WorldWideScience

Sample records for tauri star bp

  1. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    International Nuclear Information System (INIS)

    Chen, Wei; Johns-Krull, Christopher M.

    2013-01-01

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star

  2. SPECTROPOLARIMETRY OF THE CLASSICAL T TAURI STAR BP TAU

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wei; Johns-Krull, Christopher M., E-mail: wc2@rice.edu, E-mail: cmj@rice.edu [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States)

    2013-10-20

    We implement a least-squares deconvolution (LSD) code to study magnetic fields on cool stars. We first apply our code to high-resolution optical echelle spectra of 53 Cam (a magnetic Ap star) and three well-studied cool stars (Arcturus, 61 Cyg A, and ξ Boo A) as well as the Sun (by observing the asteroid Vesta) as tests of the code and the instrumentation. Our analysis is based on several hundred photospheric lines spanning the wavelength range 5000 Å to 9000 Å. We then apply our LSD code to six nights of data on the Classical T Tauri Star BP Tau. A maximum longitudinal field of 370 ± 80 G is detected from the photospheric lines on BP Tau. A 1.8 kG dipole tilted at 129° with respect to the rotation axis and a 1.4 kG octupole tilted at 104° with respect to the rotation axis, both with a filling factor of 0.25, best fit our LSD Stokes V profiles. Measurements of several emission lines (He I 5876 Å, Ca II 8498 Å, and 8542 Å) show the presence of strong magnetic fields in the line formation regions of these lines, which are believed to be the base of the accretion footpoints. The field strength measured from these lines shows night-to-night variability consistent with rotation of the star.

  3. How to unveil a T Tauri star

    International Nuclear Information System (INIS)

    Hartigan, P.; Hartmann, L.; Kenyon, S.; Hewett, R.; Stauffer, J.

    1989-01-01

    A method for separating the 'veiling' continuum often present in T Tauri stars from the underlying photospheric spectrum is described. Echelle observations from 5100 to 6800 A of the partially veiled T Tauri star BP Tau were analyzed to determine the shape of the veiling spectrum. The residuals of the fit indicate the deviation of the veiling spectrum from a simple continuum and identify the location and strength of any emission-line components. It is shown, by means of goodness-of-fit tests, that the spectrum of BP Tau can be decomposed into a normal stellar spectrum plus a smooth veiling continuum with only a few emission lines superposed. The continuum dominates the veiling spectrum in this spectral region; the veiling does not arise from numerous deep photospheric absorption lines that are filled in by weak emission. 36 refs

  4. Environments of T Tauri stars

    International Nuclear Information System (INIS)

    Chevalier, R.A.

    1983-01-01

    The environments of T Tauri stars are probably determined by the interaction of a stellar wind with matter which is falling toward a newly formed star. As shown by Ulrich, the steady infall of cool gas with angular momentum toward the star leads to a density distribution with rhoproportionalr/sup -1/2/ inside a radius r/sub d/ and rhoproportionalr/sup -3/2/ outside r/sub d/. The radius r/sub d/ is determined by the angular momentum of the infalling gas. The expansion of the wind into this medium depends on the parameter α = M/sub w/v/sub w//M/sub in/v/sub in/(r/sub d/), where v/sub in/(r/sub d/) is the free-fall velocity at r/sub d/, M/sub in/ is the mass accretion rate, v/sub w/ is the wind velocity, and M/sub w/ is the mass loss rate. For α 14 cm, v/sub w/ = 150 km s -1 , M/sub in/ = 10 -7 M/sub sun/ yr -1 , and M/sub w/ = 3 x 10 -8 M/sub sun/ yr -1 . The inflow is clumpy. The shocked wind gives the radio emission and nebular emission from T Tauri, and dust within the clumps gives the infrared emission. T Tauri is in a transitory phase in which most of the wind has only recently propagated beyond r/sub d/. The model naturally predicts variable obscuration of T Tauri stars because the infalling clumps move on nonradial trajectories. The infrared emission can vary either because of structural changes in the circumstellar gas or because of variations in the stellar luminosity. Infrared variability should be small at short time scales because of light-travel time effects

  5. The photosphere of T. Tauri Stars

    International Nuclear Information System (INIS)

    Calvet, Nuria; Marin, Zaida

    1987-01-01

    We have calculated the absorption spectrum in the wavelength interval 4880-5025A for a set of models with Teff = 4000K and log g = 3.5 and a chromospheric temperature rise. These models are considered as representative of the atmosphere of T Tauri stars. The position of the temperature minimum goes from 0.1 to 2 gr cm -2 in the models. Populations are in LTE and the two level plus continuum approximation is used for the source function. We have compared the calculated spectra with those observed in the program of rotational velocity determination by Vogel and Kuhi (1981). Differences between the spectrum of T Tauri stars can be understood in first approximation in terms of differences in the position of the temperature minimum. In particular, we find that at the moment of the observation, the minimum in BP Tau was located between 1 and 2 cm -2 and in AA Tau between 0.3 and 0.6 gr cm -2 . (Author)

  6. T Tauri stars - Wild as dust

    International Nuclear Information System (INIS)

    Bertout, C.

    1989-01-01

    T Tauri stars (TTSs), their surroundings, and their common evolution toward the main sequence are discussed. The photospheric properties of TTSs and their solar-type outer atmospheres, recent evidence for circumstellar disks around classical TTSs (CTTSs), and CTTS mass outflows are examined. TTSs are depicted as complex systems whose properties depend mostly on the initial conditions of star formation and on their rotation rates, which appear to control the magnetodynamic activity in the stars. The most exotic traits of CTTSs are primarily due to the disk and its interaction with the star, and the properties of weak-line TTSs (WTTSs) are mainly manifestations of the enhanced solar-type magnetic activity expected from their rotation rates. CTTSs are expected to become WTTSs when their disks dissipate. 217 refs

  7. Disk accretion onto magnetic T Tauri stars

    International Nuclear Information System (INIS)

    Koenigl, A.

