel lymph node biopsy. (author)

  16. Non-pertechnetate Technetium Sensor Research and Development

    Energy Technology Data Exchange (ETDEWEB)

    Bryan, Samuel A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Rapko, Brian M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Branch, Shirmir D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Univ. of Cincinnati, OH (United States); Lines, Amanda M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Heineman, William R. [Univ. of Cincinnati, OH (United States); Soderquist, Chuck Z. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-03-24

    Several significant uncertainties remain regarding the understanding and modeling of the fate and speciation of technicium-99 (99Tc) in Hanford waste tanks, glass, and low-temperature waste forms. A significant (2% to 25%) fraction of the 99Tc in the water-soluble portion of the tank waste may be present as one or more non pertechnetate species that have not been identified and to date, cannot be effectively separated from the wastes. This task will provide a sensor specifically tuned to detect the Tc(I)-carbonyl species believed to constitute the main fraction of the non-pertechnetate form of technetium. By direct measurement of the non-pertechnetate species, such a sensor will help reduce the uncertainties in the modeling of the fate and speciation of 99Tc in Hanford tanks and waste forms. This report summarizes work performed in FY2016 that was sponsored by the Department of Energy’s Office of Environmental Management and demonstrates the protocol for using fluorescent Tc(I)-tricarbonyl complex as a means to detect the non-pertechnetate species within tank waste solutions. The protocol was optimized with respect to ligand concentration, solvent choice, reaction temperature and time. This work culminated in the quantitation of Tc(I)-tricarbonyl within a waste simulant, using a standard addition method for measurement. This report also summarizes the synthesis and high-yield preparation of the low-valence technetium species, [Tc(CO)3(H2O)3]+, which will be used as the technetium standard material for the demonstration of the non-pertechnetate species in actual wastes.

  17. Method for radiolabeling proteins with technetium-99m

    International Nuclear Information System (INIS)

    Crockford, D.R.; Rhodes, B.A.

    1984-01-01

    In accordance with this invention, a substrate to be radiolabeled with technetium-99m is admixed with a buffered stannous chloride composition having a pH between about 4.5 and about 8.5 wherein the stannous chloride is produced from a non-oxidized tin source, the buffered stannous chloride is purged of oxygen and the buffer comprises a mixture of alkali metal biphthalate and an alkali metal tartrate. Alternatively, the buffer may include alkali metal borate or gentisate. The stannous chloride solution is admixed with the buffer and the resultant mixture is neutralized with sodium hydroxide. The neutralized solution then is admixed with the substrate eventually to be radiolabeled with technetium-99m. This solution is allowed to incubate for several hours (usually over 15 hours) in the absence of oxygen and at room temperature

  18. Physics of the missing atoms: technetium and promethium

    International Nuclear Information System (INIS)

    Aspden, H.

    1987-01-01

    Technetium (Z = 43) and promethium (Z = 61) are by far the least abundant of all atoms below the radioactive elements (Z = 84 onwards). Their scarcity confirms theoretical predictions emerging from a theory of the photon derived from synchronous lattice electrodynamics. This theory has given precise theoretical values for the fine-structure constant and the constant of gravitation G and is now shown in this paper to indicate resonant interactions between the vacuum lattice oscillations and technetium and promethium. In the case of promethium there is strong reason for believing that this atom can assume supergravitational or antigravitational properties, accounting for its scarcity. This paper not only adds support to the earlier theoretical work on the photon and gravitation, but suggests a research route that might lead to new technology based on controlled interactions with gravity fields

  19. Preparation and quality control of technetium-99m radiopharmaceuticals

    International Nuclear Information System (INIS)

    Samuels, D.L.

    1978-11-01

    Appropriate procedures for the production and quality control of technetium-99m based radiopharmaceuticals in hospital radiopharmacy consistent with the recently published Australian Code of Good Manufacturing Practice are discussed

  20. LABORATORY REPORT ON THE REDUCTION AND STABILIZATION (IMMOBILIZATION) OF PERTECHNETATE TO TECHNETIUM DIOXIDE USING TIN(II)APATITE

    Energy Technology Data Exchange (ETDEWEB)

    DUNCAN JB; HAGERTY K; MOORE WP; RHODES RN; JOHNSON JM; MOORE RC

    2012-06-01

    This effort is part of the technetium management initiative and provides data for the handling and disposition of technetium. To that end, the objective of this effort was to challenge tin(II)apatite (Sn(II)apatite) against double-shell tank 241-AN-105 simulant spiked with pertechnetate (TcO{sub 4}{sup -}). The Sn(II)apatite used in this effort was synthesized on site using a recipe developed at and provided by Sandia National Laboratories; the synthesis provides a high quality product while requiring minimal laboratory effort. The Sn(II)apatite reduces pertechnetate from the mobile +7 oxidation state to the non-mobile +4 oxidation state. It also sequesters the technetium and does not allow for re-oxidization to the mo bile +7 state under acidic or oxygenated conditions within the tested period oftime (6 weeks). Previous work (RPP-RPT-39195, Assessment of Technetium Leachability in Cement-Stabilized Basin 43 Groundwater Brine) indicated that the Sn(II)apatite can achieve an ANSI leachability index in Cast Stone of 12.8. The technetium distribution coefficient for Sn(II)apatite exhibits a direct correlation with the pH of the contaminated media. Table A shows Sn(II)apatite distribution coefficients as a function of pH. The asterisked numbers indicate that the lower detection limit of the analytical instrument was used to calculate the distribution coefficient as the concentration of technetium left in solution was less than the detection limit. The loaded sample (200 mg of Sn(II)apatite loaded with O.311 mg of Tc-99) was subjected to different molarities of nitric acid to determine if the Sn(II)apatite would release the sequestered technetium. The acid was allowed to contact for 1 minute with gentle shaking ('1st wash'); the aqueous solution was then filtered, and the filtrate was analyzed for Tc-99. Table B shows the results ofthe nitric acid exposure. Another portion of acid was added, shaken for a minute, and filtered ('2nd wash'). The

  1. Quantitative radiocardiography by single-probe counting using sup(99m)technetium albumin

    International Nuclear Information System (INIS)

    Man in 't Veld, A.J.; Wenting, G.J.; Verhoeven, R.P.; Schalekamp, M.A.D.H.

    1978-01-01

    Quantitative radiocardiography with sup(99m)Technetium albumin, using a single probe for percordial counting of radioactivity is a non-invasive technique to measure cardiac output. sup(99m)Technetium pertechnetate is bound to albumin by electrolytic complexation. Preparations of sup(99m)Technetium albumin showed small percentages of free radioactivity. In-vivo stability of the complex was confirmed by comparison with distribution volumes of 131 Iodine albumin and sup(113m)Indium transferrin. The isotope dilution cardiac output technique was validated by comparison with a classical indocyanine green dilution method. Results obtained by peripheral intravenous injection of the isotope were not different from those after intracardiac injection. Exact localization of the collimator over the heart was not critical. Duplicate measurements showed good reproducibility. Examples of serial measurements in patients with hyperthyroidism, primary aldosteronism and essential hypertinsion are given. The method is reliable, accurate and safe and causes no discomfort to the patient. (C.F.)

  2. ASSESSMENT OF TECHNETIUM LEACHABILITY IN CEMENT STABILIZED BASIN 43 GROUNDWATER BRINE

    International Nuclear Information System (INIS)

    COOKE GA; DUNCAN JB; LOCKREM LL

    2008-01-01

    This report is an initial report on the laboratory effort executed under RPP-PLAN-33338, Test Plan for the Assessment of Technetium Leachability in Cement-Stabilized Basin 43 Groundwater Brine. This report delineates preliminary data obtained under subcontract 21065, release 30, from the RJ Lee Group, Inc., Center for Laboratory Sciences. The report is predicated on CLS RPT-816, Draft Report: Assessment of Technetium Leachability in Cement Stabilized Basin 43 Groundwater Brine. This document will be revised on receipt of the final RJ Lee Group, Inc., Center for Laboratory Sciences report, which will contain data subjected to quality control and quality assurance criteria

  3. Chemistry of rhenium and technetium. II. Schiff base complexes with polyfunctional amino acids

    International Nuclear Information System (INIS)

    Du Preez, J.G.H.; Gerber, T.I.A.; Fourie, P.J.; Van Wyk, A.J.

    1984-01-01

    Amino acid Schiff base technetium(V) complexes of salicylaldehyde with l-cysteine, l-serine, l-histodine, l-threonine, l-glutamic acid and l-tryptophan have been preapred by direct reaction and by constituent combination. The amino acid part of the ligands coordinates to the technetium through the carboxylate group, while the other available functional group of the amino acids plays a more minor role as blocking group or in intramolecular bonding. 3 tables

  4. Adsorption of technetium-99m tetrofosmin and technetium-99m furifosmin on plastic syringes

    Energy Technology Data Exchange (ETDEWEB)

    Bartosch, R.; Granegger, S.; Sinzinger, H. [Department of Nuclear Medicine, University of Vienna (Austria)

    1998-09-01

    Some groups have reported that adsorption of radiopharmaceuticals on disposable plastic syringes can reach levels of almost 50%. This high loss of radioactivity stimulated us to carry out similar studies. Our measurements were done in combination with patient studies. Therefore, we used 2-ml syringes, all of the same brand. The radioactivity in the syringe was measured immediately before and after injection. a total of 500-600 MBq technetium-99m labelled tetrofosmin or technetium-99m furifosmin was administered to 48 patients using four different injection techniques (n = 6 for each technique with each tracer): with needles, 1 min blood incubation at 22 C, 10 or 30 min after preparation of the tracer; with butterflies, 1 min blood incubation at 22 C, 10 or 30 min after preparation of the tracer. Neither in syringes nor in needles or butterflies did more than 7% of the initial radioactivity remain. The entire residual activity in syringe plus needle or syringe plus butterfly together never exceeded the 9% limit. Furthermore, in a pilot study we measured the remaining radioactivity in the vial; here, too, we found no more than 14% of total radioactivity. These findings indicate that total retention of radioactivity during elution and application of {sup 99m}Tc-tetrofosmin and {sup 99m}Tc-furifosmin with material used in our setting does not approach relevant amounts. (orig.) With 4 figs., 1 tab., 7 refs.

  5. Contributions to the coordination chemistry of technetium

    International Nuclear Information System (INIS)

    Lorenz, B.

    1989-08-01

    New types of technetium complexes were synthesized and analyzed by IR-, 1 H- and 99 Tc nmr as well as EPR spectra. They were tested for their potential catalytic activity in special organic reactions and their relevance to catalytic reactions, for example as intermediate compounds, is discussed in depth. 317 refs., 20 figs. (BBR) [de

  6. Nature`s uncommon elements: Plutonium and technetium

    Energy Technology Data Exchange (ETDEWEB)

    Curtis, D.; Fabryka-Martin, J.; Dixon, P. [Los Alamos National Lab., NM (United States). Chemical Science and Technology Div.; Cramer, J. [Atomic Energy of Canada Ltd., Pinawa, Manitoba (Canada). Whiteshell Lab.

    1998-01-06

    The authors have taken advantage of the extremely sensitive method of thermal ionization mass spectrometry to measure technetium and plutonium concentrations in sample masses that are smaller by as much as three orders of magnitude than those used in the early research efforts. The work reported in this paper extends the understanding of the geochemistry of plutonium and technetium by developing detailed descriptions of their associations in well characterized geologic samples, and by using modern neutron-transport modeling tools to better interpret the meaning of the results. Analyses were conducted on samples from three uranium ore deposits selected for their contrasting geochemical environments. The Cigar Lake deposit is an unweathered, unaltered primary ore in a reducing environment which is expected to closely approximate a system that is closed with respect to uranium and its products. The Koongarra deposit is a shallow system, both altered and weathered, subject to active ground water flow. Finally, a sample from the Beaverlodge deposit is included because it is a commercially-available uranium ore standard that allows demonstration of the precision of the analytical results.

  7. Fundamental chemistry, characterization, and separation of technetium complexes in Hanford waste. 1998 annual progress report

    International Nuclear Information System (INIS)

    Ashley, K.R.; Blanchard, D.L. Jr.; Schroeder, N.C.

    1998-01-01

    'The ultimate goal of this proposal is to separate technetium from Hanford tank waste. The recent work has shown that a large portion of the technetium is not pertechnetate (TcO 4 - ) and is not easily oxidized. This has serious repercussions for technetium partitioning schemes because they are designed to separate this chemical form. Rational attempts to oxidize these species to TcO 4 - for processing or to separate the non-pertechnetate species themselves would be facilitated by knowing the identity of these complexes and understanding their fundamental chemistry. Tank characterization work has not yet identified any of the non-pertechnetate species. However, based on the types of ligands available and the redox conditions in the tank, a reasonable speculation can be made about the types of species that may be present. Thus, this proposal will synthesize and characterize the relevant model complexes of Tc(III), Tc(IV), and Tc(V) that may have formed under tank waste conditions. Once synthesized, these complexes will be used as standards for developing and characterizing the non-pertechnetate species in actual waste using instrumental techniques such as capillary electrophoresis electrospray mass spectrometry (CE-MS), x-ray absorbance spectroscopy (EXAFS and XANES), and multi-nuclear NMR (including 99 Tc NMR). The authors study the redox chemistry of the technetium complexes so that more efficient and selective oxidative methods can be used to bring these species to TcO 4 - for processing purposes. They will also study their ligand substitution chemistry which could be used to develop separation methods for non-pertechnetate species. Understanding the fundamental chemistry of these technetium complexes will enable technetium to be efficiently removed from the Hanford tank waste and help DOE to fulfill its remediation mission. This report summarizes the first 8 months of a 3-year project.'

  8. Technical problems associated with the production of technetium Tc 99m tin(II) pyrophosphate kits

    International Nuclear Information System (INIS)

    Kowalsky, R.J.; Dalton, D.R.

    1981-01-01

    The amount of tin(II) required for adequate reduction, complexation, and stability of technetium Tc 99m pertechnetate in radiopharmaceutical kits, and methods of preventing the loss of tin(II) during formulation of these lyophilized kits are investigated. Tin(II) loss from stannous chloride solutions was studied under several conditions, including room air versus nitrogen atmospheres, during vial filling in a laminar-flow hood with samples frozen on dry ice versus samples at room temperature, during lyophilization, and during storage under refrigerated, ambient, and elevated temperatures. Various amounts of stannous chloride, ranging from 5 to 1000 microgram/ml, were used in formulating sodium pertechnetate Tc 99m kits containing 100 mCi technetium Tc 99m and 0.4 microgram total technetium. Samples were removed at various times; hydrolyzed technetium, pertechnetate, and technetium Tc 99m pyrophosphate were isolated on instant thin-layer chromatography-silica gel and quantified with a scintillation counter. The time necessary to deoxygenate distilled water by nitrogen purging was measured. Several sources of stannous chloride were assayed for tin(II) content. Tin(II) loss occurs rapidly in solution (15% in one hour) unless continuously protected with nitrogen, and during vial filling in a laminar-flow hood unless frozen with dry ice. No substantial loss of tin(II) was detected during lyophilization or during storage of lyophilized product at any of the three temperatures. A minimum of 400 microgram tin(II) was required to provide 90% technetium Tc 99m pyrophosphate at six hours after preparation. Adequate deoxygenation of small quantities (450 ml) of water was accomplished in less than one hour. Some stannous chloride salts were highly oxidized in the dry state, and only high-purity elemental tin wire gave acceptable yields of tin

  9. Fusion of 110Pd with 110Pd

    International Nuclear Information System (INIS)

    Morawek, W.

    1991-07-01

    In the framework of this thesis the excitation functions of the systems 110 Pd + 110 Pd and 110 Pd + 104 Ru could be measured. The evaporation-residual-nucleus cross sections is deviating from lighter systems dominated by channels, which arise from evaporation of α particles. In the reaction 110 Pd + 110 Pd no xn channels were observed. In comparison to other reactions qualitatively a strong fusion hindrance of this system is shown. (orig./HSI) [de

  10. The origins of Technetium in the environment

    International Nuclear Information System (INIS)

    Scoppa, P.

    1986-01-01

    The origins of Technetium in the environment are briefly illustrated, taking into account its main sources represented by same plants of nuclear fuel cycle and by fallout fallowing nuclear explosion in atmosphere. An evaluation is also made of the TC-99 quantitees deriving from the production of nuclear power present in radioactive wastes before their final disposal

  11. Physical chemical quality control of the molybdenum technetium generator

    International Nuclear Information System (INIS)

    Olive, E.; Cruz, J.; Isaac, M.; Gamboa, R.; D'Alessandro, K.; Desdin, L.F.

    1995-01-01

    Comparative operational procedure imported molybdenum technetium generators have been made. Procedures for determination of chemical, radiochemical and radionuclidic purities that may be applied in Hospital's laboratories and in the quality control of generators production are developed

  12. Sorption of technetium and its analogue rhenium on bentonite material under aerobic conditions

    International Nuclear Information System (INIS)

    Koudelkova, M.; Vinsova, H.; Konirova, R.; Ernestova, M.; Jedinakova-Krizova, V.; Tereesha, M.

    2003-01-01

    The uptake of technetium on bentonite materials has been studied from the point of view of characterization of long-term radioactive elements behavior in nuclear waste repository. Bentonite R (locality Rokle, Czech Republic) and two types of model groundwater (granitic and bentonite) were selected for the sorption experiments. The aim of our research has been to find out the conditions suitable for the technetium sorption on selected bentonite under oxidizing condition. The sorption experiments with Tc-99 on bentonite have been carried out by batch method. The influence of the addition of different materials (e.g. activated carbon, graphite, Fe 2+ ) with bentonite, the effect of solid: aqueous phase ratio and a pH value on the percentage of technetium uptake and on the K d values were tested. Perrhenate was selected as an analogue of pertechnetate in non-active experiments of capillary electrophoresis (CE) and isotachophoresis (ITP). The percentage of rhenium sorbed on bentonite material was determined from the decrease of perrhenate peak area (CE) and from the shortening of the ITP zone corresponding to perrhenate. Both electromigration methods provided comparable results. The results obtained in this study with non-active material were compared to those of technetium acquired by radiometry and polarography. The 8 days kinetics of the perrhenate and pertechnetate sorption on bentonite was described mathematically with a tendency to predict long-term behavior of studied systems. (authors)

  13. Method of preparation of technetium-99m labelled radio-diagnostic agents and a stable non radio-active carrier

    International Nuclear Information System (INIS)

    1975-01-01

    A method of preparing improved technetium-99m labeled radiodiagnostic agents is described by reducing technetium-99m with stannous tartrate. Such radiodiagnostic agents are useful in scintigraphic examinations of the bone and lung

  14. Determination of technetium-99 in environmental samples: A review

    DEFF Research Database (Denmark)

    Shi, Keliang; Hou, Xiaolin; Roos, Per

    2012-01-01

    Due to the lack of a stable technetium isotope, and the high mobility and long half-life, 99Tc is considered to be one of the most important radionuclides in safety assessment of environmental radioactivity as well as nuclear waste management. 99Tc is also an important tracer for oceanographic...... research due to the high technetium solubility in seawater as TcO4−. A number of analytical methods, using chemical separation combined with radiometric and mass spectrometric measurement techniques, have been developed over the past decades for determination of 99Tc in different environmental samples....... This article summarizes and compares recently reported chemical separation procedures and measurement methods for determination of 99Tc. Due to the extremely low concentration of 99Tc in environmental samples, the sample preparation, pre-concentration, chemical separation and purification for removal...

  15. Technetium and neptunium reactions in basalt/groundwater systems

    International Nuclear Information System (INIS)

    Meyer, R.E.; Arnold, W.D.; Kelmers, A.D.; Kessler, J.H.; Clark, R.J.; Johnson, J.S. Jr.; Young, G.C.; Case, F.I.; Westmoreland, C.G.

    1985-01-01

    Sorption isotherms and apparent concentration limits for Tc(VII) and Np(V) for a variety of groundwater/basalt systems were determined using Grande Ronde basalt samples representative of the Hanford Site candidate high-level waste repository. Under oxic redox conditions (air present), little or no sorption of technetium was observed; neptunium exhibited low to moderate sorption ratios. Under anoxic redox conditions (oxygen-free), low to moderate sorption of technetium was often observed, but the extent of sorption was highly dependent upon the groundwater composition and the method of pretreatment (if any) of the basalt. Sorption isotherms for technetium under reducing redox conditions (hydrazine added) indicate an apparent concentration limit of approximately 10 -6 mol/l Tc. No apparent concentration limit was found for neptunium for concentrations in groundwater up to 10 -6 mol/l and 8 x 10 -7 mol/l under oxic and reducing (hydrazine added) redox conditions, respectively. Valence control and valence analysis experiments suggest that the sorption or precipitation of Tc and Np from groundwater in the presence of basalt may result from a heterogeneous reaction occurring on the surface of the basalt. One of the critical factors of this reduction reaction appears to be the accessibility of the reactive ferrous iron component of the basalt. The laboratory simulation of groundwater redox conditions representative of the repository environment through the use of solution phase redox reagents is of questionable validity, and information obtained by such experimental methods may not be defensible for site performance assessment calculations. Anoxic experiments conducted in an argon-filled glove box appear better suited for the laboratory simulation of in situ redox conditions. 15 references, 6 figures

  16. Technetium and neptunium reactions in basalt/groundwater systems

    International Nuclear Information System (INIS)

    Meyer, R.E.; Arnold, W.D.; Kelmers, A.D.; Kessler, J.H.; Clark, R.J.; Johnson, J.S. Jr.; Young, G.C.; Case, F.I.; Westmoreland, C.G.; Florida State Univ., Tallahassee)

    1984-01-01

    Sorption isotherms and apparent concentration limits for Tc(VII) and Np(V) for a variety of groundwater/basalt systems were determined using Grande Ronde basalt samples representative of the Hanford Site candidate high-level waste repository. Under oxic redox conditions (air present), little or no sorption of technetium was observed; neptunium exhibited low to moderate sorption ratios. Under anoxic redox conditions (oxygen-free), low to moderate sorption of technetium was often observed, but the extent of sorption was highly dependent upon the groundwater composition and the method of pretreatment (if any) of the basalt. Sorption isotherms for technetium under reducing redox conditions (hydrazine added) indicate an apparent concentration limit of approximately 10 -6 mol/L Tc. No apparent concentration limit was found for neptunium for concentrations in groundwater up to approx. 10 -6 mol/L and 8 x 10 -7 mol/L under oxic and reducing (hydrazine added) redox conditions, respectively. Valence control and valence analysis experiments suggest that the sorption or precipitation of Tc and Np from groundwater in the presence of basalt may result from a heterogeneous reaction occurring on the surface of the basalt. One of the critical factors of this reduction reaction appears to be the accessibility of the reactive ferrous iron component of the basalt. The laboratory simulation of groundwater redox conditions representative of the repository environment through the use of solution phase redox reagents is of questionable validity, and information obtained by such experimental methods may not be defensible for site performance assessment calculations. Anoxic experiments conducted in an argon-filled glove box appear better suited for the laboratory simulation of in situ redox conditions. 15 refs., 6 tabs

  17. An introduction to technetium-99m generators

    International Nuclear Information System (INIS)

    Abrashkin, S.

    1984-02-01

    The role played by technetium-99m generators in diagnostic medicine, their physical and chemical fundamentals and their main technical characteristics are discussed. This report is intended as a general introduction to a group of reports which summarize the work done on the development and production of the generators, and research on the chemical and physical aspects of the generator systems

  18. Technetium removal: preliminary flowsheet options

    International Nuclear Information System (INIS)

    Eager, K.M.

    1995-01-01

    This document presents the results of a preliminary investigation into options for preliminary flowsheets for 99Tc removal from Hanford Site tank waste. A model is created to show the path of 99Tc through pretreatment to disposal. The Tank Waste Remediation (TWRS) flowsheet (Orme 1995) is used as a baseline. Ranges of important inputs to the model are developed, such as 99Tc inventory in the tanks and important splits through the TWRS flowsheet. Several technetium removal options are discussed along with sensitivities of the removal schemes to important model parameters

  19. Immobilization of technetium and nitrate in cement-based materials

    International Nuclear Information System (INIS)

    Tallent, O.K.; McDaniel, E.W.; Del Cul, G.D.; Dodson, K.E.; Trotter, D.R.

    1987-01-01

    The leachabilities of technetium and nitrate wastes immobilized in cement-based grouts have been investigated. Factors found to affect the leachabilities include grout mix ratio, grout fluid density, dry solid blend composition, and waste concentration. 10 refs., 7 figs., 3 tabs

  20. Application of the ruthenium and technetium thermodynamic data bases used in the EQ3/6 geochemical codes

    Energy Technology Data Exchange (ETDEWEB)

    Isherwood, D.

    1985-04-01

    Based on a critical review of the available thermodynamic data, computerized data bases for technetium and ruthenium were created for use with the EQ3/6 geochemical computer codes. The technetium data base contains thermodynamic data for 8 aqueous species and 15 solids; 26 aqueous species and 9 solids were included in the ruthenium data base. The EQ3NR code was used to calculate solubility limits for ruthenium (8 x 10{sup -16} M) in ground water from Yucca Mountain, a potential nuclear waste repository site near the Nevada Test Site (NTS). The code confirmed the essentially unlimited solubility of technetium in oxidizing conditions, such as those that are believed to exist in the unsaturated zone at Yucca Mountain and the Cambric Nuclear event site at the NTS. Ruthenium migration observed from the Cambric site was evaluated. The solubility limit for ruthenium (as the aqueous species RuO{sub 4}{sup -}) when constrained by RuO{sub 2} is approximately equal to the concentration of ruthenium found in the cavity ground water (i.e., 2.1 x 10{sup -11} vs 4.5 x 10{sup -11} M). Differences in ruthenium solubility limits between Yucca Mountain and Cambric are primarily due to differences in ground-water pH. Technetium solubility (3 x 10{sup -8} M) for moderately reducing conditions (Eh = -0.1 V) using the metastable oxide, TcO{sub 2}.2H{sub 2}O, as the solubility constraint is within the range of experimental values recently published in a study of technetium sorption on basalt. Previously published technetium solubilities of 10{sup -12} to 10{sup -16} M were apparently based on a technetium data base that did not include aqueous species other than TcO{sub 4}{sup -}. When TcO(OH){sub 2}{sup 0} is included in the data base, the calculated values are much closer to the experimental results. Eh-pH diagrams were also generated for a variety of conditions using the SOLUPLOT code.

  1. Application of the ruthenium and technetium thermodynamic data bases used in the EQ3/6 geochemical codes

    International Nuclear Information System (INIS)

    Isherwood, D.

    1985-04-01

    Based on a critical review of the available thermodynamic data, computerized data bases for technetium and ruthenium were created for use with the EQ3/6 geochemical computer codes. The technetium data base contains thermodynamic data for 8 aqueous species and 15 solids; 26 aqueous species and 9 solids were included in the ruthenium data base. The EQ3NR code was used to calculate solubility limits for ruthenium (8 x 10 -16 M) in ground water from Yucca Mountain, a potential nuclear waste repository site near the Nevada Test Site (NTS). The code confirmed the essentially unlimited solubility of technetium in oxidizing conditions, such as those that are believed to exist in the unsaturated zone at Yucca Mountain and the Cambric Nuclear event site at the NTS. Ruthenium migration observed from the Cambric site was evaluated. The solubility limit for ruthenium (as the aqueous species RuO 4 - ) when constrained by RuO 2 is approximately equal to the concentration of ruthenium found in the cavity ground water (i.e., 2.1 x 10 -11 vs 4.5 x 10 -11 M). Differences in ruthenium solubility limits between Yucca Mountain and Cambric are primarily due to differences in ground-water pH. Technetium solubility (3 x 10 -8 M) for moderately reducing conditions (Eh = -0.1 V) using the metastable oxide, TcO 2 .2H 2 O, as the solubility constraint is within the range of experimental values recently published in a study of technetium sorption on basalt. Previously published technetium solubilities of 10 -12 to 10 -16 M were apparently based on a technetium data base that did not include aqueous species other than TcO 4 - . When TcO(OH) 2 0 is included in the data base, the calculated values are much closer to the experimental results. Eh-pH diagrams were also generated for a variety of conditions using the SOLUPLOT code

  2. Technetium: The First Radioelement on the Periodic Table

    Science.gov (United States)

    Johnstone, Erik V.; Yates, Mary Anne; Poineau, Frederic; Sattelberger, Alfred P.; Czerwinski, Kenneth R.

    2017-01-01

    The radioactive nature of technetium is discussed using a combination of introductory nuclear physics concepts and empirical trends observed in the chart of the nuclides and the periodic table of the elements. Trends such as the enhanced stability of nucleon pairs, magic numbers, and Mattauch's rule are described. The concepts of nuclear binding…

  3. Technetium-99m labeled radiodiagnostic agents for liver and bone marrow scanning and method of preparation

    International Nuclear Information System (INIS)

    Molinski, V.J.; Peacock, F.R.

    1977-01-01

    An improved technetium-99m labeled colloid and method of preparation comprising reducing technetium-99m with stannous oxalate and stabilizing with sodium phytate are described. This radiodiagnostic agent is useful in the scintigraphic examination of the reticuloendothelial system, particularly the liver. In addition, by autoclaving this product with saline, it becomes a superior bone marrow scanning agent

  4. Leaching of actinides and technetium from simulated high-level waste glass

    International Nuclear Information System (INIS)

    Bradley, D.J.; Harvey, C.O.; Turcotte, R.P.

    1979-08-01

    Leach tests were conducted using a modified version of the IAEA procedure to study the behavior of glass waste-solution interactions. Release rates were determined for Tc, U, Np, Pu, Am, Cm, and Si in the following solutions: WIPP B salt brine, NaCl (287 g/l), NaCl (1.76 g/1), CaCl 2 (1.66 g/l), NaHCO 3 (2.52 g/l), and deionized water. The leach rates for all elements decreased an order of magnitude from their initial values during the first 20 to 30 days leaching time. The sodium bicarbonate solution produced the highest elemental release rates, while the saturated salt brine and deionized water in general gave the lowest release. Technetium has the highest initial release of all elements studied. The technetium release rates, however, decreased by over four orders of magnitude in 150 days of leaching time. In the prepared glass, technetium was phase separated, concentrating on internal pore surfaces. Neptunium, in all cases except CaCl 2 solution, shows the highest actinide release rate. In general, curium and uranium have the lowest release rates. The range of actinide release rates is from 10 -5 to 10 -8 g/cm 2 /day. 25 figures, 7 tables

  5. Labelling of biological structures with technetium 99 m

    International Nuclear Information System (INIS)

    Bernardo Filho, M.

    1988-01-01

    The labelling of red blood cells (RBC) with technetium 99m ( 99m Tc) depends on several factors, as the stannous ion (Sn ++ ) concentration, the time and temperature of incubation, the anticoagulant utilized, the presence of plasma proteins (PP) and others. Although the blinding of 99m Tc with hemoglobin and PP are similar, they appear to have specific characteristics as demonstrated by precipitation with alcohol, acetone, trichloroacetic acid, hydrochloric acid and mercury chloride. The bacterial cultures labeled with Technetium- 99m , at optimal Sn ++ ion concentration, presents a large stability and their viability is not altered by this treatment. The electrophoretic mobility, the hydrophobicity, the cationized ferritin distribution and the adherence to human buccal epithelial cells are not modified either. The possibility of labelling with 99m Tc of planaria and cercariae of Schistossoma mansoni evaluative cycle increases the utilization of this radionuclide to an experimental level. The results described with the labelling of these biological structures with 99m Tc demonstrated that stable labeled and viable operations are obtained. (author)

  6. Transfer across the human gut of environmental technetium in lobsters (Homarus gammarus L.) from the Irish Sea

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, G.J. [The Centre for Environment, Fisheries and Aquaculture Science, Lowestoft Laboratory, Pakefield Road, Lowestoft, Suffolk NR33 0HT (United Kingdom)]. E-mail: g.j.hunt@cefas.co.uk; Young, A.K.; Bonfield, R.A. [The Centre for Environment, Fisheries and Aquaculture Science, Lowestoft Laboratory, Pakefield Road, Lowestoft, Suffolk NR33 0HT (United Kingdom)

    2001-03-01

    Few data are available on the uptake by the human gut of the element technetium. Of current radiological interest in connection with discharges of technetium-99 in liquid discharges from BNFL, Sellafield, is uptake from European lobsters (Homarus gammarus), whose edible parts are known to concentrate technetium. In this study, a group of eight adult volunteers (six males and two females) ate samples of edible flesh from lobsters caught off the west Cumbrian coast and provided 24 h samples of urine and faeces for analysis. Detection of uptake from the gut by difference between intake and faecal measurements proved insensitive, suggesting a low value of the gut transfer factor (f{sub 1} value) of up to 0.1 with a maximum (two standard deviations) level of about 0.3. In urine, technetium was detectable at a relatively low level compared with the intakes, consistent with a low absorption across the gut. Values for f{sub 1} were derived with the aid of literature data for excretion following intravenous administration of technetium-95m as pertechnetate, and gave averaged data for f{sub 1} in the range 0.046 to 0.23. These results are in broad conformity with those derived from the faecal measurements, and suggest a lower value than the 0.5 used by ICRP. (author)

  7. Biogeochemical Controls on Technetium Mobility in Biogeochemical Controls on Technetium Mobility in FRC Sediments

    International Nuclear Information System (INIS)

    Lloyd, J.R.; McBeth, J.M.; Livens, F.R.; Bryan, N.D.; Ellis, B.; Sharma, H.; Burke, I.T.; Morris, K.

    2004-01-01

    Technetium-99 is a priority pollutant at numerous DOE sites, due to its long half-life (2.1 x 10 5 years), high mobility as Tc(VII) in oxic waters, and bioavailability as a sulfate analog. 99 Tc is far less mobile under anaerobic conditions, forming insoluble Tc(IV) precipitates. As anaerobic microorganisms can reduce soluble Tc(VII) to insoluble Tc(IV), microbial metabolism may have the potential to treat sediments and waters contaminated with Tc. Baseline studies of fundamental mechanisms of Tc(VII) bioreduction and precipitation (reviewed by Lloyd et al, 2002) have generally used pure cultures of metal-reducing bacteria, in order to develop conceptual models for the biogeochemical cycling of Tc. There is, however, comparatively little known about interactions of metal-reducing bacteria with environmentally relevant trace concentrations of Tc, against a more complex biogeochemical background provided by mixed microbial communities in the subsurface. The objective of this new NABIR project is to probe the site specific biogeochemical conditions that control the mobility of Tc at the FRC (Oak Ridge, TN). This information is required for the rational design of in situ bioremediation strategies for technetium-contaminated subsurface environments. We will use a combination of geochemical, mineralogical, microbiological and spectroscopic techniques to determine the solubility and phase associations of Tc in FRC sediments, and characterize the underpinning biogeochemical controls. A key strength of this project is that many of the techniques we are using have already been optimized by our research team, who are also studying the biogeochemical controls on Tc mobility in marine and freshwater sediments in the UK in a NERC funded companion study.

  8. EPR investigations on technetium compounds

    International Nuclear Information System (INIS)

    Abram, U.; Munze, R.; Kirmse, R.; Stach, J.

    1986-01-01

    Stimulated by the widespread use of the isotope /sup 99m/Tc in the field of nuclear medicine, there has been a substantial growth of interest in the chemistry of this man-made element. A particular need emerges for analytical methods allowing solution investigations of coordination compounds of technetium with low substance use. Considering these facts, Electron Paramagnetic Resonance Spectroscopy (EPR) appears to be a very suitable method because only very small amounts of the compounds are needed (lower than 1 mg). The resulting spectra give information regarding the valence state, symmetry and bonding properties of the compounds under study

  9. Immobilization and Limited Reoxidation of Technetium-99 by Fe(II)-Goethite

    Energy Technology Data Exchange (ETDEWEB)

    Um, Wooyong; Chang, Hyun-shik; Icenhower, Jonathan P.; Qafoku, Nikolla; Smith, Steven C.; Serne, R. Jeffrey; Buck, Edgar C.; Kukkadapu, Ravi K.; Bowden, Mark E.; Westsik, Joseph H.; Lukens, Wayne W.

    2010-09-30

    This report summarizes the methodology used to test the sequestration of technetium-99 present in both deionized water and simulated Hanford Tank Waste Treatment and Immobilization Plant waste solutions.

  10. Preliminary study of the migration of technetium in soil under hydrous conditions

    International Nuclear Information System (INIS)

    Sisson, D.H.; MacLean, S.C.; Schulz, R.K.; Borg, R.J.

    1979-01-01

    The sorption of technetium compared to sodium, cesium, and strontium by a common agricultural soil was measured using a column method. As expected, no sorption of Tc occurred under conditions that substantially removed Na + , Cs + , and Sr ++ . High radioactivity levels were used to establish absorption profiles over six orders of magnitude of tracer concentration. Behavior of initially dry columns was compared with that of initially water-saturated columns; the results were not quantitatively different although there was a qualitative difference in the appearance of the profiles. Technetium tracked the moisture content of the column and hence migrated at the veloccity of the aqueous medium

  11. Technetium and diazotrophic organisms: toxicity, localization, transfer factors

    International Nuclear Information System (INIS)

    Vandecasteele, C.M.; Delmotte, A.; Roucoux, P.; Hove, C. van

    1982-01-01

    Three diazotrophic organisms, together with one leguminous organism in symbiosis with one of them, were cultivated in the presence of various quantities of technetium, of which the localization, transfer factors and toxicity were studied in relation to the age of the organisms and their type of metabolism. The paper discusses the biochemical aspects of the results. (author)

  12. Assessment of the Cast Stone Low-Temperature Waste Form Technology Coupled with Technetium Removal - 14379

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Christopher F.; Rapko, Brian M.; Serne, R. Jeffrey; Westsik, Joseph H.; Cozzi, Alex; Fox, Kevin M.; Mccabe, Daniel J.; Nash, C. A.; Wilmarth, William R.

    2014-03-03

    The U.S. Department of Energy Office of Environmental Management (EM) is engaging the national laboratories to provide the scientific and technological rigor to support EM program and project planning, technology development and deployment, project execution, and assessment of program outcomes. As an early demonstration of this new responsibility, Pacific Northwest National Laboratory (PNNL) and Savannah River National Laboratory (SRNL) were chartered to implement a science and technology program addressing low-temperature waste forms for immobilization of DOE aqueous waste streams, including technetium removal as an implementing technology. As a first step, the laboratories examined the technical risks and uncertainties associated with the Cast Stone waste immobilization and technetium removal projects at Hanford. Science and technology gaps were identified for work associated with 1) conducting performance assessments and risk assessments of waste form and disposal system performance, and 2) technetium chemistry in tank wastes and separation of technetium from waste processing streams. Technical approaches to address the science and technology gaps were identified and an initial sequencing priority was suggested. A subset of research was initiated in 2013 to begin addressing the most significant science and technology gaps. The purpose of this paper is to report progress made towards closing these gaps and provide notable highlights of results achieved to date.

  13. Environmental behavior of technetium in soil and vegetation: implications for radiological impact assessment

    International Nuclear Information System (INIS)

    Hoffman, F.O.

    1982-04-01

    Significant radiological exposures have been estimated for hypothetical atmospheric releases of Tc-99 from gaseous diffusion facilities when vegetation-to-soil concentration ratios representative of laboratory experiments are substituted for generic default values assumed in current regulatory models. To test the relevancy of these laboratory ratios, field investigations were conducted to obtain measurements of the vegetation-to-soil concentration ratio for Tc-99 in samples collected near operating gaseous diffusion facilities and to observe the dynamic behavior of technetium in soil and vegetation following a single application of a sprayed solution of /sup 95m/TcO 4 - Comparison of observed field concentration ratios and calculated steady-state concentration ratios with ratios obtained from previous laboratory experiments indicates that concentration ratios obtained from field data are one to two orders of magnitude less than those obtained from the laboratory. Furthermore, a substantial accumulation of technetium in soil and vegetation may not occur over long periods of time, since concentrations of technetium in both environmental media were observed to decrease with time subsequent to initial application of /sup 95m/TcO 4 -

  14. Review of technetium behavior in relation to nuclear waste disposal

    International Nuclear Information System (INIS)

    Paquette, J.; Reid, J.A.K.; Rosinger, E.L.J.

    1992-05-01

    This report contains available information which determine possible methods of the transfer of technetium element from waste disposal facilities to the biosphere. It also includes possible effects upon human beings and environment. 65 refs., 4 tabs., 3 figs

  15. Technetium-99 in lobsters from the western Irish sea

    International Nuclear Information System (INIS)

    Fegan, Mary

    1999-05-01

    Technetium-99, the most important radionuclide of technetium release to the environment, is a pure beta emitter with a half-life of 2.13 x 10(5) years. It behaves conservatively in seawater and is likely to remain available to biota for a long time. The dominant and most stable form of technetium in oxygenated seawater is the pertechnetate ion, Tco4. The principle source of radionuclide contamination of the Irish Sea has been the liquid waste discharges of low level radionuclide effluent from the spent nuclear fuel reprocessing plant at Sellafield on the Cumbria Coast. In 1994 the annual discharge authorization limit for 99Tc was increased from 10 TBq to 200 TBq. Lobster concentrates 99Tc to a high degree with concentration factors of 1x 10(3) reported in the literature. The mean 99Tc activity concentrations in lobsters caught close to Sellafield were reported to have risen by a factor of 20 in 2 years from 390 Bq/kg (wet weight) in 1993 to 8300 Bq/kg (wet weight) in 1995. This study was undertaken to determine the 99Tc activity concentration in lobsters from the western Irish Sea. Lobsters were collected from the east and north east coasts of Ireland over the period June 1997 to July 1998 and analysed using a radioanalytical method which was based on the anion-exchange seperation of technetium as pertechnetate. A gas-flow proportional counter was used to measure to 99Tc activity concentration in each sample. Technetium-99 activity concentrations were measured in the muscle from the tail, the right and the left claws and also in the green gland, the hepatopancreas and the cardiac fore-gut. The results of the measurements showed, as expected, that the 99Tc activity concentrations were not as high as those in the samples from the Cumbrian coast. The mean 99Tc activity concentrations, over the sampling period, in the tail, right and left claw muscles were 214, 124 and 136 BQ/kg (wet weight) respectively. The mean 99Tc activity concentrations in the green gland

  16. Preclinical evaluation of technetium 99m-labeled P1827DS for infection imaging and comparison with technetium 99m IL-8.