    1991-01-01

    The dynamical and radiative consequences of disk accretion onto magnetic T Tauri stars (TTS) are examined using the Ghosh and Lamb model. It is shown that a prolonged disk accretion phase is compatible with the low rotation rates measured in these stars if they possess a kilogauss strength field that disrupts the disk at a distance of a few stellar radii from the center. It is estimated that a steady state in which the net torque exerted on the star is zero can be attained on a time scale that is shorter than the age of the youngest visible TTS. Although the disk does not develop an ordinary shear boundary layer in this case, one can account for the observed UV excess and Balmer emission in terms of the shocks that form at the bottom of the high-latitude magnetic accretion columns on the stellar surface. This picture also provides a natural explanation of some of the puzzling variability properties of stars like DF Tau and RY Lup. YY Ori stars are interpreted as magnetic TTS in which the observer's line of sight is roughly parallel to an accretion column. 37 refs

  8. Spectral Variations of T Tauri stars

    Science.gov (United States)

    Guenther, E.

    1994-02-01

    Although it can now be taken for granted that T Tauri stars accrete matter from circumstellar disks, the way in which the matter is ultimately accreted by the star is still under discussion. Boundary layer models, as well as models of magnetic accretion are considered. Since the very inner part of the disk, the star, and the boundary layer or the accretion shock radiate mainly in the optical, it is necessary to investigate this wavelength region. Optical spectra of classical T Tauri stars consist of emission lines superimposed on a late-type photospheric spectrum, but the photospheric lines in T Tauri stars are much weaker than the lines of main sequence stars of the same spectral type. This is generally attributed to the presence of an additional continuum which veils the photospheric spectrum of the star, which may be be the emission of the boundary layer, or the emission of the immediate vicinity of an accretion shock. The aim of this work is to give additional information on the nature of the region that emits the veiling continuum by investigating the correlations between the veiling and line fluxes in time serieses of T Tauri stars. For this work a time series of 27, 117, and 89 spectra of BM And, DI Cep and DG Tau, were taken in 9, 13, and 12 nights, using the Echellette-Spectrograph of the 2.2m telescope on Calar Alto, Spain. These T Tauri stars were selected because of their different of levels of activity. The spectra cover the whole region between 3200Å and 11000Å with a resolution of about Δ λ λ = 3000. Using 32 template stars the spectral types of the stars were determined, which is found to remain unchanged during the whole time series. The wavelengths of all photospheric lines are in agreement with a single doppler shift (+/- 6 km/s), which is taken as the systemic velocity. It is thus assumed that the low excitation lines are indeed the photospheric lines of the star and the veiling is an additional continuum source. The spectrum of the veiling

  9. X-ray sources in regions of star formation. I. The naked T Tauri stars

    International Nuclear Information System (INIS)

    Walter, F.M.

    1986-01-01

    Einstein X-ray observations of regions of active star formation in Taurus, Ophiuchus, and Corona Australis show a greatly enhanced surface density of stellar X-ray sources over that seen in other parts of the sky. Many of the X-ray sources are identified with low-mass, pre-main-sequence stars which are not classical T Tauri stars. The X-ray, photometric, and spectroscopic data for these stars are discussed. Seven early K stars in Oph and CrA are likely to be 1-solar-mass post-T Tauri stars with ages of 10-million yr. The late K stars in Taurus are not post-T Tauri, but naked T Tauri stars, which are coeval with the T Tauri stars, differing mainly in the lack of a circumstellar envelope. 72 references

  10. POST T-Tauri Stars in Galactic Clusters

    Science.gov (United States)

    Haro, G.

    1983-08-01

    There is a number of theoretical and observational reasons to support a view of star formation and evolution as a continuous process which covers a rather long period of time, On the other hand, it can be stressed that some particular evolutionary stages are confined to relatively short lengths of time. On a purely observational basis, it seems quite evident that the typical and most "advanced" T Tauri phenomenon in a given star -and consequently its extreme spectroscopic and photometric characteristics- manifest itself during an extremely short period of time in relation to the whole evolutionary process for intermediate and late type stars. Without doubt the extreme or advanced" features of a T Tauri object tend to diminish in periods of only -in most cases- a few million years. However, a considerably longer time is required for the process of weakening or apparent total disappearance of the most persistent T Tauri features. Nevertheless, among other problems, there emerges one of fundamental importance: can we arrive to an acceptable definition of a bon T Tauri star? In the present work we repeat our attempt to define what can characterize an "advanced" T Tauri-type star or the minimum spectroscopic and photometric features required to classify a young star within the family that unmistakably includes all typical T Tauri objects. At the same time, and following the trends of modern astronomy, we try to demonstrate that certain T Tauri-type stars evolve, during different periods of time and that, although they lose mass and their most conspicuous spectroscopic characteristics, they can still be described as what Herbig calls "post-T Tauri" stars, keeping some remnants of their primitive spectroscopic and photometric features. Several years ago, we stressed that in the great majority of T Tauri stars it seems that the time required for the diminishing or even apparent disappearance of the last typical T Tauri vestiges depends on the mass or on the observable

  11. HOT GAS LINES IN T TAURI STARS

    International Nuclear Information System (INIS)

    Ardila, David R.; Herczeg, Gregory J.; Gregory, Scott G.; Hillenbrand, Lynne A.; Ingleby, Laura; Bergin, Edwin; Bethell, Thomas; Calvet, Nuria; France, Kevin; Brown, Alexander; Edwards, Suzan; Johns-Krull, Christopher; Linsky, Jeffrey L.; Yang, Hao; Valenti, Jeff A.; Abgrall, Hervé; Alexander, Richard D.; Brown, Joanna M.; Espaillat, Catherine; Hussain, Gaitee

    2013-01-01

    For Classical T Tauri Stars (CTTSs), the resonance doublets of N V, Si IV, and C IV, as well as the He II 1640 Å line, trace hot gas flows and act as diagnostics of the accretion process. In this paper we assemble a large high-resolution, high-sensitivity data set of these lines in CTTSs and Weak T Tauri Stars (WTTSs). The sample comprises 35 stars: 1 Herbig Ae star, 28 CTTSs, and 6 WTTSs. We find that the C IV, Si IV, and N V lines in CTTSs all have similar shapes. We decompose the C IV and He II lines into broad and narrow Gaussian components (BC and NC). The most common (50%) C IV line morphology in CTTSs is that of a low-velocity NC together with a redshifted BC. For CTTSs, a strong BC is the result of the accretion process. The contribution fraction of the NC to the C IV line flux in CTTSs increases with accretion rate, from ∼20% to up to ∼80%. The velocity centroids of the BCs and NCs are such that V BC ∼> 4 V NC , consistent with the predictions of the accretion shock model, in at most 12 out of 22 CTTSs. We do not find evidence of the post-shock becoming buried in the stellar photosphere due to the pressure of the accretion flow. The He II CTTSs lines are generally symmetric and narrow, with FWHM and redshifts comparable to those of WTTSs. They are less redshifted than the CTTSs C IV lines, by ∼10 km s –1 . The amount of flux in the BC of the He II line is small compared to that of the C IV line, and we show that this is consistent with models of the pre-shock column emission. Overall, the observations are consistent with the presence of multiple accretion columns with different densities or with accretion models that predict a slow-moving, low-density region in the periphery of the accretion column. For HN Tau A and RW Aur A, most of the C IV line is blueshifted suggesting that the C IV emission is produced by shocks within outflow jets. In our sample, the Herbig Ae star DX Cha is the only object for which we find a P-Cygni profile in the C IV

  12. Paradoxical gap in the relative ages of T Tauri stars

    International Nuclear Information System (INIS)

    Weaer, W.B.