    NARCIS (Netherlands)

    Krause, S.; Rennen, H.J.J.M.; Boerman, O.C.; Baumann, S.; Cyr, J.E.; Manchanda, R.; Lister-James, J.; Corstens, F.H.M.; Dinkelborg, L.M.

    2007-01-01

    BACKGROUND: The technetium 99 m (99mTc)-radiolabeled, leukocyte-avid peptide-glycoseaminoglycan complex, [99mTc]P1827DS, has been synthesized as an improved infection/inflammation imaging agent to [99mTc]P483H (LeukoTect, Diatide). In a phase I/II clinical trail, [99mTc]P483H images were equivalent

  17. Automation drying unit molybdenum-zirconium gel radioisotope production technetium-99M for nuclear medicine

    International Nuclear Information System (INIS)

    Chakrova, Y.; Khromushin, I.; Medvedeva, Z.; Fettsov, I.

    2014-01-01

    Full text : Since 2001 the Institute of Nuclear Physics of the Republic of Kazakhstan has began production of radiopharmaceutical based on technetium-99m from irradiated reactor WWR-K of natural molybdenum, which allows to obtain a solution of technetium-99m of the required quality and high volume activity. In 2013 an automated system is started, which is unique and urgent task is to develop algorithms and software in Python, as well as the manufacture of certain elements of technological systems for automated production

  18. Behavior of technetium in paddy soils

    International Nuclear Information System (INIS)

    Yanagisawa, K.; Muramatsu, Y.; Ban-Nai, T.

    1997-01-01

    In order to understand the chemical form of soluble technetium in paddy soil and its availability to a rice plant, soil incubation and uptake experiments have been carried out using 95m Tc as a tracer. The chemical form of the soluble Tc was observed by gel chromatography and found not to be pertechnetate, but rather to be associated with soluble organic matter. An uptake experiment with rice seedlings using nutrient solution showed that this Tc-organic matter complex was less available than pertechnetate. (author)

  19. Technetium-99 in the Irish marine environment

    Energy Technology Data Exchange (ETDEWEB)

    Smith, V.; Fegan, M.; Pollard, D.; Long, S.; Hayden, E.; Ryan, T.P

    2001-07-01

    Technetium-99 activity concentrations in seawater and biota from Irish coastal waters are presented. Time series measurements of {sup 99}Tc in seawater and Fucus vesiculosus from the western Irish Sea show that activity concentrations have increased in line with the increase in discharges of {sup 99}Tc from Sellafield. The peak in activity concentrations in both seawater and Fucus vesiculosus occurred in 1997 approximately two years after the peak in {sup 99}Tc discharges. The highest activity concentration recorded in Fucus vesiculosus showed a 29-fold increase over the mean concentration for the period 1988-1993. Technetium-99 activity concentrations were measured in fish, lobsters, prawns, mussels and oysters landed at major fishing ports on the east and northeast coasts of Ireland between 1996 and 1998. Concentration factors for {sup 99}Tc in the brown seaweed Fucus vesiculosus and certain species of fish, crustaceans and molluscs from the Irish Sea were estimated. In general, these concentration factors were higher than those in the literature which were derived from laboratory studies, but agreed well with values which were based on field studies. The mean committed effective doses to Irish typical and heavy seafood consumers due to {sup 99}Tc in the period 1996-1998 were 0.061 and 0.24 {mu}Sv, respectively.

  20. Studies on the solvent extraction of technetium from thiocyanate solutions in mineral acids

    International Nuclear Information System (INIS)

    Ejaz, M.; Mamoon, A.M.

    1988-01-01

    Technetium-99m, separated from fission molybdenum-99 was studied as a component of liquid-liquid phase distribution equilibria. 5-(4-Pyridyl)nonane in a carrier diluent, benzene, was used to study the distribution of the nuclide from thermodynamically suitable aqueous phases of electrolytes with and without sterically receptive thiocyanate ions. Efficient extraction of the metal can be accomplished in a variety of aqueous phase compositions. The separation factors with respect to molybdenum, under certain experimental conditions, are fairly high. The data have been utilized to effect clean separations of technetium from molybdenum. (author) 39 refs.; 11 figs

  1. Diagnostic usefulness of technetium-99m (V) DMSA scintigraphy in cases of soft tissue tumors; In comparison with that of Ga-67 citrate scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Hisataka; Kotoura, Yoshihiko; Hanbara, Harumi; Hosono, Makoto; Yamamuro, Takao; Konishi, Junji (Kyoto Univ. (Japan). Faculty of Medicine)

    1994-05-01

    Technetium-99m (V) DMSA scintigraphy was performed in 76 patients with pathologically confirmed soft tissue diseases. In 56 patients, gallium-67 citrate scintigraphy was performed within two weeks after technetium-99m (V) DMSA scintigraphy. Significant uptake of technetium-99m (V) DMSA was found in all cases of sarcoma, metastatic carcinoma, progressive benignancy (extra-abdominal desmoid etc.) and granulomatous lesions, but was not found in cases of benign, solid tumors in the soft tissue (leiomyoma, neurinoma, lipoma etc.). In conclusion, it is not necessary to treat patients with soft tissue tumors in which technetium-99m (V) DMSA did not accumulate. Therefore, it can be stated that technetium-99m (V) DMSA scintigraphy is useful for the screening of malignant tumors. (author).

  2. Recognition of reversible and irreversible myocardial injury by technetium pyrophosphate extraction kinetics

    International Nuclear Information System (INIS)

    Silva, R.; Chen, Y.F.; Sell, T.L.; Lowe, J.E.; Jones, R.H.

    1987-01-01

    The need for a more accurate method of detecting episodes of myocardial ischemia during cardiac operations, particularly during the ischemic arrest interval, prompted us to investigate the usefulness of measuring the active extraction of technetium pyrophosphate in identifying and quantitating ischemic injury. Twenty-four adult mongrel dogs were subjected to cardiopulmonary bypass, and normothermic global ischemia was induced by cross-clamping the proximal aorta. Technetium pyrophosphate (1 mCi) was injected through a standard cardioplegia line with normal saline, simulating administration of cardioplegic solution, upon placement of the aortic cross-clamp (time 0), at 15, 30, 45, and 60 minutes of global ischemia, and with the onset and completion of ischemic contracture. Radioactive counts were recorded over the heart at 1 second intervals, and the extraction fraction and half-time of clearance were calculated. The extraction fraction increased from 0.22 at time 0 to 0.58 at 15 minutes, 0.82 at 30 minutes, 0.85 at 45 minutes, and 0.91 at 60 minutes. The halftime increased from a baseline of 114 seconds (time 0) to a maximum of 321 seconds at 60 minutes of ischemia. The onset and completion of ischemic contracture showed a return toward baseline of both the extraction fraction and halftime of clearance, with an extraction fraction of 0.44 and 0.46 and a halftime of 135 and 133 seconds, respectively. These data clearly show that reversible myocardial injury increased the extraction and reduced the clearance of technetium pyrophosphate and that the magnitude of change related to the extent of injury. The progression to irreversible myocardial injury decreased the active extraction of technetium pyrophosphate. This simple procedure for real-time documentation of myocardial injury promises to provide easily obtainable endpoints of injury for use during cardiac operations in humans

  3. Detection of pulmonary hemorrhage with technetium-labeled red cells

    International Nuclear Information System (INIS)

    Winzelberg, G.G.; Laman, D.; Sachs, M.; Miller, W.H.

    1981-01-01

    Noninvasive techniques to aid in the diagnosis of massive pulmonary hemoptysis would be helpful in guiding more-invasive procedures such as bronchial artery angiography, which carries a risk of transverse myelitis. A patient was studied with technetium-labeled red cells and successfully detected a site of intermittent hemorrhage from the lung

  4. Studies in technetium chemistry, Project 1: Evaluation of technetium acetylacetonates as potential cerebral blood flow agents, Project 2

    International Nuclear Information System (INIS)

    Jones, A.G.; Packard, A.B.; Treves, S.; Davison, A.

    1990-01-01

    Although the emphasis in our original submission was on N 2 S 2 and N 3 S coordinating ligands in technetium(V), we have now broadened the chemistry studies into areas that encompass new systems that allow the generation of neutral complexes. This change was based upon developments that have taken place in our basic chemistry studies that could bear on one of the original aims of this work, i.e., the design of complexes designed to penetrate cellular membranes and to remain trapped in target tissues. Among these topics are oxotechnetium(V) complexes containing amine and alcoholate ligands, coordination compounds containing the alternative technetium(V) nitrido core and the synthesis at macroscopic levels of a tetradentate ''umbrella'' ligand that successfully binds the metal. Basic studies with the original bisamide-bisthiol ligand system have continued with the identification of the products formed when aqueous solutions of the complex [TcO(ema)] - are acidified. This material is isolatable as yellow/brown crystals when HCl is added to the tetraphenylarsonium salt of the complex synthesized according to published procedures. Elemental analysis, FAB(+) mass spectrometry and 1 H NMR results were consistent with the formulation TcO(ema)H. Infrared spectra showed a dramatic shift in the Tc = O stretch to 966 cm -1 , as distinct from 945 cm -1 in the original complex

  5. The sorption of uranium and technetium on bentonite, tuff and granodiorite

    International Nuclear Information System (INIS)

    Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Cowper, M.M.; Heath, T.G.; Tweed, C.J.

    1995-01-01

    A combined experimental and modeling study of the sorption of uranium and technetium on geological materials has been carried out as part of the PNC program to increase confidence in the performance assessment for a high-level radioactive waste (HLW) repository in Japan. Batch sorption experiments have been performed in order to study the sorption of uranium and technetium onto bentonite, tuff and granodiorite from both equilibrated seawater and de-ionized water under strongly-reducing and non-reducing conditions. A preliminary study of the sorption of uranium on mineral surfaces in granodiorite has also been undertaken using a nuclear microprobe. Mathematical modeling using the geochemical speciation program HARPHRQ in conjunction with the HATCHES database has been carried out in order to interpret the results of the sorption experiments

  6. Clinical usefulness of scintigraphy with 99mTechnetium phosphates in rhabdomyolysis

    International Nuclear Information System (INIS)

    Aizawa, Nobuyuki; Hara, Yoshikuni; Suzuki, Yutaka; Akashi, Tsunehiro; Kamei, Tetsumasa; Uchiyama, Fujio; Mitsui, Tamito; Yamazaki, Yuki.

    1990-01-01

    We performed bone scans with 99m Technetium phosphates in 15 cases of clinically suspected rhabdomyolysis admitted to Chigasaki Tokushukai Hospital. Whole body scans were performed within 5 days from the onset of illness or admission. Accumulation of the radioactivity in the skeletal muscle was revealed in 13 of the 15 cases and the involved muscle groups were visualized vividly. Etiologies of rhabdomyolysis were diverse, ranging from malignant syndrome to sepsis. Myocardial concentration was absent in all of the cases. Renal concentration of the isotope was seen in cases where the degree of rhabdomyolysis was higher and renal impairment was present. We conclude that 99m Technetium phosphate bone scan is useful in clinically suspected rhabdomyolysis as a diagnostic test and as a test to localize and quantitate the muscular involvement. (author)

  7. Sorption of technetium on composite chitosan-hydroxyapatite from aqueous solutions

    International Nuclear Information System (INIS)

    Pivarciova, L.; Rosskopfova, O.; Galambos, M.; Rajec, P.

    2013-01-01

    Biomaterials such as natural polymers (chitosan) and hydroxyapatite have an important application in material for bone replacement. Most of chitosan/hydroxyapatite composites are prepared by mixing hydroxyapatite particles with chitosan matrices. Another method of preparation of chitosan/hydroxyapatite composite is in-situ generation of nano-hydroxyapatite in chitosan matrix. The most common biomaterial used in the past years in hard tissue regeneration was hydroxyapatite, owing to its properties as biocompatibility, bioactivity, non-toxicity, non-immunogenicity etc. Chitosan is a polyaminosacharide, partially deacetylated product of chitin. Chitosan can be used in combination with other materials to enhance bone growth such as bone filling paste. The aims of this work were: the influence of the contact time on sorption of pertechnate anions on chitosan/hydroxyapatite composites; the effect of pH on sorption of pertechnate anions on chitosan/hydroxyapatite composites; the effect of foreign ions on sorption of pertechnate anions on chitosan/hydroxyapatite composites. The author concluded: the percentage of technetium sorption after 1 hour of contact time was > 97 %. In the initial pH range of 2.9-10.2, the percentage of technetium sorption on chitosan/hydroxyapatite composites CH/HA(A), CH/HA(B), CH/HA 30:70, ZCH was > 98 % and on CH/HA 50:50 was > 94%. The competition effect of Fe 2+ towards TcO 4 :- sorption is stronger than competition effect of other observed cations for all examined composites with the same weight ratio. The percentage of the technetium sorption was the same for all composites with the weight ratio of 30:70. (authors)

  8. Effects of concurrent drug therapy on technetium /sup 99m/Tc gluceptate biodistribution

    International Nuclear Information System (INIS)

    Hinkle, G.H.; Basmadjian, G.P.; Peek, C.; Barker, K.K.; Ice, R.D.

    1982-01-01

    Drug interactions with /sup 99m/Tc gluceptate resulting in altered biodistribution were studied using chart review and animal tests. Charts of nine patients who had abnormal gallbladder uptake of technetium /sup 99m/Tc gluceptate during a two-year period were reviewed to obtain data such as concurrent drug therapy, primary diagnosis, and laboratory values. Adult New Zealand white rabbits were then used for testing the biodistribution of technetium /sup 99m/Tc gluceptate when administered concurrently with possibly interacting drugs identified in the chart review--penicillamine, penicillin G potassium, penicillin V potassium, acetaminophen, and trimethoprim-sulfamethoxazole. Chart review revealed no conclusive patterns of altered biodistribution associated with other factors. The data did suggest the possibility that the five drugs listed above might cause increased hepatobiliary clearance of the radiopharmaceutical. Animal tests showed that i.v. penicillamine caused substantial distribution of radioactivity into the gallbladder and small bowel. Minimally increased gallbladder radioactivity occurred when oral acetaminophen and trimethoprim-sulfamethoxazole were administered concurrently. Oral and i.v. penicillins did not increase gallbladder activity. Penicillamine may cause substantial alteration of the biodistribution of technetium /sup 99m/Tc gluceptate

  9. Determination of technetium-99 in environmental samples: A review

    International Nuclear Information System (INIS)

    Shi Keliang; Hou Xiaolin; Roos, Per; Wu Wangsuo

    2012-01-01

    Highlights: ► The source term, physicochemical properties, environmental distribution and behaviour of 99 Tc are presented. ► Various sample pre-treatment and pre-concentration techniques of technetium are discussed. ► Chemical separation and purification techniques for 99 Tc in environmental samples are reviewed. ► Measurement techniques for 99 Tc in environmental level and automated analytical methods are reviewed. ► The reported analytical methods of 99 Tc are critically compared to provide overall information. - Abstract: Due to the lack of a stable technetium isotope, and the high mobility and long half-life, 99 Tc is considered to be one of the most important radionuclides in safety assessment of environmental radioactivity as well as nuclear waste management. 99 Tc is also an important tracer for oceanographic research due to the high technetium solubility in seawater as TcO 4 − . A number of analytical methods, using chemical separation combined with radiometric and mass spectrometric measurement techniques, have been developed over the past decades for determination of 99 Tc in different environmental samples. This article summarizes and compares recently reported chemical separation procedures and measurement methods for determination of 99 Tc. Due to the extremely low concentration of 99 Tc in environmental samples, the sample preparation, pre-concentration, chemical separation and purification for removal of the interferences for detection of 99 Tc are the most important issues governing the accurate determination of 99 Tc. These aspects are discussed in detail in this article. Meanwhile, the different measurement techniques for 99 Tc are also compared with respect to advantages and drawbacks. Novel automated analytical methods for rapid determination of 99 Tc using solid extraction or ion exchange chromatography for separation of 99 Tc, employing flow injection or sequential injection approaches are also discussed.

  10. Biomedical tracers: technetium-99 m complexing sulfur polydentate ligands

    International Nuclear Information System (INIS)

    Bendennoune, A.

    1994-01-01

    Cyclic and acyclic tetra sulfur ligands have been synthesized and some of them have been labelled with technetium-99m. These works have two different aims: 1- Development of methods permitting to obtain easily potential technetium complexing sulfur polydentate chelates. 2- Research of positive and neutral complexes of this metal likely to replace thalium-201 in the coronary flow estimation and [TcO-HMPAO] sup 0 complex in the cerebral scintigraphy, respectively. In this work, first, different ways for obtaining dithioetherdithiols and cyclic tetrathioethers containing functional groups have been carried out, then complexation of the core of nitrutechnetium (TcN) sup 2+ at tracers scale, by dithioetherdithiols, using exchange reaction with [sup 9 sup 9 sup m TcNCl sub 4 ] sup - ion complex or sup 99 sup m TcN Cl sub 2 [P(CH sub 2 CH sub 2 CN) sub 3 ] sub 2 has been studied. Finally, biological distribution in swiss mouse of these technetiated complexes has been studied. 135 refs., 30 figs., 13 tabs. (F.M.)

  11. Analysis of americium, plutonium and technetium solubility in groundwater

    International Nuclear Information System (INIS)

    Takeda, Seiji

    1999-08-01

    Safety assessments for geologic disposal of radioactive waste generally use solubilities of radioactive elements as the parameter restricting the dissolution of the elements from a waste matrix. This study evaluated americium, plutonium and technetium solubilities under a variety of geochemical conditions using the geochemical model EQ3/6. Thermodynamic data of elements used in the analysis were provided in the JAERI-data base. Chemical properties of both natural groundwater and interstitial water in buffer materials (bentonite and concrete) were investigated to determine the variations in Eh, pH and ligand concentrations (CO 3 2- , F - , PO 4 3- , SO 4 2- , NO 3 - and NH 4 + ). These properties can play an important role in the complexation of radioactive elements. Effect of the groundwater chemical properties on the solubility and formation of chemical species for americium, plutonium and technetium was predicted based on the solubility analyses under a variety of geochemical conditions. The solubility and speciation of the radioactive elements were estimated, taking into account the possible range of chemical compositions determined from the groundwater investigation. (author)

  12. 49 CFR 110.110 - After-grant requirements.

    Science.gov (United States)

    2010-10-01

    ... PUBLIC SECTOR TRAINING AND PLANNING GRANTS § 110.110 After-grant requirements. The Associate... must submit all financial, performance, and other reports required as a condition of the grant, within...

  13. Evaluation of reflux oesophagitis with technetium-99m-labelled ...

    African Journals Online (AJOL)

    Sucralfate binds with denuded protein to form a stable complex to protect the damaged mucosa. By utilising this property, technetium-99m-labelled sucraJfate can be used to demonstrate ulceration in the upper gastro-intestinal tract. Aim: The aim of this study was to evaluate 99mTc-labelled sucralfate in the diagnosis of ...

  14. Membrane-based separation technologies for cesium, strontium, and technetium

    International Nuclear Information System (INIS)

    Kafka, T.

    1996-01-01

    This work is one of two parallel projects that are part of an ESP task to develop high-capacity, selective, solid extractants for cesium, strontium, and technetium from nuclear wastes. In this subtask, Pacific Northwest National Laboratory (PNNL) is collaborating with 3M, St. Paul, Minnesota, working in cooperation with IBC Advanced Technologies, American Fork, Utah

  15. Technetium-99m-labeled annexin V imaging for detecting prosthetic joint infection in a rabbit model.

    Science.gov (United States)

    Tang, Cheng; Wang, Feng; Hou, Yanjie; Lu, Shanshan; Tian, Wei; Xu, Yan; Jin, Chengzhe; Wang, Liming

    2015-05-01

    Accurate and timely diagnosis of prosthetic joint infection is essential to initiate early treatment and achieve a favorable outcome. In this study, we used a rabbit model to assess the feasibility of technetium-99m-labeled annexin V for detecting prosthetic joint infection. Right knee arthroplasty was performed on 24 New Zealand rabbits. After surgery, methicillin-susceptible Staphylococcus aureus was intra-articularly injected to create a model of prosthetic joint infection (the infected group, n = 12). Rabbits in the control group were injected with sterile saline (n = 12). Seven and 21 days after surgery, technetium-99m-labeled annexin V imaging was performed in 6 rabbits of each group. Images were acquired 1 and 4 hours after injection of technetium-99m-labeled annexin V (150 MBq). The operated-to-normal-knee activity ratios were calculated for quantitative analysis. Seven days after surgery, increased technetium-99m-labeled annexin V uptake was observed in all cases. However, at 21 days a notable decrease was found in the control group, but not in the infected group. The operated-to-normal-knee activity ratios of the infected group were 1.84 ± 0.29 in the early phase and 2.19 ± 0.34 in the delay phase, both of which were significantly higher than those of the control group (P = 0.03 and P = 0.02). The receiver operator characteristic curve analysis showed that the operated-to-normal-knee activity ratios of the delay phase at 21 days was the best indicator, with an accuracy of 80%. In conclusion, technetium-99m-labeled annexin V imaging could effectively distinguish an infected prosthetic joint from an uninfected prosthetic joint in a rabbit model.

  16. 3. Congress of the SA Society of nuclear medicine: Technetium-99m technology

    International Nuclear Information System (INIS)

    Beyers, M.

    1988-08-01

    The Atomic Energy Corporation of SA Limited have been engaged in the manufacture of radioisotopes since 1967, shortly after the SAFARI-1 reactor at Pelindaba was commissioned. Since then the use of radioisotopes in South Africa has grown rapidly and at present 95% of the in vivo diagnostic radioisotopes (radiopharmaceuticals) utilized in nuclear medicine are manufactured locally. Because radioisotopes are applied mainly in sophisticated chemically or mechanically processed forms, production requires not only a skilled production team, but also the appropriate facilities for the manufacture of high-quality products which comply with the necessary safety standards. Compliance with such standards is especially important for the routine production of radiopharmaceuticals for use in nuclear medicine. Over the past 20 years technetium-99m has achieved a dominant position among the diagnostic tools in modern nuclear medicine.The scope of nuclear medicine is expanding continuously and its future lies primarily in the development of new organspecific technetium-99m radiodiagnostic agents. Many improvements and changes have been made to Tc-99m generators, the major source of Tc-99m, since they were introduced to nuclear medicine in the late 1950's. The new Peltek-F sterile Tc-99m generator developed by the Isotope Production Centre is a symbol of progress made. In order to commemorate the launching of the new Peltek-F technetium-99m generator during August 1988 it was decided to publish six papers that were presented at the Third Congress of the Society of Nuclear Medicine held at Bloemfontein during the period 15 - 17 August 1988 by members of the Isotope Production Centre. This will serve as a useful reference on various aspects of technetium-99m technology and will stimulate the use of this product as well as new research in this field

  17. Preoperative localization of parathyroid adenomas by technetium and thallium double-labeling scintigraphy. Difficulties linked to associated thyroid lesions

    International Nuclear Information System (INIS)

    Valensi, P.; Attali, J.R.; Sebaoun, J.; Bedig, G.; Paycha, F.; Tellier, P.; Vulpillat, M.; Sarfati, E.; Dubost, C.

    1989-01-01

    Technetium and thallium double-labeling scintigraphy with image subtraction was carried out on 63 patients suspected of having primary hyperparathyroidism, with or without thyroid involvement. Forty-four patients had a normal thyroid image with technetium. The positive foci located by double-labeling in patients who were to undergo surgery always coincided with parathyroid adenoma. In the 16 cases where the initial diagnosis of hyperparathyroidism was not substantiated, the double-labeling test was normal. Thus for these 44 patients, scintigraphy sensitivity was 75% and specificity was 100%. Nineteen patients had an abnormal thyroid image with technetium. In 7 cases, image subtraction following double-labeling yielded uninterpretable data. In 12 other patients, the positive foci located outside the thyroid by double-labeling coincided with a parathyroid adenoma, whereas this was true for only one patient whose positive foci were located inside the thyroid; a parathyroid adenoma was not detected preoperatively in 4 patients. This double-labeling test is thus useful in locating parathyroid adenomas when technetium scintigraphy of the thyroid is normal; when it is abnormal, double-labeling is advantageous only in cases of extrathyroid foci [fr

  18. 99m Technetium pyrophosphate myocardium scintigraphy. First results

    International Nuclear Information System (INIS)

    Toussaint, Paul.

    1976-01-01

    99m technetium pyrophosphate myocardium scintigraphy is a very recent examination technique. This work gives the results obtained on 61 patients. As a vector of the isotope, pyrophosphate has the advantage over polyphosphate of a fast bone uptake there it should be stressed that a 90 minute pause is necessary between the intraveinous injection of the isotope and the photographic recording so that the reading is not troubled by the labelled intracardiac blood pool image, an image quality criterion being the estimation of a good costal fixation which in fact appears sooner or later according to the subject. The role of pyrophosphate, chelator of calcium in fixation of the isotope on the myocardium, could be explained by the fast appearance of 'dense bodies', made up of calcium hydroxyapathice crystals, in the mitochondria of myocardium cells having undergone an irreversible necrotic process. The choice of 99 m technetium is based on its ease of use: 6 hour half-life, high-energy pure gamma emission at 140 keV. The fixed image studied under two incidences, front and left anterior oblique, is obtained from mobile images given by the scintillation camera used in connection with a data processing system. Several facts are underlined, explaining the disadvantages, advantages and indications of the method [fr

  19. A neutral lipophilic technetium-99m complex for regional cerebral blood flow imaging

    International Nuclear Information System (INIS)

    Narra, R.K.; Nunn, A.D.; Kuczynski, B.L.; DiRocco, R.J.; Feld, T.; Silva, D.A.; Eckelman, W.C.

    1990-01-01

    Technetium-99m-DMG-2MP (Chloro[bis[2,3-butanedionedioxime(1-)-0][2,3- butanedionedioximato (2-)-N,N',N double-prime,N'double-prime,N double-prime double-prime,N'double-prime double-prime] (2-methylpropyl borato (2-))technetium]), also known as SQ 32097 is a member of a family of neutral lipophilic compounds generally known as boronic acid adducts of technetium dioxime complexes (BATOs). After i.v. administration, the concentration of [ 99m Tc]DMG-2MP in various regions of the brain appears to be proportional to blood flow. In rats, 1.1% ID was in the brain at 5 min postinjection when the blood contained less than 3% ID. Over 24 hr excretion was 59% in the feces and 23% in the urine. The activity in monkey brain at 5 min was 2.8% ID and it cleared with a t1/2 of 86 min. Autoradiographs of monkey brain sections showed excellent regional detail with a gray/white ratio of 3.6 at 10 min. The distribution of [ 99m Tc]DMG-2MP in the monkey brain corresponds to the known cytoarchitectural pattern of cerebral glucose metabolism. The properties of [ 99m Tc]DMG-2MP make it a potentially useful agent for cerebral perfusion imaging in man

  20. Technetium-99m labeled radiodiagnostic agents and method of preparation

    International Nuclear Information System (INIS)

    1976-01-01

    A method of preparing improved technetium-99m labelled radiodiagnostic agents by reducing sup(99m)Tc-pertechnetate with stannous tartrate is given. Human serum albumine (HSA) and 1-hydroxyethylidene-1,1-disodiumphosphonate (HEDSPA), which are useful in scintigraphic examinations of the lung and bone, were labelled in this way

  1. Fast technetium Eigen-colloid determination: preparative CPC combined with suspension liquid scintillation

    International Nuclear Information System (INIS)

    Breynaert, E.; Maes, A.

    2005-01-01

    Full text of publication follows: Both medical and environmental studies concerned with the solubility and the complexation chemistry of technetium have encountered colloidal Tc(IV)-forms. Although the existence of the Tc colloids has been proven by various techniques [1-6], their determination still remains an issue. Recently a Column Precipitation Chromatography (CPC) technique was developed which enabled the quantitative determination of technetium Eigen-colloids. Based on this technique, a solid phase extraction (SPE)-like methodology was developed that can be used in combination with suspension liquid scintillation to provide a fast analysis of the Eigen-colloid content of a sample. The CPC technique is a thorough analysis methodology for the quantitative determination of the Eigen-colloid content of a sample containing reduced technetium species. This technique requires a relative long elution scheme and fractionation of the eluate. The fractionation also implies a relatively long counting time to determine the Eigen-colloid activity of a sample. Currently an SPE-like analysis methodology was developed which combines a good estimate of the Eigen-colloid content with fast analysis times. To construct a methodology providing both features a specialized extraction apparatus was constructed and a quantitative suspension liquid scintillation technique was developed. This combination enables the Eigen-colloid determination within a short experimental time (15 min) and a limited counting time (60 min). The authors acknowledge a grant from KULeuven University and financial support from the KULeuven Geconcerteerde Onderzoeksacties (GOA2000/007). We also kindly acknowledge NIRAS/ONDRAF for financial support from Contract CCHO 20004004862 [1] Grossmann, B. and R. Muenze, Relationship between complex formation by 99 Tc(IV) and the chemical structure of aliphatic carboxylic acid ligands. The International Journal of Applied Radiation and Isotopes, 1982. 33(3): p. 189

  2. Detection of unstable angina by /sup 99m/technetium pyrophosphate myocardial scintigraphy

    International Nuclear Information System (INIS)

    Abdulla, A.M.; Canedo, M.I.; Cortez, B.C.; McGinnis, K.D.; Wilhelm, S.K.

    1976-01-01

    /sup 99m/Technetium stannous pyrophosphate has been shown to accumulate in acutely infarcted myocardium. To determine if the isotope is also taken up by severely ischemic, but not necrotic myocardium, we performed myocardial scintigraphic studies in 17 patients with chest pains. Seven of the patients satisfied conventional clinical, electrocardiographic, and laboratory criteria for the diagnosis of unstable angina and showed no electrocardiographic or enzymatic evidence of myocardial necrosis. Five of these seven patients with unstable angina demonstrated abnormal localized patterns, and one showed a borderline picture. Myocardial scintiscans were normal in all of a control group of ten patients with stable angina. Thus, scanning with /sup 99m/technetium stannous pyrophosphate is shown to be of value in the objective demonstration of myocardial abnormality in unstable angina

  3. Clinical usefulness of scintigraphy with sup 99m Technetium phosphates in rhabdomyolysis

    Energy Technology Data Exchange (ETDEWEB)

    Aizawa, Nobuyuki; Hara, Yoshikuni (Shonan Kamakura Hospital, Kanagawa (Japan)); Suzuki, Yutaka; Akashi, Tsunehiro; Kamei, Tetsumasa; Uchiyama, Fujio; Mitsui, Tamito; Yamazaki, Yuki

    1990-08-01

    We performed bone scans with {sup 99m}Technetium phosphates in 15 cases of clinically suspected rhabdomyolysis admitted to Chigasaki Tokushukai Hospital. Whole body scans were performed within 5 days from the onset of illness or admission. Accumulation of the radioactivity in the skeletal muscle was revealed in 13 of the 15 cases and the involved muscle groups were visualized vividly. Etiologies of rhabdomyolysis were diverse, ranging from malignant syndrome to sepsis. Myocardial concentration was absent in all of the cases. Renal concentration of the isotope was seen in cases where the degree of rhabdomyolysis was higher and renal impairment was present. We conclude that {sup 99m}Technetium phosphate bone scan is useful in clinically suspected rhabdomyolysis as a diagnostic test and as a test to localize and quantitate the muscular involvement. (author).

  4. Advances in technetium chemistry towards 99mTc receptor imaging agents

    International Nuclear Information System (INIS)

    Johannsen, B.; Spies, H.

    1997-01-01

    The development of the chemistry of technetium and its non-radioactive surrogate rhenium has been prompted by the trends and needs of nuclear medicine, which predominantly uses 99m Tc radiopharmaceuticals for a broad range of diagnostics. Technetium-99m is the ideal radioisotope for tomographic single-photon emission tomography (SPECT) imaging due to its nuclear properties (6.2 h, E γ 140 keV) and ready availability through generator systems. Transition metals offer many opportunities for designing molecules by modifying the environment around the core, allowing certain biological properties to be imposed upon the molecule. Whereas research in the past was mainly concerned with biological properties that allow relatively unspecific functional imaging, as in brain or myocardium perfusion studies, nuclear medicine is now requiring more and more biochemical information on low capacity, high specificity targets. Many research groups have become involved in the search for new technetium-based compounds, called the third generation of 99m Tc radiopharmaceuticals, that employ the principles of modern pharmacology to achieve biochemical specificity. There has been considerable interest in imaging CNS and other receptors with 99m Tc receptor-binding ligands. Such a 99m Tc CNS receptor-imaging agent is currently not yet in use because of the significant hurdles to be overcome in attaining this ambitious goal. However, some Tc and Re complexes of remarkable affinity in vitro, and the first high-affinity 99m Tc probes able to label the dopamine transporter in the brain by SPECT imaging prove the feasibility of this approach. (Author)

  5. Technetium-99m-Sestamibi in the diagnosis of acute chest pain

    International Nuclear Information System (INIS)

    Gilleece, T.; Salehi, N.; Better, N.

    1998-01-01

    Full text: A 45-year-old male was admitted to coronary care with a two-day history of recurrent chest pain. Despite maximal medical therapy, pain persisted. Examination and ECG with pain, were normal, suspicion of ischaemia was moderately high but coronary angiography was not immediately available. Technetium-99m-Sestamibi was prepared at the start of the day according to the standard preparation protocol (Du Pont). Coronary Care informed the Nuclear Medicine Department immediately the patient experienced a further episode of chest pain. Technetium-99m-Sestamibi was administered in coronary care, 4.30 minutes after being advised of the onset of further chest pain. Images were acquired 60 minute post-injection; 15 minutes after the patient had been given 200 mL of milk. A triple-headed gamma camera was used to acquire SPECT images over a 1200 arc, 30 frames of 30 seconds using a 64 x 64 matrix. The patient was laying prone with arms raised out of the field of view. Images showed a normal distribution of technetium-99m -Sestamibi throughout the myocardium. Due to ongoing clinical suspicion by the treating physician, coronary angiography was subsequently performed. This showed normal coronary arteries. Medical therapy was ceased and the patient discharged the next day. We concluded that the chest pain at the time of injection was not ischaemic. Previous trials had shown a 95% sensitivity for this method of diagnosing ischaemia. This method permits a novel and simple technique for diagnosing myocardial ischaemia and obviating the need for cardiac catheterization in this group of patients

  6. Determination of technetium by total reflection x-ray fluorescence

    International Nuclear Information System (INIS)

    Bermudez, J.I.; Greaves, E.D.; Nemeth, P.

    2000-01-01

    We describe a technique using total reflection x-ray fluorescence (TXRF) for determination of Technetium produced by elution of chromatography generators with physiological saline solutions. The analysis with the 18.41 keV K α line of Technetium was accomplished with monochromatized K α radiation from a silver anode x-ray tube operated at 45 keV and 20 mA. This radiation at 22.104 keV is efficiently coupled to the 21.054 keV absorption edge of Tc. It is also of advantage in the direct analysis of organic and saline properties of the Tc-bearing samples. Quantification was accomplished by internal standard addition of Ga and using an interpolated value of the sensitivity for Tc between Molybdenum and Rhenium. Data processing was carried out with the QXAS-AXIL software package. System sensitivity was found adequate for direct Tc determination of eluted saline solutions. The interest and advantages of the use of the technique as an auxiliary in the synthesis and characterization of Tc-labeled radiopharmaceuticals used for diagnosis in nuclear medicine are discussed. Detection limits in the matrices analyzed are reported. (author)

  7. Determination of degradation conditions of exchange resins containing technetium

    International Nuclear Information System (INIS)

    Rivera S, A.; Monroy G, F.; Quintero P, E.

    2014-10-01

    The quantification of Tc-99 in spent exchange resins, coming from nuclear power plants, is indispensable to define their administration. The Tc-99 is a pure beta emitter of 210000 years of half-life, volatile and of a high mobility in water and soil. For this reason, the objective of this work is to establish a digestion method of ionic exchange resins containing technetium that retains more than 95% of this radioisotope. Mineralization tests were carried out of a resin Amberlite IRN-150 by means of an oxidation heat, in acid medium, varying the resin mass, the medium volume, the media type, the temperature and the digestion time. The digested samples were analyzed by gas chromatography to estimate the grade of their degradation. The 99m Tc was used as tracer to determine the technetium percentage recovered after mineralizing the resin. The digestion process depends on the temperature and the resin mass. At higher temperature better mineralization of samples and to greater resin mass to a constant temperature, less degradation of the resin. The spectra beta of the 99m Tc and 99 Tc are presented. (Author)

  8. Technetium compounds

    International Nuclear Information System (INIS)

    Murphy, C.A. de; Ferro F, G.

    2003-01-01

    The first radiopharmaceuticals of 99m Tc, also call of 'first generation' as colloids, aggregates and simple complexes were developed with relative easiness without it was necessary a wide understanding of its chemical structure. In the radiopharmaceuticals of 'second generation' were included those derived of the HIDA for hepatobiliary images, MAG3 and EC for images of tubular renal de purification, HMPAO and ECD for images of cerebral perfusion and MIBI and tetrofosmin for images of heart perfusion, that which implies a bigger demand in terms of the chemical knowledge. At the moment, we can affirm that the future of the radiopharmaceuticals of 99m Tc is based on the use of small and relevant biomolecules with high biological activity that allow the visualization in vivo of specific receiving sites and/or its expression in diverse pathologies. It is for it that with the 'third generation' is necessary a wide one knowledge of the chemistry of the technetium that allows the design and characterization of highly specific bio complexes. In this book, although focused mainly to the chemistry of the Tc, a brief revision is also presented on the main biologically active molecules that, coordinated the 99m Tc, present a high recognition In vivo for specific receivers. (Author)

  9. Technetium-99m-human fibrinogen

    International Nuclear Information System (INIS)

    Wong, D.W.; Mishkin, F.S.

    1975-01-01

    Exogenous fibrinogen has been successfully labeled with /sup 99m/Tc using a modified electrolytic method. The exact labeling mechanism has not been determined. Experimental data suggest that the labeling process of /99m/Tc-fibrinogen is quite similar to that of /sup 99m/Tc-human serum albumin as reported earlier by Benjamin. Technetium-99m-fibrinogen is stable in human plasma or in 1 percent buffered human serum albumin. A binding efficiency of 76 percent has been achieved with approximately 25 percent clottable protein. The entire labeling procedure requires less than 1 hr of preparation time. This short labeling time in a closed system may allow development of a practical method for labeling autologous fibrinogen, thus eliminating the risk of hepatitis transmission. (U.S.)

  10. Removal of technetium from alkaline nuclear-waste media by a solvent-extraction process using crown ethers

    International Nuclear Information System (INIS)

    Bonnesen, P.V.; Presley, D.J.; Haverlock, T.J.; Moyer, B.A.

    1995-01-01

    Crown ethers dissolved in suitably modified aliphatic kerosene diluents can be employed to extract technetium as pertechnetate anion (TcO 4 - ) with good extraction ratios from realistic simulants of radioactive alkaline nitrate waste. The modifiers utilized are non-halogenated and non-volatile, and the technetium can be removed from the solvent by stripping using water. The crown ethers bis-4,4'(5')[(tert-butyl)cyclohexano]-18-crown-6 (di-t-BuCH18C6) and dicyclohexano-18-crown-6 (DCH18C6) provide stronger TcO 4 - extraction than dicyclohexano-21-crown-7 and 4-tert-butylcyclohexano 15-crown-5. Whereas DCH18C6 provides somewhat higher TcO 4 - extraction ratios than the more lipophilic di-t-BuCH18C6 derivative, the latter was selected for further study owing to its lower distribution to the aqueous phase. Particularly good extraction and stripping results were obtained with di-t-BuCH 18C6 at 0.02 M in a 2:1 vol/vol blend of tributyl phosphate and Isopar reg-sign M. Using this solvent, 98.9% of the technetium contained (at 6 x 10 -5 M) in a Double-Shell Slurry Feed (DSSF) Hanford tank waste simulant was removed following two cross-current extraction contacts. Two cross-current stripping contacts with deionized water afforded removal of 99.1% of the technetium from the organic solvent

  11. Extraosseous uptake of 99sup(m)technetium methylene diphosphonate

    International Nuclear Information System (INIS)

    Sty, J.R.; Kun, L.; Casper, J.; Babbitt, D.P.

    1980-01-01

    A child with a ganglioneuroblastoma and tumor uptake of 99 sup(m)technetium methylene diphosphate ( 99 sup(m)Tc-MDP) is presented. After surgical removal of an encapsulated tumor and radiation therapy, an interval bone scan demonstrated the same presurgical abnormality. Awareness of abnormal uptake of 99 sup(m)Tc-MDP in irradiated renal tissue prevents interpreting radiation nephritis as recurrent tumor. (orig.) [de

  12. Mew organometallic complexes of technetium in different oxidation states

    International Nuclear Information System (INIS)

    Joachim, J.E.