    1984-01-01

    The frequency distribution of T Tauri stars of different Youth (relative age) shows a pronounced gap at 5% of their time to the zero-age main sequence. This gap, which occurs in all of the four major T Tauri associations, is too large to be filled by unclassifiable veiled stars. It is nearly vertical on the Hertzsprung-Russell diagram, is centered near spectral class K5, and lies close to the transition between the convective and radiative tracks of the pre-main-sequence stars

  13. Chemical Compositions of RV Tauri Stars and Related Objects

    Science.gov (United States)

    Rao, S. S.; Giridhar, S.

    2014-04-01

    We have undertaken a comprehensive abundance analysis for a sample of relatively unexplored RV Tauri and RV Tauri like stars to further our understanding of post-Asymptotic Giant Branch (post-AGB) evolution. From our study based on high resolution spectra and a grid of model atmospheres, we find indications of mild s-processing for V820 Cen and IRAS 06165+3158. On the other hand, SU Gem and BT Lac exhibit the effects of mild dust-gas winnowing. We have also compiled the existing abundance data on RV Tauri objects and find that a large fraction of them are afflicted by dust-gas winnowing and aided by the present work, we find a small group of two RV Tauris showing mild s-process enhancement in our Galaxy. With two out of three reported s-process enhanced objects belonging to RV Tauri spectroscopic class C, these intrinsically metal-poor objects appear to be promising candidates to analyse the possible s-processing in RV Tauri stars.

  14. New T Tauri stars in Chamaeleon I and Chamaeleon II

    Science.gov (United States)

    Hartigan, Patrick

    1993-01-01

    A new objective prism survey of the entire Chamaeleon I dark cloud and 2/3 of the Chamaeleon II cloud has uncovered 26 new H-alpha emission line objects that were missed by previous H-alpha plate surveys. The new H-alpha emission line objects have similar IR colors and spatial distributions to the known T Tauri stars in these dark clouds, and could represent the very low mass end of the stellar population in these clouds or an older, less active component to the usual classical T Tauri star population. The new H-alpha survey identified 70 percent of the total known Young Stellar Objects (YSOs) in Cha I, compared with 35 percent for IRAS, and 25 percent from the Einstein X-ray survey. Ten of the new objects are weak-lined stars, with H-alpha equivalent widths less than 10 A. Weak-lined T Tauri stars make up about half of the total population of young stars in the Chamaeleon I cloud, a proportion similar to the Taurus-Auriga cloud. Presented are coordinates, finding charts, and optical and IR photometry of the new emission-line objects.

  15. Flat spectrum T Tauri stars: The case for infall

    Science.gov (United States)

    Calvet, Nuria; Hartmann, Lee; Kenyon, S. J.; Whitney, B. A.

    1994-01-01

    We show that the mid- to far-infrared fluxes of 'flat spectrum' T Tauri stars can be explained by radiative equilibrium emission from infalling dusty envelopes. Infall eliminates the need for accretion disks with non-standard temperature distributions. The simplicity and power of this explanantion indicates that models employing 'active' disks, in which the temperature distribution is a parameterized power law, should be invoked with caution. Infall also naturally explains the scattered light nebulae detected around many flat spectrum sources. To match the observed spectra, material must fall onto a disk rather than the central star, as expected for collapse of a rotating molecular cloud. It may be necessary to invoke cavities in the envelopes to explain the strength of optical and near-infrared emission; these cavities could be produced by the powerful bipolar outflows commonly observed from young stars. If viewed along the cavity, a source may be lightly extincted at visual wavelengths, while still accreting substantial amounts of material from the envelope. Infall may also be needed to explain the infrared-bright companions of many optical T Tauri stars. This picture suggests that many of the flat spectrum sources are 'protostars'-young stellar objects surrounded by dust infalling envelopes of substantial mass.

  16. Local protoplanetary disk ionisation by T Tauri star energetic particles

    Science.gov (United States)

    Fraschetti, F.; Drake, J.; Cohen, O.; Garraffo, C.

    2017-10-01

    The evolution of protoplanetary disks is believed to be driven largely by viscosity. The ionization of the disk that gives rise to viscosity is caused by X-rays from the central star or by energetic particles released by shock waves travelling into the circumstellar medium. We have performed test-particle numerical simulations of GeV-scale protons traversing a realistic magnetised wind of a young solar mass star with a superposed small-scale turbulence. The large-scale field is generated via an MHD model of a T Tauri wind, whereas the isotropic (Kolmogorov power spectrum) turbulent component is synthesised along the particles' trajectories. We have combined Chandra observations of T Tauri flares with solar flare scaling for describing the energetic particle spectrum. In contrast with previous models, we find that the disk ionization is dominated by X-rays except within narrow regions where the energetic particles are channelled onto the disk by the strongly tangled and turbulent field lines; the radial thickness of such regions broadens with the distance from the central star (5 stellar radii or more). In those regions, the disk ionization due to energetic particles can locally dominate the stellar X-rays, arguably, out to large distances (10, 100 AU) from the star.

  17. Applicability of colour index calibrations to T Tauri stars

    Science.gov (United States)

    Schöning, T.; Ammler, M.

    2008-01-01

    We examine the applicability of effective temperature scales of several broad band colours to T Tauri stars (TTS). We take into account different colour systems as well as stellar parameters like metallicity and surface gravity which influence the conversion from colour indices or spectral type to effective temperature. For a large sample of TTS, we derive temperatures from broad band colour indices and check if they are consistent in a statistical sense with temperatures inferred from spectral types. There are some scales (for V-H, V-K, I-J, J-H, and J-K) which indeed predict the same temperatures as the spectral types and therefore can be at least used to confirm effective temperatures. Furthermore, we examine whether TTS with dynamically derived masses can be used for a test of evolutionary models and effective temperature calibrations. We compare the observed parameters of the eclipsing T Tauri binary V1642 Ori A to the predictions of evolutionary models in both the H-R and the Kiel diagram using temperatures derived with several colour index scales. We check whether the evolutionary models and the colour index scales are consistent with coevality and the dynamical masses of the binary components. It turns out that the Kiel diagram offers a stricter test than the H-R diagram. Only the evolutionary models of \\cite {BCAH98} with mixing length parameter α=1.9 and of \\cite{DM94,DM97} show consistent results in the Kiel diagram in combination with some conversion scales of \\cite{HBS00} and of \\cite{KH95}.

  18. JHKL photometry of three Herbig-Haro jet sources and a nebulous T Tauri star

    International Nuclear Information System (INIS)

    Vrba, F.J.; Rydgren, A.E.; Zak, D.S.; Computer Sciences Corp., Baltimore, MD; Rensselaer Polytechnic Institute, Troy, NY)

    1985-01-01

    Infrared sources have been detected at the positions of the Herbig-Haro jet sources HH 30, DG Tau B, and Haro 6-5 B in the Taurus dark cloud complex. The colors of these Herbig-Haro jet sources in the 1-4 micron wavelength range are comparable to those of the dustiest T Tauri stars, while the K magnitudes corrected for likely interstellar extinction are actually somewhat fainter than those oftypical T Tauri stars in this region. These observations are consistent with the view that these Herbig-Haro jet sources are low-mass premain-sequence stars. The nebulous T Tauri star Haro 6-5 was also observed and found to show both a large infrared excess and an intrinsic-polarization of about 3 percent in visible light. Thus this star seems to resemble HL Tau and DG Tau, which have been suggested as examples of young stars with circumstellar disks. 17 references

  19. Flares on a Bp Star

    Science.gov (United States)

    Mullan, D. J.

    2009-09-01

    Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.

  20. FLARES ON A Bp STAR

    International Nuclear Information System (INIS)

    Mullan, D. J.

    2009-01-01

    Two large X-ray flares have been reported from the direction of a magnetic B2p star (σ Ori E). Sanz-Forcada et al. have suggested that the flares did not occur on the B2p star but on a companion of late spectral type. A star which is a candidate for a late-type flare star near σ Ori E has recently been identified by Bouy et al. However, based on the properties of the flares, and based on a recent model of rotating magnetospheres, we argue that, rather than attributing the two flares to a late-type dwarf, it is a viable hypothesis that the flares were magnetic phenomena associated with the rotating magnetosphere of the B2p star itself.

  1. Spectral energy distributions of T Tauri stars - disk flaring and limits on accretion

    International Nuclear Information System (INIS)

    Kenyon, S.J.; Hartmann, L.

    1987-01-01

    The Adams et al. (1987) conclusion that much of the IR excess emission in the spectral energy distribution of T Tauri stars arises from reprocessing of stellar radiation by a dusty circumstellar disk is presently supported by analyses conducted in light of various models of these stars' spectra. A low mass reprocessing disk can, however, produce these spectra as well as a massive accretion disk. The detection of possible boundary layer radiation in the optical and near-UV regions poses the strongest limits on accretion rates. Disk accretion in the T Tauri phase does not significantly modify stellar evolution. 85 references

  2. The character and behaviour of circumstellar shells at T Tauri stars

    International Nuclear Information System (INIS)

    Goetz, W.

    1988-01-01

    T Tauri stars are extremely young low-mass stars in the pre-main sequence stage. A brief review of investigations made at the Sonneberg observatory concerning the character and the behaviour of circumstellar shells at T Tauri stars is given. They lead to the construction of a shell model on the basis of observational facts. The idea rests upon the causal connection between the gas and dust shell phenomenon and the cosmogonic mass loss of the stars, which is the connecting link between the stars and their shells and which appears in the early phase of the pre-main sequence stage and decreases, like the accompanying shell phenomena, during the evolution of the stars. (author)

  3. Residual Gas and Dust around Transition Objects and Weak T Tauri Stars

    Energy Technology Data Exchange (ETDEWEB)

    Doppmann, Greg W. [W. M. Keck Observatory, 65-1120 Mamalahoa Hwy., Kamuela, HI 96743 (United States); Najita, Joan R. [National Optical Astronomy Observatory, 950 N. Cherry Avenue, Tucson, AZ 85719 (United States); Carr, John S., E-mail: gdoppmann@keck.hawaii.edu, E-mail: najita@noao.edu, E-mail: carr@nrl.navy.mil [Naval Research Laboratory, Code 7213, Washington, DC 20375 (United States)

    2017-02-20

    Residual gas in disks around young stars can spin down stars, circularize the orbits of terrestrial planets, and whisk away the dusty debris that is expected to serve as a signpost of terrestrial planet formation. We have carried out a sensitive search for residual gas and dust in the terrestrial planet region surrounding young stars ranging in age from a few to ∼10 Myr. Using high-resolution 4.7 μ m spectra of transition objects (TOs) and weak T Tauri stars, we searched for weak continuum excesses and CO fundamental emission, after making a careful correction for the stellar contribution to the observed spectrum. We find that the CO emission from TOs is weaker and located farther from the star than CO emission from nontransition T Tauri stars with similar stellar accretion rates. The difference is possibly the result of chemical and/or dynamical effects (i.e., a low CO abundance or close-in low-mass planets). The weak T Tauri stars show no CO fundamental emission down to low flux levels (5 × 10{sup −20} to 10{sup −18} W m{sup −2}). We illustrate how our results can be used to constrain the residual disk gas content in these systems and discuss their potential implications for star and planet formation.

  4. New upper limit to the coronal line emission from the T Tauri star RU Lupi

    Energy Technology Data Exchange (ETDEWEB)

    Gahm, G F [Stockholm Observatory (Sweden); Lago, M T.V.T. [Universidade do Porto (Portugal). Grupo de Matematica Aplicada; Penston, M V [ESTEC, European Space Agency, Villafranca Satellite Tracking Station, Madrid, (Spain)

    1981-05-01

    A high dispersion AAT spectrogram sets an upper limit on the (Fe x) emission line lambda 6374.5 A in the T Tauri star RU Lupi. The intensity of any 10/sup 6/ K corona in this star is less than 600 times that of the Sun compared to a chromosphere and transition region of 3 x 10/sup 3/ to 2 x 10/sup 5/ K gas 10/sup 6/ times stronger than the Sun's. The important theoretical implications are noted.