    1993-09-01

    New organometallic compounds of Tc(I), Tc(III) and Tc(VII) were synthesized and their properties examined. These compounds were correlated with their homologous compounds of manganese and rhenium, which were also synthesized by the same route. The molecular and crystal structures of most technetium complexes and of the homologous complexes of manganese and rhenium were determined by single crystal X-ray diffraction. (orig.) [de

  13. Removal of Technetium, Carbon Tetrachloride, and Metals from DOE Properties - Final Report

    International Nuclear Information System (INIS)

    Mallouk, Thomas E.; Ponder, S.M.

    2000-01-01

    This research is a three year project involving close collaboration between chemists at Pennsylvania State University and materials scientists at Pacific Northwest National Laboratory (PNNL). The goal of the project is the development and characterization of supported reducing agents, and solid waste forms derived from them, which will be effective in remediation of aqueous wastes. The work follows the recent discovery that zero-valent metals, such as iron, are effective decontaminants for waste streams containing chlorinated hydrocarbons. Preliminary data, obtained at Penn State and elsewhere, have shown that the same strategy will be effective in reducing soluble compounds containing toxic metals (technetium, lead, mercury, and chromium) to insoluble forms. The Penn State group has prepared a new class of powerful reducing agents, called Ferragels, which consist of finely divided zero-valent metals on high surface area supports. Because the rate of the surface oxidation-reduction reaction depends on available surface area, Ferragels are more effective in every case tested to date than unsupported metals. The project will further develop and investigate the application of these composite materials to problems relevant to the DOE-EM mission, namely the detoxification of waste streams containing technetium, carbon tetrachloride, and toxic metal ions. The Penn State group will work closely with the PNNL group to prepare materials that are compatible with the highly corrosive liquid fraction of Hanford site tank waste, to conduct tests with waste simulants containing technetium, and to formulate and characterize vitrified waste forms derived from these materials

  14. Multi-organ technetium complexes production and use thereof

    International Nuclear Information System (INIS)

    Koehler, G.A.; Pestel, G.M.

    1976-01-01

    Chemical complexes, useful as radiopharmaceuticals, are formed by reacting technetium-99m with substituted or unsubstituted alkyl monophosphonic acids and certain ester derivatives thereof. The complexes are formed by reducing pertechnetate ion chemically or electrolytically in the presence of the phosphonic acid. By chemical modification of the phosphonic acid complexing agent, it is possible to ''tailor'' complexes for kidney, liver or bone imaging. The complexes are normally used in a physiologically acceptable aqueous medium. 20 Claims, No Drawings

  15. The impact of technetium-99m-radiopharmaceuticals' design on their biological behavior

    International Nuclear Information System (INIS)

    Jankovic, D.Lj.; Djokic, D.Dj. . E-mail address of corresponding author: drinaj@vin.bg.ac.yu; Jankovic, D.)

    2005-01-01

    The coordination has a great and not always predictable impact on the in-vivo behaviour of the small molecule into which the technetium-bearing chelate units is integrated. The different valence state of technetium in the complexes with some ligands changes the properties of these complexes, such as physico-chemical parameters and biological behaviour. The change of their biological behaviour has a great impact on quality of imaging study and on radiation dose to the patient. The results of the labelling of DPD and EHIDA with 99mTc(I) and their biological behaviour, in comparison with the same one for 99mTc(III)-DPD and 99mTc(III)-EHIDA complexes, confirmed that different oxidation state of 99mTc make possible forming variety of complexes with quite a different and unexpected biological behaviour. (author)

  16. Clinical comparison of technetium-99m-EC, technetium-99-m-MAG3 and Iodine-131-OIH in renal disorders

    International Nuclear Information System (INIS)

    Kabasakal, L.; Turoglu, T.; Oensel, C.

    1995-01-01

    Technetium-99m-ethylenedicysteine has recently been developed for renal function studies. The pharmacokinetics of 99m Tc-EC were studied by constant infusion technique and compared with 99m Tc-MAG3 and 131 I-OIH in 11 patients with various renal disorders. After giving a 7.4 MBq 131 I-OIH and 90-110 MBq 99m Tc-EC or 99m Tc-MAG3 bolus, a constant infusion (MBq/ml) 99m Tc--agent and 0.07 MBq/m 131 I-OIH was started. Sixteen blood and five urine samples were obtained over three hr. The renal clearance of 99m Tc-EC was higher than than of 99m Tc-MAG3. The 99m Tc-EC/OIH and 99m Tc-MAG3/OIH ratios were 0.75 ± 0.05 and 0.55 ± 0.10 (p=0.00087), respectively. The distribution volume of 99m Tc-EC was also higher than that of 99m Tc-MAG3 (15722 ± 4644 and 9509 ± 2788 ml/1.73m 2 , respectively; p=0.072). The 99m Tc-EC/OIH and 99m Tc-MAG/OIH distribution volume ratios were 1.03 ± 0.14 and 0.55 ± 0.10, respectively (p = 0.0003). The 60-min excretion values of 99m Tc-EC and 99m Tc-MAG3 were compared to that of OIH. The 99m Tc-EC/OIH and 99m Tc-MAG3/OIH excretion ratios were 0.96 ± 0.06 and 1.07 ± 0.10, respectively (p=0.162). The protein binding of 99m -EC and OIH were found to be 34% ±4 and 66% ±5, respectively (p 99m Tc-EC was negligible (3% ±1.2) in comparison to OIH (27% ±3; p 99m Tc-EC. This agent has good potential for renal function evaluation. 32 refs., 5 tabs

  17. PREDICTION OF RELAPSE FROM HYPERTHYROIDISM FOLLOWING ANTITHYROID MEDICATION WITHDRAWAL USING TECHNETIUM THYROID UPTAKE SCANNING.

    Science.gov (United States)

    Nakhjavani, Manouchehr; Abdollahi, Soraya; Farzanefar, Saeed; Abousaidi, Mohammadtagi; Esteghamati, Alireza; Naseri, Maryam; Eftekhari, Mohamad; Abbasi, Mehrshad

    2017-04-02

    Technetium thyroid uptake (TTU) is not inhibited by antithyroid drugs (ATD) and reflects the degree of thyroid stimulation. We intended to predict the relapse rate from hyperthyroidism based on TTU measurement. Out of 44 initially enrolled subjects, 38 patients aged 41.6 ± 14.6 with Graves disease (duration: 84 ± 78 months) completed the study. TTU was performed with 40-second imaging of the neck and mediastinum 20 minutes after injection of 1 mCi technetium-99m pertechnetate. TTU was measured as the percentage of the count of activity accumulated in the thyroidal region minus the mediastinal background uptake to the count of 1 mCi technetium-99m under the same acquisition conditions. Then methimazole was stopped and patients were followed. The optimal TTU cutoff value for Graves relapse prediction was calculated using Youden's J statistic. Hyperthyroidism relapsed in 11 (28.9%) patients 122 ± 96 (range: 15-290) days post-ATD withdrawal. The subjects in remission were followed for 209 ± 81 days (range: 88-390). TTU was significantly higher in patients with forthcoming relapse (12.0 ± 8.0 vs. 3.9 ± 2.0, P = .007). The difference was significant after adjustment for age, sex, history of previous relapse, disease duration, and thyroid-stimulating hormone (TSH) levels before withdrawal. The area under the receiver operative characteristic (ROC) curve was 0.87. The optimal TTU cutoff value for classification of subjects with relapse and remission was 8.7 with sensitivity, specificity, and positive and negative predictive value of 73%, 100%, 100%, and 90%, respectively (odds ratio [OR] = 10.0; 95% confidence interval [CI]: 3.4-29.3). TTU evaluation in hyperthyroid patients receiving antithyroid medication is an accurate and practical method for predicting relapse after ATD withdrawal. ATD = antithyroid drugs RIU = radio-iodine uptake TSH = thyroid-stimulating hormone TSI = thyroid-stimulating immunoglobulin TTU = technetium thyroid uptake.

  18. Validation of measurements of Fourier phase and amplitude analysis of technetium99 gated cardiac scans using artificial hearts

    International Nuclear Information System (INIS)

    Yiannikas, J.; Takatani, S.; MacIntyre, W.J.; Underwood, D.A.; Cook, S.A.; Go, R.T.; Napoli, C.; Nose, Y.

    1982-01-01

    The use of artificial hearts, developed for total heart replacement programs, allows assessment of the accuracy of measuring the first Fourier component phase and amplitude when applied to gated cardiac technetium 99 scans. In the extreme example of asynchrony of ventricular contraction in coronary artery disease that of ventricular aneurysms, the first Fourier component measurements of amplitude were highly correlated to volume increases suggesting that the calculated amplitude accurately reflects volume changes. The calculated asynchrony using Fourier analysis of the gated technetium 99 studies of two artificial hearts was highly accurate when compared to the predetermined calculation of phase angle difference and hence degree of asynchrony. The studies suggest that measurement of phase and amplitude using the first Fourier component of time-activity waves of gated cardiac technetium 99 studies accurately measure degree of asynchrony and volume changes respectively

  19. Precipitation process for the removal of technetium values from nuclear waste solutions

    Science.gov (United States)

    Walker, D.D.; Ebra, M.A.

    1985-11-21

    High efficiency removal of techetium values from a nuclear waste stream is achieved by addition to the waste stream of a precipitant contributing tetraphenylphosphonium cation, such that a substantial portion of the technetium values are precipitated as an insoluble pertechnetate salt.

  20. Simulation of technetium extraction behavior in UO2 (NO3)2-TcO4--HNO3-H2O/TBP-kerosene system

    International Nuclear Information System (INIS)

    Zhang Chunlong; He Hui; Chen Yanxin; Tang Hongbin

    2012-01-01

    By comparing and analyzing lots of reported data of technetium with the computing results, a modification function P(c 0 (U), t) was introduced to the existing distribution coefficient model of technetium, and a new mathematical model for simulating technetium extraction behavior in the system of UO 2 (NO 3 ) 2 -TcO 4 -HNO 3 -H 2 O/TBP- kerosene was established, as well as a computer program. The reliability of the program was verified by 179 sets of distribution coefficient data, and the results were found to agree well with experimental data. By comparing the reported data of technetium with the computing results, an evaluation was made to test the performance of the revised model. It turned out that the calculation results of the new model were more reliable than that of the one reported previously. The revised model and program can be the foundation to simulating technetium extraction behavior in the system of UO 2 (NO 3 ) 2 - TcO 4 - -HNO 3 -H 2 O/TBP-kerosene with the temperature scope from 10 to 60℃, U concentration from 0 to 280 g/L, and nitric acid concentration from 0.1 to 5 mol/L. (authors)

  1. Synthesis, libelling and bio-distribution of cerebral radiopharmaceuticals with Technetium 99

    International Nuclear Information System (INIS)

    Malek Saied, Nadia

    2013-01-01

    The prevalence of brain pathologies especially neurodegenerative diseases still increasing due to longer life expectancy and the age pyramid evolution that shows an increase in the proportion of the old persons. So, we count currently more than 30 million persons affected by a neuro-degenerative disease. It is estimated that this number will reach 100 million at 2050. Generally, these diseases are not fatal, but the intellectual handicap and/or the progressive physical deterioration which causes some of them (Alzheimer, Parkinson), may lead to the death. Despite the screening efforts, it remains difficult to establish an early and differential diagnosis. It is proposed that research provides new solutions for diagnostic to reduce the risk of mortality associated with these diseases and improve patient comfort. The first part of this presentation is dedicated to some definitions of the radiopharmaceuticals, the chemistry of technetium and rhenium and the strategies of labeling with Technetium. We propose first to give an overview concerning the target vectors and criteria for crossing of the hemato-encephalic barrier. In the second part we will present our results concerning the synthesis and the physico-chemical characterization of some ferrocenic ligands, radio-complex of the technetium-99 and their "rhenisted" analogues. We will expose some bio-distributions as well as the biochemical studies of certain cytectrenic molecules which showed a very interesting affinity for 5HT1A serotonergic receptors such as Tc-MP associated to the molecule of piperazine (2 - methoxyphenyl) as a vector of choice. This molecule allows an exceptional kinetic of extraction around (2.47 pou cent DI / g) in 5min pi. (Author)

  2. Molecular Engineering of Technetium and Rhenium Based Radiopharmaceuticals

    International Nuclear Information System (INIS)

    Zubieta, J.

    2003-01-01

    The research was based on the observation that despite the extraordinarily rich coordination chemistry of technetium and rhenium and several notable successes in reagent design, the extensive investigations by numerous research groups on a variety of N 2 S 2 and N 3 S donor type ligands and on HYNIC have revealed that the chemistries of these ligands with Tc and Re are rather complex, giving rise to considerable difficulties in the development of reliable procedures for the development of radiopharmaceutical reagents

  3. Preparation and characterisation of a sorbent suitable for technetium separation from environmental matrices

    International Nuclear Information System (INIS)

    Bartosova, A.; Rajec, P.; Reich, M.

    2003-01-01

    A sorbent based on Aliquat 336 anchored on hydrophobised silica gel support as an ion exchanger was prepared. Prepared sorbent was suitable for separation of technetium-99 from environmental matrices. The sorbent properties, sorption characteristic and distribution coefficient of 99 mTcO 4 - in various medium was studied. The chemical yield of Tc during separation process was determined using 99m Tc tracer and gamma measurement. Typical sorption recoveries of Tc for this sorbent from 0.1 M HNO 3 were more than 98 %. Typical desorption recoveries using 8 M HNO 3 were in the range 92 - 96 %. The commercial TEVA Spec resin from Eichrom Industries for comparison purpose was used as well. It was found that the prepared sorbent is suitable for separation of technetium from environmental matrices. (authors)

  4. Review of technetium chemistry research conducted at the University of Nevada Las Vegas

    International Nuclear Information System (INIS)

    Poineau, F.; Weck, P.F.; Forster, P.; Hartmann, T.; Mausolf, E.; Silva, G.W.C.; Czerwinski, K.R.; Rodriguez, E.E.; Sattelberger, A.P.; Jarvinen, G.D.; Cheetham, A.K.

    2009-01-01

    The chemistry of technetium is being explored at the University of Nevada Las Vegas. Our goal is to investigate both the applied and fundamental aspects of technetium chemistry, with a special emphasis on synthesis, separations, and materials science. The synthetic chemistry focuses on metal-metal multiple bonding, oxides and halides. Synthesis and characterizations of (n-Bu 4 N) 2 Tc 2 X 8 , Tc 2 (O 2 CCH 3 ) 4 X 2 (X = Cl, Br), TcO 2 , Bi 2 Tc 2 O 7 , Bi 3 TcO 8 , TcBr 3 and TcBr 4 have been performed. The applied chemistry is related to the behavior of Tc in the UREX process. Separation of U/Tc has been conducted using anion exchange resin and metallic Tc waste form synthesized and characterized. (author)

  5. Behavior of technetium in alkaline solution: Identification of non-pertechnetate species in high-level nuclear waste tanks at the Hanford reservation

    International Nuclear Information System (INIS)

    Lukens, Wayne W. Jr.; Shuh, David K.; Schroeder, Norman C.; Ashley, Kenneth R.

    2003-01-01

    Technetium is a long-lived (99Tc: 213,000 year half-life) fission product found in nuclear waste and is one of the important isotopes of environmental concern. The known chemistry of technetium suggests that it should be found as pertechnetate, TcO4-, in the extremely basic environment of the nuclear waste tanks at the Hanford site. However, other chemical forms of technetium are present in significant amounts in certain tanks, and these non-pertechnetate species complicate the treatment of the waste. The only spectroscopic characterization of these non-pertechnetate species is a series of X-ray absorption near edge structure (XANES) spectra of actual tank waste. To better understand the behavior of technetium under these conditions, we have investigated the reduction of pertechnetate in highly alkaline solution in the presence of compounds found in high-level waste. These results and the X-ray absorption fine structure (XAFS) spectra of these species are compared to the chemical behavior and XANES spectra of the actual non-pertechnetate species. The identity of the nonpertechnetate species is surprising

  6. Labelling of metaiodobenzylguanidine (MIBG) with Technetium-99m radionuclide

    International Nuclear Information System (INIS)

    Maula Eka Sriyani; Dini Natanegara; Aang Hanafiah Ws

    2015-01-01

    Various neuroendocrine tumors and their metastases are able to localized and staged by Metaiodobenzylguanidine (MIBG). MIBG is a molecule that has a chemical structure similarities with noradrenaline in the adrenal. The research on 131 I-MIBG has been successfully conducted in the tumor imaging. This research of preparing 99m Tc-MIBG that will be used as a diagnostic agent for adrenal tumors was carried out. MIBG labeling activities with technetium-99m radionuclide were carried out through labeling of MIBG with technetium-99m and radiochemical purity analysis. The labeling of MIBG was carried out using both direct and indirect methods with diethylene triamine pentaacetic acid (DTPA) as a co-ligand. Determination of 99m Tc-MIBG labeling efficiency was performed using paper chromatography with Whatman 3MM/dried acetone and Whatman 31ET/acetonitrile 50%. The results of labeling efficiency using the indirect method with DTPA as a co-ligand was obtained 93.44 ± 1.93%, which the concentration of MIBG was 2 mg/0.5 mL H 2 O, concentration of co-ligand was 37,5 μg of SnCl 2 .2H 2 O and DTPA of 1,125 mg at pH 6.5 for 15 minutes incubation in the room temperature ( 25 °C). (author)

  7. Technetium /sup 99m/Tc macroaggregated albumin lung scans. Use in chronic childhood asthma

    International Nuclear Information System (INIS)

    Hyde, J.S.; Koch, D.F.; Isenberg, P.D.; Werner, P.

    1976-01-01

    Serial roentgenograms and technetium /sub 99m/Tc macroaggregated albumin lung scans were done simultaneously in 30 bronchodilator-dependent asthmatic children and young adults during both relative remission and attacks of status asthmaticus. When chest roentgenograms showed air trapping and increased peribronchial vascular markings associated with persistent perfusion defects, the children benefited from further laboratory studies and continuous comprehensive therapy. Serial scans provided information about underperfusion that was not discernible either by roentgenograms or by usual blood gas studies. Also, lung scans are easier to obtain in children with long-standing asthma than are detailed pulmonary tests. In our study, technetium /sup 99m/Tc macroaggregated albumin scans showed persistent regional perfusion defects in 20 children with chronic asthma during relative remission and exacerbations

  8. Peculiarities of the introduction of technetium isotopes into protein molecules - of human serum albumin as an example

    International Nuclear Information System (INIS)

    Stanko, V.I.; Ovsyannikov, N.N.; Zuykova, N.P.; Gouskov, A.F.; Kovalchouk, N.D.

    1978-07-01

    Pecularities of the introduction of the radioisotope technetium 99m into the molecules of human serum albumin have been investigated. Tin not only participates in the Tc(V11) reduction process, but is incorporated into the originating Tc albumin complex. It is shown that no more than four technetium atoms enter into bond with an albumin molecule. The authors express their opinion that in order to produce high-quality protein preparations, the albumin has to be modified through a polyfunctional complexing agent which forms an entirely saturated coordination complex with Tc(IV)

  9. Pecularities of the introduction of technetium isotopes into protein molecules using human serum albumin as an example

    International Nuclear Information System (INIS)

    Stanko, V.I.; Ovsyannikov, N.N.; Sujkova, N.P.; Gus'kov, A.F.; Koval'chuk, N.D.

    1978-01-01

    Pecularities of the introduction of the radioisotope technetium 99m into the molecules of human serum albumin have been investigated. Tin not only participates in the Tc(VII) reduction process, but is incorporated into the originating Tc albumin complex. It is shown that no more than four technetium atoms enter into bond with an albumin molecule. The authors express their opinion that in order to produce high-quality protein preparations, the albumin has to be modified through a polyfunctional complexing agent which forms an entirely saturated coordination complex with Tc(IV). (author)

  10. Forefront of PUREX system engineering. Chemistry and engineering of ruthenium, technetium and neptunium

    International Nuclear Information System (INIS)

    2004-07-01

    The paper reports the activity of the research committee organized by the Atomic Energy Society of Japan on 'Ruthenium and Technetium Chemistry in the PUREX System', with focusing on basic behaviors of ruthenium, technetium and neptunium in the PUREX process, the principles of plant design, and behaviors during the final waste treatment. The scope of the work includes the following major topics: (1) basic solution and solid-state chemistry; (2) basic solution and solid-state chemistry of minor actinides in particular, Np; (3) partitioning chemistry in the PUREX system and environmental behavior of the components; (4) processes of recovery, purification, and utilization of rare metal fission products; (5) field data on plant design, operation, decontamination, and decommissioning; (6) numerical process simulations and process control technologies; (7) compilation of a data base for process chemistry and plant engineering. (S. Ohno)

  11. Stripping voltammetry of technetium using a TOA modified carbon paste electrode

    International Nuclear Information System (INIS)

    Ruf, H.; Schorb, K.

    1989-10-01

    Low concentrations of technetium have been measured DP-stripping-voltammetrically using a carbon paste electrode modified with tri-n-octylamine (TOA-CPE). Preconcentration of the metal ion on the electrode surface accomplished by dipping of the latter in the sample solution which is 2M in HCl, relies on the chemical reaction with the amine acting as a liquid anion exchanger. Both, Tc-IV occurring as the TcCl 6 2- ion in chloride solutions as well as Tc-VII hereby are deposited. Measurements following deposition yield voltammograms of essentially different shapes for the two Tc species. With Tc-IV a characteristic curve with a prominent current signal at -280 mV (vs. Ag/AgCl) is obtained which can be evaluated for Tc quantitation. However, starting from Tc-VII, complex voltammograms are registered not allowing direct technetium assays. Nevertheless, after reduction to Tc-IV, e.g. by means of ascorbic acid, also Tc-VII can be quantified reliably by the method described, the lower detection limit for both oxidation states being about 4x10 -8 M. (orig.) [de

  12. Diagnostic value of technetium pyrophosphate bone scintigraphy. Study of 277 patients

    International Nuclear Information System (INIS)

    Sainte-Croix, Annick.

    1975-01-01

    277 bone scintigraphs were carried out with 99m technetium pyrophosphate and an attempt was made, on the basis of this experience, to define the advantages and limits of the technique. 99m technetium pyrophosphate seems to be the isotope most suitable for bone scintigraphy. The scintillation camera bone scintigraphic examination is simple, allowing the whole skeleton to be explored in a relatively short time, and above all harmless since the total irradiation to which the organism is exposed throughout is no more than 0.07 rad. The broadest field of application of bone scintigraphy appears to be cancer: in 45 cases out of 66 it revealed bone metastases invisible radiologically and in 28 cases out of 90 the number of metastases observed was greater than that shown by X-rays. In 11 cases however radiologically visible bone metastases were not detected by scintigraphy. In spite of this reservation we consider bone scintigraphy to be a valuable technique, more sensitive than X-ray examinations in the detection of bone metastases of cancers [fr

  13. Removal of technetium, carbon tetrachloride, and metals from DOE properties. 1998 annual progress report

    International Nuclear Information System (INIS)

    Darab, J.G.; Mallouk, T.E.; Ponder, S.M.

    1998-01-01

    'The objective of the project is to develop and characterize supported reducing agents, and solid waste forms derived from them, which will be effective in the removal of transition metal ions, chlorinated organic molecules, and technetium from aqueous mixed wastes. This work follows the discovery that a nanoscale form of zero-valent iron, dispersed on high surface area supports, reduces metal ions (chromium, mercury, and lead) and rhenium (as a surrogate for technetium) to insoluble forms much faster than does unsupported iron. The scientific goals of the project are to better understand the mechanism of the reduction process, to develop supports that are compatible with a variety of mixed waste compositions, and to develop surface modifiers for the supported iron aggregates that will optimize their selectivity for the contaminants of interest. The support composition is of particular interest in the case of technetium (Tc) separation and stabilization in the Hanford tank wastes. While it is expected that pertechnetate will be reduced insoluble TcO 2 , the support material must be compatible with the vitrification process used in the final waste disposition. The surface modifications are also a focal point for Hanford applications because of the complex and variable makeup of the tank wastes. This report summarizes progress in the first 8 months of a 3-year collaborative project involving Penn State and Pacific Northwest National Laboratory (PNNL).'

  14. Small-Scale Ion Exchange Removal of Cesium and Technetium from Hanford Tank 241-AN-102

    International Nuclear Information System (INIS)

    Hassan, N.M.

    2000-01-01

    The pretreatment process for BNFL, Inc.'s Hanford River Protection Project is to provide decontaminated low activity waste and concentrated eluate streams for vitrification into low and high activity waste glass, respectively. The pretreatment includes sludge washing, filtration, precipitation, and ion exchange processes to remove entrained solids, cesium, transuranics, technetium, and strontium. The cesium (Cs-137) and technetium (Tc-99) ion exchange removal is accomplished by using SuperLig 644, and 639 resins from IBC Advanced Technologies, American Fork, Utah. The resins were shown to selectively remove cesium and technetium (as anionic pertechnetate ) from alkaline salt solutions. The efficiency of ion exchange column loading and elution is a complex function involving feed compositions, equilibrium and kinetic behavior of ion exchange resins, diffusion, and the ionic strength and pH of the aqueous solution. A previous experimental program completed at the Savannah River Tech nology Center2 demonstrated the conceptualized flow sheet parameters with an Envelope C sample from Hanford Tank 241-AN-107. Those experiments also included determination of Cs and Tc batch distribution coefficients by SuperLig 644 and 639 resins and demonstration of small-scale column breakthrough and elution. The experimental findings were used in support of preliminary design bases and pretreatment flow sheet development by BNFL, Inc

  15. Environmental behavior of technetium-99 and iodine-129

    International Nuclear Information System (INIS)

    Garland, T.R.; Schreckhise, R.G.

    1982-01-01

    The environmental behavior of technetium-99 and iodine-129 was once thought to be similar, particularly with respect to their soil solubility and biological interactions. Over the past several years, the comparative behavior of these two anions has been studied with respect to their fate in natural environments (both aquatic and terrestrial). The mechanisms studied include physical, chemical and biological parameters that account for differences in soil behavior, cycling between soil and/or air to vegetation, adsorption and metabolism in plants, and their availability and fate following ingestion by animals

  16. Preparation of L-asparagine complex with technetium

    International Nuclear Information System (INIS)

    Persano, S.C.M.

    1981-01-01

    The preparation of technetium chelated to L-asparagine is aimed at for obtention of potentially useful radiopharmaceutical in nuclear medicine. The reduction of pertechnetate anion ( 99 TcO - 4 and sup(99m) TcO - 4 ) using hydrazine as a reducing agent is studied with use of polarographic spectrophotometric and chromatographic methods. Spectrophotometric determination shows that the aqueous solution of amonium sup(-99m) Tc pertechnetate absorbs at 244, 248 and 290 nm. After reduction the species absorbs at 330 and near 495-530 nm. Polarographic measurements with 0,1 N NaOH electrolyte show a half-wave potential E sub(1/2 = -0,82 V for technetium +VII. After the addition of increasing amounts of hydrazine into a solution containing Tc+VII, the half wave potential shifts to more positives values, indicating the reduction of Tc+VII. Chromatographic determinations are in good agreement with polarographic analysis, emphatizing reduction of Tc+IV by hydrazine. The reduced 99 Tc shows ability of being incorporated into L-asparagine forming a cristalline compound with melting point 118.6 0 C. Infrared absorption spectrometry shows that amino and carboxyl groups are bound to the metal in this complex. The yield of sup(99m) Tc incorporation into L-asparagine at 60 0 C in 30 minutes is up to 95%. The labeled complex can be presented as a radiopharmaceutical product. Tissue distribution performed in groups of normal and bearing lymphoma Walker 256 Wistar rats (50-60) shows that the radiopharmaceutical concentrates seletively in the tumor and is fastly excreted by the kidney and it doesn't have significant affinity for any organ, being so adequate for the formation of tumoral images. (Authors) [pt

  17. Anionic sorbents for arsenic and technetium species

    International Nuclear Information System (INIS)

    Lucero, Daniel A.; Moore, Robert Charles; Bontchev, Ranko Panayotov; Hasan, Ahmed Ali Mohamed; Zhao, Hongting; Salas, Fred Manuel; Holt, Kathleen Caroline

    2003-01-01

    Two sorbents, zirconium coated zeolite and magnesium hydroxide, were tested for their effectiveness in removing arsenic from Albuquerque municipal water. Results for the zirconium coated zeolite indicate that phosphate present in the water interfered with the sorption of arsenic. Additionally, there was a large quantity of iron and copper present in the water, corrosion products from the piping system, which may have interfered with the uptake of arsenic by the sorbent. Magnesium hydroxide has also been proven to be a strong sorbent for arsenic as well as other metals. Carbonate, present in water, has been shown to interfere with the sorption of arsenic by reacting with the magnesium hydroxide to form magnesium carbonate. The reaction mechanism was investigated by FT-IR and shows that hydrogen bonding between an oxygen on the arsenic species and a hydrogen on the Mg(OH)2 is most likely the mechanism of sorption. This was also confirmed by RAMAN spectroscopy and XRD. Technetium exists in multiple oxidation states (IV and VII) and is easily oxidized from the relatively insoluble Tc(IV) form to the highly water soluble and mobile Tc(VII) form. The two oxidation states exhibit different sorption characteristics. Tc(VII) does not sorb to most materials whereas Tc(IV) will strongly sorb to many materials. Therefore, it was determined that it is necessary to first reduce the Tc (using SnCl2) before sorption to stabilize Tc in the environment. Additionally, the effect of carbonate and phosphate on the sorption of technetium by hydroxyapatite was studied and indicated that both have a significant effect on reducing Tc sorption

  18. Under used technetium-99m generators

    International Nuclear Information System (INIS)

    Mushtaq, A.

    2001-01-01

    Health care reform truly has become a global issue and it will undoubtedly have a dramatic impact on the future of nuclear medicine business in particular. A bigger concern within the nuclear medicine community is its competitiveness with other modalities and cost effectiveness.Technetium-99m and its generators are playing key role for the majority of diagnostic scans performed in the world today. Availability of ''9''9''mTc can be increased if it is separated from ''9''9Mo after much shorter growth times. After proper planning with the extra ''9''9''mTc, a significant number of scans can be performed or we would be able to order approximately 30% low activity ''9''9Tc generators to fulfill our requirements

  19. Evaluation of experimental studies on technetium transfers to sediments and benthic marine species, and comparison with in situ data

    Energy Technology Data Exchange (ETDEWEB)

    Aprosi, G [Electricite de France, 78 - Chatou; Masson, M [Commisariat a l' Energie Atomique, Institut de Protection et de Surete Nucleaire, 50 - Cherbourg (France)

    1984-01-01

    To obtain basic information for the evaluation of the radiological impact of technetium (Tc) on the marine environment, investigations are performed by different laboratories. Technetium is not a natural element and the main source of production is the nuclear fuel cycle. Under anoxic conditions, in presence of reducing sediments, the distribution coefficients are very high (Ksub(D)=10/sup 3/). Concentration factors from water to species are mostly very low (FC 1 to 10); however, concentration factors up to 1000 have been observed for a few species such as macrophytic brown algae, worms and lobster. Biochemical analysis shows that Tc is bound with protein. The transfer factors between sediment and species are very low (FT<0,5). The biological half-life (Tb) was determined in some marine organisms which had accumulated the radionuclide from water-contamined food or from sediments. The loss is biphasic in storage organs (liver and kidney); uptake in the edible parts is low. Among the parameters studied (light for algae, physico-chemical form of Tc, salinity and temperature) only light and the physico-chemical forms have an effect on the accumulation of technetium. Analyses of /sup 99/Tc concentrations in species collected near the La Hague and Windscale (Sellafield) reprocessing plants confirm the experimental studies. Since sea water is likely to be an oxidant environment, technetium appears as a conservative element.

  20. Monoclonal anti-elastin antibody labelled with technetium-99m

    International Nuclear Information System (INIS)

    Oliveira, Marcia B.N. de; Silva, Claudia R. da; Araujo, Adriano C. de; Bernardo Filho, Mario; Porto, Luis Cristovao M.S.; Gutfilen, Bianca; Souza, J.E.Q.; Frier, Malcolm

    1999-01-01

    Technetium-99m ( 99m Tc) is widely employed in nuclear medicine due to its desirable physical, chemical and biological properties. Moreover, it is easily available and normally is inexpensive. A reducing agent is necessary to label cells and molecules with 99m Tc and stannous chloride (Sn C L 2 ) is usually employed. Elastin is the functional protein component of the elastic fiber and it is related with some diseases such as arteriosclerosis, pulmonary emphysema and others. The present study refers to the preparation of the 99m Tc labeled monoclonal anti-elastin antibody. The monoclonal antibody was incubated with an excess of 2-iminothiolane. The free thiol groups created, were capable of binding with the reduced technetium. Labeling was an exchange reaction with 99m Tc-glucoheptonate. The labeled preparation was left at 4 deg C for one hour. Then, it was passed through a Sephadex G50 column. Various fractions were collected and counted. A peak corresponding to the radiolabeled antibody was obtained. Stability studies of the labelled anti-elastin were performed at 0,3 6, 24 hours, at both 4 deg C or room temperature. The biodistribution pattern of the 99m Tc-anti-elastin was studied in healthy male Swiss mice. The immunoreactivity was also determined. An useful labeled-anti-elastin was obtained to future immunoscintigraphic investigations. (author)

  1. Technetium-99m labeling and fibronectin binding ability of Corynebacterium diphtheriae

    International Nuclear Information System (INIS)

    Souza, S.M.S.; Nagao, P.E.; Bernardo-Filho, M.; Pereira, G.A.; Napoleao, F.; Andrade, A.F.B.; Hirata Junior, R.; Mattos-Guaraldi, A.L.

    2004-01-01

    The use of radionuclides has permitted advances in areas of clinical and scientific knowledge. Several molecules and cells have been labelled with Technetium-99m ( 99m Tc). The stannous chloride (SnCl 2 ) has a significant influence on the labeling and stability of 99m Tc radiotracers. The frequent risk of diphtheria epidemics has intensified interest in the virulence factors of Corynebacterium diphtheriae. Although studies have looked at potential adhesins including haemagglutinins and exposed sugar residues, the molecular basis of mechanisms of adherence remains unclear. Adherence of pathogens to mammalian tissues may be mediated by fibronectin (FN) found in body fluids, matrix of connective tissues, and cell surfaces. In the present study we evaluated the binding ability to human plasma FN by 99m Tc labeled-C.diphtheriae. Due to adverse effects of stannous ions, microorganisms were submitted to survival and filamentation induction assays. Data showed a dose dependent susceptibility to SnCl 2 bactericidal effects. Cell filamentation was observed for concentrations of SnCl 2 > 110 μg/ml. Adherence levels of 99m Tc labelled 241strain to coverslips coated with 20 μg/ml FN were higher (P = 0.0037) than coated with bovine serum albumin. FN binding by the sucrose fermenting 241 C. diphtheriae strain (8.9% + 2.6) was significantly lower (P=0.0139) than Staphylococcus aureus Cowan I strain (34.1% ± 1.2). Therefore, bacterial 99m Tc labeling represents an additional tool that may contribute to the comprehension of C. diphtheriae interactions with host receptors such as FN that act as biological organizers by holding bacterial cells in position and guiding their migration. (author)

  2. Diagnostic pharmaco-scintigraphy with hepatic intra-arterial technetium-99m macroaggregated albumin in the determination of tumour to non-tumour uptake ratio in hepatocellular carcinoma

    International Nuclear Information System (INIS)

    Lau, W.Y.; Leung, T.W.T.; Chan, M.; Leung, N.W.Y.; Metreweli, C.; Li, A.K.C.

    1994-01-01

    Between October 1990 and March 1993, 124 patients with hepatocellular carcinoma (HCC) underwent diagnostic pharmaco-scintigraphy with hepatic intraarterial technetium-99m macroaggregated albumin (TcMAA) to determine the tumorous to non-tumorous liver tissue uptake ratio (T/N ratio). There were 110 males and 14 females. Ages ranged from 16 to 73 with a median of 55 years. The range of T/N ratio was 0.7 to 19.3 with a median of 3.8. 12 patients with inoperable HCC were subsequently selected by predetermined criteria to undergo treatment with hepatic intraarterial yttrium-90 microspheres and the T/N ratios in these patients were validated by beta probe dosimetry and liquid scintillation count of multiple liver biopsies. The T/N ratio determined by preoperative diagnostic TcMAA scan corrected well with intraoperative beta probe dosimetry, with coefficient of correlation r = 0.82. Preoperative TcMAA scan also correlated well with liquid scintillation count of biopsy specimens. (author)

  3. Overview of nuclear medicine and the role of technetium

    International Nuclear Information System (INIS)

    Eckelman, W.C.

    1987-01-01

    One of the driving forces for the elucidation of the chemistry of 99 Tc was the discovery of the Molybdenum Technetium generator. Since this generator system produces no-carrier-added 99 Tc, these studies at the nanomolar level mostly involve chromatography, and that analytical tool is then used to link the no-carrier added and carrier chemistry. These well-defined 99 Tc compounds are used in vivo to measure perfusion, but biochemical probes offer an exciting target for further exploration

  4. The aqueous corrosion behavior of technetium - Alloy and composite materials

    International Nuclear Information System (INIS)

    Jarvinen, G.; Kolman, D.; Taylor, C.; Goff, G.; Cisneros, M.; Mausolf, E.; Poineau, F.; Koury, D.; Czerwinski, K.

    2013-01-01

    Metal waste forms are under study as possible disposal forms for technetium and other fission products. The alloying of Tc is desirable to reduce the melting point of the Tc-containing metal waste form and potentially improve its corrosion resistance. Technetium-nickel composites were made by mixing the two metal powders and pressing the mixture to make a pellet. The as-pressed composite materials were compared to sintered composites and alloys of identical composition in electrochemical corrosion tests. As-pressed samples were not robust enough for fine polishing and only a limited number of corrosion tests were performed. Alloys and composites with 10 wt% Tc appear to be more corrosion resistant at open circuit than the individual components based on linear polarization resistance and polarization data. The addition of 10 wt% Tc to Ni appears beneficial at open circuit, but detrimental upon anodic polarization. Qualitatively, the polarizations of 10 wt% Tc alloys and composites appear like crude addition of Tc plus Ni. The 1 wt% Tc alloys behave like pure Ni, but some effect of Tc is seen upon polarization. Cathodic polarization of Tc by Ni appears feasible based on open circuit potential measurements, however, zero resistance ammetry and solution measurements are necessary to confirm cathodic protection

  5. The aqueous corrosion behavior of technetium - Alloy and composite materials

    Energy Technology Data Exchange (ETDEWEB)

    Jarvinen, G.; Kolman, D.; Taylor, C.; Goff, G.; Cisneros, M. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Mausolf, E.; Poineau, F.; Koury, D.; Czerwinski, K. [Department of Chemistry, University of Nevada, Las Vegas, Las Vegas, NV 89154 (United States)

    2013-07-01

    Metal waste forms are under study as possible disposal forms for technetium and other fission products. The alloying of Tc is desirable to reduce the melting point of the Tc-containing metal waste form and potentially improve its corrosion resistance. Technetium-nickel composites were made by mixing the two metal powders and pressing the mixture to make a pellet. The as-pressed composite materials were compared to sintered composites and alloys of identical composition in electrochemical corrosion tests. As-pressed samples were not robust enough for fine polishing and only a limited number of corrosion tests were performed. Alloys and composites with 10 wt% Tc appear to be more corrosion resistant at open circuit than the individual components based on linear polarization resistance and polarization data. The addition of 10 wt% Tc to Ni appears beneficial at open circuit, but detrimental upon anodic polarization. Qualitatively, the polarizations of 10 wt% Tc alloys and composites appear like crude addition of Tc plus Ni. The 1 wt% Tc alloys behave like pure Ni, but some effect of Tc is seen upon polarization. Cathodic polarization of Tc by Ni appears feasible based on open circuit potential measurements, however, zero resistance ammetry and solution measurements are necessary to confirm cathodic protection.

  6. Stripping voltammetric behavior of technetium at various chemically modified electrodes

    International Nuclear Information System (INIS)

    Dick, R.

    1990-09-01

    In monitoring of nuclear processing plants and storage facilities the necessity arises of assaying traces of the artificial radioactive element technetium. The oxidation states IV and VII are of particular interest. Stripping voltammetry is among the methods of assay which are suited for this purpose. It allows an enhanced selectivity to be achieved by preconcentration of the analyte and of an oxidation state of the analyte, respectively, at the electrode used. This specific enrichment is successful after appropriate chemical modification of the electrode through immobilization of a Tc-specific reagent. When various approaches of chemical modification of a glassy carbon electrode were examined, the tetraphenylarsonium chloride extractant, which is highly selective with respect to technetium, proved to be the best suited reagent, capable of fixation both by ionic and by covalent bonding on an electrodeposited polymer film. For ionic immobilization the reagent was reacted to m-sulfophenyltriphenyl arsonium and then bound to a copolymer of vinylferrocene and vinylpyridine, which had been provided with cations. It was possible to enrich Tc(VII) at such an electrode and to determine it by stripping voltammetry down to a concentration of 1x10 -8 M after 5 minutes enrichment time. (orig./EF) [de

  7. Volatility literature of chlorine, iodine, cesium, strontium, technetium, and rhenium; technetium and rhenium volatility testing

    International Nuclear Information System (INIS)

    Langowski, M.H.; Darab, J.G.; Smith, P.A.