  5. High-resolution TNG spectra of T Tauri stars. Near-IR GIANO observations of the young variables XZ Tauri and DR Tauri

    Science.gov (United States)

    Antoniucci, S.; Nisini, B.; Biazzo, K.; Giannini, T.; Lorenzetti, D.; Sanna, N.; Harutyunyan, A.; Origlia, L.; Oliva, E.

    2017-10-01

    Aims: We aim to characterise the star-disk interaction region in T Tauri stars that show photometric and spectroscopic variability. Methods: We used the GIANO instrument at the Telescopio Nazionale Galileo to obtain near-infrared high-resolution spectra (R 50 000) of XZ Tau and DR Tau, which are two actively accreting T Tauri stars classified as EXors. Equivalent widths and profiles of the observed features are used to derive information on the properties of the inner disk, the accretion columns, and the winds. Results: Both sources display composite H I line profiles, where contributions from both accreting gas and high-velocity winds can be recognised. These lines are progressively more symmetric and narrower with increasing upper energy which may be interpreted in terms of two components with different decrements or imputed to self-absorption effects. XZ Tau is observed in a relatively high state of activity with respect to literature observations. The variation of the He I 1.08 μm line blue-shifted absorption, in particular, suggests that the inner wind has undergone a dramatic change in its velocity structure, connected with a recent accretion event. DR Tau has a more stable wind as its He I 1.08 μm absorption does not show variations with time in spite of strong variability of the emission component. The IR veiling in the two sources can be interpreted as due to blackbody emission at temperatures of 1600 K and 2300 K for XZ Tau and DR Tau, respectively, with emitting areas 30 times larger than the central star. While for XZ Tau these conditions are consistent with emission from the inner rim of the dusty disk, the fairly high temperature inferred for DR Tau might suggest that its veiling originates from a thick gaseous disk located within the dust sublimation radius. Strong and broad metallic lines, mainly from C I and Fe I, are detected in XZ Tau, similar to those observed in other EXor sources during burst phases. At variance, DR Tau shows weaker and

  6. Bipolar molecular outflows: T Tauri stars and Herbig-Haro objects

    International Nuclear Information System (INIS)

    Choe, S.U.

    1984-01-01

    The relations of Herbig-Haro objects to the observed bipolar molecular outflows with T Tauri stars are studied. An evaporation disk model is proposed to obtain the shape of the disk where gas evaporates and to explain the collimation of the central T Tauri wind. In this case the collimation angle is about 10 0 . The collimated T Tauri wind making a form of de Laval nozzle viscously interacts with the surrounding medium. This interaction enhances the second collimation (about 40 0 ) of the resulting flow, mixing stellar and disk winds with external molecular gas. These viscous outflows are observed in the bipolar molecular outflow of the T Tauri stars. It is also proposed in the model that a Kelvin-Helmholtz instability in the throat of the de Laval nozzle produces clumps, which can be accelerated by the ram pressure of the collimated wind up to the wind speed. The clumps eventually pass through a shock in the outlfow, which results from its encounter with the ambient cloud. The clumps are then moving faster than the surrounding flow. These clumps are identified with Herbig-Haro objects

  7. A radio survey of weak T Tauri stars in Taurus-Auriga

    International Nuclear Information System (INIS)

    O'neal, D.; Feigelson, E.D.; Mathieu, R.D.; Myers, P.C.

    1990-01-01

    A multi-epoch 5 GHz survey of candidate or confirmed weak T Tauri stars in the Taurus-Auriga molecular cloud complex was conducted with the Very Large Array. The stars were chosen from those having detectable X-ray or chromospheric emission, and weak-emission-line pre-main-sequence stars found by other means. Snapshots of 99 VLA fields containing 119 candidate stars were obtained with a sensitivity of 0.7 mJy; most fields were observed on two or three dates. Nine radio sources coincident with cataloged stars were found. One may be an RS CVn binary system; the other eight are pre-main-sequence stars. Three of the detected stars - HD 283447, V410 Tau, and FK X-ray 1 - were previously known radio sources. Five new detections are Herbig's Anon 1, Hubble 4, HDE 283572, Elias 12, and HK Tau/c. At least five of the sources are variable, and no linear or circular polarization was found. Several lines of evidence suggest that the radio-detected weak T Tauri stars are quite young, perhaps younger on average than nondetected stars. 54 refs

  8. Spectrophotometry at 10 microns of T Tauri stars

    Science.gov (United States)

    Cohen, M.; Witteborn, F. C.

    1985-01-01

    New 8-13 micron spectra of 32 T Tau, or related young, stars are presented. Silicate emission features are commonly seen. Absorptions occur less frequently but also match the properties of silicate materials. The shape of the emission feature suggests that a more crystalline grain is responsible in the T Tau stars than those of the Trapezium region. The evolution of the silicate component of the circumstellar shell around T Tau stars, and its dependence upon stellar wind activity, visual linear polarization, and extinction are investigated. Several correlations suggest that the shells are likely to be flattened, disklike structures rather than spherical.

  9. C2D spitzer-IRS spectra of disks around T tauri stars : II. PAH emission features

    NARCIS (Netherlands)

    Geers, V. C.; Augereau, J. -C; Pontoppidan, K. M.; Dullemond, C. P.; Visser, R.; Kessler-Silacci, J. E.; Evans, N. J.; van Dishoeck, E. F.; Blake, G. A.; Boogert, A. C. A.; Lahuis, F.; Merin, B.