    1996-03-01

    A literature review pertaining to the volatilization of Sr, Cs, Tc (and its surrogate Re), Cl, I and other related species during the vitrification of Hanford Low Level Waste (LLW) streams has been performed and the relevant information summarized. For many of these species, the chemistry which occurs in solution prior to the waste stream entering the melter is important in dictating their loss at higher temperatures. In addition, the interactive effects between the species being lost was found to be important. A review of the chemistries of Tc and Re was also performed. It was suggested that Re would indeed act as an excellent surrogate for Tc in non-radioactive materials testing. Experimental results on Tc and Re loss from sodium aluminoborosilicate melts of temperatures ranging from 900--1350 degrees C performed at PNL are reported and confirm that Re behaves in a nearly identical manner to that of technetium

  8. Osteomyelitis and infarction in sickle cell hemoglobinopathies: differentiation by combined technetium and gallium scintigraphy

    International Nuclear Information System (INIS)

    Amundsen, T.R.; Siegel, M.J.; Siegel, B.A.

    1984-01-01

    Clinical records and scintigrams were reviewed of 18 patients with sickle cell hemoglobinophaties who had undergone combined technetium and gallium scintigraphy during 22 separate episodes of suspected osseous infection. The combined scintigrams were correctly interpreted as indicating osteomyelitis in four studies. Of 18 studies in patients with infarction, the combined scintigrams were correctly interpreted in 16 and showed either no local accumulation of Ga-67 or less accumulation than that of Tc-99m MDP at symptomatic sites. In the other two studies, the scintigrams were falsely interpreted as indicating osteomyelitis and showed congruent, increased accumulation of both Tc-99, MDP and Ga-67. This pattern must be considered indeterminate. Overall, the results indicate that the combination of technetium and gallium scintigraphy is an effective means to distinguish osteomyelitis from infarction in patients with sickle cell hemoglobinopathies

  9. Candidate Low-Temperature Glass Waste Forms for Technetium-99 Recovered from Hanford Effluent Management Facility Evaporator Concentrate

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Mei [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Tang, Ming [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rim, Jung Ho [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Chamberlin, Rebecca M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-07-24

    Alternative treatment and disposition options may exist for technetium-99 (99Tc) in secondary liquid waste from the Hanford Direct-Feed Low-Activity Waste (DFLAW) process. One approach includes development of an alternate glass waste form that is suitable for on-site disposition of technetium, including salts and other species recovered by ion exchange or precipitation from the EMF evaporator concentrate. By recovering the Tc content from the stream, and not recycling the treated concentrate, the DFLAW process can potentially be operated in a more efficient manner that lowers the cost to the Department of Energy. This report provides a survey of candidate glass formulations and glass-making processes that can potentially incorporate technetium at temperatures <700 °C to avoid volatilization. Three candidate technetium feed streams are considered: (1) dilute sodium pertechnetate loaded on a non-elutable ion exchange resin; (2) dilute sodium-bearing aqueous eluent from ion exchange recovery of pertechnetate, or (3) technetium(IV) oxide precipitate containing Sn and Cr solids in an aqueous slurry. From the technical literature, promising candidate glasses are identified based on their processing temperatures and chemical durability data. The suitability and technical risk of three low-temperature glass processing routes (vitrification, encapsulation by sintering into a glass composite material, and sol-gel chemical condensation) for the three waste streams was assessed, based on available low-temperature glass data. For a subset of candidate glasses, their long-term thermodynamic behavior with exposure to water and oxygen was modeled using Geochemist’s Workbench, with and without addition of reducing stannous ion. For further evaluation and development, encapsulation of precipitated TcO2/Sn/Cr in a glass composite material based on lead-free sealing glasses is recommended as a high priority. Vitrification of pertechnetate in aqueous anion exchange eluent solution

  10. Technetium scanning in Kaposi's sarcoma and its simulators

    International Nuclear Information System (INIS)

    Gunnoe, R.; Kalivas, J.

    1982-01-01

    The clinical picture of ulcerated purple plaques on the legs often suggests several diagnoses: Kaposi's sarcoma, stasis dermatitis, atrophie blanche (livedoid vasculitis), and a poorly understood condition called acroangiodermatitis of Favre-Chaix (pseudo-Kaposi's sarcoma). Even the skin biopsy may not always be conclusive. We describe our experience with three patients with pseudo-Kaposi's sarcoma, one with true Kaposi's sarcoma and two with atrophie blanche. Clinical and histopathologic similarities among these three conditions pointed up the need for additional confirmatory studies, i.e., isotope scanning. The technetium scan was positive in both Kaposi's sarcoma and pseudo-Kaposi's sarcoma but negative in atrophie blanche

  11. Doses to nurses by the technetium-99m, in private and public sector

    International Nuclear Information System (INIS)

    Bied, J.Ch.; Philippon, B.

    1999-01-01

    The global body dose due to the technetium is 1.2 and 1.9 mSv for the two nurses of the private sector. In the public sector, the level reached by the personnel is 0.75 mSv for the global body dose, and the only technetium (global body dose 1.4 and 2.1 mSv for the private sector, 0.95 for the public sector and for the whole of radiations measured by the O.P.R.I. film dosemeter. The doses received at the fingers level present higher levels in the private sector. But these values, 15.2 and 10.7 mSv by month, that is to say 180 mSv by year are the 2/5 of the maximum permissible value. The two persons of the private sector received whole body doses, higher that the doses of the public sector. These doses are about 1.2 to 1.9 these ones received in the public sector. (N.C.)

  12. Kit development for labelling erythrocytes or leukocytes with technetium-99m in vitro

    International Nuclear Information System (INIS)

    Wang Xuebin; Han Quansheng; Wang Jingcheng; Mi Hongzhi

    1996-01-01

    This study developed a modified pre tinning method for labeling erythrocytes with technetium-99m in vitro using a kit which contains stannous chloride stabilized with geneticist acid (GA) in lyophilized form. This GA-kit a sterile closed system that does not require centrifugation,washing and separation of the RBCs. The kit is simple to use and labeling takes ∼ 30 min with a typical labeling efficiency of 97.3% ± 1.2% for 60 determinations. Imaging studies were performed in rabbit using GA-kit in vitro labeling procedure and PYP-kit in vivo labeling. It shows that the heart-to-background ratio with GA in vitro labeling were significantly higher than with in vivo labeling. Leukocytes labeling with technetium-99m using the same GA kit also was studied. The labeling efficiency was 20 ∼ 41%. Thus, the GA kit is versatile and cost-effective. (author). 21 refs., 5 figs., 2 tabs

  13. Selenium-75 and technetium-95m biokinetics in rats at different physiological states

    International Nuclear Information System (INIS)

    Archimbaud, Yves; Grillon, Gerard; Poncy, Jean-Luc; Masse, Roland

    1992-06-01

    Selenium 79 ( 79 Se) and technetium ( 99 Tc), beta emitters, components of nuclear wastes, may increase the dose equivalent to members of the public. Data used by ICRP show that there is relatively little information on Te and Se biokinetics at different physiologic stages. Retention was almost equivalent for young, male adult and pregnant rat. Selenium was concentrated in the testis, the kidneys, the liver and the spleen as technetium was in the skin, the thyroid and the kidneys. The biological half-time for Se and Te was respectively 20 and 41 days for pregnant rats, 33 and 15 days for young rats. Placental transfer per one fetus was 0.56% of the initial activity for Te and 1.27% for Se. These data point out the eventually high doses delivered to the skin for Te and to the testis for Se. They may be taken into consideration in estimating risk by humans at different stages of life [fr

  14. Environmental fate and distribution of technetium-99 in a deciduous forest ecosystem

    International Nuclear Information System (INIS)

    Garten, C.T. Jr.; Tucker, C.S.; Walton, B.T.

    1986-01-01

    The uptake of 99 Tc by trees intercepting contaminated groundwater from a radioactive waste storage site was measured to identify the major 99 Tc pools within the woodland ecosystem and to assess the relative mobility of 99 Tc in the existing element cycle. The highest average 99 Tc concentrations in vegetation were found in herbaceous plants. Tree wood was the major above-ground pool for 99 Tc because of the high concentrations in wood as well as the large amount of wood relative to other biomass at the site. Technetium was not easily leached from the trees by rainfall and was not readily extractable from forest floor leaf litter by water. The relative importance of return pathways for 99 Tc to the forest floor was leaf fall > stemflow > throughfall, indicating that 99 Tc was conserved by the trees. Snails and millipedes from the leaf litter layer concentrated technetium 20- and 16-fold, respectively, above levels found in the soil. Pertechnetate was rendered less bioavailable after ingestion by a leaf litter macroinvertebrate (Porcellio sp.) common to the study site. (author)

  15. Sup(110)Sn/110In - a new generator system for positron emission tomography

    International Nuclear Information System (INIS)

    Lundqvist, H.; Einarsson, L.; Malmborg, P.; Scott-Robson, S.

    1991-01-01

    A generator system, 110 Sn/ 110 In, is suggested for use in the labelling of leukocytes with this short-lived (t 1/2 = 1.15 h) positron emitting (62%) isotope of indium. The half-life gives the labelled leukocytes time to be adequately distributed but is short enough to allow repeated studies within a few hours. The mother radionuclide 110 Sn (t 1/2 = 4.15 h) is produced by the reaction nat In(p, xn) 110 Sn which has a maximum cross-section of 110 mb at approx. 70 MeV and a practical yield of 400 MBq/μAh. (author)

  16. Technetium labelled plasminogen activator - a potential reagent for thrombus detection

    Energy Technology Data Exchange (ETDEWEB)

    Paulsma-De Waal, J.H.; Boer, A.C. de; Cox, P.H.; Pillay, M.; Stassen, J.H.; Collen, D.

    1987-12-01

    The preparation of a technetium labelled plasminogen activator complex using a solid phase labelling technique is described. The labelled complex showed no significant loss of fibrinolytic activity in vitro and showed in vivo a rapid uptake in thrombi in an animal model and in human volunteer patients with known thrombi when injected into a vein draining to the thrombotic region. Systemic injection showed no uptake in the thrombi probably due to rapid sequestration of the complex by the liver.

  17. Voltammetric assay of extremely low technetium concentrations following enrichment at the HMDE after reaction with Thiocyanate

    International Nuclear Information System (INIS)

    Friedrich, M.; Ruf, H.

    1984-12-01

    It is known that in sulfuric acid solution pertechnetate is reduced by thiocyanate to form thiocyanate complexes. After this reaction the technetium acquires the capability of being adsorbed at the hanging mercury drop electrode (HMDE) provided that a potential of -0,40 V (vs. Ag/AgCl) has been applied to the electrode. If, by application of the differential pulse voltammetry after the phase of deposition the potential at the electrode is scanned cathodically, traces of technetium can be determined very sensitively by evaluation of the peak current recorded at minus 1,27 V (Ag/AgCl). The effect is still being enhanced by the presence of not interfering small perrhenate amounts. The reproducibility of the measured values is excellent. (orig.) [de

  18. Mass spectral analysis of cationic and neutral technetium complexes

    International Nuclear Information System (INIS)

    Unger, S.E.; McCormick, T.J.; Nunn, A.N.; Treher, E.N.

    1986-01-01

    Cationic and neutral technetium compounds have been characterized by mass spectrometry using a variety of ionization methods. These compounds include octahedral cationic complexes containing phosphorous and arsenic ligands such as DIPHOS and DIARS and neutral complexes containing PnAO and dimethylglyoxime, DMG, or cyclohexanedione dioxime, CDO, ligands. Boronate esters incorporating methyl and butyl derivatives of the DMG and CDO dioximes represent a new class of seven-coordinate Tc radiopharmaceuticals whose characterization by mass spectrometry has not previously been described. These complexes show promise as myocardial imaging agents. (author)

  19. Investigation of space-occupying lesions in the liver with technetium-99m tin colloid and indium-113m-chloride

    International Nuclear Information System (INIS)

    Nelson, M.J.; Klopper, J.F.

    1985-01-01

    Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts

  20. Investigation of space-occupying lesions in the liver with technetium-99m tin colloid and indium-113m-chloride

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, M.J. (Provincial Hospital, Port Elizabeth (South Africa). Dept. of Nuclear Medicine); Klopper, J.F. (Stellenbosch Univ. (South Africa). Dept. of Nuclear Medicine)

    1985-01-26

    Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts.

  1. Complexes of technetium, rhenium, and rhodium with sexidentate Schiff-base ligands

    International Nuclear Information System (INIS)

    Hunter, G.; Kilcullen, N.

    1989-01-01

    The monocationic technetium (IV) and rhenium (IV) complexes with the sexidentate Schiff-base ligands tris[2-(2'-hydroxybenzylideneethyl)]amine and its substituted derivatives have been prepared and their electrochemical properties studied. The variable-temperature 90.6 MHz 13 C-{ 1 H} n.m.r. spectrum of the rhodium (III) complex of tris[2-(2-hydroxy-5'-isopropylbenzylideneethyl)-amine] has been observed, indicating fluxionality at temperatures above 218 K. (author)

  2. Technetium(V)-nitrido complexes of dithiocarbazic acid derivatives. Reactivity of [Tc≡N]2+ core towards Schiff bases derived from S-methyl dithiocarbazate. Crystal structures of [S-methyl 3-(2-hydroxyphenyl-methylene) dithiocarbazato]intrido(triphenylphosphine)technetium(V) and bis(S-methyl 3-isopropylidenedithiocarbazato)nitridotechnetium(V)

    International Nuclear Information System (INIS)

    Marchi, A.; Duatti, A.; Rossi, R.; Magon, L.; Bertolasi, V.; Ferretti, V.; Gilli, G.; Pasqualini, R.

    1988-01-01

    As a potential alternative approach to lipophilic square-pyramidal technetium complexes, we investigate here the synthesis of new Tcsup(V) complexes, containing the [Tc''ident to''N] 2+ core, with bi- and tri-dentate Schiff bases derived from S-methyl dithiocarbazate, NH 2 NHC(=S)SCH 3 . Square-pyramidal complexes having an apical Tcsup(V) ≡ N group, with bis(quinoline-8-thiolato), [TcN(C 9 H 6 NS) 2 ], and bis(diethyldithiocarbamate), [TcN(S 2 CNEt 2 ) 2 ], have been reported. In this paper, we report the synthesis and characterization of a series of technetium(V)-nitrido complexes with the ligands illustrated, obtained by reduction of the technetium(VI) complex [TcNCl 4 ] - or by ligand substitution of the Tcsup(V) complex [TcNCl 2 (PPh 3 ) 2 ]. We discuss also the crystal structures of the complexes [TcNL 1 (PPh 3 )] [H 2 L 1 = S-methyl 3-(2-hydroxy-phenylmethylene)dithiocarbazate] and [TcN(L 12 ) 2 ] (HL 12 S-methyl 3-isopropylidenedithiocarbazate. (author)

  3. PRELIMINARY ASSESSMENT OF THE LOW-TEMPERATURE WASTE FORM TECHNOLOGY COUPLED WITH TECHNETIUM REMOVAL

    Energy Technology Data Exchange (ETDEWEB)

    Fox, K.

    2014-05-13

    The U.S. Department of Energy Office of Environmental Management (EM) is engaging the national laboratories to provide the scientific and technological rigor to support EM program and project planning, technology development and deployment, project execution, and assessment of program outcomes. As an early demonstration of this new responsibility, Pacific Northwest National Laboratory (PNNL) and Savannah River National Laboratory (SRNL) have been chartered to implement a science and technology program addressing low-temperature waste forms for immobilization of DOE aqueous waste streams, including technetium removal as an implementing technology. As a first step, the laboratories examined the technical risks and uncertainties associated with the Cast Stone waste immobilization projects at Hanford. Science and technology needs were identified for work associated with 1) conducting performance assessments and risk assessments of waste form and disposal system performance, and 2) technetium chemistry in tank wastes and separations of technetium from waste processing streams. Technical approaches to address the science and technology needs were identified and an initial sequencing priority was suggested. The following table summarizes the most significant science and technology needs and associated approaches to address those needs. These approaches and priorities will be further refined and developed as strong integrated teams of researchers from national laboratories, contractors, industry, and academia are brought together to provide the best science and technology solutions. Implementation of a science and technology program that addresses these needs by pursuing the identified approaches will have immediate benefits to DOE in reducing risks and uncertainties associated with near-term decisions regarding supplemental immobilization at Hanford. Longer term, the work has the potential for cost savings and for providing a strong technical foundation for future

  4. Labeling of thymine with 99m technetium: a suggestion of a chemical model

    International Nuclear Information System (INIS)

    Gutfilen, Bianca; Silva, Claudia Ribeiro da; Bernardo Filho, Mario; Ribeiro, Barbara Luzia Almeida; Mattos, Maura Ferreira

    1996-01-01

    Successful targeting of diagnose but also to stage cancer. It has been shown that certain tumor cells are permeable to low level of exogenous adenosine-diphosphate and adenosine-triphosphate nucleotides, that are incorporated into intracellular pools. We present the labeling of a nucleotide precursor, a base, thymine technetium-99m ( 99m Tc). (author)

  5. Technetium(I) complexes Tc(CO)3BrL2 (L = phosphine, pyridine, isocyanide)

    International Nuclear Information System (INIS)

    Lorenz, B.; Findeisen, M.; Olk, B.; Schmidt, K.

    1988-01-01

    Technetium pentacarbonyl bromide reacts with π-acceptor ligands L (L = phosphine, pyridine, isocyanide) to form disubstituted compounds of the type Tc(CO) 3 BrL 2 . The stereochemistry of the complexes was established by infrared and 1 H-NMR measurement. Chemical shifts and the half-widths of the 99 Tc-NMR signals are discussed. (author)

  6. Mixed-ligand complexes of technetium-III. Synthesis and characterization of [bis(diphenylphosphino)ethane]tetrakis(trimethylphosphite)tech netium(I) hexafluorophosphate, [Tc(DPPE)(TMP)4]PF6

    International Nuclear Information System (INIS)

    Abram, U.; Beyer, R.; Muenze, R.; Stach, J.; Kaden, L.; Lorenz, B.; Findeisen, M.

    1989-01-01

    The diamagnetic technetium(I) complex [Tc(DPPE)(TMP) 4 ]PF 6 was prepared from [Tc(N 2 )H(DPPE) 2 ] and characterized by elemental analysis. 1 H- and 99 Tc-NMR spectroscopy and fast atom bombardment mass spectrometry. [Tc(DPPE)(TMP) 4 ]PF 6 is a prototype compound for technetium complexes with mixed phosphine-phosphite coordination spheres. (author)

  7. An investigation into the technical feasibility of cyclotron production of technetium-99m

    International Nuclear Information System (INIS)

    Egan, G.F.; Lagunas-Solar, M.C.

    1994-01-01

    The role of technetium-99m in nuclear medicine is well established with 80 per cent to 90 per cent of all nuclear medicine studies utilising this isotope. Technetium-99m is currently produced from nuclear reactors via production of the parent radionuclide molybdenum-99. The reactor production of 99m Tc has both significant financial and environmental costs, with unresolved problems in the areas of radioactive waste disposal and reactor decommissioning. Recent scientific publications have indicated that medical quality 99m Tc may be produced using cyclotrons without having the associated problems of waste disposal and decommissioning. Further scientific research is now required to demonstrate the feasibility of this cyclotron production technique. A collaboration between the Cyclotron and PET Centre, Austin Hospital, the National Medical Cyclotron, ANSTO, Sydney, and the Crocker Nuclear Laboratory, University of California, Davis, USA has been proposed. The general objective of the proposed collaboration is to acquire additional scientific data to evaluate the 99m Tc cyclotron production method and to determine the feasibility of cyclotron technology for Australian nuclear medicine. 16 refs., 2 tabs

  8. Sorption of iodine, chlorine, technetium and cesium in soil

    International Nuclear Information System (INIS)

    Soederlund, M.; Lusa, M.; Lehto, J.; Hakanen, M.; Vaaramaa, K.

    2011-01-01

    The safety assessment of final disposal of spent nuclear fuel will include an estimate for the behavior of waste nuclides in the biosphere. As a part of this estimate also the sorption of radioactive iodine, chlorine, technetium and cesium in soil is to be considered. The chemistry and the sorption of these radionuclides in soils are described in this literature survey. Behavior of I-129, Cl-36 and Tc-99 in the environment is of great interest because of their long half-lives and relatively high mobilities. The importance of Cs-135 arises from its high content in spent nuclear fuel and long physical half-life, even though it is considered relatively immobile in soil. Factors affecting the migration and sorption of radionuclides in soils can be divided into elemental and soil specific parameters. The most important elemental factor is the speciation of the element, which is influenced by the soil redox potential, pH and complex forming ligands. Soil micro-organisms can either serve as sorbents for radionuclides or affect their speciation by altering the prevailing soil redox conditions. Soil organic matter content and mineral properties have a marked influence on the retention of radionuclides. The sorption of anionic radionuclides such as I-, Cl- and TcO 4 - is pronounced in the presence of organic matter. Clay minerals are known to bound cesium effectively. The effect of speciation of radioactive iodine, chlorine, technetium and cesium in soil is considered in this study, as well as the effect of soil micro-organisms, organic matter and mineral properties. (orig.)

  9. Technetium-99m Sestamibi in Multiple Myeloma

    International Nuclear Information System (INIS)

    Saber, R.A.

    2002-01-01

    Technetium-99m 2-methoxy - isobutyl - isonitrile (99mTc-MIBI) has been reported to be useful in evaluating patients with multiple myeloma. The aim of this study is to evaluate the role of technetium-99m sestamibi (99mTc-MIBI) scintigraphy in the diagnosis. staging and follow-up of patients with multiple myeloma. Methods and Materials: twenty-five consecutive patients with multiple myeloma were studied using 99mTc- MIBI. Of the 25 patients included in this study, 6 were in stage I, II in stage II and 8 in stage III. Anterior and posterior whole-body imaging were obtained 20 min after I.V. injection of 740 MBq of 99mTc-MIBI. Four different MIBI patterns could be described in our patients: physiological (P), diffuse (D), focal (F) and combined diffuse and focal (D+F). All patients in stages II and III as well as 3 patients in stage I were treated with chemotherapy (cyclophosphamide and prednisone) then 99mTc-MlBI scans were repeated after 6 courses. Results: in comparison to conventional X-ray skeletal survey, 99mTc-MIBI scans showed a higher number of myeloma bone disease at diagnosis. All patients with stage II and III multiple myeloma were positive with 99mTc-MlBl scans at diagnosis. The pattern of positive MIBI accumulation was diffuse in 13 (52%) patients, focal in 4 (16%) and combined focal and diffuse in 6 (24%) patients. The intensity of 99mTc-MIBI correlated with disease activity as determined by lactate dehydrogenase (LDH), number of plasma cells in bone marrow and serum electrophoresis. There was a direct correlation between 99mTc-MIBI scan result and clinical outcome of patients following 6 courses of chemotherapy. Sensitivity and specificity of 99mTc-MIBI scintigraphy in detecting myeloma bone lesions were 92% and 90% respectively. Conclusion: 99mTc-MIBI scintigraphy is a reliable method to evaluate bone marrow activity in patients with multiple myeloma and follow-up of myeloma bone lesions

  10. Increased technetium uptake is not equivalent to muscle necrosis: scintigraphic, morphological and intramuscular pressure analyses of sore muscles after exercise

    Science.gov (United States)

    Crenshaw, A. G.; Friden, J.; Hargens, A. R.; Lang, G. H.; Thornell, L. E.

    1993-01-01

    A scintigraphic technique employing technetium pyrophosphate uptake was used to identify the area of skeletal muscle damage in the lower leg of four runners 24 h after an ultramarathon footrace (160 km). Most of the race had been run downhill which incorporated an extensive amount of eccentric work. Soreness was diffuse throughout the posterior region of the lower leg. In order to interpret what increased technetium uptake reflects and to express extreme endurance related damages, a biopsy was taken from the 3-D position of abnormal uptake. In addition, intramuscular pressures were determined in the deep posterior compartment. Scintigraphs revealed increased technetium pyrophosphate uptake in the medial portion of the gastrocnemius muscle. For 3698 fibres analysed, 33 fibres (1%) were necrotic, while a few other fibres were either atrophic or irregular shaped. A cluster of necrotic fibres occurred at the fascicular periphery for one subject and fibre type grouping occurred for another. Ultrastructural analysis revealed Z-line streaming near many capillaries and variously altered subsarcolemmal mitochondria including some with paracrystalline inclusions. The majority of the capillaries included thickened and irregular shaped endothelial cells. Intramuscular pressures of the deep posterior compartment were slightly elevated (12-15 mmHg) for three of the four subjects. Increased technetium uptake following extreme endurance running does not just reflect muscle necrosis but also subtle fibre abnormalities. Collectively, these pathological findings are attributed to relative ischaemia occurring during the race and during pre-race training, whereas, intramuscular pressure elevations associated with muscle soreness are attributed to mechanical stress caused by extensive eccentric work during the race.

  11. Elimination of interference of 129-iodine by its adsorption at extraction separation of 99-technetium

    International Nuclear Information System (INIS)

    Metelkova, M.; Tkac, P.; Kopunec, R.

    2001-01-01

    Three types of macro-amount of anions SO 4 2- , CO 3 2- , OH - in the presence of I- were chosen in this work for comparison of competition with TcO 4 - anions in extraction reaction with Ph 4 As + , where weak, medium and strong competition can be expected respectively. Ph 4 AsCl in chloroform was used as organic phase. The influence of solid AgI or AgCl on Tc extraction was also studied in this extraction systems. The extraction of technetium after four-multiplied extraction from chosen solutions was studied. This procedure was applied in the process of Tc extraction from solutions of reprocessing plant. Various concentrations of K 2 CrO 4 and UO 2 (NO 3 ) 2 in water phase on Tc extraction was investigate, too. The influence of I - ( 131 I) in the process of extraction separation of technetium was studied. The iodine removal was taken out from the solution by its adsorption on insoluble AgI or AgCl phase. The yields for 99m Tc were higher than 95% in organic phase and for 131 I higher than 80% in AgI or AgCl. It is possible to note, that this procedure can be also applied for 99 Tc and 129 I separation and estimation. The results of the extraction are presented in the form of graphical plots of technetium distribution ratio (D Tc , log D Tc ) or extraction yield (E Tc %) against concentration of investigate component in aqueous phase. (authors)

  12. Specifications and Quality of Technetium99m Produced diopharmaceuticals According to Good Manufacturing Practice Regulations

    International Nuclear Information System (INIS)

    Abudaia, Jamal; Ben Othman, Monji H.; Maatoug, Maatoug A.; Maatoug, M. Omar

    2003-01-01

    A Technological revolution has occurred in the last two decades of this century in field of Cold Kits preparations processed by Lyophilization technique (A drying process while frozen) which are labeled afterwards with Technetium-99m radionuclide. Such materials are intended to be used as Radiopharmaceutical probes in nuclear medicine for the diagnosis of dynamic and static conditions of organs, and therefore; uncovering of diseases and syndromes targeting humans. Preferability and the advantages of such kits labeled with Technetium-99m radionuclide over other types of radiopharmaceuticals is attributed to the unique physical properties of the radionuclide including its short half life of 6.02 hours, low photon energy of 140 keV, lacking of alpha and beta particles which are usually exposing patients to have additional exposed doses. Moreover, simplicity in obtaining such radionuclide in form portable generators containing the mother radionuclide Molybdenum - 99 (i.e. solvent extraction generators or adsorption column chromatographic generators) for-on-the- spot-labeling, and the ability of formulating the cold kits as chemical complexes located at different organs of human body. Those lyophilized kits intended for radiopharmaceutical preparations labeled with Technetium - 99m radionuclide must stand for quality assurance standards and assessments for the sake of safety, efficiency, apyrogenecity, radiochemical purity, in- vivo stability and suitability for the endeavor planed for. Therefore, in order to control and optimize those considerations, implementations of the so-called GOOD MANUFACTURING PRACTICE composed of regulations and constitutional laws related to the process of preparation and final produced preparation must take place.(author)

  13. Technetium in late-type stars. I. Observations

    International Nuclear Information System (INIS)

    Little-Marenin, I.R.; Little, S.J.

    1979-01-01

    An analysis of about 90 spectra (11 or 13A/mm) of nonvariable and variable (mostly Mira variables) M, MS, S, CS, and C stars for the presence of the radioactive element technetium (T/sub 1/2/approx. =2 x 10 5 y) suggests that Tc is most often present at certain variability periods. Stars with no Tc I lines in their spectra can be found at most periods (P-bar=234/sup d/), whereas stars with Tc I lines have periods in most cases in excess of 300 days (P-bar=330/sup d/ +- 83/sup d/). Interpreting our data in terms of kinematic studies by Feast (1963) suggests that the stars with Tc are Pop I and that variables without Tc are largely Pop II type stars

  14. Contribution for labelling study of cellular and molecular structures of biomedical interest with technetium 99

    International Nuclear Information System (INIS)

    Rebello, L.H.; Piotkwosky, M.C.; Pereira, J.A.A.; Boasquevisque, E.M.; Silva, J.R.M.; Reis, R.J.N.; Pires, E.T.; Bernardo-Filho, M.

    1992-01-01

    The methodologies for labelling bacteria, planaria and cercaria from schistosomiasis evolution cycle and in oxamniquine with technetium 99 m, developed in the Biomedical Center of Rio de Janeiro University and in the Research Center of National Institute of Cancer are shown. (C.G.C.)

  15. On the technetium abundance determination in the atmospheres of red giants

    International Nuclear Information System (INIS)

    Kipper, T.A.

    1987-01-01

    Technetium abundance in the atmospheres of S- and C-stars are estimated by comparing the synthetic and observed spectra for the TcI λ5924.47 region. It was found that reliable estimates are possible only for the pure S-stars and SC-stars. For the late carbon stars only the upper limit for the Tc abundance can be fiound. For TX Psc (C6.5) this was found to be lgε Tc =0.5

  16. Extraosseous uptake of sup(99m)technetium methylene diphosphonate: Neuroblastoma or radiation therapy

    Energy Technology Data Exchange (ETDEWEB)

    Sty, J R; Kun, L; Casper, J; Babbitt, D P [Wisconsin Univ., Milwaukee (USA). Dept. of Radiology

    1980-01-01

    A child with a ganglioneuroblastoma and tumor uptake of sup(99m)technetium methylene diphosphonate (sup(99m)Tc-MDP) is presented. After surgical removal of an encapsulated tumor and radiation therapy, an interval bone scan demonstrated the same presurgical abnormality. Awareness of abnormal uptake of sup(99m)Tc-MDP in irradiated renal tissue prevents interpreting radiation nephritis as recurrent tumor.

  17. Contribution to the study of the red blood cells labelled with chromium-51 and technetium-99 m

    International Nuclear Information System (INIS)

    Canine, M.S.

    1983-01-01

    Although the bindings of Cr-51 and Tc-99 m were both in the β chain of hemoglobin molecule, the results obtained after previous incubations of the RBC with chromium and technetium, and the determinations of the efficiency of the labeling of RBC showed that the points of fixing of chromium and technetium with β chain of hemoglobin were probably different. The observations through the optic microscope allowed the verification that, at the concentration of 100 mg/ml of Cr-50, there were morphologic in the RBC. These modifications were not found after the other treatments. The comparison between scintigraphy obtained with Tc-99 m or Cr-51 RBC suggested that the technique which employs Tc-99 m can be more adequate than the one with Cr-51. (author)

  18. 7 CFR 917.110 - Communications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Communications. 917.110 Section 917.110 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... CALIFORNIA Rules and Regulations General § 917.110 Communications. Unless otherwise prescribed in this...

  19. Complexes of technetium with polyhydric ligands

    International Nuclear Information System (INIS)

    Hwang, L.L.Y.; Ronca, N.; Solomon, N.A.; Steigman, J.

    1985-01-01

    Polyhydric complexes of Tc(V) show absorption bands near 500 nm, with molar absorptivity coefficients of about 100. The shorter-chain compounds like ethylene glycol produce complexes which quickly disproportionate to Tc(IV) (as TcO 2 ) and Tc(VII) (as TcO 4 - ) on acidification. The longer-chain ligands like mannitol and gluconate do not. However, while the mannitol complex shows no change in spectrum from pH 12 to pH 3, the gluconate and glucoheptonate compounds show a definite spectral change on acidification, starting at pH 5. Electrophoresis similarity showed a change in mobility with pH for Tc-glucoheptonate, but none for Tc-mannitol. It was concluded that the carboxylic acid group of glucoheptonate was not binding the technetium. In 25 molal choline chloride the glucoheptonate-Tc mole ratio was 1:1 or less. A similar result emerged from a similar experiment in methylcellosolve as solvent. (author)

  20. Influence of some drugs, used in coronary artery disease on in vitro labelling red blood cells with technetium 99mTc

    International Nuclear Information System (INIS)

    Poniatowicz-Frasunek, E.

    1997-01-01

    In some patients investigated by radionuclide ventriculography poor labeling efficiency of red blood cells with technetium 99m Tc is observed. Among possible mechanisms responsible for this phenomenon, the pharmacological treatment applied to the patients should be taken into consideration. The aim of the study was to define the effect of selected drugs used in CAD on technetium binding efficiency by erythrocytes in vitro. Blood samples were obtained from 40 normal individuals receiving no medication. The effect of the following drugs were examined: Aerosonit, Isoptin, Bemecor, Dopegyt, Enarenal, Binazin, Furosemid, Aspirin, Vitamin E and Propranolol. Only Enarenal and Vitamin E proved to have no effect on technetium binding efficiency. The most expressed reduction was observed in experiments with Aerosonit, Furosemid and Propranolol and the smallest changes were found in blood samples with Bemecor, Binazin and Aspirin. The results of the study suggest that pharmacological treatment may influence the quality of scintigraphic images obtained with radioisotope ventriculography. For that reason the medicines applied to the patients should be as much as possible reduced or withdrawn for at least several days before examination. (author)

  1. Spectroscopic studies on technetium and silicon. A solid-state laser system for the resonance-ionization spectroscopy; Spektroskopische Untersuchungen an Technetium und Silizium. Ein Festkoerperlasersystem fuer die Resonanzionisationsspektroskopie

    Energy Technology Data Exchange (ETDEWEB)

    Mattolat, Christoph

    2010-11-15

    This doctoral thesis describes advancement and refinement of the titanium:sapphire laser system of the working group LARISSA, Institut fuer Physik, Johannes Gutenberg- Universitaet Mainz and its application to resonance ionization spectroscopy. Activities on the laser systems comprised three major tasks: The output power of the conventional titanium:sapphire lasers could be increased by a factor of two in order to match the needs at resonance ionization laser ion source at ISOL facilities. Additionally, the laser system was complemented by a titanium:sapphire laser in Littrow geometry, which ensures a mode-hop free tuning range from 700 nm to 950 nm, and by an injection seeded titanium:sapphire laser with a spectral width of 20 MHz (in respect to a spectral width of 3 GHz for the conventional lasers). The performance of the new laser system was tested in spectroscopic investigations of highly excited atomic levels of gold and technetium. From the measured level positions the ionization potential of gold could be verified by using the Rydberg-Ritz formula, while the ionization potential of technetium could be determined precisely for the first time. Using the seeded titanium: sapphire laser Doppler-free two-photon spectroscopy inside a hot ionizer cavity was demonstrated. A width of the recorded resonances of 90 MHz was achieved and the hyperfine structure and isotope shift of stable silicon isotopes was well resolved with this method. (orig.)

  2. Complex formation of technetium with the methyl esters of MAG2 and MAG1

    International Nuclear Information System (INIS)

    Noll, B.; Noll, S.; Grosse, B.; Johannsen, B.; Spies, H.

    1993-01-01

    Mercaptoacetylglycine methyl ester (MAG 2 ester) and mercaptoacetyldiglycine methyl ester (MAG 1 ester) were included to investigate complex formation of SH/amide ligands with technetium. The studies are aimed at finding out how blocking the carboxylic groups influences the complexation reaction, with a view to finding an approach to new lipophilic species. (orig./BBR)

  3. Studies on technetium clethrochelate. Pt.1. Synthesis and characterization of three new BATO complexes

    International Nuclear Information System (INIS)

    Li Hongfeng; Wang Xiangyun; Liu Yuanfang

    1995-01-01

    Three BATO (boronic acid adducts of technetium tris (dioxime) complexes are synthesized from α-dioximes, boronic acid, 99 TcO 4 - and SnCl 2 by the template reaction. Their IR and UV/V spectra are measured to have similar features as those of 99 TcCl(DMG) 3 BC 6 H 4 CH 3

  4. Labeling of thymine with {sup 99m} technetium: a suggestion of a chemical model

    Energy Technology Data Exchange (ETDEWEB)

    Gutfilen, Bianca; Silva, Claudia Ribeiro da; Bernardo Filho, Mario [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Inst. de Biologia. Dept. de Biofisica e Biometria; Ribeiro, Barbara Luzia Almeida [Instituto Nacional do Cancer, Rio de Janeiro, RJ (Brazil). Centro de Pesquisa Basica; Mattos, Maura Ferreira [Universidade do Estado, Rio de Janeiro, RJ (Brazil). Inst. de Quimica

    1996-03-01

    Successful targeting of diagnose but also to stage cancer. It has been shown that certain tumor cells are permeable to low level of exogenous adenosine-diphosphate and adenosine-triphosphate nucleotides, that are incorporated into intracellular pools. We present the labeling of a nucleotide precursor, a base, thymine technetium-99m ({sup 99m} Tc). (author)

  5. 11 CFR 6.110 - Evaluation.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Evaluation. 6.110 Section 6.110 Federal... OR ACTIVITIES CONDUCTED BY THE FEDERAL ELECTION COMMISSION § 6.110 Evaluation. (a) Within one year of... persons, including handicapped persons and organizations representing handicapped persons, and evaluation...

  6. Technetium in alkaline, high-salt, radioactive tank waste supernate: Preliminary characterization and removal

    International Nuclear Information System (INIS)

    Blanchard, D.L. Jr.; Brown, G.N.; Conradson, S.D.

    1997-01-01

    This report describes the initial work conducted at Pacific Northwest National Laboratory to study technetium (Tc) removal from Hanford tank waste supernates and Tc oxidation state in the supernates. Filtered supernate samples from four tanks were studied: a composite double shell slurry feed (DSSF) consisting of 70% from Tank AW-101, 20% from AP-106, and 10% from AP-102; and three complexant concentrate (CC) wastes (Tanks AN-107, SY-101, ANS SY-103) that are distinguished by having a high concentration of organic complexants. The work included batch contacts of these waste samples with Reillex trademark-HPQ (anion exchanger from Reilly Industries) and ABEC 5000 (a sorbent from Eichrom Industries), materials designed to effectively remove Tc as pertechnetate from tank wastes. A short study of Tc analysis methods was completed. A preliminary identification of the oxidation state of non-pertechnetate species in the supernates was made by analyzing the technetium x-ray absorption spectra of four CC waste samples. Molybdenum (Mo) and rhenium (Re) spiked test solutions and simulants were tested with electrospray ionization-mass spectrometry to evaluate the feasibility of the technique for identifying Tc species in waste samples

  7. Can aquatic macrophytes mobilize technetium by oxidizing their rhizosphere?

    International Nuclear Information System (INIS)

    Sheppard, S.C.; Evenden, W.G.

    1991-01-01

    Technetium (Tc) is very mobile in aerated surface environments, but is essentially immobile and biologically unavailable in anaerobic sediments. Aquatic macrophyte roots penetrate anaerobic sediments, carrying O 2 downward and frequently creating oxidizing conditions in their rhizosphere. The authors hypothesized that this process could mobilize otherwise unavailable Tc, possibly leading to incorporation of Tc into human or animal foods. Through experiments with rice (Oryza sativa L.), and with a novel artificial macrophyte root, they concluded that this pathway is unlikely to be important for annual plants, especially in soils with a high biological oxygen demand. The relatively slow oxidation of Tc limited its mobilization by short-lived root systems

  8. Stabilization of marked hexametazima with technetium 99-metastables (99mTc) with chloride of cobalt hexahidratado, for the labelling of leukocytes

    International Nuclear Information System (INIS)

    Oliva Palencia, Rosa Maria

    1996-01-01

    Presently study you work with hexametilpropilen amino oxima (HM-PAO), radiopharmaceuticals of labelling leucocytes marking it with technetium 99 recently acquired of the second elution of a generator of molybdenum technetium adding chloride of cobalt hexahidratado in different concentrations, as stabilizing agent in order to settling down if it prolongs the useful life of this expensive radiopharmaceuticals for but of minutes. For it one carries out the determination from the purity radiochemical to the 5,60,120 and 180 minutes after the labelled and the labelling of leukocytes is made with quality control of the cells after the labelling compared against a control

  9. Solidification/stabilization of technetium in cement-based grouts

    International Nuclear Information System (INIS)

    Gilliam, T.M.; Bostick, W.D.; Spence, R.D.; Shoemaker, J.L.

    1990-01-01

    Mixed low-level radioactive and chemically hazardous process treatment wastes from the Portsmouth Gaseous Diffusion Plant are stabilized by solidification in cement-based grouts. Conventional portland cement and fly ash grouts have been shown to be effective for retention of hydrolyzable metals (e.g., lead, cadmium, uranium and nickel) but are marginally acceptable for retention of radioactive Tc-99, which is present in the waste as the highly mobile pertechnate anion. Addition of ground blast furnace slag to the grout is shown to reduce the leachability of technetium by several orders of magnitude. The selective effect of slag is believed to be due to its ability to reduce Tc(VII) to the less soluble Tc(IV) species. 12 refs., 4 tabs

  10. The determination of technetium-99 in environmental materials

    International Nuclear Information System (INIS)

    Harvey, B.R.; Ibbett, R.D.; Williams, K.J.; Lovett, M.B.