    Aims. We search for Polycyclic Aromatic Hydrocarbon (PAH) features towards young low-mass (T Tauri) stars and compare them with surveys of intermediate mass (Herbig Ae/Be) stars. The presence and strength of the PAH features are interpreted with disk radiative transfer models exploring the PAH

  10. T Tauri stars in Taurus - the IRAS view

    International Nuclear Information System (INIS)

    Harris, Stella; Clegg, Peter; Hughes, Joanne

    1988-01-01

    Statistical studies of star-formation have traditionally been beset with selection effects. We have developed a technique, using the completeness of the IRAS catalogue, which circumvents these effects. We have taken the properties of known T Tau stars within Taurus as a template to establish a purely IRAS-based definition of such sources. We then use this definition to extract, from the IRAS catalogue, all sources within a specific region of Taurus having those same IRAS properties. This wider class of source is examined and discussed. (author)

  11. IMAGING THE DISK AND JET OF THE CLASSICAL T TAURI STAR AA TAU

    International Nuclear Information System (INIS)

    Cox, Andrew W.; Grady, Carol A.; Hammel, Heidi B.; Hornbeck, Jeremy; Russell, Ray W.; Sitko, Michael L.; Woodgate, Bruce E.

    2013-01-01

    Previous studies of the classical T Tauri star AA Tau have interpreted the UX-Orionis-like photo-polarimetric variability as being due to a warp in the inner disk caused by an inclined stellar magnetic dipole field. We test that these effects are macroscopically observable in the inclination and alignment of the disk. We use Hubble Space Telescope (HST)/STIS coronagraphic imagery to measure the V magnitude of the star for both STIS coronagraphic observations, compare these data with optical photometry in the literature, and find that, unlike other classical T Tauri stars observed in the same HST program, the disk is most robustly detected in scattered light at stellar optical minimum light. We measure the outer disk radius, 1.''15 ± 0.''10, major-axis position angle, and disk inclination and find that the inner disk, as reported in the literature, is both misinclined and misaligned with respect to the outer disk. AA Tau drives a faint jet, detected in both STIS observations and in follow-on Goddard Fabry-Perot imagery, which is also misaligned with respect to the projection of the outer disk minor axis and is poorly collimated near the star, but which can be traced 21'' from the star in data from 2005. The measured outer disk inclination, 71° ± 1°, is out of the range of inclinations suggested for stars with UX-Orionis-like variability when no grain growth has occurred in the disk. The faintness of the disk, small disk size, and detection of the star despite the high inclination all indicate that the dust disk must have experienced grain growth and settling toward the disk midplane, which we verify by comparing the observed disk with model imagery from the literature.

  12. X-ray sources in stars formation areas: T Tauri stars and proto-stars in the rho Ophiuchi dark cloud

    International Nuclear Information System (INIS)

    Grosso, Nicolas

    1999-01-01

    This thesis studies from large to small scales, X-ray sources in the rho Ophiuchi dark cloud. After some background on the formation of the low-mass young stars (Chapter 1), Chapter 2 takes an interest in the T Tauri star population. Chapter 3 tackles the search of the magnetic activity at the younger stage of protostar, presenting a powerful X-ray emission from an IR protostar, called YLW15, during a flare, and a quasi-periodic flare of the same source; as well as a new detection of another IR protostar in the ROSAT archives. It ends with a review of protostar detections. Some IR protostar flares show a very long increasing phase. Chapter 4 links this behaviour with a modulation by the central star rotation. The standard model of jet emission assumes that the central star rotates at the same speed that the inner edge of its accretion disk. This chapter shows that the observation of the YLW15 quasi-periodic flare suggests rather that the forming star rotates faster than its accretion disk, at the break up limit. The synchronism with the accretion disk, observed on T Tauri stars, must be reach progressively by magnetic breaking during the IR protostar stage, and more or less rapidly depending on the forming star mass. Recent studies have shown that T Tauri star X-ray emission could ionize the circumstellar disk, and play a role in the instability development, as well as stimulate the accretion. The protostar X-ray emission might be higher than the T Tauri star one, Chapter 5 presents a millimetric interferometric observation dedicated to measure this effect on YLW15. Finally, Chapter 6 reassembles conclusions and perspectives of this work. (author) [fr

  13. Clumpy molecular clouds: A dynamic model self-consistently regulated by T Tauri star formation

    International Nuclear Information System (INIS)

    Norman, C.; Silk, J.

    1980-01-01

    A new model is proposed which can account for the longevity, energetics, and dynamical structure of dark molecular clouds. It seems clear that the kinetic and gravitational energy in macroscopic cloud motions cannot account for the energetic of many molecular clouds. A stellar energy source must evidently be tapped, and infrared observations indicate that one cannot utilize massive stars in dark clouds. Recent observations of a high space density of T Tauri stars in some dark clouds provide the basis for our assertion that high-velocity winds from these low-mass pre--main-sequence stars provide a continuous dynamic input into molecular clouds. The T Tauri winds sweep up shells of gas, the intersections or collisions of which form dense clumps embedded in a more rarefied interclump medium. Observations constrain the clumps to be ram-pressure confined, but at the relatively low Mach numbers, continuous leakage occurs. This mass input into the interclump medium leads to the existence of two phases; a dense, cold phase (clumps of density approx.10 4 --10 5 cm -3 and temperature approx.10 K) and a warm, more diffuse, interclump medium (ICM, of density approx.10 3 --10 4 cm -3 and temperature approx.30 K). Clump collisions lead to coalescence, and the evolution of the mass spectrum of clumps is studied

  14. A Search for Giant Planet Companions to T Tauri Stars

    Science.gov (United States)

    2012-12-20

    detection – stars: pre-main sequence – techniques: radial velocities Online-only material: color figures 1. INTRODUCTION The discovery of over 760...exoplanets8 in the past twenty years has revealed that planetary systems are common and diverse. Pulsar planets (Wolszczan 1994), hot Jupiters (Mayor... discoveries , the processes underlying planet formation remain unclear. Lacking direct observational inputs, theorists must deduce formation mechanisms from

  15. Emission-line widths and stellar-wind flows in T Tauri stars

    International Nuclear Information System (INIS)

    Sa, C.; Lago, M.T.V.T.

    1986-01-01

    Spectra are reported of T Tauri stars taken with the IPCS on the Isaac Newton Telescope at the Observatorio del Roque de los Muchachos at a dispersion of l7 A mm -1 . These were taken in order to determine emission-line widths and hence flow velocities in the winds of these stars following the successful modelling of the wind from RU Lupi using such data. Line widths in RW Aur suggest a similar pattern to the wind flow as in RU Lupi with velocities rising in the inner chromosphere of the star and then entering a 'ballistic' zone. The wind from DFTau is also similar but velocities are generally much lower and the lines sharper. (author)

  16. Mottled Protoplanetary Disk Ionization by Magnetically Channeled T Tauri Star Energetic Particles

    Science.gov (United States)

    Fraschetti, F.; Drake, J. J.; Cohen, O.; Garraffo, C.