    1991-01-01

    The Aquatic Environment Protection Division of the Directorate of Fisheries Research (DFR), Lowestoft carries out analyses, on a routine basis, for a considerable range of radionuclides in a wide variety of environmental materials. Technetium-99 is included in the list of radionuclides for which analysis is regularly carried out as part of the DFR monitoring programme. Its determination is inevitably somewhat labour-intensive and over the years the procedures used have changed to accommodate increasing demands for information on the environmental behaviour of the nuclide. Reliable analytical procedures for the radiochemical separation and assaying of 99 Tc are thus important. Radiometric and gravimetric analyses described in this publication have been developed over a substantial period of time and have given excellent results in international intercomparison exercises. (author)

  11. Extraosseous uptake of sup(99m)technetium methylene diphosphonate: Neuroblastoma or radiation therapy

    International Nuclear Information System (INIS)

    Sty, J.R.; Kun, L.; Casper, J.; Babbitt, D.P.

    1980-01-01

    A child with a ganglioneuroblastoma and tumor uptake of sup(99m)technetium methylene diphosphonate (sup(99m)Tc-MDP) is presented. After surgical removal of an encapsulated tumor and radiation therapy, an interval bone scan demonstrated the same presurgical abnormality. Awareness of abnormal uptake of sup(99m)Tc-MDP in irradiated renal tissue prevents interpreting radiation nephritis as recurrent tumor. (orig.) [de

  12. 49 CFR 230.110 - Pilots.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Pilots. 230.110 Section 230.110 Transportation... and Equalizing System § 230.110 Pilots. (a) General provisions. Pilots shall be securely attached... clearance. The minimum clearance of pilot above the rail shall be 3 inches and the maximum clearance shall...

  13. 21 CFR 131.110 - Milk.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Milk. 131.110 Section 131.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.110 Milk. (a...

  14. 34 CFR 110.32 - Mediation.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Mediation. 110.32 Section 110.32 Education Regulations..., Conciliation, and Enforcement Procedures § 110.32 Mediation. (a) ED promptly refers to the Federal Mediation and Conciliation Service or to the mediation agency designated by the Secretary of Health and Human...

  15. 24 CFR 1710.110 - Roads.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Roads. 1710.110 Section 1710.110... (INTERSTATE LAND SALES REGISTRATION PROGRAM) LAND REGISTRATION Reporting Requirements § 1710.110 Roads. (a) Access to the subdivision. (1) Is access to the subdivision provided by public or private roads? What...

  16. An improved method for determination of technetium-99m half-life for the quality assurance procedures of radiopharmaceuticals

    International Nuclear Information System (INIS)

    Abd Jalil Abd Hamid; Juhari Mohd Yusof; Zakaria Ibrahim; Wan Mohd Ferdaus Wan Ishak; Mohamad Hafiz Ahmad

    2009-01-01

    An improve method for identity tests of technetium-99m for the quality assurance procedures are presented. Computerized methods based on the least-squares of decay curve fitting for half-life estimation of technetium-99m was tested. Thus, least-squares method was employ as a decay curve fitting procedures in our software. Theoretical calculated half-life of technetium-99m for evaluation was performed for comparison. In Fig. 3 is shown, the decay curve fitting of a sample over one second counting time interval. The R2 value of the curve suggests that the time of the study was too short to obtain acceptable value. A similar measurement for another data set was done for a longer period of time and in Table 1 is shown a representative decay curve fitting. The value was found to be 6.006 hours with a discrepancy of -0.28% from the value taken from the literature. The value is in agreement with the literature for time interval greater than 2 seconds. The results obtained by this method show that the used of least-squares method for decay curve fitting are appropriate for routine identity tests. This confirmed that the least-squares method applied in our decay curve fitting software are remarkably improved and convenient for routine identity tests purposes. (Author)

  17. Investigations Into the Nature of Alkaline Soluble, Non-Pertechnetate Technetium

    Energy Technology Data Exchange (ETDEWEB)

    Rapko, Brian M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Bryan, Samuel A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Chatterjee, Sayandev [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Edwards, Matthew K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Levitskaia, Tatiana G. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Peterson, James M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Peterson, Reid A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sinkov, Sergey I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2013-11-01

    This report summarizes work accomplished in fiscal year (FY) 2013, exploring the chemistry of a low-valence technetium(I) species, [Tc(CO)3(H2O)3]+, a compound of interest due to its implication in the speciation of alkaline-soluble technetium in several Hanford tank waste supernatants. Various aspects of FY 2013’s work were sponsored both by Washington River Protection Solutions and the U.S. Department of Energy’s Office of River Protection; because of this commonality, both sponsors’ work is summarized in this report. There were three tasks in this FY 2013 study. The first task involved examining the speciation of [(CO)3Tc(H2O)3]+ in alkaline solution by 99Tc nuclear magnetic resonance spectroscopy. The second task involved the purchase and installation of a microcalorimeter suitable to study the binding affinity of [(CO)3Tc(H2O)3]+ with various inorganic and organic compounds relevant to Hanford tank wastes, although the actual measure of such binding affinities is scheduled to occur in future FYs. The third task involved examining the chemical reactivity of [(CO)3Tc(H2O)3]+ as relevant to the development of a [(CO)3Tc(H2O)3]+ spectroelectrochemical sensor based on fluorescence spectroscopy.

  18. Technology Evaluations Related to Mercury, Technetium, and Chloride in Treatment of Wastes at the Idaho Nuclear Technology and Engineering Center of the Idaho National Engineering and Environmental Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    C. M. Barnes; D. D. Taylor; S. C. Ashworth; J. B. Bosley; D. R. Haefner

    1999-10-01

    The Idaho High-Level Waste and Facility Disposition Environmental Impact Statement defines alternative for treating and disposing of wastes stored at the Idaho Nuclear Technology and Engineering Center. Development is required for several technologies under consideration for treatment of these wastes. This report contains evaluations of whether specific treatment is needed and if so, by what methods, to remove mercury, technetium, and chlorides in proposed Environmental Impact Statement treatment processes. The evaluations of mercury include a review of regulatory requirements that would apply to mercury wastes in separations processes, an evaluation of the sensitivity of mercury flowrates and concentrations to changes in separations processing schemes and conditions, test results from laboratory-scale experiments of precipitation of mercury by sulfide precipitation agents from the TRUEX carbonate wash effluent, and evaluations of methods to remove mercury from New Waste Calcining Facility liquid and gaseous streams. The evaluation of technetium relates to the need for technetium removal and alternative methods to remove technetium from streams in separations processes. The need for removal of chlorides from New Waste Calcining Facility scrub solution is also evaluated.

  19. Technology Evaluations Related to Mercury, Technetium, and Chloride in Treatment of Wastes at the Idaho Nuclear Technology and Engineering Center of the Idaho National Engineering and Environmental Laboratory

    International Nuclear Information System (INIS)

    Barnes, C.M.; Taylor, D.D.; Ashworth, S.C.; Bosley, J.B.; Haefner, D.R.

    1999-01-01

    The Idaho High-Level Waste and Facility Disposition Environmental Impact Statement defines alternative for treating and disposing of wastes stored at the Idaho Nuclear Technology and Engineering Center. Development is required for several technologies under consideration for treatment of these wastes. This report contains evaluations of whether specific treatment is needed and if so, by what methods, to remove mercury, technetium, and chlorides in proposed Environmental Impact Statement treatment processes. The evaluations of mercury include a review of regulatory requirements that would apply to mercury wastes in separations processes, an evaluation of the sensitivity of mercury flowrates and concentrations to changes in separations processing schemes and conditions, test results from laboratory-scale experiments of precipitation of mercury by sulfide precipitation agents from the TRUEX carbonate wash effluent, and evaluations of methods to remove mercury from New Waste Calcining Facility liquid and gaseous streams. The evaluation of technetium relates to the need for technetium removal and alternative methods to remove technetium from streams in separations processes. The need for removal of chlorides from New Waste Calcining Facility scrub solution is also evaluated

  20. Influence of microbial activity on the migration behaviour of redox-sensitive radionuclides (technetium and selenium) in loose rock

    International Nuclear Information System (INIS)

    Stroetmann, I.

    1995-01-01

    In closed cycle column tests under sterile conditions there was no or hardly any sorption of the two radionuclides. In closed cycle column tests with unsterile soils, however, the two radionuclides were extremely immobilised (80 % of the output activity of Tc-95m and 40 % of the output activity of Se-75). By inoculation of the sterile columns with mixed soil cultures an increase in sorption of 40 % of the output activity was achieved which is attributed to the microbial activity. The adsorbed radionuclides in unsterile columns could be remobilized by adding a bactericide. In columns with saline water the sorption of radionuclides was slightly lower. Soils with a 5 % organic carbon content showed extremely increased sorption of the two radionuclides. In comparison with closed cycle columns shake tests were carried out. During turbulent intermixing of water and solid, no sorption of technetium was observed in unsterile tests either, while Se-75 added as selenite was strongly adsorbed to the solid. When adding acetate as a C-source, the microbially conditioned reduction of the redox potential to -100 mV and, subsequently, a strong increase of sorption could be observed. A reduction of the pH value in the soils to pH 4, and simultaneous adding of acetate significally reduced the microbial activity and the sorption of technetium, while selenite sorption remained strong as before. Sorption tests with bacteria-pure and mixed cultures showed no sorption of the pertechnetate anion in the oxidation stage (VII). However, when reducing the pertechnetate by means of SnCl2, up to 40 % of the feed activity of killed and living biomass was immobilized. Between 20-30 % of the adsorbed technetium quantity was outside at the membrane, and 40% inside the cells. After a three-day incubation period in a technetium-containing solution, a factor of 15,5 was achieved as the maximum intracellular concentration factor for the isolate 143 (Xanthomas sp.). (orig./MG) [de

  1. 45 CFR 235.110 - Fraud.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Fraud. 235.110 Section 235.110 Public Welfare... PROGRAMS § 235.110 Fraud. State plan requirements: A State plan under title I, IV-A, X, XIV, or XVI of the Social Security Act must provide: (a) That the State agency will establish and maintain: (1) Methods and...

  2. Evaluation of Technetium Getters to Improve the Performance of Cast Stone

    International Nuclear Information System (INIS)

    Neeway, James J.; Qafoku, Nikolla P.; Serne, R. Jeffrey; Lawter, Amanda R.; Stephenson, John R.; Lukens, Wayne W.; Westsik, Joseph H.

    2015-01-01

    Cast Stone has been selected as the preferred waste form for solidification of aqueous secondary liquid effluents from the Hanford Tank Waste Treatment and Immobilization Plant (WTP) process condensates and low-activity waste (LAW) melter off-gas caustic scrubber effluents. Cast Stone is also being evaluated as a supplemental immobilization technology to provide the necessary LAW treatment capacity to complete the Hanford tank waste cleanup mission in a timely and cost effective manner. One of the major radionuclides that Cast Stone has the potential to immobilize is technetium (Tc). The mechanism for immobilization is through the reduction of the highly mobile Tc(VII) species to the less mobile Tc(IV) species by the blast furnace slag (BFS) used in the Cast Stone formulation. Technetium immobilization through this method would be beneficial because Tc is one of the most difficult contaminants to address at the U.S. Department of Energy (DOE) Hanford Site due to its complex chemical behavior in tank waste, limited incorporation in mid- to high-temperature immobilization processes (vitrification, steam reformation, etc.), and high mobility in subsurface environments. In fact, the Tank Closure and Waste Management Environmental Impact Statement for the Hanford Site, Richland, Washington (TC&WM EIS) identifies technetium-99 ( 99 Tc) as one of the radioactive tank waste components contributing the most to the environmental impact associated with the cleanup of the Hanford Site. The TC&WM EIS, along with an earlier supplemental waste-form risk assessment, used a diffusion-limited release model to estimate the release of different contaminants from the WTP process waste forms. In both of these predictive modeling exercises, where effective diffusivities based on grout performance data available at the time, groundwater at the 100-m down-gradient well exceeded the allowable maximum permissible concentrations for 99 Tc. (900 pCi/L). Recent relatively short-term (63 day

  3. Evaluation of Technetium Getters to Improve the Performance of Cast Stone

    Energy Technology Data Exchange (ETDEWEB)

    Neeway, James J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla P. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Serne, R. Jeffrey [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lawter, Amanda R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Stephenson, John R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lukens, Wayne W. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Westsik, Joseph H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2015-11-01

    Cast Stone has been selected as the preferred waste form for solidification of aqueous secondary liquid effluents from the Hanford Tank Waste Treatment and Immobilization Plant (WTP) process condensates and low-activity waste (LAW) melter off-gas caustic scrubber effluents. Cast Stone is also being evaluated as a supplemental immobilization technology to provide the necessary LAW treatment capacity to complete the Hanford tank waste cleanup mission in a timely and cost effective manner. One of the major radionuclides that Cast Stone has the potential to immobilize is technetium (Tc). The mechanism for immobilization is through the reduction of the highly mobile Tc(VII) species to the less mobile Tc(IV) species by the blast furnace slag (BFS) used in the Cast Stone formulation. Technetium immobilization through this method would be beneficial because Tc is one of the most difficult contaminants to address at the U.S. Department of Energy (DOE) Hanford Site due to its complex chemical behavior in tank waste, limited incorporation in mid- to high-temperature immobilization processes (vitrification, steam reformation, etc.), and high mobility in subsurface environments. In fact, the Tank Closure and Waste Management Environmental Impact Statement for the Hanford Site, Richland, Washington (TC&WM EIS) identifies technetium-99 (99Tc) as one of the radioactive tank waste components contributing the most to the environmental impact associated with the cleanup of the Hanford Site. The TC&WM EIS, along with an earlier supplemental waste-form risk assessment, used a diffusion-limited release model to estimate the release of different contaminants from the WTP process waste forms. In both of these predictive modeling exercises, where effective diffusivities based on grout performance data available at the time, groundwater at the 100-m down-gradient well exceeded the allowable maximum permissible concentrations for 99Tc. (900 pCi/L). Recent relatively

  4. Labeling of creatinine with technetium-99m

    Energy Technology Data Exchange (ETDEWEB)

    Yurt Lambrecht, F. [Ege Univ., Bornova, Izmir (Turkey). Dept. of Nuclear Applications, Inst. of Nuclear Sciences; Durkan, K. [Dokuz Eylul Univ., Buca, Izmir (Turkey). Chemistry Technicianship Program, Izmir Vocational School; Soylu, A. [Dokuz Eylul Univ., Narlidere, Izmir (Turkey). Dept. of Pediatrics, Medical Faculty

    2004-07-01

    Creatinine is a clinically important index of renal glomerular filtration rate. Urine creatinine levels can be used as a screening test to evaluate kidney function or can be part of the creatinine clearance test. In case of kidney dysfunction or muscle disorders the creatinine concentration in serum/plasma may rise to a higher value than in healthy body. Technetium- 99m has been used in nuclear medicine and in biomedical research to label molecular and cellular structures employed as radiotracers. {sup 99m}Tc is utilized to label molecules and cells, used as radiopharmaceuticals, and also to label biological species. It presents many desirable characteristics. SnCl{sub 2} method is frequently used as a reducing agent in the {sup 99m}Tc- labeling process. Creatinine metabolism might be investigated by using labeled {sup 99m}Tc- creatinine in healthy or uremic rats. (orig.)

  5. Thallium-technetium-subtraction scintigraphy in secondary hyperparathyroidism

    International Nuclear Information System (INIS)

    Adalet, I.; Hawkins, T.; Clark, F.; Wilkinson, R.

    1994-01-01

    Between 1983 and 1992 thallium-technetium subtraction scintigraphy (TTS) was performed on 74 patients with clinical and biochemical evidence of hyperparathyroidism. Twenty-five of the 53 investigations since 1988 were conducted on patients with renal failure with a suspicion of secondary hyperparathyroidism. In a retrospective study we have evaluated radioisotope scintigraphy for patients with adenoma and for renal failure patients with possible parathyroid hyperplasia. Thirty of 74 patients underwent neck exploration. Scintigraphy detected 17 of 24 parathyroid adenomas (sensitivity 71%). In contrast, in six renal patients who came to operation, scintigraphy localised only 5 of 20 hyperplastic parathyroid glands (sensitivity 25%) and in one renal patient we localised a parathyroid adenoma. A review of the literature shows low detection rates for hyperplasia by TTS to be a common observation. Based on these findings a rational approach is offered for parathyroid localisation in renal patients prior to neck exploration. (orig.)

  6. Technetium-99m labeling anti-amastigote polyclonal antibodies of Leishmania amazonensis

    International Nuclear Information System (INIS)

    Araujo, J.G.V.C.; Toledo, V.P.C.P.; Guimaraes, T.M.P.D.; Bernardo-Filho, M.; Simal, C.J.R.; Mota, L.G.; Diniz, S.O.F.; Cardoso, V.N.

    2002-01-01

    Anti-amastigote polyclonal antibody (IgG) was incubated with solutions of stannous chloride and sodium borohidride. After that, 3.7 MBq of technetium-99m ( 99m Tc) was added. A labeling yield of the antibody about 84% was obtained. After filtration of 99m Tc-IgG, the radiochemical purity increased from 84 to 95%. The labeling of IgG with 99m Tc did not modify the immunoreactivity of the antibody, since it was able to identify in vitro and in vivo the specific antigen of Leishmania amazonensis

  7. Labelling of Klebsiella pneumoniae with technetium-99m: a preliminary communication

    International Nuclear Information System (INIS)

    Bernardo Filho, M.; Pereira, J.A.A.; Boasquevisque, E.M.

    1986-01-01

    The labeling of Klebsiella pneumoniae with technetium-99m (Tc-99m) seems to depend on the stannous ion (Sn ++ ) concentration. Starting at 3μg/ml of this ion is the suspension fluid an uptake of Tc-99m close to 90% was observed. The labeling is apparently strong, since the eluation of Tc-99m, after incubation of the tagged culture, in a water-bath at 37 0 C for several hours, was very weak. The viability of the culture was unaltered after treatment with tin and Tc-99m. (Author) [pt

  8. Determination of technetium-99 in mixed fission products by neutron activation analysis

    International Nuclear Information System (INIS)

    Bate, L.C.

    1980-01-01

    A method has been developed for analysis of 99 Tc in fission product mixtures. The analysis consists of a chemical separation of 99 Tc, neutron irradiation of the isolated 99 Tc, and gamma-ray spectrometric determination of the induced 100 Tc radioactivity. Technetium-99 is chemically separated from most fission products by a cyclohexanone extraction from basic carbonate solution. Technetium-99 is stripped into water by addition of carbon tetrachloride to the cyclohexanone phase. A final step in the separation procedure is adsorption of 99 Tc on an anion exchange column which provides additional decontamination and places the 99 Tc in a concentrated form for neutron activation analysis. Neutron irradiations of the isolated 99 Tc were made in the pneumatic tube facility at the High Flux Isotope Reactor at a flux of 5 x 10 14 n/cm 2 /sec for 11 seconds. Induced 100 Tc radioactivity was determined immediately after irradiation using gamma-ray spectrometry to measure the 540 and 591 keV lines. Sensitivity of the analysis under these conditions is approximately 5 ng, and samples of up to about 100 ml volume can be easily processed. The method has been successfully applied to reactor fuel solutions and off-gas traps containing 6.5 x 10 -4 to 240 μg 99 Tc/ml

  9. Effect of technetium Tc 99m pertechnetate on bacterial survival in solution

    International Nuclear Information System (INIS)

    Stathis, V.J.; Miller, C.M.; Doerr, G.F.; Coffey, J.L.; Hladik, W.B.

    1983-01-01

    Survival of Staphylococcus epidermidis (10(2) organisms/ml) in solutions containing various levels of radioactivity was assessed. Six test preparations contained nonbacteriostatic 0.9% sodium chloride solution; four of these contained technetium Tc 99m pertechnetate (99mTcO-4) in various quantities (80, 250, 500, and 750 mCi). A fifth contained technetium that had decayed to an essentially nonradioactive form, and a sixth contained 0.9% sodium chloride solution only. Each of the six 20-ml solutions was inoculated with 2 ml of single-strength trypticase soy broth (TSB) containing 10(3) organisms/ml. At various times up to 12 hours after inoculation, 1-ml aliquots of each test solution were withdrawn and passed through 0.22-micron filters, thereby preventing further irradiation of the filtered organisms. The filters were incubated in single-strength TSB at 37 degrees C, and samples were examined for turbidity at 24, 48, and 72 hours. After 24 hours, 25 of the 36 sample tubes showed turbidity; after 48 hours, the turbid samples totaled 28. Bacteria in the two nonradioactive solutions remained viable throughout the 12-hour sampling period. Accumulated doses of radiation obtained in the 250-, 500-, and 750-mCi samples inhibited bacterial growth. To be a valid quality-control measure, sterility monitoring of prepared radiopharmaceutical dosage forms may need to be performed concurrently with their preparation

  10. Adsorption and desorption experiments in the natural redox milieu over several months, using technetium as an example

    International Nuclear Information System (INIS)

    Winkler, A.; Bruehl, H.; Trapp, C.

    1986-01-01

    Complicated experimental equipment has been developed in order to carry out long-term laboratory studies under true to reality, stable conditions simulating the natural milieu of the formation waters, i.e. the redox potential in the range + 200 to -70 mV. The single-pass column experiments have been made with loose rock samples from the Gorleben site and with natural formation water samples in order to study the adsorption and desorption and thus the mobility of technetium, as well as the building up of the geochemical equilibrium state, which has been studied in circulation columns. The results show that the process of Tc fixation in the loose rock in a lower redox milieu is not so much influenced by adsorption or desorption conditions but rather more by changes of the Eh-conditions, i.e. by the oxidation stage of the technetium. (RB) [de

  11. Preparation and crystal structure of carbonyltris (diethyldithiocarbamato) technetium (III): an unexpected source of co-ordinated carbon monoxide

    International Nuclear Information System (INIS)

    Baldas, J.; Bonnyman, J.; Pojer, P.M.; Williams, G.A.

    1981-10-01

    Tc(S 2 CNEt 2 ) 3 CO has been prepared by the reduction of NH 4 TcO 4 with formamidinesulphinic acid in the presence of NaS 2 CNEt 2 . It is suggested that the co-ordinated carbon monoxide is formed after co-ordination of formamidinesulphinic acid, or some decomposition product, with technetium. The crystal structure of Tc(S 2 CNEt 2 ) 3 CO has been determined by single-crystal X-ray diffraction methods at 17 deg. C. Diffractometry has provided significant Bragg intensities for 2045 independent reflections and the structure has been refined by full-matrix least-squares methods to R 0.049. The compound is isostructural with the rhenium analogue and consists of discrete Tc(S 2 CNEt 2 ) 3 CO molecules, each containing a terminal linear CO group. The technetium atom has a seven co-ordinate environment which is best described as a distorted pentagonal bipyramid

  12. 32 CFR 865.110 - Decision process.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 6 2010-07-01 2010-07-01 false Decision process. 865.110 Section 865.110...-GENERAL PERSONNEL REVIEW BOARDS Air Force Discharge Review Board § 865.110 Decision process. (a) The DRB... decision making process. ...

  13. 5 CFR 950.110 - Prohibited discrimination.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Prohibited discrimination. 950.110 Section 950.110 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE... PRIVATE VOLUNTARY ORGANIZATIONS General Provisions § 950.110 Prohibited discrimination. Discrimination for...

  14. Increased uptake of technetium-99m methylene diphosphonate in muscles in the course of polymyositis

    International Nuclear Information System (INIS)

    Niemir, Z.; Oleksa, R.; Czepczynski, R.; Sowinski, J.

    2005-01-01

    A case of a woman aged 46 years with signs of rhabdomyolysis and acute renal failure is presented. Coxsackie serum test was positive. Increased uptake of Technetium-99m methylene diphosphonate ( 99mT c-MDP) by muscles of thighs and calves was observed. After 1 year no increased accumulation of radiotracer in the muscles was found

  15. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences; Localisation moleculaire de l'americium, du technetium et du cesium chez des animaux marins comestibles leur comportement metabolique et ses consequences

    Energy Technology Data Exchange (ETDEWEB)

    Pieri, J; Goudard, F; Milcent, M C [Laboratoire de Biochimie et Radiochimie, Faculte des Sciences et des Techniques, Nantes Cedex (France)

    1992-07-01

    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  16. Extraosseous uptake of /sup 99/sup(m)technetium methylene diphosphonate. Neuroblastoma or radiation therapy

    Energy Technology Data Exchange (ETDEWEB)

    Sty, J R; Kun, L; Casper, J; Babbitt, D P

    1980-01-01

    A child with a ganglioneuroblastoma and tumor uptake of /sup 99/sup(m)technetium methylene diphosphate (/sup 99/sup(m)Tc-MDP) is presented. After surgical removal of an encapsulated tumor and radiation therapy, an interval bone scan demonstrated the same presurgical abnormality. Awareness of abnormal uptake of /sup 99/sup(m)Tc-MDP in irradiated renal tissue prevents interpreting radiation nephritis as recurrent tumor.

  17. Experimental study and quality control of a technetium-99 generator

    International Nuclear Information System (INIS)

    Jimeno de Osso, F.

    1981-01-01

    The performarce of a generator of technetium-99m to be used in nuclear medicine is studied. The most interesting characteristic of this generator is the use of a U-shaped chromatographuc column so as to improve its efficiency and design without increasing the weight of its shield. With the aim of improving certain aspects of the generator, molibdenum-99 was applied to adecuate pH, pirogens were removed from the column set up before application, application was effected on a dry column, the smallest alumina particles were separated on the column, etc. The most important parameters of an isotopic generator are studied, and the corresponding quality controls performed. (author)

  18. Technetium Immobilization Forms Literature Survey

    Energy Technology Data Exchange (ETDEWEB)

    Westsik, Joseph H.; Cantrell, Kirk J.; Serne, R. Jeffrey; Qafoku, Nikolla

    2014-05-01

    Of the many radionuclides and contaminants in the tank wastes stored at the Hanford site, technetium-99 (99Tc) is one of the most challenging to effectively immobilize in a waste form for ultimate disposal. Within the Hanford Tank Waste Treatment and Immobilization Plant (WTP), the Tc will partition between both the high-level waste (HLW) and low-activity waste (LAW) fractions of the tank waste. The HLW fraction will be converted to a glass waste form in the HLW vitrification facility and the LAW fraction will be converted to another glass waste form in the LAW vitrification facility. In both vitrification facilities, the Tc is incorporated into the glass waste form but a significant fraction of the Tc volatilizes at the high glass-melting temperatures and is captured in the off-gas treatment systems at both facilities. The aqueous off-gas condensate solution containing the volatilized Tc is recycled and is added to the LAW glass melter feed. This recycle process is effective in increasing the loading of Tc in the LAW glass but it also disproportionally increases the sulfur and halides in the LAW melter feed which increases both the amount of LAW glass and either the duration of the LAW vitrification mission or the required supplemental LAW treatment capacity.

  19. Clinical comparison of cardiac blood pool visualization with technetium-99m red blood cells labeled in vivo and with technetium-99m human serum albumin

    International Nuclear Information System (INIS)

    Thrall, J.H.; Freitas, J.E.; Swanson, D.; Rogers, W.L.; Clare, J.M.; Brown, M.L.; Pitt, B.

    1978-01-01

    Technetium-99m red blood cells (Tc-RBC) labeled by an in vivo technique were compared with two preparations of Tc-99m human serum albumin (HSA) for cardiac blood-pool imaging. Relative distribution of the tracers was analyzed on end-diastolic frames of gated blood-pool studies and on whole-body (head to mid-thigh) anterior pinhole images. The Tc-RBC demonstrated greater relative percentage localization in the cardiac blood pool, higher target-to-background ratios in the left ventricle, and less liver concentration. For cardiac blood-pool imaging, Tc-RBC labeled by the in vivo approach appears to be superior to the two Tc-HSA preparations studied

  20. Dicty_cDB: VFF110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFF110 (Link to dictyBase) - - - Contig-U10843-1 VFF110P (Link... to Original site) VFF110F 496 VFF110Z 306 VFF110P 802 - - Show VFF110 Library VF (Link to library) Clone ID VFF110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U10843-1 Original site URL http://dict...AVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---XIFKVXXNGGIXXQXIXXPQGKFQXXKSKXXRXKXLITG...VYKGRCRLKDVAVKVMLKQVDQKTLTDF RKEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLESLL--- ---qflklxxmxvfxxkxfxxpkvnskxxkv

  1. 46 CFR 403.110 - Accounting entities.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Accounting entities. 403.110 Section 403.110 Shipping COAST GUARD (GREAT LAKES PILOTAGE), DEPARTMENT OF HOMELAND SECURITY GREAT LAKES PILOTAGE UNIFORM ACCOUNTING SYSTEM General § 403.110 Accounting entities. Each Association shall be a separate accounting...

  2. 41 CFR 115-1.110 - Deviations.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviations. 115-1.110 Section 115-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) ENVIRONMENTAL PROTECTION AGENCY 1-INTRODUCTION 1.1-Regulation System § 115-1.110 Deviations...

  3. 1 CFR 500.110 - Self-evaluation.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 500.110 Section 500.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL COMMISSION FOR EMPLOYMENT POLICY § 500.110 Self-evaluation... or organizations representing handicapped persons, to participate in the self-evaluation process by...

  4. 1 CFR 457.110 - Self-evaluation.

    Science.gov (United States)

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Self-evaluation. 457.110 Section 457.110... PROGRAMS OR ACTIVITIES CONDUCTED BY THE NATIONAL CAPITAL PLANNING COMMISSION § 457.110 Self-evaluation. (a... organizations representing handicapped persons, to participate in the self-evaluation process by submitting...

  5. 49 CFR 28.110 - Self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false Self-evaluation. 28.110 Section 28.110 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION § 28.110 Self-evaluation...

  6. 7 CFR 922.110 - Container exemption.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Container exemption. 922.110 Section 922.110... COUNTIES IN WASHINGTON Container Exemption; Waivers of Inspection and Certification § 922.110 Container exemption. Whenever container limitations are effective pursuant to § 922.52, a handler may make test...

  7. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences

    International Nuclear Information System (INIS)

    Pieri, J.; Goudard, F.; Milcent, M.C.

    1992-01-01

    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  8. Study of technetium behaviour in radiopharmaceuticals. Characterization of sup(99m)Tc-pyrophosphate, sup(99m)Tc-dimercaptosuccinate, sup(99m)Tc-diethylenetriaminepentaacetate complexes and sup(99m)Tc-colloidal rhenium sulphide

    International Nuclear Information System (INIS)

    Saccavini, J.-C.

    1980-12-01

    The chemistry of technetium in extremely dilute solution was approached through the study of three complexing agents and a colloid. By the application of high-performance chromatographic techniques to the analysis of (Tc-pyro), (Tc-DTPA), (Tc-DMSA) complexes it was possible to isolate one or more chelates from a single complexing agent. Addition of pertechnetates to a solution of sodium pyrophosphates and stannous chloride at neutral pH leads to the formation of two complexes, both highly osteotropic. By the use of sup(117m)Sn it was shown that tin employed as reducing agent enters into the composition of one of the two complexes, either of which may be obtained preferentially by varying the (Sn)/(pyro) ratio. With technetium at acid pH (2.5) DMSA gives one or more chelates according to the concentration of the reagents present. DTPA with technetium at neutral pH gives a single complex for which a structure is proposed. The addition of calcium, indispensable for DTPA injection, leads to the appearance of a second bimetallic complex in very much smaller proportions than the first. The size distribution of some colloids was studied by ultrafiltration and permeation on gel. The preparation of colloidal rhenium sulphide and the technetium labelling conditions needed to obtain a very fine colloid were developed. The behaviour of technetium in the presence of colloidal rhenium sulphide and tin pyrophosphate was followed by sup(99m)Tc - sup(186)Re and sup(99m)Tc - sup(117m)Sn double-labelling tests. One reduced technetium fraction associates with the hydrolysed tin, the other follows the rhenium sulphide [fr

  9. 34 CFR 300.110 - Program options.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Program options. 300.110 Section 300.110 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION AND... DISABILITIES State Eligibility Other Fape Requirements § 300.110 Program options. The State must ensure that...

  10. 41 CFR 105-1.110 - Deviation.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Deviation. 105-1.110 Section 105-1.110 Public Contracts and Property Management Federal Property Management Regulations System (Continued) GENERAL SERVICES ADMINISTRATION 1-INTRODUCTION 1.1-Regulations System § 105-1.110 Deviation. (a...

  11. 41 CFR 101-1.110 - Deviation.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Deviation. 101-1.110 Section 101-1.110 Public Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS GENERAL 1-INTRODUCTION 1.1-Regulation System § 101-1.110 Deviation...

  12. 42 CFR 136.110 - Facilities construction.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Facilities construction. 136.110 Section 136.110..., DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH Grants for Development, Construction, and Operation of Facilities and Services § 136.110 Facilities construction. In addition to other requirements of this subpart...

  13. Soil-to-Rice Seeds Transfer Factors of Radioiodine and Technetium for Paddy Fields around the Radioactive-Waste Disposal Site in Gyeongju

    International Nuclear Information System (INIS)

    Choi, Yong Ho; Lim, Kwang Muk; Jun, In; Park, Doo Won; Keum, Dong Kwon; Han, Moon Hee

    2010-01-01

    Radiotracer experiments were performed over two years using pot cultures in a greenhouse to investigate soil-torice seeds transfer factors of radioiodine and technetium for paddy fields around the radioactive-waste disposal site in Gyeongju. Before transplanting rice seedlings, the top about 20 cm soils were thoroughly mixed with 125 I (2007) and 99 Tc (2008), and the pots were irrigated to simulate flooded rice fields. Transfer factors were determined as the ratios of the radionuclide concentrations in dry rice seeds (brown rice) to those in dry soils. Transfer factors of radioiodine and technetium were in the ranges of 1.1 x 10 -3 ∼ 6.4 x 10 -3 (three soils) and 5.4 x 10 -4 ∼ 2.5 x 10 -3 (four soils), respectively, for different soils. It seems that the differences in the clay content among soils played a more important role for such variations than those in the organic matter content and pH. As the representative values of radioiodine and technetium transfer factors for rice seeds, 2.9 x 10 -3 and 1.1 x 10 -3 , respectively, were proposed. In order to obtain more highly representative values in the future, investigations for the sites of interest need to be carried out continuously

  14. 11 CFR 110.17 - Price index increase.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Price index increase. 110.17 Section 110.17... PROHIBITIONS § 110.17 Price index increase. (a) Price index increases for party committee expenditure... 11 CFR 109.32 and 110.8 shall be increased by the percent difference between the price index, as...

  15. 34 CFR 1200.110 - Self-evaluation.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Self-evaluation. 1200.110 Section 1200.110 Education Regulations of the Offices of the Department of Education (Continued) NATIONAL COUNCIL ON DISABILITY... COUNCIL ON DISABILITY § 1200.110 Self-evaluation. (a) The agency shall, by November 28, 1994, evaluate its...

  16. 49 CFR 807.110 - Self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Self-evaluation. 807.110 Section 807.110... TRANSPORTATION SAFETY BOARD § 807.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...

  17. 22 CFR 530.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 530.110 Section 530.110 Foreign... PROGRAMS OR ACTIVITIES CONDUCTED BY THE BROADCASTING BOARD OF GOVERNORS § 530.110 Self-evaluation. (a) The... representing handicapped persons, to participate in the self-evaluation process by submitting comments (both...

  18. 21 CFR 225.110 - Distribution records.

    Science.gov (United States)

    2010-04-01

    ...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR MEDICATED FEEDS Records and Reports § 225.110 Distribution records. (a) Distribution records permit the manufacturer to relate complaints to specific batches and/or... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 225.110 Section 225.110 Food...

  19. 9 CFR 3.110 - Veterinary care.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Veterinary care. 3.110 Section 3.110 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... Mammals Animal Health and Husbandry Standards § 3.110 Veterinary care. (a) Newly acquired marine mammals...

  20. 7 CFR 4290.110 - Qualified management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Qualified management. 4290.110 Section 4290.110... Qualifications for the RBIC Program Organizing A Rbic § 4290.110 Qualified management. An Applicant must show, to the satisfaction of the Secretary, that its current or proposed management team is qualified and has...

  1. Technical considerations in gastric ulcer localization using technetium-99m sucralfate

    International Nuclear Information System (INIS)

    Garrett, S.G.; Wcislo, W.J.

    1985-01-01

    After the completion and evaluation of 17 patients studies using technetium-99m-labeled sucralfate for the detection of ulcerated areas, the authors felt that the technical aspects of the studies should be evaluated. The factors for evaluation are: the time the patient is kept fasting; the time the patient is being imaged and rotated for various anatomic views; the technologist time and camera time that are involved in one study; and the cost factor of the testing procedure. Based on the findings of their small sample of patients, the sensitivity of the test is uncertain

  2. Technical considerations in gastric ulcer localization using technetium-99m sucralfate

    Energy Technology Data Exchange (ETDEWEB)

    Garrett, S.G.; Wcislo, W.J.

    1985-09-01

    After the completion and evaluation of 17 patients studies using technetium-99m-labeled sucralfate for the detection of ulcerated areas, the authors felt that the technical aspects of the studies should be evaluated. The factors for evaluation are: the time the patient is kept fasting; the time the patient is being imaged and rotated for various anatomic views; the technologist time and camera time that are involved in one study; and the cost factor of the testing procedure. Based on the findings of their small sample of patients, the sensitivity of the test is uncertain.

  3. Investigation into the mobility of technetium (and selenium) in aquifers in Northern Germany, and of technetium in contact with natural mineral deposits

    International Nuclear Information System (INIS)

    Winkler, A.

    1989-01-01

    Technetium is the lightest radio element of the periodic system (No. 43). While primordial Tc doesn't exist in nature (on earth) any longer, it is produced in nuclear reactors with 6.13% of the fission products. Tc-99 has a half life of 2.13 E+5 years. A very poor retardation occurs during transportation through aquifers under oxidizing conditions. Combined with the long half life this is the reason for Tc's great hazard potential. In addition, if there is migration from the disposal site, Tc is one of the problematic elements. In aqueous solutions, Tc (VI) and (VII) are the most important valence states. Other states are only stable in connection with complexing ligands. Under reducing conditions Tc (IV) is more or less immobile. (orig.) With 95 figs., 45 tabs., 5 annexes [de

  4. Aqueous Synthesis of Technetium-Doped Titanium Dioxide by Direct Oxidation of Titanium Powder, a Precursor for Ceramic Nuclear Waste Forms

    Energy Technology Data Exchange (ETDEWEB)

    Lukens, Wayne W. [Chemical; Saslow, Sarah A. [Earth

    2017-11-17

    Technetium-99 (Tc) is a problematic fission product that complicates the long-term disposal of nuclear waste due to its long half-life, high fission yield, and the environmental mobility of pertechnetate, its stable form in aerobic environments. One approach to preventing Tc contamination is through incorporation into durable waste forms based on weathering-resistant minerals such as rutile (titanium dioxide). Here, the incorporation of technetium into titanium dioxide by means of simple, aqueous chemistry is presented. X-ray absorption fine structure spectroscopy and diffuse reflectance spectroscopy indicate that Tc(IV) replaces Ti(IV) within the structure. Rather than being incorporated as isolated Tc(IV) ions, Tc is present as pairs of edge-sharing Tc(IV) octahedra similar to molecular Tc(IV) complexes such as [(H2EDTA)TcIV](u-O)2. Technetium-doped TiO2 was suspended in deionized water under aerobic conditions, and the Tc leached under these conditions was followed for 8 months. The normalized release rate of Tc (LRTc) from the TiO2 particles is low (3×10-6 g m-2 d-1), which illustrates the potential utility of TiO2 as waste form. However, the small size of the as-prepared TiO2 nanoparticles results in estimated retention of Tc for 104 years, which is only a fraction of the half-life of Tc (2×10-5 years).

  5. 22 CFR 711.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Self-evaluation. 711.110 Section 711.110 Foreign... CORPORATION § 711.110 Self-evaluation. (a) The agency shall, by September 6, 1989, evaluate its current... participate in the self-evaluation process by submitting comments (both oral and written). (c) The agency...

  6. 20 CFR 365.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Self-evaluation. 365.110 Section 365.110... § 365.110 Self-evaluation. (a) The agency shall, by December 27, 1989, evaluate its current policies and... self-evaluation process by submitting comments (both oral and written). (c) The agency shall, until at...

  7. 19 CFR 201.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Self-evaluation. 201.110 Section 201.110 Customs... Commission § 201.110 Self-evaluation. (a) The agency shall, by April 9, 1987, evaluate its current policies... in the self-evaluation process by submitting comments (both oral and written). (c) The agency shall...

  8. 21 CFR 226.110 - Distribution records.

    Science.gov (United States)

    2010-04-01

    ...: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR TYPE A MEDICATED ARTICLES Records and Reports § 226.110 Distribution records. Complete records shall be maintained for each shipment of Type A medicated article(s) in... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Distribution records. 226.110 Section 226.110 Food...

  9. 21 CFR 165.110 - Bottled water.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Bottled water. 165.110 Section 165.110 Food and... CONSUMPTION BEVERAGES Requirements for Specific Standardized Beverages § 165.110 Bottled water. (a) Identity—(1) Description. Bottled water is water that is intended for human consumption and that is sealed in...

  10. 12 CFR 410.110 - Self-evaluation.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Self-evaluation. 410.110 Section 410.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES § 410.110 Self...

  11. Extraction processes and solvents for recovery of cesium, strontium, rare earth elements, technetium and actinides from liquid radioactive waste

    Science.gov (United States)

    Zaitsev, Boris N.; Esimantovskiy, Vyacheslav M.; Lazarev, Leonard N.; Dzekun, Evgeniy G.; Romanovskiy, Valeriy N.; Todd, Terry A.; Brewer, Ken N.; Herbst, Ronald S.; Law, Jack D.