    2018-02-01

    The evolution of protoplanetary disks is believed to be driven largely by angular momentum transport resulting from magnetized disk winds and turbulent viscosity. The ionization of the disk that is essential for these processes has been thought to be due to host star coronal X-rays but could also arise from energetic particles produced by coronal flares, or traveling shock waves, and advected by the stellar wind. We have performed test-particle numerical simulations of energetic protons propagating into a realistic T Tauri stellar wind, including a superposed small-scale magnetostatic turbulence. The isotropic (Kolmogorov power spectrum) turbulent component is synthesized along the individual particle trajectories. We have investigated the energy range [0.1–10] GeV, consistent with expectations from Chandra X-ray observations of large flares on T Tauri stars and recent indications by the Herschel Space Observatory of a significant contribution of energetic particles to the disk ionization of young stars. In contrast with a previous theoretical study finding a dominance of energetic particles over X-rays in the ionization throughout the disk, we find that the disk ionization is likely dominated by X-rays over much of its area, except within narrow regions where particles are channeled onto the disk by the strongly tangled and turbulent magnetic field. The radial thickness of such regions is 5 stellar radii close to the star and broadens with increasing radial distance. This likely continues out to large distances from the star (10 au or greater), where particles can be copiously advected and diffused by the turbulent wind.

  17. V819 TAU: A RARE WEAK-LINED T TAURI STAR WITH A WEAK INFRARED EXCESS

    International Nuclear Information System (INIS)

    Furlan, E.; Forrest, W. J.; Manoj, P.; Kim, K. H.; Watson, Dan M.; Sargent, B. A.

    2009-01-01

    We use Spitzer data to infer that the small infrared excess of V819 Tau, a weak-lined T Tauri star in Taurus, is real and not attributable to a 'companion' 10'' to the south. We do not confirm the mid-infrared excess in HBC 427 and V410 X-ray 3, which are also non-accreting T Tauri stars in the same region; instead, for the former object, the excess arises from a red companion 9'' to the east. A single-temperature blackbody fit to the continuum excess of V819 Tau implies a dust temperature of 143 K; however, a better fit is achieved when the weak 10 and 20 μm silicate emission features are also included. We infer a disk of sub-μm silicate grains between about 1 AU and several 100 AU with a constant surface density distribution. The mid-infrared excess of V819 Tau can be successfully modeled with dust composed mostly of small amorphous olivine grains at a temperature of 85 K, and most of the excess emission is optically thin. The disk could still be primordial, but gas-poor and therefore short-lived, or already at the debris disk stage, which would make it one of the youngest debris disk systems known.

  18. Intrinsic polarization changes and the H-alpha and CA II emission features in T-Tauri stars

    Science.gov (United States)

    Svatos, J.; Solc, M.

    1981-12-01

    On the basis of the correlation between polarization and emission features observed in certain T-Tauri stars, it is concluded that flaring effects associated with UV and/or X-ray irradiation and with increased magnetic field are responsible for the intrinsic polarization changes in T-Tauri stars. The correlation between emission Ca II lines and polarization degree both in Miras and T-Tau stars is thought to support the contention that the intrinsic polarization changes are due to the irradiation of silicate-like grains. In some T-Tau stars the increase in the magnetic field can be the principal agent causing the polarization increase due to the enhanced orientation of elongated grains.

  19. MAGNETIC FIELD MEASUREMENTS OF T TAURI STARS IN THE ORION NEBULA CLUSTER

    International Nuclear Information System (INIS)

    Hao Yang; Johns-Krull, Christopher M.

    2011-01-01

    We present an analysis of high-resolution (R ∼ 50, 000) infrared K-band echelle spectra of 14 T Tauri stars (TTSs) in the Orion Nebula Cluster. We model Zeeman broadening in three magnetically sensitive Ti I lines near 2.2 μm and consistently detect kilogauss-level magnetic fields in the stellar photospheres. The data are consistent in each case with the entire stellar surface being covered with magnetic fields, suggesting that magnetic pressure likely dominates over gas pressure in the photospheres of these stars. These very strong magnetic fields might themselves be responsible for the underproduction of X-ray emission of TTSs relative to what is expected based on main-sequence star calibrations. We combine these results with previous measurements of 14 stars in Taurus and 5 stars in the TW Hydrae association to study the potential variation of magnetic field properties during the first 10 million years of stellar evolution, finding a steady decline in total magnetic flux with age.

  20. THE SPITZER INFRARED SPECTROGRAPH SURVEY OF T TAURI STARS IN TAURUS

    International Nuclear Information System (INIS)

    Furlan, E.; Luhman, K. L.; Espaillat, C.

    2011-01-01

    We present 161 Spitzer Infrared Spectrograph (IRS) spectra of T Tauri stars and young brown dwarfs in the Taurus star-forming region. All of the targets were selected based on their infrared excess and are therefore surrounded by protoplanetary disks; they form the complete sample of all available IRS spectra of T Tauri stars with infrared excesses in Taurus. We also present the IRS spectra of seven Class 0/I objects in Taurus to complete the sample of available IRS spectra of protostars in Taurus. We use spectral indices that are not significantly affected by extinction to distinguish between envelope- and disk-dominated objects. Together with data from the literature, we construct spectral energy distributions for all objects in our sample. With spectral indices derived from the IRS spectra we infer disk properties such as dust settling and the presence of inner disk holes and gaps. We find a transitional disk frequency, which is based on objects with unusually large 13-31 μm spectral indices indicative of a wall surrounding an inner disk hole, of about 3%, and a frequency of about 20% for objects with unusually large 10 μm features, which could indicate disk gaps. The shape and strength of the 10 μm silicate emission feature suggests weaker 10 μm emission and more processed dust for very low mass objects and brown dwarfs (spectral types M6-M9). These objects also display weaker infrared excess emission from their disks, but do not appear to have more settled disks than their higher-mass counterparts. We find no difference for the spectral indices and properties of the dust between single and multiple systems.