    2001-01-01

    Cesium and strontium are extracted from aqueous acidic radioactive waste containing rare earth elements, technetium and actinides, by contacting the waste with a composition of a complex organoboron compound and polyethylene glycol in an organofluorine diluent mixture. In a preferred embodiment the complex organoboron compound is chlorinated cobalt dicarbollide, the polyethylene glycol has the formula RC.sub.6 H.sub.4 (OCH.sub.2 CH.sub.2).sub.n OH, and the organofluorine diluent is a mixture of bis-tetrafluoropropyl ether of diethylene glycol with at least one of bis-tetrafluoropropyl ether of ethylene glycol and bis-tetrafluoropropyl formal. The rare earths, technetium and the actinides (especially uranium, plutonium and americium), are extracted from the aqueous phase using a phosphine oxide in a hydrocarbon diluent, and reextracted from the resulting organic phase into an aqueous phase by using a suitable strip reagent.

  12. Contribution to optimization of individual doses of workers in shipment of generator technetium-99m

    International Nuclear Information System (INIS)

    Fonseca, Lizandra Pereira de Souza

    2010-01-01

    The Instituto de Pesquisas Energeticas e Nucleares, IPEN, radiopharmaceuticals research and produce that are distributed throughout Brazil, currently the radiopharmaceutical with the largest number of packaged shipped per year and with the highest total activity is the 99m technetium generator. To reduce individual doses for workers involved in the production of radiopharmaceuticals was performed a study of radiological protection optimization in the shipment process of technetium generator, using the techniques: differential cost-benefit analysis, integral cost-benefit analysis, multi-attribute utility analysis and multi-criteria outranking analysis. With changes in the configuration of packed for generator dispatch and with the acquirement of a mat transporter it was possible establish 4 protection options. The attributes considered were the protection cost, collective dose, individual dose and physical effort by worker to move the package without the mat. To assess the robustness of analytical solutions found with the techniques used in the optimization we performed a sensitivity study and found that option 3 is more robust than option 1, which is no longer the analytical solution with an increase of R$ 20.000,00 the cost of protection. (author)

  13. Efficient one-step direct labelling of recombinant antibodies with technetium-99m

    International Nuclear Information System (INIS)

    Liberatore, M.; Neri, D.; Neri, G.; Pini, A.; Lurilli, A.P.; Ponzo, F.; Spampinato, G.; Padula, F.; Pala, A.; Colella, A.C.

    1995-01-01

    High-affinity bacterially expressed antibody fragments can nowadays be cloned from established hybridomas or, more conveniently, isolated directly from antibody libraries displayed on filamentous phage. Such antibodies can be tagged with C-terminal peptide tags containing one cysteine residue, which represents a convenient functionalisation site for a number of applications, including technetium-99m labelling. Here we describe a simple one-step method for 99m Tc labelling of cysteine-tagged recombinant antibodies with more than 50% radionuclide incorporation. The labelled antibodies displayed full retention of immuoreactivity and good stability. (orig.)

  14. Efficient one-step direct labelling of recombinant antibodies with technetium-99m

    Energy Technology Data Exchange (ETDEWEB)

    Liberatore, M. [Dipartimento di Medicina Sperimentale, Sezione di Medicina Nucleare, Policlinico Umberto I, Universita di Roma `La Sapienza` (Italy); Neri, D. [Cambridge Centre for Protein Engineering - MRC Centre (United Kingdom); Neri, G. [Dipartimento di Biologia Molecolare, Universita di Siena (Italy); Pini, A. [Dipartimento di Biologia Molecolare, Universita di Siena (Italy); Lurilli, A.P. [Dipartimento di Medicina Sperimentale, Sezione di Medicina Nucleare, Policlinico Umberto I, Universita di Roma `La Sapienza` (Italy); Ponzo, F. [Dipartimento di Medicina Sperimentale, Sezione di Medicina Nucleare, Policlinico Umberto I, Universita di Roma `La Sapienza` (Italy); Spampinato, G. [Laboratorio di Biochimica degli Ormoni Sessuali, Il Instituto di Clinica Ostetrica e Ginecologica, Universita di Roma `La Sapienza` (Italy); Padula, F. [Laboratorio di Biochimica degli Ormoni Sessuali, Il Instituto di Clinica Ostetrica e Ginecologica, Universita di Roma `La Sapienza` (Italy); Pala, A. [Laboratorio di Biochimica degli Ormoni Sessuali, Il Instituto di Clinica Ostetrica e Ginecologica, Universita di Roma `La Sapienza` (Italy); Colella, A.C. [Dipartimento di Medicina Sperimentale, Sezione di Medicina Nucleare, Policlinico Umberto I, Universita di Roma `La Sapienza` (Italy)

    1995-11-01

    High-affinity bacterially expressed antibody fragments can nowadays be cloned from established hybridomas or, more conveniently, isolated directly from antibody libraries displayed on filamentous phage. Such antibodies can be tagged with C-terminal peptide tags containing one cysteine residue, which represents a convenient functionalisation site for a number of applications, including technetium-99m labelling. Here we describe a simple one-step method for {sup 99m}Tc labelling of cysteine-tagged recombinant antibodies with more than 50% radionuclide incorporation. The labelled antibodies displayed full retention of immuoreactivity and good stability. (orig.)

  15. 10 CFR 110.64 - Civil penalty.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Civil penalty. 110.64 Section 110.64 Energy NUCLEAR... Enforcement § 110.64 Civil penalty. (a) In response to a violation, the Commission may institute a proceeding to impose a civil penalty under section 234 of the Atomic Energy Act by issuing a notice to the...

  16. 49 CFR 174.110 - Car magazine.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Car magazine. 174.110 Section 174.110...) Materials § 174.110 Car magazine. When specially authorized by the carrier, Division 1.1 or 1.2 (explosive... packages of Class 1 (explosive) materials are placed in a “magazine” box made of sound lumber not less than...

  17. 14 CFR 1250.110 - Judicial review.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Judicial review. 1250.110 Section 1250.110... PROGRAMS OF NASA-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964 § 1250.110 Judicial review. Action taken pursuant to section 602 of the Act is subject to judicial review as provided in section 603...

  18. 21 CFR 168.110 - Dextrose anhydrous.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Dextrose anhydrous. 168.110 Section 168.110 Food... Table Sirups § 168.110 Dextrose anhydrous. (a) Dextrose anhydrous is purified and crystallized D-glucose... solids content is not less than 98.0 percent m/m. (b) The name of the food is “Dextrose anhydrous” or...

  19. Periarticular uptake of /sup 99m/technetium diphosphonate in psoriatics. Correlation with cutaneous activity

    International Nuclear Information System (INIS)

    Namey, T.C.; Rosenthall, L.

    1976-01-01

    The periarticular uptake of /sup 99m/technetium-labeled diphosphonate (/sup 99m/TcDP) was compared in 12 patients hospitalized for psoriasis and in 12 hospitalized for other dermatoses not associated with arthropathy. The 12 patients with psoriasis had recent onset disease of less than 5 years duration; neither group had historical or clinical evidence of arthritis. All psoriatics had markedly abnormal scans with symmetrically increased periarticular uptake about the imaged joints. None of the controls had similar findings. In 4 patients scanned with /sup 99m/technetium-pertechnetate within 24 hours of their /sup 99m/TcDP scan, no evidence of inflammatory synovitis was found. Three of these patients were serially imaged with /sup 99m/TcDP at intervals of 2 weeks to 3 months after their initial study, when obvious clinical improvement in their psoriasis was apparent. Improvement in the radionuclide joint images was demonstrated in some of the patients, but none reverted to normal during the study period. In light of recent evidence for the preferential binding of /sup 99m/TcDP to immature collagen, it is suggested that psoriasis may represent a generalized, but uncharacterized, collagen disorder present in bone as well as skin, linking the cutaneous disease with the potential for arthropathy

  20. Deletion in HSP110 T17: correlation with wild-type HSP110 expression and prognostic significance in microsatellite-unstable advanced gastric cancers.

    Science.gov (United States)

    Kim, Kyung-Ju; Lee, Tae Hun; Kim, Jung Ho; Cho, Nam-Yun; Kim, Woo Ho; Kang, Gyeong Hoon

    2017-09-01

    Deletion of the HSP110 T 17 mononucleotide repeat has recently been identified as a prognostic marker that is correlated with wild-type HSP110 (HSP110wt) expression in microsatellite instability-high (MSI-H) colorectal cancers. The aim of this study was to assess the correlation between deletion of the HSP110 T 17 repeat and expression of HSP110wt using DNA testing and immunohistochemistry and to determine the prognostic implications of HSP110 T 17 deletion in MSI-H advanced gastric cancers (GCs). The status of HSP110wt expression was evaluated by immunohistochemistry using an HSP110wt-specific antibody in 142 MSI-H advanced GCs. The size of the HSP110 T 17 repeat deletion was analyzed in 96 MSI-H advanced GCs; deletions were divided into small (0-2base pairs) and large deletions (3-5base pairs). Low and high expressions of HSP110wt were detected in 38 (26.8%) and 104 (73.2%) of the 142 cases, respectively. The HSP110 T 17 deletion was observed in 45 (46.9%) of the 96 MSI-H GC samples. Tumors with high expression of HSP110wt showed a tendency to have small or no deletion of HSP110 T 17 . In Kaplan-Meier survival analysis, tumors with a large HSP110 T 17 deletion were associated with favorable overall survival and disease-free survival compared with those with small/no deletion of HSP110 T 17 . However, HSP110 T 17 deletion size was not an independent prognostic factor in multivariate analysis. In summary, deletion of the HSP110 T 17 repeat was frequently observed in MSI-H GCs, and HSP110 T 17 deletion size was inversely correlated with HSP110wt expression status. Large HSP110 T 17 was not a prognostic indicator in MSI-H GCs. Copyright © 2017 Elsevier Inc. All rights reserved.

  1. Evaluation of technetium-99m/rhenium labelled nucleoside analogues as potential radiotracers in oncology

    International Nuclear Information System (INIS)

    Desbouis, D.

    2007-01-01

    Over the last decade, suicide gene therapy has emerged as a very promising method to treat cancer. This therapy consists of introducing new genetic material into the nucleus of cancer cells so that they express a therapeutic protein. The protein leads to a therapeutic effect upon interaction with a prodrug. The most widely used system is the combination of the enzyme Herpes Simplex Virus Thymidine Kinase of type 1 (HSV1-TK) with the nontoxic antiviral prodrug gancyclovir. The efficiency of protein expression is crucial for a successful therapy. Several Positron Emission Tomography (PET) tracers such as 9-[4-[ 18 F]fluoro-3-(hydroxymethyl)butyl]guanine [ 18 F]FHBG) or [ 124 I]iodo-2'-fluoro-2'-deoxy-l-β-D-arabino-furanosyluracil ( 124 I]FIAU) have been shown to be suitable probes for reporting HSV1-TK expression. One aspect of this work was to develop Single Photon Emission Tomography (SPET) reporter probes based on the inexpensive technetium-99m whose physical properties are well-suited for diagnosis (t 1/2 = 6.02 h; E γ = 140 keV). A series of complexes was prepared by derivatizing the precursor 5'-amino-5'-deoxythymidine at position N5' in order to introduce spacers of various lengths (∼ 0-30 aangstroem) carrying tridentate metal chelating entities such as iminodiacetic acid and picolylamine-N-monoacetic acid. The nucleoside derivatives were reacted with the precursors [ReBr 3 (CO) 3 ] 2- and [ 99m Tc(OH 2 ) 3 (CO) 3 ] + to form water-stable organometallic thymidine complexes. Unexpectedly, most of the compounds showed no inhibition of HSV1-TK but a mixed inhibition of the human cytosolic thymidine kinase with K iu values ranging from 4.4-334 μM. Competitive inhibition of HSV1-TK was only observed for the thymidine analogue in which the base and the metal core were separated by a spacer of approximately 30 aangstroem length (K i = 16.3 ± 4.6 μM). This compound also exhibited a mixed inhibition of the hTK1 with K ic = 73 ± 20 μM. When tested in vitro for

  2. Development of a Chemistry-Based, Predictive Method for Determining the Amount of Non-Pertechnetate Technetium in the Hanford Tanks: FY 2012 Progress Report

    Energy Technology Data Exchange (ETDEWEB)

    Rapko, Brian M.; Bryan, Samuel A.; Bryant, Janet L.; Chatterjee, Sayandev; Edwards, Matthew K.; Houchin, Joy Y.; Janik, Tadeusz J.; Levitskaia, Tatiana G.; Peterson, James M.; Peterson, Reid A.; Sinkov, Sergey I.; Smith, Frances N.; Wittman, Richard S.

    2013-01-30

    This report describes investigations directed toward understanding the extent of the presence of highly alkaline soluble, non-pertechnetate technetium (n-Tc) in the Hanford Tank supernatants. The goals of this report are to: a) present a review of the available literature relevant to the speciation of technetium in the Hanford tank supernatants, b) attempt to establish a chemically logical correlation between available Hanford tank measurements and the presence of supernatant soluble n-Tc, c) use existing measurement data to estimate the amount of n-Tc in the Hanford tank supernatants, and d) report on any likely, process-friendly methods to eventually sequester soluble n-Tc from Hanford tank supernatants.

  3. Technetium-99m-Labeled Autologous Serum Albumin: A Personal-Exclusive Source of Serum Component

    OpenAIRE

    Wang, Yuh-Feng; Chen, Yi-Chun; Li, Dian-Kun; Chuang, Mei-Hua

    2011-01-01

    Technetium-99m human serum albumin (99mTc-HSA) is an important radiopharmaceutical required in nuclear medicine studies. However, the risk of transfusion-transmitted infection remains a major safety concern. Autopreparation of serum component acquired from patient provides a “personal-exclusive” source for radiolabeling. This paper is to evaluate the practicality of on-site elusion and subsequent radiolabeling efficacy for serum albumin. Results showed that the autologous elute contained more...

  4. Biogeochemical studies of technetium in marine and estuarine ecosystems. Progress report, 1 July 1980-31 July 1981

    International Nuclear Information System (INIS)

    Beasley, T.M.

    1981-01-01

    This report summarizes progress from July 1980 through July 1981 on studies dealing with the biogeochemical behavior of technetium in marine and estuarine ecosystems. While the duration of the research has been slightly over two years, the results of our experiments have substantially extended our understanding of the environmental behavior of Tc

  5. Technetium-99m-sestamibi scintigraphy in breast nodes; Estudo cintilografico de nodulos mamarios com tecnecio-99m-sestamibi

    Energy Technology Data Exchange (ETDEWEB)

    Pellini, Marcos Pinto; Fonseca, Lea Mirian Barbosa da [Universidade Federal, Rio de Janeiro, RJ (Brazil). Faculdade de Medicina; Balen, Jacir Luiz; Fabricio, Maria Ines Menescal [Universidade Federal, Rio de Janeiro, RJ (Brazil). Faculdade de Medicina. Inst. de Ginecologia; Amarante Junior, Jose Luiz de Medeiros

    1997-01-01

    The purpose was to was to determine if technetium-99m-sestamibi accumulates preferentially within the malignant palpable nodes of breast. Twenty-five patients, mean age 36.16 ({+-} 9.34) year, and without any other additional information, underwent breast scintigraphy and excisional biopsy. We had nineteen true-negative cases, four true-positive, two false-positive and none false-negative. Sensitivity, 100% specificity, 90.5%, accuracy, 92%; PPV, 66.7%, NPV, 100%. The four true positive were invasive intraductal carcinomas and one of them metastases in auxiliary lymph-nodes, confirmed in biopsy and well defined in scintigraphy. The two false-positives were a fibroadenoma with high cellularity and a fibrodisplasy surrounded by chronic inflammatory process. Two statistical tests were applied: chi-square and Fisher. Both rejected the antithesis at a confidence interval of 99% (p , 0.01) We concluded that technetium-99-sestamibi accumulates preferentially within the malignant nodes of breast. (author) 17 refs., 3 figs., 2 tabs.

  6. Technetium compounds; Compuestos de tecnecio

    Energy Technology Data Exchange (ETDEWEB)

    Murphy, C.A. de [Instituto Nacional de Ciencias Medicas y Nutricion Salvador Zubiran, Vasco de Quiroga 15, 14000 Tlalpan D.F. (Mexico); Ferro F, G. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)

    2003-07-01

    The first radiopharmaceuticals of {sup 99m} Tc, also call of 'first generation' as colloids, aggregates and simple complexes were developed with relative easiness without it was necessary a wide understanding of its chemical structure. In the radiopharmaceuticals of 'second generation' were included those derived of the HIDA for hepatobiliary images, MAG3 and EC for images of tubular renal de purification, HMPAO and ECD for images of cerebral perfusion and MIBI and tetrofosmin for images of heart perfusion, that which implies a bigger demand in terms of the chemical knowledge. At the moment, we can affirm that the future of the radiopharmaceuticals of {sup 99m} Tc is based on the use of small and relevant biomolecules with high biological activity that allow the visualization in vivo of specific receiving sites and/or its expression in diverse pathologies. It is for it that with the 'third generation' is necessary a wide one knowledge of the chemistry of the technetium that allows the design and characterization of highly specific bio complexes. In this book, although focused mainly to the chemistry of the Tc, a brief revision is also presented on the main biologically active molecules that, coordinated the {sup 99m} Tc, present a high recognition In vivo for specific receivers. (Author)

  7. Speciation of Technetium(IV) in Bicarbonate Media

    Energy Technology Data Exchange (ETDEWEB)

    Alliot, I.; Fattahi, M. [Univ Nantes, CNRS, IN2P3, SUBATECH, EMN, Nantes (France); Alliot, C. [INSERM, U892, F-44093 Nantes 1 (France); GIP Arronax, F-44817 St Herblain (France); Vitorge, P. [CEA Saclay, LSRM, DEN DANS DPC SECR, 91 - Gif sur Yvette (France)

    2009-11-15

    The technetium isotope {sup 99}Tc is a major fission product from nuclear reactors. Ultimately it is disposed of as radioactive waste since it has few applications outside of scientific research. Geochemical modeling of the dissolution of nuclear waste and of the solubility and speciation of the dissolved radionuclides in groundwater is an important part of the Performance Assessment for the safety of nuclear waste repositories. It relies on the availability of a critically assessed thermodynamic database. The potential of the Tc(VII)/Tc(IV) redox couple is measured here under various chemical conditions to verify the stoichiometries of Tc complexes and determine their stabilities: (i) -log{sub 10}[H{sup +}] in the range 7.0-10.0, for 0.3, 0.6, and 0.7 M [CO{sub 3}](total); (II) [CO{sub 3}](total) in the range 0.01-0.6 M at -log{sub 10}[H+] approximately 8.6; and (iii) [Tc(VII)]/[Tc(IV)] ratios of (6.02*10{sup -5} M)/10{sup -6} M) and (6.02*10{sup -5} M)/(6.02*10{sup -5} M) at -log{sub 10}[H+]= -9.1 and [CO{sub 3}](total) = 1 M. Assuming that Tc(VII), TcO{sub 4}{sup -} is the only species which exists under all the above chemical conditions, the potentiometric results can be interpreted by considering the presence of two hydroxide-carbonate monomeric complexes. The hydrolysis equilibrium between these two complexes is Tc(CO{sub 3})(OH){sub 2} + H{sub 2}O {r_reversible} Tc(CO{sub 3})(OH){sub 3}{sup -} + H{sup +} with -log{sub 10}[H{sup +}]{sub 1/2} = 8.69 {+-} 0.20, which is consistent with the -8.3 {+-} 0.6 corresponding hydrolysis constant of the NEA TDB review. 733 {+-} 44 mV/SHE and 575 {+-} 60 mV/SHE are measured for the standard potentials of the TcO{sub 4}{sup -}/Tc(CO{sub 3})(OH){sub 2}, and for the TcO{sub 4}{sup -}/Tc(CO{sub 3})(OH){sup 3-} redox couples respectively. The corresponding formation constants from TcO(OH){sub 2} are log{sub 10}K{sub 1,2} = 19.8 {+-} 0.5 and log{sub 10}K{sub 1,3} = 10.5 {+-} 0.5, to be compared with the 19.3 {+-} 0.3 and 11.0

  8. Benzimidazolyl methyliminodiacetic acids: new bifunctional chelators of technetium for hepatobiliary scintigraphy

    International Nuclear Information System (INIS)

    Hunt, F.C.; Wilson, J.G.; Maddalena, D.J.

    1979-01-01

    Dimethyl- and chloro- substituted benzimidazolyl methyliminodiacetic acids have been synthesized and evaluated as new bifunctional chelators of /sup 99m/Tc. Stannous chelates of these compounds were prepared as freeze-dried kits and labeled with /sup 99m/Tc. The radiopharmaceuticals thus prepared were rapidly excreted by the hepatobiliary system of rats and rabbits with little urinary excretion. The chloro- compound had a higher biliary and lesser urinary excretion than the dimethyl- however both technetium complexes provided good scintigraphic images of the hepatobiliary system in animals. The compounds behaved similarly to the /sup 99m/Tc-lidocaine iminodiacetic acid [HIDA] complexes with respect to their biliary elimination

  9. Radiation hazards from horses undergoing scintigraphy using technetium -{sup 99m}

    Energy Technology Data Exchange (ETDEWEB)

    Whitelock, R.G. [Royal Veterinary College, Hatfield (United Kingdom)

    1997-01-01

    This paper quantifies the extent of the radiation hazard to personnel from horses undergoing scintigraphy using technetium{sup 99m} methylene diphosphonate ({sup 99m}Tc{sup m}-MDP). From the data produced it is possible to derive safe working protocols which are comfortably within the legislated limits for whole body doses as set out in the Ionising Radiations Regulations 1985. Measurements were made of the surface and environmental activities which result from individuals undergoing scintigraphic evaluation and also from urine contaminated bedding. The use of both high and low activities in the assessment of the radiation hazard to personnel and owners is considered. (author).

  10. The p110beta isoform of phosphoinositide 3-kinase signals downstream of G protein-coupled receptors and is functionally redundant with p110gamma.

    Science.gov (United States)

    Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J H; Okkenhaug, Klaus; Vanhaesebroeck, Bart

    2008-06-17

    The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110alpha, p110beta, and p110delta) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110alpha and p110delta to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110gamma class IB PI3K lack SH2 domains and instead couple p110gamma to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110beta and cells derived from a p110beta-deficient mouse line, that p110beta is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110beta and p110gamma contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110beta but not p110gamma, p110beta mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110gamma in these cells reduced the contribution of p110beta to GPCR signaling. Taken together, these data show that p110beta and p110gamma can couple redundantly to the same GPCR agonists. p110beta, which shows a much broader tissue distribution than the leukocyte-restricted p110gamma, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110gamma expression is low or absent.

  11. The p110β isoform of phosphoinositide 3-kinase signals downstream of G protein-coupled receptors and is functionally redundant with p110γ

    Science.gov (United States)

    Guillermet-Guibert, Julie; Bjorklof, Katja; Salpekar, Ashreena; Gonella, Cristiano; Ramadani, Faruk; Bilancio, Antonio; Meek, Stephen; Smith, Andrew J. H.; Okkenhaug, Klaus; Vanhaesebroeck, Bart

    2008-01-01

    The p110 isoforms of phosphoinositide 3-kinase (PI3K) are acutely regulated by extracellular stimuli. The class IA PI3K catalytic subunits (p110α, p110β, and p110δ) occur in complex with a Src homology 2 (SH2) domain-containing p85 regulatory subunit, which has been shown to link p110α and p110δ to Tyr kinase signaling pathways. The p84/p101 regulatory subunits of the p110γ class IB PI3K lack SH2 domains and instead couple p110γ to G protein-coupled receptors (GPCRs). Here, we show, using small-molecule inhibitors with selectivity for p110β and cells derived from a p110β-deficient mouse line, that p110β is not a major effector of Tyr kinase signaling but couples to GPCRs. In macrophages, both p110β and p110γ contributed to Akt activation induced by the GPCR agonist complement 5a, but not by the Tyr kinase ligand colony-stimulating factor-1. In fibroblasts, which express p110β but not p110γ, p110β mediated Akt activation by the GPCR ligands stromal cell-derived factor, sphingosine-1-phosphate, and lysophosphatidic acid but not by the Tyr kinase ligands PDGF, insulin, and insulin-like growth factor 1. Introduction of p110γ in these cells reduced the contribution of p110β to GPCR signaling. Taken together, these data show that p110β and p110γ can couple redundantly to the same GPCR agonists. p110β, which shows a much broader tissue distribution than the leukocyte-restricted p110γ, could thus provide a conduit for GPCR-linked PI3K signaling in the many cell types where p110γ expression is low or absent. PMID:18544649

  12. Sensitivity of technetium-99m-d,1-HMPAO to radiolysis in aqueous solutions

    International Nuclear Information System (INIS)

    Tubergen, K.; Corlija, M.; Volkert, W.A.; Holmes, R.A.

    1991-01-01

    The sensitivity of technetium-99m- (99mTc) d,l-HMPAO to radiolytically induced dissociation in aqueous solutions was investigated. It was found that cobalt-60 (60Co) gamma irradiation of solutions containing 99mTc-d,l-HMPAO with only 1600 cGy reduced the lipophilic chelates' radiochemical purity (RCP) to 50%-60%. The radiolytic sensitivity of 99mTc-meso-HMPAO is significantly lower. The results indicate that radiolytically produced intermediates limit the in vitro stability of 99mTc-d,l-HMPAO

  13. Site-specific conjugation and labelling of prostate antibody 7E11C5.3 (CYT-351) with technetium-99m

    International Nuclear Information System (INIS)

    Stalteri, M.A.; Mather, S.J.; Belinka, B.A.; Coughlin, D.J.; Chengazi, V.U.; Britton, K.E.

    1997-01-01

    Attachment of chelating agents to the sugar residues of antibodies for subsequent radiolabelling is an attractive approach since it may have less effect on the immunoreactivity than attachment through lysine residues, which are distributed throughout the antibody and may be present near the antigen binding site. We have attached a new hydrazide-linked chelator CYT-395 (Cytogen Corp., Princeton, N.J.) to the sugar residues of the anti-prostate monoclonal antibody 7E11C5.3 and optimised the conditions for labelling the conjugate with technetium-99m in order to compare the conjugate to 7E11C5.3 antibody labelled directly with technetium using a mercaptoethanol reduction technique. Labelling yields of 70%-90% were obtained at specific activities up to 2000 MBq/mg antibody. The stability of the technetium-labelled conjugate in plasma or to a challenge with 0.1 or 1.0 mM cysteine was similar to that of direct-labelled antibody. In nine patients with prostate cancer, the plasma clearance of the labelled conjugate followed a two-compartment model, with an average β-phase half-life of 31.4±3.9 h. The average urinary clearance at 24 h was 15.3±5.0% of the injected dose. In this group of patients there was no significant difference between the blood and urine clearance of the labelled conjugate, and the clearances of the direct-labelled antibody. (orig.). With 5 figs

  14. Myocardial perfusion scintigraphy with technetium 99m-MIBI in the diagnosis of coronary artery disease in women

    International Nuclear Information System (INIS)

    Peix, C. Amalia; Chacon, Deylis; Llerena, Lorenzo; Torres, Maritza; Garcia, Ernesto Javier; Cabrera, Lazaro Omar

    2006-01-01

    The results of technetium 99 m - methoxy-isobutyl-isonitrile scintigraphy in a one-day protocol: rest - physical or combined stress bicycle plus endovenoous dipyridamole were compared with those of coronary angiography in 20 women referred for the evaluation of pre cordial pain and of the usefulness of myocardial perfusion scintigraphy. The uptake of the radio drug under stress and at rest varied from 93 + - 9 to 94 + - 7 % in the 204 segments with normal uptake under stress, from 67 He articulates it analyzes the reasons or utility of the employment of the radioactive iodine in the diagnosis and treatment of the thyroid affections + - 9 to 75 + - 17 % in the 89 with moderate reduction, and from 33 + - 9 to 64 + - 28 % in the 27 with severe reduction. The qualitative and quantitative uptake analyses coincided in 18 patients. The perfusion scintigraphy and the angiography agreed in 70 % of the patients. It was concluded that the myocardial perfusion scintigraphy with technetium 99 -MIBI contributes to the diagnosis of the coronary artery disease in women

  15. Technetium speciation in a chlorine-sulphate environment. Contribution to the study of the effects of γ radiolysis

    International Nuclear Information System (INIS)

    Vichot, Laurent

    2001-01-01

    The objective of this research thesis is to study the chemical and electrochemical behaviour of Technetium (Tc) as it is necessary to understand this behaviour in order to better control its migration during the storage of radioactive wastes. The author more particularly addresses Technetium complexation in an aqueous environment, mainly due to the presence of sulphate in solution. The first part recalls chemical and thermodynamic characteristics of Tc species at different Tc oxidation levels, the solubility of oxide compounds, and complexation reactions. The second part proposes a description of operating principles and of characteristics of implemented methods. The third part reports the study of complexation and stability of Tc 4+ in solution. Among the used characterisation methods, X absorption spectroscopy has been crucial for the interpretation of results regarding speciation, and is presented in the fourth part. The fifth part reports the study of TcO 2 solubility in a chlorinated environment. The sixth part finally reports the study of the effects of γ rays on Tc chemistry

  16. 48 CFR 249.110 - Settlement negotiation memorandum.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Settlement negotiation memorandum. 249.110 Section 249.110 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 249.110 Settlement negotiation memorandum. Follow...

  17. Methods for the quality control of macroaggregates and colloids labelled with technetium-99m. Part of a coordinated programme on radiopharmaceuticals

    International Nuclear Information System (INIS)

    Cifka, J.

    1975-09-01

    Comprehensive studies of the antimony sulphide and sulphur colloids labelled with sup(99m)Tc was performed by the authors. Similar studies dealing with human serum albumin macroaggregates labelled with sup(99m)Tc were also initiated. The labelling processes were studied to determine the possible chemical forms of technetium-99m not bound to the colloidal particles. It was found that pertechnetate-99m is not the only possible impurity in the case of the colloids. Technetium-99m may be present as an soluble tartrate complex in the case of antimony sulphide colloid or as a soluble chlorocomplex in the case of the sulphur colloid. Techniques for the control of these colloids were developed. A method for the determination of particle size of the sulphur colloid is also described

  18. Dicty_cDB: SLE110 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLE110 (Link to dictyBase) - - - Contig-U16520-1 SLE110E (Link... to Original site) - - - - - - SLE110E 237 Show SLE110 Library SL (Link to library) Clone ID SLE110 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16520-1 Original site URL http://dict...NLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVLYR KTAGAPEGLYM*kkknqnq Translated Amino Acid sequence... (All Frames) Frame A: AKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTYXDFKKAKEKVL

  19. Chemical Speciation of Long-lived Radionuclide Technetium-99 and its Environmental Behaviour

    DEFF Research Database (Denmark)

    Shi, Keliang

    issue for understanding its fate and behaviour in ecosystem. This thesis aims to develop series of analytical methods for rapid and accurate determination of total 99Tc in environmental samples (e.g., seaweed, soil, and seawater), as well as speciation analysis of 99Tc in seaweeds. The application of 99...... - sorption at different concentrations of H+ was deduced. With the application of two small TEVA columns (1.5 mL for each), decontamination factors of >104 for molybdenum and >105 for ruthenium and recovery of 60-95% for technetium were achieved for different environmental samples. An absolute detection...

  20. Technetium phosphate bone scan in the diagnosis of septic arthritis in childhood

    International Nuclear Information System (INIS)

    Sundberg, S.B.; Savage, J.P.; Foster, B.K.

    1989-01-01

    The technetium phosphate bone scans of 106 children with suspected septic arthritis were reviewed to determine whether the bone scan can accurately differentiate septic from nonseptic arthropathy. Only 13% of children with proved septic arthritis had correct blind scan interpretation. The clinically adjusted interpretation did not identify septic arthritis in 30%. Septic arthritis was incorrectly identified in 32% of children with no evidence of septic arthritis. No statistically significant differences were noted between the scan findings in the septic and nonseptic groups and no scan findings correlated specifically with the presence or absence of joint sepsis

  1. Comparative synergistic (technetium-actinide) extraction chemistry by tributylphosphate and some amide extractants

    International Nuclear Information System (INIS)

    Condamines, N.; Musikas, C.

    1993-01-01

    In nuclear fuel reprocessing, technetium (TcO 4 - ) leads to bad interferences in the extractions, being synergistically co-extracted with different actinide cations as Uranium (VI), Plutonium (IV) and Zirconium (IV). It destroys the hydrazine in the reductive partition of U and Pu, it decreases the decontamination of U and Pu from fission products. Thus, its extraction behaviour with new extractants as N,N-diakylamides is useful to be known. TcO 4 - extraction in nitric acid media is compared for TBP and different amides. The influence of nitric acidity is related to the amides formula

  2. Mechanisms of sorption of neptunium and technetium on argillaceous materials

    International Nuclear Information System (INIS)

    Hooker, P.J.; West, J.M.; Noy, D.J.

    1986-01-01

    It is of pressing concern to understand the behaviour of radionuclides in the environment and in particular long-lived ones (e.g. Np-237 and Te-99) in argillaceous rocks. Clay formations have been chosen as likely candidates for holding low level radioactive waste repositories and in the event of leakage of radionuclides into the geosphere some knowledge of their fate is required in a far-field safety assessment study. The objectives of this present work were to examine the properties of neptunium and technetium in ground-waters associated with clay-rich materials and to ascertain the variations in sorption of these radionuclides under different environmental conditions and to use the information in a forecast of transport through a clay layer

  3. Uptake of technetium from seawater by red abalone Haliotis rufescens

    International Nuclear Information System (INIS)

    Spies, R.B.

    1975-01-01

    Technetium accumulation from seawater by the abalone Haliotis rufescens was studied with 95 Tc. Concentration factors, uptake rates, steady state concentrations, and biological half-lives were determined experimentally for whole-body uptake. Whole-body concentration factors ranged from 135 to 205; biological half-life was 60 days. Changes in concentration factors were determined for six tissues during the uptake period. The highest activities were in the order of: digestive gland>gill>kidneys>heart>gonad>columnar muscle. Dead shells accumulated little activity compared to shells of living abalone. Gills and digestive system appear to be the routes of entry. Autoradiography shows that of the muscular tissues the outer edge of the foot and epipodium are the most active and the edible columnar muscle the least active. (author)

  4. 7 CFR 29.110 - Method of sampling.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Method of sampling. 29.110 Section 29.110 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing... INSPECTION Regulations Inspectors, Samplers, and Weighers § 29.110 Method of sampling. In sampling tobacco...

  5. Distribution coefficients of caesium, chlorine, iodine, niobium, selenium and technetium on Olkiluoto soils

    International Nuclear Information System (INIS)

    Soederlund, M.; Lusa, M.; Virtanen, S.; Vaelimaa, I.; Hakanen, M.; Lehto, J.; Lahdenperae, A.-M.

    2014-02-01

    Retention of caesium, chlorine, iodine, niobium, selenium and technetium was investigated on soil samples from Olkiluoto using laboratory batch sorption experiments. Distribution coefficients were measured for both dried and sieved and untreated (wet, not sieved) mineral soil and humus in aerobic and anaerobic conditions. Mineralogical composition of the samples was determined by XRD-analysis. Caesium was sorbed efficiently on mineral soil samples and less efficiently on humus. Sorption decreased with decreasing cation exchange capacity and clay fraction content. The effect of competing cations decreased in the order Cs + >NH 4 + >K + >Ca 2+ >Na + . Chlorine was not retained by mineral soil samples, and the sorption was weak on humus. The sorption of iodine was the strongest on humus and the weakest on the untreated mineral soil samples in the anaerobic conditions. In the mineral soil samples, the sorption decreased with decreasing organic matter content and increasing pH. The retention of niobium on soil samples was the most efficient among the studied elements. The retention was high regardless of the aeration conditions. Sorption on humus was smaller. Selenium was retained efficiently on humus. Sorption on mineral soil samples was stronger in aerobic conditions. Sorption increased with time. Technetium was sorbed well on humus and anaerobic, untreated mineral soil samples. Sorption increased with increasing organic matter content and decreasing redox potential. The results from the sorption experiments are used in the site specific radionuclide migration modelling. (orig.)

  6. Quality control of technetium-labelled lung imaging agents

    International Nuclear Information System (INIS)

    Chervu, L.R.; Vallabhajosula, S.R.; Blaufox, M.D.

    1977-01-01

    A study has been made of the labelling of macroaggregated albumin particles (MAA) with sup(99m)Tc using three commercial kits, and the results compared with those obtained with albumin microspheres. The tagging efficiency was measured by three different methods, and the chemistry and radiochemical nature of the sup(99m)Tc-MAA supernates or eluates were also investigated. The total body distribution of the sup(99m)Tc-MAA supernates was determined in mice after tail-vein injection. The results indicated that technetium-labelled MAA preparations may contain sup(99m)Tc-tagged albumin, similar to human serum albumin in solution. The nature of labelling pattern of MAA and the albumin microspheres indicated that the macroaggregates and microspheres were not completely or uniformly labelled during a one-step addition of pertechnetate. The lung aggregates had a large residual labelling capacity. Consideration is given to the significance of these results in lung perfusion studies. (U.K.)

  7. Extraction of technetium from simulated Hanford tank wastes

    International Nuclear Information System (INIS)

    Chaiko, D.J.; Vojta, Y.; Takeuchi, M.

    1993-01-01

    Aqueous biphasic separation systems are being developed for the treatment of liquid radioactive wastes. These extraction systems are based on the use of polyethylene glycols (PEGs) for the selective extraction and recovery of long-lived radionuclides, such as 129 I, 75 Se, and 99 Tc, from caustic solutions containing high concentrations of nitrate, nitrite, and carbonate. Because of the high ionic strengths of supernatant liquids in Hanford underground storage tanks, aqueous biphasic systems can be generated by simply adding aqueous PEG solutions directly to the waste solution. In the process, anionic species like I - and TcO 4 - are selectively transferred to the less dense PEG phase. The partition coefficient for a wide range of inorganic cations and anions, such as sodium, potassium, aluminum, nitrate, nitrate, and carbonate, are all less than one. The authors present experimental data on extraction of technetium from several simulated Hanford tank wastes at 25 degree and 50 degree C

  8. The abdominal technetium scan (a decade of experience)

    International Nuclear Information System (INIS)

    Cooney, D.R.; Duszynski, D.O.; Camboa, E.; Karp, M.P.; Jewett, T.C. Jr.

    1982-01-01

    Out of 270 children with gastrointestinal symptoms, the indications for technetium scanning were: gastrointestinal tract bleeding (165 patients), abdominal pain (99 patients) and a history of intussusception (6 patients). Thirty children had abnormal findings, while the remaining 240 patients had normal scans. Four of the 30 children with positive scans were not explored, while the others underwent laparotomy. Of the 26 operated patients, 12 (46%) had a Meckel's diverticulum. Nine patients (34%) had other pathologic lesions that were detected by the scan. Five had true false positives as no pathologic lesions were found. Of the 240 children with negative scans, 19 were eventually explored because of persistent symptoms or clinical findings. Two of these had a Meckel's diverticulum. Eleven had a negative exploration while six had other surgical lesions. Technitium scan should reliably detect around 80%-90% of Meckel's diverticula. It will also accurately exclude the diagnosis of Meckel's diverticulum in over 90% of patients

  9. 33 CFR 110.25 - Salem Sound, Mass.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Salem Sound, Mass. 110.25 Section 110.25 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Special Anchorage Areas § 110.25 Salem Sound, Mass. (a) Beverly Harbor, north of Salem...

  10. 33 CFR 110.238 - Apra Harbor, Guam.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Apra Harbor, Guam. 110.238 Section 110.238 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.238 Apra Harbor, Guam. (a) The anchorage grounds (Datum: WGS...

  11. Study of the catalytic activity of supported technetium catalysts

    International Nuclear Information System (INIS)

    Spitsyn, V.I.; Mikhailenko, I.E.; Pokorovskaya, O.V.

    1985-01-01

    The radioactive d metal 43 Tc 99 has catalytic properties in the synthesis of ammonia. For the purpose of reducing the quantity of the radioactive metal and of increasing the specific surface, the active component was applied to BaTiO 3 and gamma-Al 2 O 3 supports. This paper uses charcoal as a support and a table presents the catalytic activity of the samples during the synthesis of ammonia. X-ray diffractometric investigation of the catalysts was carried out with the use of Cu K /SUB alpha/ radiation. It is shown that the catalysts. The values of the specific rate constants of technetium in the catalysts. The values of the specific rate constants remain practically constant for all the catalyst samples studied, attesting to the absence of a specific metal-support interaction during the synthesis of ammonia

  12. Risk analysis applied to the production of generators of Molybdenum-99/Technetium-99m

    International Nuclear Information System (INIS)

    Rodriguez, Daniel; Torres, Antonio; Henriquez, Jorge R.; Soria, Miguel A.; Ayra, Fernando E.

    2017-01-01

    Radionuclide Technetium-99m is the most used today, so that their production is vital to the branches of health and the economy of any country. Cuba currently producing generators for obtaining this radionuclide, and it is produce at the Center of Isotopes. Risk assessments of radiological hazard installations are a regulatory requirement in Cuba. Although there are several qualitative or quantitative methods to perform these studies, the existence of basis risk starting and analysis codes and simplicity of use has been privileged the risk matrix as a preferred semi-quantitative method. The investigation presents the application, for the first time, of this method on a complex installation with radiological hazard in Cuba. Using the SECURE - MR Ver. 2.0 code detailed risk analysis of the practice carried out, resulting in three accidental sequences with high-risk level and determining the importance of reducers and barriers related with human factors associated to sufficiency and personnel training. Among the derived applications are reported the novelties analysis capabilities and possibilities of risk monitoring. The risk model developed for the production process of generators of Molybdenum-99/Technetium-99m joined with capabilities review, analysis and documentation provided by the tool, allow obtaining a completely and coherent document with the model, which constitutes a valuable basis for understanding the safety of the installation knowledge. (author)

  13. Risk analysis applied to the production of generators of Molybdenum-99/Technetium-99m

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, Daniel; Torres, Antonio; Henriquez, Jorge R.; Soria, Miguel A.; Ayra, Fernando E., E-mail: danivd1188@gmail.com, E-mail: rjorge@ufpe.br, E-mail: masguevara@centis.edu.cu, E-mail: feayra@centis.cu [Universidade Federal de Pernambuco (DEMEC/UFPE), Recife, PE (Brazil). Departamento de Engenharia Mecanica; Departamento de Ingenieria Nuclear, Instituto Superior de Tecnologias y Ciencias Aplicadas (DIN/InSTEC), La Habana (Cuba); Departamento de Proteccion Radiologica, Centro de Isotopos (DPR/CENTIS), La Habana (Cuba)

    2017-11-01

    Radionuclide Technetium-99m is the most used today, so that their production is vital to the branches of health and the economy of any country. Cuba currently producing generators for obtaining this radionuclide, and it is produce at the Center of Isotopes. Risk assessments of radiological hazard installations are a regulatory requirement in Cuba. Although there are several qualitative or quantitative methods to perform these studies, the existence of basis risk starting and analysis codes and simplicity of use has been privileged the risk matrix as a preferred semi-quantitative method. The investigation presents the application, for the first time, of this method on a complex installation with radiological hazard in Cuba. Using the SECURE - MR Ver. 2.0 code detailed risk analysis of the practice carried out, resulting in three accidental sequences with high-risk level and determining the importance of reducers and barriers related with human factors associated to sufficiency and personnel training. Among the derived applications are reported the novelties analysis capabilities and possibilities of risk monitoring. The risk model developed for the production process of generators of Molybdenum-99/Technetium-99m joined with capabilities review, analysis and documentation provided by the tool, allow obtaining a completely and coherent document with the model, which constitutes a valuable basis for understanding the safety of the installation knowledge. (author)

  14. 38 CFR 4.110 - Ulcers.

    Science.gov (United States)

    2010-07-01

    ... DISABILITIES Disability Ratings The Digestive System § 4.110 Ulcers. Experience has shown that the term “peptic ulcer” is not sufficiently specific for rating purposes. Manifest differences in ulcers of the stomach... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Ulcers. 4.110 Section 4...

  15. Extramedullary pulmonary hematopoiesis causing pulmonary hypertension and severe tricuspid regurgitation detected by 99m technetium sulfur colloid bone marrow scan and single-photon emission computed tomography/CT

    International Nuclear Information System (INIS)

    Ali, Syed Zama; Clarke, Michael John; Kannivelu, Anbalagan; Chinchure, Dinesh; Srinivasan, Sivasubramanian

    2014-01-01

    Extramedullary pulmonary hematopoiesis is a rare entity with a limited number of case reports in the available literature only. We report the case of a 66-year-old man with known primary myelofibrosis, in whom a 99m technetium sulfur colloid bone marrow scan with single-photon emission computed tomography (SPECT)/CT revealed a pulmonary hematopoiesis as the cause of pulmonary hypertension and severe tricuspid regurgitation. To the best of our knowledge, this is the first description of 99m technetium sulfur colloid SPECT/CT imaging in this rare condition.

  16. Technetium-99m labeled somatostatin and analogs: synthesis, characterization and in vivo evaluation

    International Nuclear Information System (INIS)

    Amartey, J.K.

    1993-01-01

    Technetium-99m complexes of somatostatin and analogs were synthesized following the introduction of sulfhydryl groups with 2-iminothiolane (Traut's Reagent). In rats the complex was taken up by the liver, kidneys, adrenals, lungs and the pancreas. Analysis of urine samples of treated rats showed that the radiochemicals have reasonably good in vivo stability. This implies that the complexes may be potentially useful for biochemical characterization of somatostatin receptors and also in scintigraphic detection of somatostatin receptor positive tumors, especially for metastatic deposits in patients on somatostatin therapy. (Author)

  17. Technetium-99m scintigraphy associated with spondylolysis of the lumbar spine in children

    International Nuclear Information System (INIS)

    Kubota, Wataru; Sudo, Nariomi; Nakazima, Kiyonori; Nakamura, Mitsutaka

    1987-01-01

    Eight children with spondylolysis, aged from 10 to 18 years of age, underwent bone scanning with technetium-99m methylene diphosphonic acid. Radioisotope (RI) uptake was significantly observed in the site marked by the separation of the pars interarticularis, compared with the other sites between the articular processes. This showed the increase in metabolic activity of bones, providing supplementary information in the initial diagnosis. At the completion of conservative treatment, RI uptake decreased, being seemingly attributable to the improvement of subjective symptoms. Bone scanning may, however, be unhelpful in detecting synostosis. (Namekawa, K.)

  18. Technetium-99m scintigraphy associated with spondylolysis of the lumbar spine in children

    Energy Technology Data Exchange (ETDEWEB)

    Kubota, W.; Sudo, N.; Nakazima, K.; Nakamura, M.

    1987-02-01

    Eight children with spondylolysis, aged from 10 to 18 years of age, underwent bone scanning with technetium-99m methylene diphosphonic acid. Radioisotope (RI) uptake was significantly observed in the site marked by the separation of the pars interarticularis, compared with the other sites between the articular processes. This showed the increase in metabolic activity of bones, providing supplementary information in the initial diagnosis. At the completion of conservative treatment, RI uptake decreased, being seemingly attributable to the improvement of subjective symptoms. Bone scanning may, however, be unhelpful in detecting synostosis.

  19. 24 CFR 110.15 - Location of posters.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Location of posters. 110.15 Section 110.15 Housing and Urban Development Regulations Relating to Housing and Urban Development OFFICE OF... HOUSING POSTER Requirements for Display of Posters § 110.15 Location of posters. All fair housing posters...

  20. 12 CFR 411.110 - Certification and disclosure.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Certification and disclosure. 411.110 Section 411.110 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING General § 411.110 Certification and disclosure. (a) Each person shall file a certification, and a disclosure...

  1. 7 CFR 3565.110 - Insolvency of lender.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Insolvency of lender. 3565.110 Section 3565.110... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Lender Requirements § 3565.110 Insolvency of lender. The... determination of insolvency by the lender. If the lender fails to transfer a loan when required, the guarantee...

  2. 46 CFR 7.110 - Mamala Bay, HI.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Mamala Bay, HI. 7.110 Section 7.110 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Hawaii § 7.110 Mamala Bay, HI. A line drawn from Barbers Point Light to Diamond Head Light. Pacific Coast ...

  3. 10 CFR 603.110 - Use of TIAs.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Use of TIAs. 603.110 Section 603.110 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS General § 603.110 Use of TIAs. The ultimate goal for using a TIA is to broaden the technology base available to meet DOE mission...

  4. 27 CFR 28.110 - Losses.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Losses. 28.110 Section 28... Manufacturing Bonded Warehouse Losses § 28.110 Losses. Where there has been a loss of distilled spirits while in... of subpart O of this part, with respect to losses of spirits after withdrawal without payment of tax...

  5. Result Summary for the Area 5 Radioactive Waste Management Site Performance Assessment Model Version 4.110

    International Nuclear Information System (INIS)

    2011-01-01

    Results for Version 4.110 of the Area 5 Radioactive Waste Management Site (RWMS) performance assessment (PA) model are summarized. Version 4.110 includes the fiscal year (FY) 2010 inventory estimate, including a future inventory estimate. Version 4.110 was implemented in GoldSim 10.11(SP4). The following changes have been implemented since the last baseline model, Version 4.105: (1) Updated the inventory and disposal unit configurations with data through the end of FY 2010. (1) Implemented Federal Guidance Report 13 Supplemental CD dose conversion factors (U.S. Environmental Protection Agency, 1999). Version 4.110 PA results comply with air pathway and all-pathways annual total effective dose (TED) performance objectives (Tables 2 and 3, Figures 1 and 2). Air pathways results decrease moderately for all scenarios. The time of the maximum for the air pathway open rangeland scenario shifts from 1,000 to 100 years (y). All-pathways annual TED increases for all scenarios except the resident scenario. The maximum member of public all-pathways dose occurs at 1,000 y for the resident farmer scenario. The resident farmer dose was predominantly due to technetium-99 (Tc-99) (82 percent) and lead-210 (Pb-210) (13 percent). Pb-210 present at 1,000 y is produced predominantly by radioactive decay of uranium-234 (U-234) present at the time of disposal. All results for the postdrilling and intruder-agriculture scenarios comply with the performance objectives (Tables 4 and 5, Figures 3 and 4). The postdrilling intruder results are similar to Version 4.105 results. The intruder-agriculture results are similar to Version 4.105, except for the Pit 6 Radium Disposal Unit (RaDU). The intruder-agriculture result for the Shallow Land Burial (SLB) disposal units is a significant fraction of the performance objective and exceeds the performance objective at the 95th percentile. The intruder-agriculture dose is due predominantly to Tc-99 (75 percent) and U-238 (9.5 percent). The acute

  6. Association of parathyroid adenoma and autonomous nodule of the thyroid. Diagnostic efficacy of 201thallium-sup(99m)technetium scintigraphy

    International Nuclear Information System (INIS)

    Talbot, J.N.; Kiffel, T.; Duron, F.; Nordlinger, B.

    1986-01-01

    The thallium-technetium subtraction technique, proposed originally by Ferlin and co-workers, is now widely used to localize parathyroid adenoma. We report here the case of a hypercalcemic women, referred to our ward with the biologically assessed diagnosis of primary hyperparathyroidism. Thallium-technetium substraction scintigraphy not only successfully localized the parathyroid adenoma but alsorevealed the existence of an autonomous nodule of the thyroid, which was not suspected. It has previously been shown that this method can localize parathyroid adenoma in cases of cold thyroid nodule. This report shows that this is also true in the case of hot thyroid nodule. No observations of concomitant parathyroid adenoma and autonomous nodule of the thyroid have been reported (at least during the two past decades). Is this association casual or has it never been raticed. Further examinations can be performed with thallium when a hot thyroid is found in a hypercalcemic patient. (orig.)

  7. Characterization of Rh films on Ta(110)

    International Nuclear Information System (INIS)

    Jiang, L.Q.; Ruckman, M.W.; Strongin, M.

    1989-01-01

    The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low energy electron diffraction and low energy ion scattering. From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh/Ta(110) appears to grow in the Stranski-Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at 1.2 and 2. 5 eV binding energy during the initial phase of thin film growth (0 3.7 ML). Photoemission data for CO covered surfaces show that CO dissociates on the Rh/Ta(110) surface for Rh coverages less than 2.5 ML and also show that the Rh clusters develop at least one site capable of molecular CO adsorption above 0.3 ML Rh coverage. 38 refs., 5 figs

  8. Blood clearance rates of technetium-99m albumin preparations: concise communication

    International Nuclear Information System (INIS)

    Nusynowitz, M.L.; Straw, J.D.; Benedetto, A.R.; Dixon, R.S.

    1978-01-01

    Technetium-labeled human serum albumin (HSA) is extensively used as a cardiac imaging agent. An evaluation of the blood-clearance rates of electrolytically reduced HSA (EHSA) and four stannous-reduced HSA (SnHSA) preparations was conducted in dogs, and was compared with that of radioiodinated HSA (IHSA). The EHSA was found to have a clearance rate only about 1.5 times that of IHSA, whereas the SnHSA agents were cleared at two to five times the rate of IHSA. Thus, EHSA has definite advantages over SnHSA preparations for the purposes of blood-volume determinations required in quantitative cardiac studies and for the reduction of extravascular background in the accurate delineation of cardiac boundaries

  9. Evaluation of the use of technetium Tc 99m diethylenetriamine pentaacetic acid and technetium Tc 99m dimercaptosuccinic acid for scintigraphic imaging of the kidneys in green iguanas (Iguana iguana).

    Science.gov (United States)

    Greer, Leah L; Daniel, Gregory B; Shearn-Bochsler, Valerie I; Ramsay, Edward C

    2005-01-01

    To evaluate the use of scintigraphy involving technetium Tc 99m diethylenetriamine pentaacetic acid ((99m)Tc-DTPA) or technetium Tc 99m dimercaptosuccinic acid ((99m)Tc-DMSA) for the determination of kidney morphology and function in green iguanas (Iguana iguana). 10 healthy iguanas weighing >1.6 kg. Renal scintigraphy was performed by use of (99m)Tc-DTPA in 6 of the iguanas and by use of (99m)Tc-DMSA in all 10 iguanas. After the injection of (99m)Tc-DMSA, scans were performed for each iguana at intervals during a 20-hour period. Renal biopsies were performed in all 10 iguanas after the final scintigraphic evaluation. In iguanas, the use of (99m)Tc-DTPA for renal scintigraphy was nondiagnostic because of serum protein binding and poor renal uptake of the isotope; mean +/- SD (99m)Tc-DTPA bound to serum proteins was 48.9 +/- 9.9%. Renal uptake of (99m)Tc-DMSA produced distinct visualization of both kidneys. Renal uptake and soft tissue clearance of (99m)Tc-DMSA increased over the 20-hour imaging period; mean +/- SD renal uptake of (99m)Tc-DMSA was 11.31 +/- 3.06% at 20 hours. In each of the 10 iguanas, ultrasonographic and histologic examinations of biopsy specimens from both kidneys revealed no abnormalities. Results indicate that the kidneys of iguanas can be evaluated scintigraphically by use of (99m)Tc-DMSA; this technique may be potentially useful for the diagnosis of renal failure in iguanas.

  10. Researches on Technetium in the framework of the programs of the Laboratory of marine chemistry and biology

    International Nuclear Information System (INIS)

    Zurlini, G.

    1986-01-01

    Research activities concerning Technetium carried out in the framework of experimental radioecology in the ENEA Energy Research Centre of Santa Teresa are underlined. It is shown how these activities are included in a general plan of ecological and environmental research. Finally the need and importance of such studies is pointed out both from the point of view of radioprotection and ecological in general

  11. Speciation of technetium in acidic media: effect of α radiations

    International Nuclear Information System (INIS)

    Denden, Ibtihel

    2013-01-01

    This project is part of the fundamental study of technetium speciation in highly acidic medium. The behaviour of technetium in HTFMS was carried out in the absence then in the presence of a irradiation. Given these two different conditions, spectrophotometric results of Tc(VII) reduction are similar. XAS analysis indicates the formation of a cyclic dimer of Tc(IV) complexed to triflate ligands and formulated asTc 2 O 2 (CF 3 SO 3 ) 4 (H 2 O)4. This compound is linearized to Tc(IV)-O-Tc(IV) with the increase of HTFMS concentration. At high concentration of HTFMS +98% (11.15 M), the protonated species TcO 3 (OH)(H 2 O) 2 which is formed in the absence of external ionizing radiations, is reduced to the V oxidation state under a irradiation. Structural characterization by EXAFS spectroscopy and DFT calculations suggests the formation of monomer species of Tc(V)-triflate complexes where [OTc(F 3 CSO 3 ) 2 (H 2 O)2] + and [OTc(F 3 CSO 3 ) 2 (OH) 2 ] - compounds were proposed. In concentrated H 2 SO 4 (CH 2 SO 4 ≥ 12 M), a-radiolysis experiments of Tc(VII) were performed in order to compare the radiolytic behaviour of Tc(VII) in both comparable media HTFMS and H 2 SO 4 . XANES studies show that radiolytic reduction of Tc(VII) leads to the formation of Tc(V)-Tc(VII) mixture in H 2 SO 4 13 M and just Tc(V) in 18 M of H 2 SO 4 . The analysis of EXAFS spectra is consistent with the formation of [TcO(HSO 4 ) 3 (H 2 O) 2 ] and [TcO(HSO 4 )3(H 2 O)(OH)] - monomer complexes in H 2 SO 4 13 M and [Tc(HSO 4 ) 3 (SO 4 )(H 2 O)] and [Tc(HSO 4 ) 3 (SO 4 )(OH)] - species at 18 M of H 2 SO 4 . (author)

  12. Extramedullary pulmonary hematopoiesis causing pulmonary hypertension and severe tricuspid regurgitation detected by {sup 99m} technetium sulfur colloid bone marrow scan and single-photon emission computed tomography/CT

    Energy Technology Data Exchange (ETDEWEB)

    Ali, Syed Zama; Clarke, Michael John; Kannivelu, Anbalagan; Chinchure, Dinesh; Srinivasan, Sivasubramanian [Dept. of Diagnostic Radiology, Khoo Teck Puat Hospital, Singapore (Singapore)

    2014-06-15

    Extramedullary pulmonary hematopoiesis is a rare entity with a limited number of case reports in the available literature only. We report the case of a 66-year-old man with known primary myelofibrosis, in whom a {sup 99m}technetium sulfur colloid bone marrow scan with single-photon emission computed tomography (SPECT)/CT revealed a pulmonary hematopoiesis as the cause of pulmonary hypertension and severe tricuspid regurgitation. To the best of our knowledge, this is the first description of {sup 99m} technetium sulfur colloid SPECT/CT imaging in this rare condition.

  13. Detection of esophageal ulcerations with technetium-99m albumin sucralfate

    International Nuclear Information System (INIS)

    Goff, J.S.; Adcock, K.A.; Schmelter, R.

    1986-01-01

    Technetium-99m albumin-sucralfate ([/sup 99m/Tc]Su) can be used to demonstrate peptic ulcer disease in man and animals. We evaluated the usefulness of [/sup 99m/Tc]Su for detecting various grades of esophagitis. [/sup 99m/Tc]Su adhered to the distal esophagus for up to 3 hr in five of six patients with esophageal ulcers but adhered to only two of nine with lesser degrees of esophagitis. No adherence was seen in five patients without esophagitis. Thus, [/sup 99m/Tc]Su may not be useful for detecting any but the most severe grade of esophagitis. Based on these results, we speculate that the previously documented beneficial effects of sucralfate on mild to moderate esophagitis may be due to other mechanisms besides adherence to the ulcerated mucosa

  14. Technetium-99m DMSA preparation: Trivial issues causing severe problems

    International Nuclear Information System (INIS)

    Kumar, V.

    1997-01-01

    Urinary tract infection (UTI) in children involving renal parenchyma, upper collecting system or bladder is one of the major causes for consideration in the diagnosis and management of paediatric nuclear medicine. Acute pyelonephritis is one of the prime causes of morbidity associated with urinary tract infection in children which can lead to progressive renal damage. Technetium-99m dimercaptosuccinic acid (DMSA) is used extensively for the assessment of UTI in paediatrics. The radiopharmaceutical preparation could be influenced by several factors, most of them are trivial, but invariably have severe impact on the quality of the scintiphotographs. This communication is mainly to highlight some of the issues related to 99 mTc-DMSA preparation and the possible precautionary measures that need to be taken to obviate unwarranted problems. (author)

  15. Detection of esophageal ulcerations with technetium-99m albumin sucralfate

    Energy Technology Data Exchange (ETDEWEB)

    Goff, J.S.; Adcock, K.A.; Schmelter, R.

    1986-07-01

    Technetium-99m albumin-sucralfate ((/sup 99m/Tc)Su) can be used to demonstrate peptic ulcer disease in man and animals. We evaluated the usefulness of (/sup 99m/Tc)Su for detecting various grades of esophagitis. (/sup 99m/Tc)Su adhered to the distal esophagus for up to 3 hr in five of six patients with esophageal ulcers but adhered to only two of nine with lesser degrees of esophagitis. No adherence was seen in five patients without esophagitis. Thus, (/sup 99m/Tc)Su may not be useful for detecting any but the most severe grade of esophagitis. Based on these results, we speculate that the previously documented beneficial effects of sucralfate on mild to moderate esophagitis may be due to other mechanisms besides adherence to the ulcerated mucosa.

  16. Positive thyroid cancer scintigraphy using technetium-99m methoxyisobutylisonitrile

    International Nuclear Information System (INIS)

    Nemec, J.; Nyvltova, O.; Blazek, T.; Vlcek, P.; Racek, P.; Novak, Z.; Preiningerova, M.; Hubackova, M.; Krizova, M.; Zimak, J.; Bilek, R.

    1996-01-01

    The aim of the study was to evaluate the possibility of detecting thyroid cancer recurrences without the need for withdrawal of thyroid suppressive treatment. Upper-body or whole-body scintigraphy was performed in a group of 200 patients evaluated for differentiated thyroid cancers in 1993 and 1994 using technetium-99m sestamibi. Scans were performed 20-30 min following i.v. administration of 500 MBq of 99m Tc-methoxyisobutylisonitrile (MIBI). Bone and lung metastases were detected with very high sensitivity and specificity, with a very high predictive value of negative results and a somewhat lower predictive value of positive results. The sensitivity and specificity of findings in the neck were lower but the predictive value of negative results was high. Whole-body scans with 99m Tc-MIBI are a useful tool in the follow-up of patients with differentiated thyroid cancer, for the detection of distant metastatic lesions. (orig.)

  17. Use of technetium-99m-di-isopropyl-iminodiacetic acid imaging in the demonstration of a biliary-bronchial fistula

    Energy Technology Data Exchange (ETDEWEB)

    Savitch, I.; Esser, J.D.; Levin, J. (University of the Witwatersrand, Johannesburg (South Africa). Dept. of Nuclear Medicine); Krige, L.P.; Kew, M.C. (University of the Witwatersrand, Johannesburg (South Africa). Dept. of Medicine)

    1984-05-12

    A case is described in which technetium-99m-di-isopropyl-iminodiacetic acid imaging was used to trace the passage of bile from its site of leakage into an amoebic liver abscess, through a fistulous tract connecting the liver abscess with an abscess in the right lower lobe of the lung, and into the upper respiratory tract.

  18. Technetium 99mTc Pertechnetate Brain Scanning

    International Nuclear Information System (INIS)

    Rhee, Sang Min; Park, Jin Yung; Lee, Ahn Ki; Chung, Choo Il; Hong, Chang Gi; Rhee, Chong Heon; Koh, Chang Soon

    1968-01-01

    Technetium 99 mTc pertechnetate brain scanning were performed in 3 cases of head injury (2 chronic subdural hematomas and 1 acute epidural hematoma), 2 cases of brain abscess and 1 case of intracerebral hematoma associated with arteriovenous anomaly. In all the cases brain scintigrams showed 'hot areas.' Literatures on radioisotope scanning of intracranial lesions were briefly reviewed. With the improvement of radioisotope scanner and development of new radiopharmaceuticals brain scanning became a safe and useful screening test for diagnosis of intracranial lesions. Brain scanning can be easily performed even to a moribund patient without any discomfort and risk to the patient which are associated with cerebral angiography or pneumoencephalography. Brain scanning has been useful in diagnosis of brain tumor, brain abscess, subdural hematoma, and cerebral vascular diseases. In 80 to 90% of brain tumors positive scintigrams can be expected. Early studies were done with 203 Hg-Neohydrin or 131 I-serum albumin. With these agents, however, patients receive rather much radiation to the whole body and kidneys. In 1965 Harper introduced 99 mTc to reduce radiation dose to the patient and improve statistical variation in isotope scanning.

  19. The use of technetium-99m-DTPA in the diagnosis of tuberculous meningitis

    International Nuclear Information System (INIS)

    Von Wenzel, K.S.

    1988-03-01

    As 82 Br is not available locally in South West Africa on a daily basis a technetium preparation, 99m Tc-DTPA, was used in the diagnosis of patients with tuberculous meningitis. The 99m Tc-DTPA partition test was compared with the 82 Br partition test on 22 trial subjects. The trial subjects varied in age (0,8-57 years), sex and race. There were 7 patients diagnosed by the clinicians as having tuberculous meningitis. All patients were placed on anti-tuberculous meningitis treatment and all, except 2, one of whom regressed and 1 who died 7 days later, improved slowly. The 9 patients with viral meningitis received no antibiotics and recovered rapidly on symptomatic treatment only. With all 5 the septic meningitis cases, the organism was identified and there was thus no diagnostic uncertainty. One normal control subject was also examined. It would appear from the results that both 82 Br, as well as 99m Tc-DTPA, cross the blood-brain barrier to a greater extent in the case of tuberculous meningitis, compared to viral meningitis. Although the accuracy of the 82 Br test, if a critical ratio value of 1,3 was chosen, is 90,6% compared to 86,9% of the 99m Tc-DTPA partition test if a critical ratio value of 3 was chosen, there are still advantages to the use of the technetium preparation. These include the availability, cost and lower radiation dose per MBq as well as the possibility of brain imaging. 10 figs., 58 refs., 9 tabs

  20. Clinical application of calculated split renal volume using computed tomography-based renal volumetry after partial nephrectomy: Correlation with technetium-99m dimercaptosuccinic acid renal scan data.

    Science.gov (United States)

    Lee, Chan Ho; Park, Young Joo; Ku, Ja Yoon; Ha, Hong Koo

    2017-06-01

    To evaluate the clinical application of computed tomography-based measurement of renal cortical volume and split renal volume as a single tool to assess the anatomy and renal function in patients with renal tumors before and after partial nephrectomy, and to compare the findings with technetium-99m dimercaptosuccinic acid renal scan. The data of 51 patients with a unilateral renal tumor managed by partial nephrectomy were retrospectively analyzed. The renal cortical volume of tumor-bearing and contralateral kidneys was measured using ImageJ software. Split estimated glomerular filtration rate and split renal volume calculated using this renal cortical volume were compared with the split renal function measured with technetium-99m dimercaptosuccinic acid renal scan. A strong correlation between split renal function and split renal volume of the tumor-bearing kidney was observed before and after surgery (r = 0.89, P volumetry had a strong correlation with the split renal function measured using technetium-99m dimercaptosuccinic acid renal scan. Computed tomography-based split renal volume measurement before and after partial nephrectomy can be used as a single modality for anatomical and functional assessment of the tumor-bearing kidney. © 2017 The Japanese Urological Association.

  1. Technetium-99m pyrophosphate imaging in acute renal failure associated with nontraumatic rhabdomyolysis

    Energy Technology Data Exchange (ETDEWEB)

    Patel, R.; Mishkin, F.S.

    1986-10-01

    Technetium-99m pyrophosphate (Tc-PYP) imaging was performed in five patients with acute renal failure associated with nontraumatic rhabdomyolysis. Four patients had phencyclidine intoxication and one had viral pneumonia. During the acute phase, marked uptake of pyrophosphate was seen in all patients in several muscle groups, but always in the thigh adductors. The results show that phencyclidine intoxication can result in diffuse muscle uptake of Tc-PYP without overt evidence of muscle injury. Tc-PYP imaging may provide a clue to the cause of acute renal failure in patients with suspected rhabdomyolysis in whom elevations of serum creatine phosphokinase concentrations are equivocal.

  2. Technetium-99m pyrophosphate imaging in acute renal failure associated with nontraumatic rhabdomyolysis

    International Nuclear Information System (INIS)

    Patel, R.; Mishkin, F.S.

    1986-01-01

    Technetium-99m pyrophosphate (Tc-PYP) imaging was performed in five patients with acute renal failure associated with nontraumatic rhabdomyolysis. Four patients had phencyclidine intoxication and one had viral pneumonia. During the acute phase, marked uptake of pyrophosphate was seen in all patients in several muscle groups, but always in the thigh adductors. The results show that phencyclidine intoxication can result in diffuse muscle uptake of Tc-PYP without overt evidence of muscle injury. Tc-PYP imaging may provide a clue to the cause of acute renal failure in patients with suspected rhabdomyolysis in whom elevations of serum creatine phosphokinase concentrations are equivocal

  3. Labeling of Tannic Acid with Technetium-99m for Diagnosis of Stomach Ulcer

    OpenAIRE

    Ibrahim, I. T.; El-Tawoosy, M.; Talaat, H. M.

    2011-01-01

    Tannic acid is a polyphenolic compound that could be labeled with technetium-99m. To produce about 90% yield of  99mTc-tannic acid in acidic media (pH), the conditions required were 150  g tin chloride, 30 min reaction time, and 200  g of the substrate. 99mTc-tannic was stable for 6 h. Oral biodistribution of 99mTc-tannic showed that it concentrated in the stomach ulcer to reach about 50% of the total injected dose at 1 h after orall administration. This concentration of 99mTc-tannic in s...

  4. Characterization of Rh films on Ta(110)

    International Nuclear Information System (INIS)

    Jiang, L.Q.; Ruckman, M.W.; Strongin, M.

    1990-01-01

    The surface and electronic structure of Rh films on Ta(110) up to several monolayers thick on Ta(110) are characterized by photoemission, Auger emission, low-energy electron diffraction (LEED) and low-energy ion scattering (LEIS). From the variation of the Rh Auger peak-to-peak intensity as a function of evaporation time, Rh appears to grow in the Stranski--Krastanov mode at room temperature. However, the LEIS data show that the Rh adatoms begin to cluster on Ta(110) before growth of the monolayer is completed. Diffuse LEED scattering suggests that the Rh films are disordered. Photoemission shows that Rh chemisorption on Ta(110) generates two peaks located at -1.5 and -2.5 eV binding energy during the initial phase of thin-film growth (0 3.7 ML). CO dissociates on the Rh/Ta(110) surface for Rh coverages<2.5 ML and the surface develops a site capable of molecular CO adsorption above 0.3-ML Rh coverage

  5. Evaluation of technetium-99m/rhenium labelled nucleoside analogues as potential radiotracers in oncology[Dissertation 17173

    Energy Technology Data Exchange (ETDEWEB)

    Desbouis, D

    2007-07-01

    Over the last decade, suicide gene therapy has emerged as a very promising method to treat cancer. This therapy consists of introducing new genetic material into the nucleus of cancer cells so that they express a therapeutic protein. The protein leads to a therapeutic effect upon interaction with a prodrug. The most widely used system is the combination of the enzyme Herpes Simplex Virus Thymidine Kinase of type 1 (HSV1-TK) with the nontoxic antiviral prodrug gancyclovir. The efficiency of protein expression is crucial for a successful therapy. Several Positron Emission Tomography (PET) tracers such as 9-[4-[{sup 18}F]fluoro-3-(hydroxymethyl)butyl]guanine [{sup 18}F]FHBG) or [{sup 124}I]iodo-2'-fluoro-2'-deoxy-l-{beta}-D-arabino-furanosyluracil ({sup 124}I]FIAU) have been shown to be suitable probes for reporting HSV1-TK expression. One aspect of this work was to develop Single Photon Emission Tomography (SPET) reporter probes based on the inexpensive technetium-99m whose physical properties are well-suited for diagnosis (t{sub 1/2} = 6.02 h; E{sub {gamma}} = 140 keV). A series of complexes was prepared by derivatizing the precursor 5'-amino-5'-deoxythymidine at position N5' in order to introduce spacers of various lengths ({approx} 0-30 aangstroem) carrying tridentate metal chelating entities such as iminodiacetic acid and picolylamine-N-monoacetic acid. The nucleoside derivatives were reacted with the precursors [ReBr{sub 3}(CO){sub 3}]{sup 2-} and [{sup 99m}Tc(OH{sub 2}){sub 3}(CO){sub 3}]{sup +} to form water-stable organometallic thymidine complexes. Unexpectedly, most of the compounds showed no inhibition of HSV1-TK but a mixed inhibition of the human cytosolic thymidine kinase with K{sub iu} values ranging from 4.4-334 {mu}M. Competitive inhibition of HSV1-TK was only observed for the thymidine analogue in which the base and the metal core were separated by a spacer of approximately 30 aangstroem length (K{sub i} = 16.3 {+-} 4.6 {mu

  6. 27 CFR 21.110 - Gasoline, unleaded.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Gasoline, unleaded. 21.110....110 Gasoline, unleaded. Conforms to specifications as established by the American Society for Testing...-79. Any of the “seasonal and geographical” volatility classes for unleaded gasoline are considered...

  7. 44 CFR 16.110 - Self-evaluation.

    Science.gov (United States)

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Self-evaluation. 16.110... ACTIVITIES CONDUCTED BY THE FEDERAL EMERGENCY MANAGEMENT AGENCY § 16.110 Self-evaluation. (a) The agency... handicaps or organizations representing individuals with handicaps, to participate in the self-evaluation...

  8. Influence of microbial activities on the mobility of technetium and selenium

    International Nuclear Information System (INIS)

    Merz, C.; Winkler, A.; Pekdeger, A.; Stroetmann, I.; Kaempfer, P.; Dott, W.

    1992-01-01

    Interactions between migration processes and microbiology have become known during the last few years, with an observed immobilization of radionuclides being attributed to the formation of microenvironments. In such microenvironments produced by bacterial accumulations at grain surfaces and in grain gores, changed redox conditions may lead to the precipitation of technetium and selenium. Such microenvironments, however, cannot be detected by measuring the physico-chemical parameters in the macroenvironment, and therefore they may cause misjudgement of the migration behaviour of radionuclides. To study the microbiological effects, batch and column tests were made with unsterile and sterile loose rock, and sterilization methods were tested with soil materials. In order to detect a possible attachment to microorganisms, the sorption behaviour in bacterial suspensions was studied in addition. (orig.) [de

  9. Technetium Chemistry in HLW: Role of Organic Complexants

    International Nuclear Information System (INIS)

    Hess, Nancy J.; Blanchard, David L. Jr.; Campbell, James A.; Cho, Herman M.; Rai, Dhanpat Rai; Xia, Yuanxian; Conradson, Steven D.

    2002-01-01

    Technetium complexation with organic compounds in tank waste plays a significant role in the redox chemistry of Tc and the partitioning of Tc between the supernatant and sludge components in waste tanks. These processes need to be understood so that strategies to effectively remove Tc from high-level nuclear waste prior to waste immobilization can be developed and so that longterm consequences of Tc remaining in residual waste after sludge removal can be evaluated. Only limited data on the stability of Tc-organic complexes exists, and even less thermodynamic data on which to develop predictive models of Tc chemical behavior is available. To meet these challenges, we present a research program to study Tc-speciation in actual tank waste using state-of-the-art analytical organic chemistry, separations, and speciation techniques. On the basis of such studies, we will acquire thermodynamic data for the identified Tc-organic complexes over a wide range of chemical conditions in order to develop credible models to predict Tc speciation in tank waste and Tc behavior during waste pretreatment processing and in waste tank residuals

  10. p110α and p110β isoforms of PI3K signaling: are they two sides of the same coin?

    Science.gov (United States)

    Singh, Paramjeet; Dar, Mohd Saleem; Dar, Mohd Jamal

    2016-09-01

    Class-1 phosphatidylinositol-3-kinases (PI3Ks) are activated by a variety of extracellular stimuli and have been implicated in a wide range of cellular processes. p110α and p110β are the two most studied isoforms of the class-1A PI3K signaling pathway. Although these two isoforms are ubiquitously expressed and play multiple redundant roles, they also have distinct functions within the cell. More recently, p110α and p110β isoforms have been shown to translocate into the nucleus and play a role in DNA replication and repair, and in cell cycle progression. In the following Review article, we discuss the overlapping and unique roles of p110α and p110β isoforms with a particular focus on their structure, expression analysis, subcellular localization, and signaling contributions in various cell types and model organisms. © 2016 Federation of European Biochemical Societies.

  11. Enhanced sludge processing of HLW: Hydrothermal oxidation of chromium, technetium, and complexants by nitrate. 1997 mid-year progress report

    International Nuclear Information System (INIS)

    Buelow, S.

    1997-01-01

    'Treatment of High Level Waste (HLW) is the second most costly problem identified by OEM. In order to minimize costs of disposal, the volume of HLW requiring vitrification and long term storage must be reduced. Methods for efficient separation of chromium from waste sludges, such as the Hanford Tank Wastes (HTW), are key to achieving this goal since the allowed level of chromium in high level glass controls waste loading. At concentrations above 0.5 to 1.0 wt.% chromium prevents proper vitrification of the waste. Chromium in sludges most likely exists as extremely insoluble oxides and minerals, with chromium in the plus III oxidation state [1]. In order to solubilize and separate it from other sludge components, Cr(III) must be oxidized to the more soluble Cr(VI) state. Efficient separation of chromium from HLW could produce an estimated savings of $3.4B[2]. Additionally, the efficient separation of technetium [3], TRU, and other metals may require the reformulation of solids to free trapped species as well as the destruction of organic complexants. New chemical processes are needed to separate chromium and other metals from tank wastes. Ideally they should not utilize additional reagents which would increase waste volume or require subsequent removal. The goal of this project is to apply hydrothermal processing for enhanced chromium separation from HLW sludges. Initially, the authors seek to develop a fundamental understanding of chromium speciation, oxidation/reduction and dissolution kinetics, reaction mechanisms, and transport properties under hydrothermal conditions in both simple and complex salt solutions. The authors also wish to evaluate the potential of hydrothermal processing for enhanced separations of technetium and TRU by examining technetium and TRU speciation at hydrothermal conditions optimal for chromium dissolution.'

  12. 25 CFR 720.110 - Self-evaluation.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Self-evaluation. 720.110 Section 720.110 Indians THE...-evaluation. (a) The agency shall, by August 24, 1987, evaluate its current policies and practices, and the... or organizations representing handicapped persons, to participate in the self-evaluation process by...

  13. Study of the electrochemical behaviour of technetium on mercury in an acetic buffer medium; Etude du comportement electrochimique du technetium sur mercure en milieu acetique tamponne

    Energy Technology Data Exchange (ETDEWEB)

    Courson, Olivier [Inst. de Physique Nucleaire, Paris-11 Univ., 91 - Orsay (France)

    1997-11-07

    Technetium 99, produced with a high yield as fission product of {sup 235}U in nuclear reactors constitutes an important issue in the nuclear waste management. The rich and complex solution chemistry leads up to now to an insufficient knowledge of its behaviour in PUREX process and in environment. In order to understand the reduction mechanism of pertechnetate on mercury electrode, we have developed electrochemical techniques which use an additional time parameter to classical techniques used on mercury electrode. On micro-electrode, we have observed, for long time measurements (3D polarography), a split of the first polarographic wave into two waves, which characterizes the reduction of Tc(VII) in Tc(III) as well as a modification of the catalytic peak associated with technetium metal formation. moreover, differential capacitance determination of electrode/solution interface brings to the fore the existence of species (Tc(IV), T(0)) on mercury in the reduction zone corresponding to the following reductions: Tc(VII) -> T(III) and T(III) -> Tc(0). Moreover the Tc(III)/Tc(0) reduction brings the intermediary Tc(I) and Tc(II) which are present only for rates faster than the scan. Results obtained on microelectrodes have been confirmed on macro-electrode; the insoluble species Tc(IV) and Tc are formed during the reduction of Tc(VII) on metal. Thus, in acetate buffer media (pH=4.6), the pertechnetate reduction is characterized by the presence of absorbable species (Tc O{sub 2} hydrated,Tc). Moreover, the different electrochemical responses obtained with our techniques like 3D-polarography (waves and catalytic peaks) can be attributed to the following steps: Tc(VII)->Tc(V), Tc(IV) -> Tc(III), Tc(III) -> Tc(I) and Tc(I) -> Tc(0). The Tc(V) formation is followed by the rapid disproportionation of Tc(V) and Tc(VI) and Tc(I) reduction is associated with the proton reduction. (author) 124 refs., 68 figs., 19 tabs.

  14. 36 CFR 223.110 - Delegation to regional forester.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Delegation to regional forester. 223.110 Section 223.110 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... § 223.110 Delegation to regional forester. The Chief, Forest Service, after approval of conditions of...

  15. 33 CFR 110.208 - Buffalo Harbor, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y. 110.208 Section 110.208 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.208 Buffalo Harbor, N.Y. (a) The anchorage grounds—(1...

  16. Technetium-99m HMPAO labeled leukocytes in inflammation imaging

    International Nuclear Information System (INIS)

    Uno, Kimiichi; Yoshikawa, Kyousan; Imazeki, Keiko; Minoshima, Satoshi; Arimizu, Noboru

    1991-01-01

    Technetium-99m-HMPAO (Tc-99m-HMPAO) labeled leukocyte imaging was carried out in 19 patients at 3-5 hr after reinjection. There were no side effects noted. Tc-99m leukocyte images showed gall bladder, colon, kidney, and urinary bladder activity in normal distribution as a result of excretion of the eluted Tc-99m complex. They yielded a sensitivity of 93%, a specificity of 100% and an accuracy of 95%. They were correctly positive in 14 out of 19 cases. But one false negative case was seen in a patient with pyonephrosis showing a lack of renal function with decreased renal blood flow. It was concluded that they have some advantages over In-111 leukocyte images, but we have to consider the fact that the ureteral obstruction or the lack of renal function with decreased renal blood flow may result in a false positive or a false negative case. (author)

  17. Lymphoma imaging with a new technetium-99m labelled antibody, LL2

    International Nuclear Information System (INIS)

    Murthy, S.; Sharkey, R.M.; Goldenberg, D.M.; Lee, R.E.; Pinsky, C.M.; Hansen, H.J.; Burger, K.; Swayne, L.C.

    1992-01-01

    The lesion detection capability of a new technetium-99m labelled B-cell lymphoma monoclonal antibody (MoAb) imaging agent, LL2, was evaluated in 8 patients with non-Hodgkin's lymphoma and 1 patient with chronic lymphocytic leukaemia. The MoAb kit consists of a 1-vial, 1-mg Fab' form of LL2 ready for instant labelling with technetium. The patients were injected with ∝925 MBq (25 mCi) of 99m Tc-LL2 Fab' (1 mg), and planar and single photon emission tomography (SPET) studies were performed at 3-4 h post injection and at 24 h. There was no evidence of thyroid or stomach activity up to 24 h. Uniform splenic uptake was seen in all patients. Two non-lymphoma patients were also administered with the same agent and demonstrated a similar splenic distribution; therefore, splenic targeting was not scored as tumour-specific. A total of 29 from 48 tumour sites were detected by scintigraphy, including tumours of various grades and histological types. Excluding 1 patient who had a large tumour burden of over 500 g, 29 of 33 lesions were detected. One patient was free of disease at the time of the study and had a negative scan. Another patient showed excellent targeting of gallium-negative sites in the liver and bone. The bone involvement was not known prior to the antibody study and was subsequently confirmed by a bone scan. Additional sites of MoAb localization could not be followed in this group, since most patients went on to radioimmunotherapy immediately following the 99m Tc-LL2 study. However, these initial results suggest that this new 99m Tc-labelled antibody imaging kit should be further investigated for its potential role in the staging and follow-up of lymphoma patients. (orig.)

  18. Carbonyltrichlorotris(dimethylphenylphosphine)technetium-ethanol (1/1), the first seven-coordinate complex of technetium; position of this molecule in the Csub(3v) family

    Energy Technology Data Exchange (ETDEWEB)

    Bandoli, G; Clemente, D A; Mazzi, U [Consiglio Nazionale delle Ricerche, Padua (Italy). Lab. di Chimica e Tecnologia dei Radioelementi

    1978-01-01

    The preparation and the crystal and molecular structure of the title complex are reported. The coordination polyhedron is that of a distorted capped octahedron Csub(3v) symmetry). The technetium atom is seven-coordnate and bonded to three phosphine ligands (capped face), three chlorine ligands (uncapped face), and to the carbonyl group, which occupies the unique capping position. Crystals are monoclinic, space group P2/sub 1//c, with cell dimensions a = 11.732(9), b = 11.807(9), c = 23.588(12) A, and ..beta..103.42(8)/sup 0/. The structure has been refined by least squares to a conventional R of 0.093 for 1 794 observed reflections. Metal-ligand bond lengths are: Tc-CO 1.86(2), Tc-C1 2.48(1). and Tc-p 2.44(1) A. Seven coordinate complexes are briefly reviewed: in particular, a description of Csub(3v) symmetry and its distortions has been developed in terms of repulsion theory and the angular-overlap model.

  19. 29 CFR 1650.110 - Implementation of salary offset.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 4 2010-07-01 2010-07-01 false Implementation of salary offset. 1650.110 Section 1650.110... Procedures for the Collection of Debts by Salary Offset § 1650.110 Implementation of salary offset. (a... proposed voluntary repayment agreement, deductions will begin in the next bi-weekly salary payment after a...

  20. Estimation of Physical Properties of AN-107 Cesium and Technetium Eluate Blend

    Energy Technology Data Exchange (ETDEWEB)

    Choi, A.S.

    2001-06-12

    The objective of this study, as defined in the associated test specifications and task technical and quality assurance plan, was to estimate all the physical properties that are required to design the storage and transport facilities for the concentrated cesium and technetium eluates. Specifically, the scope of this study included: (1) modeling of the aqueous electrolyte chemistry of Tank 241-AN-107 Cs and Tc eluate evaporators, (2) process modeling of semi-batch and continuous evaporation operations, (3) determination of the operating vacuum and target endpoint of each evaporator, (4) calculation of the physical properties of the concentrated Cs and Tc eluate blend, and (5) development of the empirical correlations for the physical properties thus estimated.

  1. Non-invasive investigation of the upper gastrointestinal tract using technetium - 99m

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, T V [Royal Infirmary, Edinburgh (UK)

    1979-01-01

    The use of technetium - 99m in the non-invasive investigation of the upper gastrointestinal tract is discussed with particular reference to the evolution of a method of assessing gastric function or gastric acid secretion non-invasively and to the applications of this method in the investigation of surgical patients with disease of the upper gastrointestinal tract. The assessment of maximal acid output and the insulin response is described and the use of the test in the diagnosis of pernicious anaemia, hypo- and hyperchlorhydric states, gastric cancer, hiatus hernia and Barrett's oesophagus, coeliac disease, Meckel's diverticulum, and abdominal aortic aneurism outlined. The use of chemicals labelled with this tracer in hepatobilary scanning is briefly described.

  2. Proposal on new formulas for renal depth in the technetium-99m-mercaptoacetyltriglycine (MAG3) scintigraphy

    International Nuclear Information System (INIS)

    Uchiyama, Katsuhiro; Kuniyasu, Yoshio; Niio, Yasuo

    1997-01-01

    Recently, camera-based techniques to measure effective renal plasma flow (ERPF) have become more popular than single plasma sample techniques because camera-based measurements avoid the necessity of delayed plasma samples and in vitro techniques. The measurements of ERPF are used to estimate the clearance of technetium-99m-mercaptoacetyltriglycine (MAG3). However, camera-based techniques are dependent on an accurate estimate of renal depth to correct for soft-tissue attenuation. Then, new formulas for renal depth correction of technetium-99m-MAG3 clearance in place of Toennesen's, M. Ito's, K. Itoh's, and Taylor's methods were tried to establish in this paper. Eleven hundred and seventy patients without any renal disease were objected. The data from measurement of renal depth using X-ray CT in supine position were analyzed statistically. The depths of right kidney (Dr) and left kidney (Dl) were 7.33±1.27 and 7.07±1.27 cm. The correlation coefficients between Dr and height (H), body weight (W), body Surface area (BSA: W 0.425 xH 0.725 x0.007184 m 2 ), age, and abdominal thickness (Ta) were 0.275, 0.709, 0.615, 0.087, and 0.743. The correlation coefficients between Dl and H, W, BSA, age, and Ta were 0.269, 0.732, 0.629, 0.029, and 0.812. Ta had best correlation with both Dr and Dl. The calculation formulas for Dr and Dl using Ta were as follows; Dr=0.32xTa+0.87 cm, and Dl=0.36xTa-0.08 cm. On the other hand, the multiplex calculation formulas of Dr or Dl with H, W, and Ta were as follows; Dr=0.18Ta+8.54x(W/H)+0.75 (r=0.768), and Dl=0.26Ta+5.90x(W/H)-0.16 (r=0.823). The new regression equations provide superior estimates of renal depth compared to conventional equations. Application of these new formulas into camera-based protocols to determine renal clearances may lead to more accurate measurements of ERPF using technetium-99m-MAG3 scintigraphy. (author)

  3. 21 CFR 160.110 - Frozen eggs.

    Science.gov (United States)

    2010-04-01

    ... Frozen eggs. (a) Frozen eggs, frozen whole eggs, frozen mixed eggs is the food prepared by freezing... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen eggs. 160.110 Section 160.110 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN...

  4. 29 CFR 1978.110 - Judicial review.

    Science.gov (United States)

    2010-07-01

    ... Labor, shall not be subject to judicial review in any criminal or other civil proceedings (49 U.S.C... law judge, shall be transmitted by the Administrative Review Board, United States Department of Labor... 29 Labor 9 2010-07-01 2010-07-01 false Judicial review. 1978.110 Section 1978.110 Labor...

  5. The use of technetium-99m-di-isopropyl-iminodiacetic acid imaging in the demonstration of a biliary-bronchial fistula

    International Nuclear Information System (INIS)

    Savitch, I.; Esser, J.D.; Levin, J.; Krige, L.P.; Kew, M.C.

    1984-01-01

    A case is described in which technetium-99m-di-isopropyl-iminodiacetic acid imaging was used to trace the passage of bile from its site of leakage into an amoebic liver abscess, through a fistulous tract connecting the liver abscess with an abscess in the right lower lobe of the lung, and into the upper respiratory tract

  6. Study with radio aerosol of DTPA technetium-99 m in individuals with pulmonary disease by amiodarone

    International Nuclear Information System (INIS)

    Terra Filho, M.

    1989-01-01

    In order to evaluate the role of the clearance of 99 m Technetium chelated to diethylenetriamine-penta-acetate (99 m Tc-DTPA) in amiodarone induced pulmonary disease, 40 individuals were studied in four groups. After spirometry, where a volume-time curve was registered, all individuals inhaled 740 MBq of 99 m Tc-DTPA diluted in 4 ml of saline, for five minutes. Pulmonary images were obtained in a computerized scintillation camera and 9 regions of interest were selected. (author)

  7. Electrochemistry of oxo-technetium(V) complexes containing Schiff base and 8-quinolinol ligands

    International Nuclear Information System (INIS)

    Refosco, F.; Mazzi, U.; Deutsch, E.; Kirchhoff, J.R.; Heineman, W.R.; Seeber, R.

    1988-01-01

    The electrochemistry of six-coordinate, monooxo technetium(V) complexes containing Schiff base ligands has been studied in acetonitrile and N,N'-dimethylformamide solutions. The complexes have the general formula TcOCl(L B ) 2 or TcO(L T )(L B ), where L B represents a bidentate-N,O Schiff base ligand or a bidentate-N,O 8-quinolinol ligand and L T represents a tridentate-O,N,O Schiff base ligand. Cyclic voltammetry at a platinum-disk electrode, controlled-potential coulometry, and thin-layer spectroelectrochemistry were used to probe both the oxidation and the reduction of these complexes. The results of these studies, and previously reported results on the analogous Re(V) complexes, can be understood within a single general reaction scheme. The salient features of this scheme are (i) one-electron reduction of Tc(V) to Tc(IV), (ii) subsequent loss of a ligand situated cis to the Tc≡O linkage, and (iii) subsequent isomerization of this unstable Tc(IV) product to more stable complex in which the site trans to the Tc≡O linkage is vacant. The Tc(IV) complexes can also be reduced to analogous Tc(III) species, which appear to undergo the same ligand loss and isomerization reactions. The technetium complexes are 400-500 mV easier to reduce than are their rhenium analogues. The 8-quinolinol ligands, and especially the 5-nitro derivative, both thermodynamically and kinetically stabilize the Tc(IV) and Tc(III) oxidation states. These electrogenerated species are unusual in that they constitute the bulk of the known examples of monomeric Tc(IV) and Tc(III) complexes containing only N- and O-donating ligands. 34 refs., 9 figs., 1 tab

  8. 31 CFR 17.110 - Self-evaluation.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Self-evaluation. 17.110 Section 17... § 17.110 Self-evaluation. (a) The agency shall, by two years after the effective date of this part... handicaps, to participate in the self-evaluation process. (c) The agency shall, until three years following...

  9. An electron spin resonance study of bis(tetraphenylarsonium) pentakis(isothiocyanato)nitrosyltechnetate(II): a six-co-ordinate low-spin 4d5 technetium(II) complex

    International Nuclear Information System (INIS)

    Baldas, J.; Boas, J.F.; Bonnyman, J.; Williams, G.A.

    1984-01-01

    The e.s.r. spectrum of the title complex has been studied in non-aqueous solution in the liquid and frozen glass phases. The spectrum is characteristic of a low-spin 4d 5 technetium(II) ion in an axially symmetric environment: g and A values are reported. The small quadrupole interaction observed is solvent dependent. A simple crystal field model, in which the unpaired electron is located in the tsub(2g) orbital triplet, is able to explain most features of the e.s.r. spectrum. A consideration of the electronic parameters derived from the g and A values leads to the conclusion that the results are best explained by a large tetragonal distortion from octahedral symmetry with strong π bonding between technetium and the ligands. (author)

  10. Preparation and characterization of TRIS(1,10-phenanthroline) technetium(III)

    International Nuclear Information System (INIS)

    Kremer, C.; Kremer, E.

    1993-01-01

    The [Tc(phen) 3 ] (PF 6 ) 3 complex has been synthesized by ligand substitution on [Tc(tu) 6 ] 3+ . The reaction proceeds quickly in aqueous solution. A pure compound is obtained with 40% yield. It was characterized by Tc elemental analysis, cerimetric titration, conductometry and electrophoresis. The corresponding spectroscopic properties (UV, Vis, IR and NMR) are also reported and discussed. (author) 16 refs.; 3 tabs

  11. 29 CFR 825.110 - Eligible employee.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Eligible employee. 825.110 Section 825.110 Labor... employee. (a) An “eligible employee” is an employee of a covered employer who: (1) Has been employed by the... worksite where 50 or more employees are employed by the employer within 75 miles of that worksite. (See...

  12. Fermi surface and quantum well states of V(110) films on W(110)

    International Nuclear Information System (INIS)

    Krupin, Oleg; Rotenberg, Eli; Kevan, S D

    2007-01-01

    Using angle-resolved photoemission spectroscopy, we have measured the Fermi surface of V(110) films epitaxially grown on a W(110) substrate. We compare our results for thicker films to existing calculations and measurements for bulk vanadium and find generally very good agreement. For thinner films, we observe and analyse a diverse array of quantum well states that split and distort the Fermi surface segments. We have searched unsuccessfully for a thickness-induced topological transition associated with contact between the zone-centre jungle gym and zone-boundary hole ellipsoid Fermi surface segments. We also find no evidence for ferromagnetic splitting of any bands on this surface

  13. Fermi surface and quantum well states of V(110) films on W(110)

    Energy Technology Data Exchange (ETDEWEB)

    Krupin, Oleg [MS 6-2100, Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Rotenberg, Eli [MS 6-2100, Advanced Light Source, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Kevan, S D [Department of Physics, University of Oregon, Eugene, OR 97403 (United States)

    2007-09-05

    Using angle-resolved photoemission spectroscopy, we have measured the Fermi surface of V(110) films epitaxially grown on a W(110) substrate. We compare our results for thicker films to existing calculations and measurements for bulk vanadium and find generally very good agreement. For thinner films, we observe and analyse a diverse array of quantum well states that split and distort the Fermi surface segments. We have searched unsuccessfully for a thickness-induced topological transition associated with contact between the zone-centre jungle gym and zone-boundary hole ellipsoid Fermi surface segments. We also find no evidence for ferromagnetic splitting of any bands on this surface.

  14. Contribution of technetium pyrophosphate bone scintigraphy in the evaluation of prostate cancer extension based on 100 cases

    International Nuclear Information System (INIS)

    Oliveux, Alain.

    1976-01-01

    The aim of this work was to compare the results of technetium 99m pyrophosphate bone scintigraphy with those of the standard radiographic exploration of the skeleton in order to find out whether scintigraphic data allow an earlier and more accurate diagnosis of the presence of bone metastases. The dose administered is about 10MCi per patient; the recording is made 4 hours after intraveinous injection of the tracer. The documents are obtained in two stages: - first of all a whole-body scintigraph is carried out by means of an 'omniview' system adapted to the Picker dynacamera. This instrument gives an image of the entire body by translation of the patient's bed before the detection head of the camera; - immediately after the whole-body scan a series of static views is taken, especially on abnormal or doubtful areas. These documents have a better resolution than the reduced whole-body image and supply complementary data all the more valuable as they are directed towards the zones of interest. Analysis of our observations underlines the advantages of technetium 99m pyrophosphate bone scintigraphy in the evaluation of prostate neoplasm extension. This particularly sensitive method of investigation enables bone metastases to be detected earlier and more precisely in a patient presenting a neoplasm [fr

  15. Ion Exchange Column Tests Supporting Technetium Removal Resin Maturation

    Energy Technology Data Exchange (ETDEWEB)

    Nash, C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); McCabe, D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hamm, L. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Smith, F. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Morse, M. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2013-12-20

    The primary treatment of the tank waste at the DOE Hanford site will be done in the Waste Treatment and Immobilization Plant, currently under construction. The baseline plan for this facility is to treat the waste, splitting it into High Level Waste (HLW) and Low Activity Waste (LAW). Both waste streams are then separately vitrified as glass and sealed in canisters. The LAW glass will be disposed on site. There are currently no plans to treat the waste to remove technetium, so its disposition path is the LAW glass. Due to the soluble properties of pertechnetate and long half-life of 99Tc, effective management of 99Tc is important. Options are being explored to immobilize the supplemental LAW portion of the tank waste, as well as to examine the volatility of 99Tc during the vitrification process. Removal of 99Tc, followed by off-site disposal has potential to reduce treatment and disposal costs. A conceptual flow sheets for supplemental LAW treatment and disposal that could benefit from technetium removal will specifically examine removing 99Tc from the LAW feed stream to supplemental immobilization. SuperLig® 639 is an elutable ion exchange resin. In the tank waste, 99Tc is predominantly found in the tank supernate as pertechnetate (TcO4-). Perrhenate (ReO4-) has been shown to be a good non-radioactive surrogate for pertechnetate in laboratory testing for this ion exchange resin. This report contains results of experimental ion exchange distribution coefficient and column resin maturation kinetics testing using the resin SuperLig® 639a to selectively remove perrhenate from simulated LAW. This revision includes results from testing to determine effective resin operating temperature range. Loading tests were performed at 45°C, and the computer modeling was updated to include the temperature effects. Equilibrium contact testing indicated that this batch of

  16. Click-to-Chelate: Development of Technetium and Rhenium-Tricarbonyl Labeled Radiopharmaceuticals

    Directory of Open Access Journals (Sweden)

    Thomas L. Mindt

    2013-03-01

    Full Text Available The Click-to-Chelate approach is a highly efficient strategy for the radiolabeling of molecules of medicinal interest with technetium and rhenium-tricarbonyl cores. Reaction of azide-functionalized molecules with alkyne prochelators by the Cu(I-catalyzed azide-alkyne cycloaddition (CuAAC; click reaction enables the simultaneous synthesis and conjugation of tridentate chelating systems for the stable complexation of the radiometals. In many cases, the functionalization of (biomolecules with the ligand system and radiolabeling can be achieved by convenient one-pot procedures. Since its first report in 2006, Click-to-Chelate has been applied to the development of numerous novel radiotracers with promising potential for translation into the clinic. This review summarizes the use of the Click-to-Chelate approach in radiopharmaceutical sciences and provides a perspective for future applications.

  17. Development of a remote spectroelectrochemical sensor for technetium as pertechnetate

    Science.gov (United States)

    Monk, David James

    Subsurface contamination by technetium (Tc) is of particular concern in the monitoring, characterization, and remediation of underground nuclear waste storage tanks, processing areas, and associated surroundings at the Hanford Site and other U.S. DOE sites nationwide. The concern over this radioactive element arises for two reasons. First, its most common isotope, 99Tc, has an extremely long lifetime of 2.15 x 105 years. Second, it's most common chemical form in environmental conditions, pertechnetate (TcO4-), exhibits very fast migration through soils and readily presents itself to any nearby aquifer. Standard procedures of sampling and analysis in a laboratory prove to be slow and costly in the case of subsurface contamination by radioactive materials. It is highly desirable to develop sensors for these materials that possess the capability of either in-situ or on-site placement for continuous monitoring or immediate analysis of collected samples. These sensors need to possess adequate detection limit and selectivity, rapid response, reversibility (many measurements with one sensor), the ability to perform remotely, and ruggedness. This dissertation describes several areas of the continued work toward a sensor for 99Tc as TcO4-. Research initially focused on developing spectroelectrochemical instrumentation and a disposable sensing element, engineered to address the need to perform remote measurements. The instrument was then tested using samples containing 99Tc, resulting in the development of ancillary equipment and techniques to address concerns associated with performing experiments on radioactive materials. In these tests, the electrochemistry of TcO4 - was demonstrated to be irreversible. Electrochemical reduction of TcO4- on a bare or polymer modified electrode resulted in the continuous build up of technetium oxide (TcO2) on the electrode surface. This TcO2 formed in visual quantities in these films during electrochemistry, and proved to be non-ideal for

  18. Investigation of Technetium Redox Cycling in FRC Background Sediments using EXAFS and Gamma Camera Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Lloyd, J.R.; McBeth, J.M.; Lear, G.; Morris, K.; Burke, I.T.; Livens, F.R.; Ellis, B.; Lawson, R.

    2006-04-05

    Technetium-99 is a priority pollutant at numerous DOE sites, due to its long half-life (2.1 x 105 years), high mobility as Tc(VII) in oxic waters, and bioavailability as a sulfate analogue. {sup 99}Tc is far less mobile under anaerobic conditions, forming insoluble Tc(IV) precipitates. As anaerobic microorganisms can reduce soluble Tc(VII) to insoluble Tc(IV), microbial metabolism may have the potential to treat sediments and waters contaminated with Tc. Baseline studies of fundamental mechanisms of Tc(VII) bioreduction and precipitation (reviewed by Lloyd et al., 2005, in press) have generally used pure cultures of metal-reducing bacteria, in order to develop conceptual models for the biogeochemical cycling of {sup 99}Tc. There is, however, comparatively little known about interactions of metal-reducing bacteria with environmentally relevant trace concentrations of {sup 99}Tc, against a more complex biogeochemical background provided by mixed microbial communities in aquifer sediments. The objective of this project is to probe the site specific biogeochemical conditions that control the mobility of {sup 99}Tc at the US DOE Field Research Center Site (FRC; Oak Ridge, Tennessee). This information is required for the rational design of in situ bioremediation strategies for technetium-contaminated subsurface environments. We are using a combination of geochemical, mineralogical, microbiological and spectroscopic techniques to determine the solubility and phase associations of {sup 99}Tc in FRC sediments, and characterize the underpinning biogeochemical controls.

  19. Technetium-99m-HMPAO SPECT in patients with hemiconvulsions followed by Todd`s paralysis

    Energy Technology Data Exchange (ETDEWEB)

    Kimura, M.; Sejima, Hitoshi; Ozasa, Hiroshi; Yamaguchi, Seiji [Department of Pediatrics, Shimane Medical University, 89-1 Enya-cho, Izumo, Shimane 693 (Japan)

    1998-02-01

    We performed technetium-99m-hexamethylpropylene- amineoxime (Tc-HMPAO) single photon emission computed tomography in two patients with prolonged hemiconvulsions followed by transient hemiparesis (Todd`s paralysis). In both cases, a prolonged post-ictal cerebral hyperperfusion state of approximately 24 h was observed, even after the neurological deficits had resolved. The cerebral hyperperfusion in both cases was of much longer duration than that in previously reported cases of single and uncomplicated focal seizures. The prolonged cerebral hyperperfusion might have been due to impairment of the cerebrovascular autoregulation in seizures followed by Todd`s paralysis. (orig.) With 2 figs., 9 refs.

  20. Sup(99m) Technetium - labeled red blood cells 'in vitro'

    International Nuclear Information System (INIS)

    Bernardo Filho, M.; Souza Moura, I.N. de; Boasquevisque, E.M.

    1983-01-01

    A simple technique for the preparation of sup(99m) Tc labeled red blood cells using a comercial kit is described. To each 3ml of plain blood with anti-coagulant was added 1ml of solution of commercial kit with 6.8 μg of stannous chloride. This mixture was incubated in water bath, at 37 0 C, for 60 minutes. Then technetium-99m was added and the mixture was left for another ten minutes, in water bath, at 37 0 C. Under these conditions there was the best labeling of the red blood cells. Similar results were obtained with a solution of stannous chloride prepared freshly. The labeling is strong for 6.8 μg stannous chloride because the labeling was not removed by the several washes of the red blood cells or by the left in water bath. (Author) [pt

  1. Synthesis of new Technetium 99 agents from aryl piperozine derivatives

    International Nuclear Information System (INIS)

    Zenati, Kaouther

    2012-01-01

    This work arises in the context of developing specific radiopharmaceuticals for serotoninergic 5-HT 1A receptors, for scintigraphic imaging by SPECT. these being involved in several neuropathology. Starting from new derivative of Technetium cytectrene bearing the methoxyphenyl piperazine moiety that have revealed an impressive brain uptake (2.47 pour cent ID/G), we thought to obtain an other radiocomplexe characterized by a more stable brain retention. To do this we added a spacer amino propyl to the first ligand 1-((2methoxyphenyl) piperazine carboxamide ferrocene, thus obtaining 1(3-aminopropyl) 4 (2-methoxyphenyl piperazine) ferrocene carboxamide. We report here the synthesis of the tricarbonyl 99mT c radioligand, its characterization and its biological study. The biodistribution is characterized by a very large uptake in the lungs and relatively slow depuration.Brain absorption is reduced compared to the analogue of origin with equivalent cerebral retention time.

  2. 110GHz ECH on DIII-D

    International Nuclear Information System (INIS)

    Cary, W.P.; Allen, J.C.; Callis, R.W.; Doane, J.L.; Harris, T.E.; Moetler, C.P.; Neren, A.; Prater, P.; Rensen, D.

    1992-01-01

    This paper reports on a new high power electron cyclotron heating (ECH) system which has been introduced on DIII-D. This system is designed to operate at 110 GHz with a total output power of 2 MW. The system consists of four Varian VGT-8011 gyrotrons (output power of 500 kW), and their associated support equipment. All components have been designed for up to a 10 second pulse duration. The 110 GHz system is intended to further progress in rf current drive experiments on DIII-D when used in conjunction with the existing 60 GHz ECH (1. 6 MW) , and the 30-60 MHz ICH (2MW) systems. H-mode physics, plasma stabilization experiments and transport studies are also to be conducted at 110 GHz

  3. evaluation of some technetium-99m fluoroquinolones complexes as imaging agents for bacterial inflammatory lesions

    International Nuclear Information System (INIS)

    Abdel-Kawy, O.A.A.

    2007-01-01

    in this study, the labeling method of ciprofloxacin and levofloxacin with technetium-99m and their biological evaluation in man-induced inflammation models were described . in -vitro microbiological evaluation of both complexes was also performed in order to investigate the effect of labeling on the activity and spectrum of both antibiotics. all the gathered biological data support the usefulness of 99m Tc-fluoroquinolones as infection imaging agents that could discriminate between infections and sterile inflammations. the freeze-dried form of levofloxacin kits was prepared and found to meet all the radiochemical and biological tests

  4. 33 CFR 110.84b - Buffalo, N.Y.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Buffalo, N.Y. 110.84b Section 110... REGULATIONS Special Anchorage Areas § 110.84b Buffalo, N.Y. The area within the Port of Buffalo known as Port of Buffalo Small Boat Harbor commencing at a point on shore at latitude 42°51′05″ N., longitude 78°51...

  5. Spin-polarized scanning tunneling microscopy of magnetic nanostructures at the example of bcc-Co/Fe(110), Fe/Mo(110), and copper phthalocyanine/Fe(1110); Spinpolarisierte Rastertunnelmikroskopie magnetischer Nanostrukturen am Beispiel von bcc-Co/Fe(110), Fe/Mo(110) und Kupfer-Phthalocyanin/Fe(110)

    Energy Technology Data Exchange (ETDEWEB)

    Methfessel, Torsten

    2010-12-09

    This thesis provides an introduction into the technique of spin-polarized scanning tunnelling microscopy and spectroscopy as an experimental method for the investigation of magnetic nanostructures. Experimental results for the spin polarized electronic structure depending on the crystal structure of ultrathin Co layers, and depending on the direction of the magnetization for ultrathin Fe layers are presented. High-resolution measurements show the position-dependent spin polarization on a single copper-phthalocyanine molecule deposited on a ferromagnetic surface. Co was deposited by molecular beam epitaxy on the (110) surface of the bodycentered cubic metals Cr and Fe. In contrast to previous reports in the literature only two layers of Co can be stabilized in the body-centered cubic (bcc) structure. The bcc-Co films on the Fe(110) surface show no signs of epitaxial distortions. Thicker layers reconstruct into a closed-packed structure (hcp / fcc). The bcc structure increases the spin-polarization of Co to P=62 % in comparison to hcp-Co (P=45 %). The temperature-dependent spin-reorientation of ultrathin Fe/Mo(110) films was investigated by spin-polarized spectroscopy. A reorientation of the magnetic easy axis from the [110] direction along the surface normal to the in-plane [001] axis is observed at T (13.2{+-}0.5) K. This process can be identified as a discontinuous reorientation transition, revealing two simultaneous minima of the free energy in a certain temperature range. The electronic structure of mono- and double-layer Fe/Mo(110) shows a variation with the reorientation of the magnetic easy axis and with the direction of the magnetization. The investigation of the spin-polarized charge transport through a copper-phthalocyanine molecule on the Fe/Mo(110) surface provides an essential contribution to the understanding of spin-transport at the interface between metal and organic molecule. Due to the interaction with the surface of the metal the HOMO-LUMO energy

  6. Application of crown ethers to selective extraction and quantitative analysis of technetium 99, iodine 129 and cesium 135 in effluents

    International Nuclear Information System (INIS)

    Paviet, P.

    1992-01-01

    Properties of crown ethers are first recalled. Then extraction of technetium 99 is studied in actual radioactive effluents. Quantitative analysis is carried out by liquid scintillation and interference of tritium is corrected. Iodine 129 is extracted from radioactive effluents and determined by gamma spectrometry. Finally cesium 135 is extracted and determined by thermo ionization mass spectroscopy

  7. Technetium behavior in sulfide and ferrous iron solutions

    International Nuclear Information System (INIS)

    Lee, S.Y.; Bondietti, E.A.

    1982-01-01

    Pertechnetate oxyanion ( 99 TcO 4- ), a potentially mobile species in leachate from a breached radioactive waste repository, was removed from a brine solution by precipitation with sulfide, iron, and ferrous sulfide at environmental pH's. Maghemite (ν-Fe 2 O 3 ) and geothite (α-FeOOH) were the dominant minerals in the precipitate obtained from the TcO 4- -ferrous iron reaction. The observation of small particle size and poor crystallinity of the minerals formed in the presence of Tc suggested that the Tc was incorporated into the mineral structure after reduction to a lower valence state. Amorphous ferrous sulfide, an initial phase precipitating in the TcO 4- -ferrous iron-sulfide reaction, was transformed to goethite and hematite (α-Fe 2 O 3 ) on aging. The black precipitate obtained from the TcO 4- -sulfide reaction was poorly crystallized technetium sulfide (Tc 2 S 7 ) which was insoluble in both acid and alkaline solution in the absence of strong oxidents. The results suggested that ferrous- and/or sulfide-bearing groundwaters and minerals in host rocks or backfill barriers could reduce the mobility of Tc through the formation of less-soluble Tc-bearing iron and/or sulfide minerals

  8. Technetium {sup 99m}Tc Pertechnetate Brain Scanning

    Energy Technology Data Exchange (ETDEWEB)

    Rhee, Sang Min; Park, Jin Yung; Lee, Ahn Ki; Chung, Choo Il; Hong, Chang Gi [Capital Army Hospital, ROKA, Seoul (Korea, Republic of); Rhee, Chong Heon; Koh, Chang Soon [Radiological Research Institute, Seoul (Korea, Republic of)

    1968-03-15

    Technetium {sup 99}mTc pertechnetate brain scanning were performed in 3 cases of head injury (2 chronic subdural hematomas and 1 acute epidural hematoma), 2 cases of brain abscess and 1 case of intracerebral hematoma associated with arteriovenous anomaly. In all the cases brain scintigrams showed 'hot areas.' Literatures on radioisotope scanning of intracranial lesions were briefly reviewed. With the improvement of radioisotope scanner and development of new radiopharmaceuticals brain scanning became a safe and useful screening test for diagnosis of intracranial lesions. Brain scanning can be easily performed even to a moribund patient without any discomfort and risk to the patient which are associated with cerebral angiography or pneumoencephalography. Brain scanning has been useful in diagnosis of brain tumor, brain abscess, subdural hematoma, and cerebral vascular diseases. In 80 to 90% of brain tumors positive scintigrams can be expected. Early studies were done with 203 Hg-Neohydrin or {sup 131}I-serum albumin. With these agents, however, patients receive rather much radiation to the whole body and kidneys. In 1965 Harper introduced {sup 99}mTc to reduce radiation dose to the patient and improve statistical variation in isotope scanning.

  9. 21 CFR 110.93 - Warehousing and distribution.

    Science.gov (United States)

    2010-04-01

    ...) FOOD FOR HUMAN CONSUMPTION CURRENT GOOD MANUFACTURING PRACTICE IN MANUFACTURING, PACKING, OR HOLDING... microbial contamination as well as against deterioration of the food and the container. ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Warehousing and distribution. 110.93 Section 110...

  10. Emission computed tomography with technetium-99m pyrophosphate for delineating location and size of acute myocardial infarction in man

    Energy Technology Data Exchange (ETDEWEB)

    Tamaki, S; Kadota, K; Kambara, H; Suzuki, Y; Nohara, R; Murakami, T; Kawai, C; Tamaki, N; Torizuka, K [Kyoto Univ. (Japan). Faculty of Medicine

    1984-07-01

    Emission computed tomography with technetium-99m pyrophosphate was used to delineate the location and estimate the size of myocardial infarcts in 20 patients with documented acute myocardial infarction. Tomography was performed after planar imaging within 2-5 days after the onset of infarction. Infarct volume was measured from the tomographic images by computerised planimetry and compared with the cumulative release of creatine kinase MB isoenzyme. The planar images showed discrete myocardial uptake in 13 of the 20 patients and diffuse uptake throughout the cardiac region in the remaining seven. In contrast, the tomographic images clearly delineated myocardial uptake by avoiding confusion of myocardial activity with that of surrounding structures, particularly bones, in all patients. For the 10 patients whose infarct size was assessed by analysis of the creatine kinase MB curve there was a close correlation between infarct volume estimated by tomography and by cumulative creatine kinase MB release. Thus emission computed tomography can provide a three dimensional map of technetium-99m pyrophosphate distribution within the heart and is thus able accurately to localise and estimate the size of myocardial infarcts in man.

  11. Emission computed tomography with technetium-99m pyrophosphate for delineating location and size of acute myocardial infarction in man

    International Nuclear Information System (INIS)

    Tamaki, S.; Kadota, K.; Kambara, H.; Suzuki, Y.; Nohara, R.; Murakami, T.; Kawai, C.; Tamaki, N.; Torizuka, K.

    1984-01-01

    Emission computed tomography with technetium-99m pyrophosphate was used to delineate the location and estimate the size of myocardial infarcts in 20 patients with documented acute myocardial infarction. Tomography was performed after planar imaging within 2-5 days after the onset of infarction. Infarct volume was measured from the tomographic images by computerised planimetry and compared with the cumulative release of creatine kinase MB isoenzyme. The planar images showed discrete myocardial uptake in 13 of the 20 patients and diffuse uptake throughout the cardiac region in the remaining seven. In contrast, the tomographic images clearly delineated myocardial uptake by avoiding confusion of myocardial activity with that of surrounding structures, particularly bones, in all patients. For the 10 patients whose infarct size was assessed by analysis of the creatine kinase MB curve there was a close correlation between infarct volume estimated by tomography and by cumulative creatine kinase MB release. Thus emission computed tomography can provide a three dimensional map of technetium-99m pyrophosphate distribution within the heart and is thus able accurately to localise and estimate the size of myocardial infarcts in man. (author)

  12. The DOE/NASA SRG110 Program Overview

    Science.gov (United States)

    Shaltens, R. K.; Richardson, R. L.

    2005-12-01

    The Department of Energy is developing the Stirling Radioisotope Generator (SRG110) for NASAs Science Mission Directorate for potential surface and deep space missions. The SRG110 is one of two new radioisotope power systems (RPSs) currently being developed for NASA space missions, and is capable of operating in a range of planetary atmospheres and in deep space environments. It has a mass of approximately 27 kg and produces more than 125We(dc) at beginning of mission (BOM), with a design lifetime of fourteen years. Electrical power is produced by two (2) free-piston Stirlings convertor heated by two General Purpose Heat Source (GPHS) modules. The complete SRG110 system is approximately 38 cm x 36 cm and 76 cm long. The SRG110 generator is being designed in 3 stages: Engineering Model, Qualification Generator, and Flight Generator. Current plans call for the Engineering Model to be fabricated and tested by October 2006. Completion of testing of the Qualification Generator is scheduled for mid-2009. This development is being performed by Lockheed Martin, Valley Forge, PA and Infinia Corporation, Kennewick, WA under contract to the Department of Energy, Germantown, Md. Glenn Research Center, Cleveland, Ohio is providing independent testing and support for the technology transition for the SRG110 Program.

  13. 21 CFR 110.110 - Natural or unavoidable defects in food for human use that present no health hazard.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Natural or unavoidable defects in food for human... PRACTICE IN MANUFACTURING, PACKING, OR HOLDING HUMAN FOOD Defect Action Levels § 110.110 Natural or... natural or unavoidable defects to the lowest level currently feasible. (d) The mixing of a food containing...

  14. Production cross sections and isomeric ratios for sup(110m)In/sup(110g)In formed in Cd (d,xn) reactions

    International Nuclear Information System (INIS)

    Herreros Usher, Oscar; Maceiras de Jefimowicz, Elena; De la Vega Vedoya, Mario; Jorge Nassiff, Sonia

    1980-01-01

    Excitation functions and isomeric cross sections ratios have been measured for the 110 Cd (d,2n) and 111 Cd (d,3n) reactions in which the isomeric pair sup(110m)In/sup(110g)In is produced. Activation method was employed and the irradiations were performed at the synchrocyclotron of the Comision Nacional de Energia Atomica, Argentina, with an incident energy of 27.MeV. (author) [es

  15. 11 CFR 110.18 - Voting age population.

    Science.gov (United States)

    2010-01-01

    ... 11 Federal Elections 1 2010-01-01 2010-01-01 false Voting age population. 110.18 Section 110.18 Federal Elections FEDERAL ELECTION COMMISSION GENERAL CONTRIBUTION AND EXPENDITURE LIMITATIONS AND... population of the United States, of each State, and of each Congressional district. The term voting age...

  16. CP110 exhibits novel regulatory activities during centriole assembly in Drosophila

    Science.gov (United States)

    Franz, Anna; Roque, Hélio; Saurya, Saroj; Dobbelaere, Jeroen

    2013-01-01

    CP110 is a conserved centriole protein implicated in the regulation of cell division, centriole duplication, and centriole length and in the suppression of ciliogenesis. Surprisingly, we report that mutant flies lacking CP110 (CP110Δ) were viable and fertile and had no obvious defects in cell division, centriole duplication, or cilia formation. We show that CP110 has at least three functions in flies. First, it subtly influences centriole length by counteracting the centriole-elongating activity of several centriole duplication proteins. Specifically, we report that centrioles are ∼10% longer than normal in CP110Δ mutants and ∼20% shorter when CP110 is overexpressed. Second, CP110 ensures that the centriolar microtubules do not extend beyond the distal end of the centriole, as some centriolar microtubules can be more than 50 times longer than the centriole in the absence of CP110. Finally, and unexpectedly, CP110 suppresses centriole overduplication induced by the overexpression of centriole duplication proteins. These studies identify novel and surprising functions for CP110 in vivo in flies. PMID:24297749

  17. 33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

  18. Absorption behavior of technetium and rhenium through plant roots

    International Nuclear Information System (INIS)

    Tagami, K.; Uchida, S.

    2004-01-01

    The absorption behavior of technetium (Tc) and rhenium (Re) through plant roots was studied using nutrient solution culture. Radish samples, grown in culture solutions for 20-30 days in a green house, were transferred into plastic vessels containing nutrient solutions contaminated with multi-tracer solutions including Tc-95m and Re-183. The plant samples were grown individually for 1-7 days under laboratory conditions. The activities of radionuclides in nutrient solutions and oven-dried plant parts (roots, fleshy roots and leaves) were measured with Ge detecting systems. The concentrations of Tc-95m and Re-183 in the nutrient solutions after harvesting the plants were almost the same as those in the initial solution. Possibly, the radionuclides were taken up with water through plant roots. The distributions of Tc and Re in the plants showed no differences, thus, soluble Tc and Re absorption by plant samples were the same. It is suggested that Re could be used as a geochemical tracer of Tc in the soil environment. (author)

  19. Post-traumatic avascular necrosis of the femoral head predicted by preoperative technetium-99m antimony-colloid scan: an experimental and clinical study

    International Nuclear Information System (INIS)

    Turner, J.H.

    1983-01-01

    Technetium-99m antimony colloid was used to visualize the bone marrow of the head of the femur within twenty-four hours after interruption of the blood supply by subcapital osteotomy and section of the ligamentum teres in thirteen rabbits and within twenty-four hours after a subcapital fracture in thirty patients. Of the rabbits, all showed loss of marrow radioactivity over the affected femoral head. Bone-imaging with technetium-99m methylene diphosphonate, in contrast, failed to demonstrate any abnormality in the avascular head of the femur for as long as forty-eight hours after osteotomy. This difference between the marrow scan and the bone scan was attributed to earlier loss of function in the marrow cells than in the osteocytes. The thirty patients who had a preoperative scan within twenty-four hours after sustaining a subcapital fracture were treated by internal fixation with a Richards screw and plate and were followed for as long as two years, or until the patient died or radiographs showed evidence of avascular necrosis. The preoperative technetium-99m antimony-colloid activity in the head of the fractured femur was normal in sixteen patients and absent in fourteen; two of the fourteen had no activity in either hip, which precluded assessment of the fractured hip in these patients. In fifteen of the sixteen hips, preservation of the uptake in the marrow of the head of the fractured femur preoperatively predicted normal healing. Late segmental collapse developed in the remaining hip. In eleven of the twelve patients who had loss of marrow activity in the femoral head preoperatively, avascular necrosis developed within two years

  20. Effects of neutron irradiation on red blood cell labeling with technetium-99m

    International Nuclear Information System (INIS)

    Eng, R.R.; Conklin, J.J.; Grissom, M.P.

    1982-01-01

    The effects of in vivo and in vitro neutron irradiation on red blood cell radiolabeling with technetium-99m (Tc-99m) were studied. Blood from three dogs was irradiated with neutrons (725 rads, free in air dose) followed by radiolabeling with Tc-99m. The three dogs were subsequently whole body, neutron irradiated (250 rads, midline dose); and blood samples were drawn for radiolabeling at 24, 48, 72 and 96 hours post-irradiation. Blood from three control dogs was also drawn and radiolabeled on each day for comparison. The results show that there were no significant differences between the radiolabeling capacities of in vivo or in vitro neutron irradiated and control RBCs