  1. Measuring the rotation periods of 4-10 Myr T-Tauri stars in the Orion OB1 association

    Science.gov (United States)

    Karim, Md Tanveer; Stassun, Keivan; Briceno, Cesar; Vivas, Kathy; Raetz, Stefanie; Calvet, Nuria; Mateu, Cecilia; Downes, Juan Jose; Hernandez, Jesus; Neuhäuser, Ralph; Mugrauer, Markus; Takahashi, Hidenori; Tachihara, Kengo; Chini, Rolf; YETI

    2016-01-01

    Most existing studies of young stellar populations have focused on the youngest (Investigaciones de Astronomía-Quest Equatorial Survey Team (CIDA-QUEST), the Young Exoplanet Transit Initiative (YETI) and from a Kitt Peak National Observatory (KPNO) campaign. We investigated stellar rotation periods according to the type of stars (Classical or Weak-lined T-Tauri stars) and their locations, to look for population-wide trends. We detected 563 periodic variables and 1411 non-periodic variables by investigating the light curves of these stars. We find that ~ 30% of Weak-line T-Tauri stars (WTTS) and ~ 20% of Classical T-Tauri stars (CTTS) are periodic. Though we did not find any noticeable difference in rotation period between CTTS and WTTS, our study does show a change in the overall rotation periods of stars 4-10 Myr old, consistent with predictions of angular momentum evolution models, an important constraint for theoretical models for an age range for which no similar data existed.

  2. Optical veiling, disk accretion, and the evolution of T Tauri stars

    International Nuclear Information System (INIS)

    Hartmann, L.W.; Kenyon, S.J.

    1990-01-01

    High-resolution spectra of 31 K7-M1 T Tauri stars (TTs) in the Taurus-Auriga molecular cloud demonstrate that most of these objects exhibit substantial excess emission at 5200 A. Extrapolations of these data consistent with low-resolution spectrophotometry indicate that the extra emission is comparable to the stellar luminosity in many cases. If this continuum emission arises in the boundary layers of accreting disks, more than about 30 percent of all TTs may be accreting material at a rate which is sufficiently rapid to alter their evolution from standard Hayashi tracks. It is estimated that roughly 10 percent of the final stellar mass is accreted in the TT phase. This amount of material is comparable to the minimum gravitationally unstable disk mass estimated by Larson and it is speculated that the TT phase represents the final stages of disk accretion driven by gravitational instabilities. 40 refs

  3. PHOTO-REVERBERATION MAPPING OF A PROTOPLANETARY ACCRETION DISK AROUND A T TAURI STAR

    Energy Technology Data Exchange (ETDEWEB)

    Meng, Huan Y. A.; Plavchan, Peter; Ciardi, David [Infrared Processing and Analysis Center, California Institute of Technology, MC 100-22, 770 S. Wilson Ave., Pasadena, CA 91125 (United States); Rieke, George H. [Lunar and Planetary Laboratory and Department of Planetary Sciences, University of Arizona, 1629 E. University Blvd., Tucson, AZ 85721 (United States); Cody, Ann Marie [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Güth, Tina [Department of Physics, New Mexico Institute of Mining and Technology, 801 Leroy Pl., Socorro, NM 87801 (United States); Stauffer, John; Carey, Sean; Rebull, Luisa M. [Infrared Science Archive and Spitzer Science Center, Infrared Processing and Analysis Center, California Institute of Technology, MC 314-6, 1200 E. California Blvd., Pasadena, CA 91125 (United States); Covey, Kevin [Department of Physics and Astronomy, MS-9164, Western Washington University, 516 High St., Bellingham, WA 98225 (United States); Duran-Rojas, Maria C. [Instituto de Astronomía, Universidad Nacional Autónoma de México, Apartado Postal 106, 22800, Ensenada, Baja California, México (Mexico); Gutermuth, Robert A. [Department of Astronomy, University of Massachusetts, Amherst, MA 01003 (United States); Morales-Calderón, María, E-mail: hyameng@lpl.arizona.edu [Centro de Astrobiología, Departamento de Astrofísica, INTA-CSIC, P.O. Box 78, E-28691, ESAC Campus, Villanueva de la Cañada, Madrid (Spain); and others

    2016-05-20

    Theoretical models and spectroscopic observations of newborn stars suggest that protoplantary disks have an inner “wall” at a distance set by the disk interaction with the star. Around T Tauri stars, the size of this disk hole is expected to be on a 0.1 au scale that is unresolved by current adaptive optics imaging, though some model-dependent constraints have been obtained by near-infrared interferometry. Here we report the first measurement of the inner disk wall around a solar-mass young stellar object, YLW 16B in the ρ Ophiuchi star-forming region, by detecting the light-travel time of the variable radiation from the stellar surface to the disk. Consistent time lags were detected on two nights, when the time series in H (1.6 μ m) and K (2.2 μ m) bands were synchronized while the 4.5 μ m emission lagged by 74.5 ± 3.2 s. Considering the nearly edge-on geometry of the disk, the inner rim should be 0.084 au from the protostar on average, with an error of order 0.01 au. This size is likely larger than the range of magnetospheric truncations and consistent with an optically and geometrically thick disk front at the dust sublimation radius at ∼1500 K. The widths of the cross-correlation functions between the data in different wavebands place possible new constraints on the geometry of the disk.

  4. An optical spectroscopic study of T Tauri stars. I. Photospheric properties

    Energy Technology Data Exchange (ETDEWEB)

    Herczeg, Gregory J. [Kavli Institute for Astronomy and Astrophysics, Peking University, Yi He Yuan Lu 5, Haidian Qu, Beijing 100871 (China); Hillenbrand, Lynne A. [Caltech, MC105-24, 1200 East California Boulevard, Pasadena, CA 91125 (United States)

    2014-05-10

    Estimates of the mass and age of young stars from their location in the H-R diagram are limited by not only the typical observational uncertainties that apply to field stars, but also by large systematic uncertainties related to circumstellar phenomena. In this paper, we analyze flux-calibrated optical spectra to measure accurate spectral types and extinctions of 281 nearby T Tauri stars (TTSs). The primary advances in this paper are (1) the incorporation of a simplistic accretion continuum in optical spectral type and extinction measurements calculated over the full optical wavelength range and (2) the uniform analysis of a large sample of stars, many of which are well known and can serve as benchmarks. Comparisons between the non-accreting TTS photospheric templates and stellar photosphere models are used to derive conversions from spectral type to temperature. Differences between spectral types can be subtle and difficult to discern, especially when accounting for accretion and extinction. The spectral types measured here are mostly consistent with spectral types measured over the past decade. However, our new spectral types are one to two subclasses later than literature spectral types for the original members of the TW Hya Association (TWA) and are discrepant with literature values for some well-known members of the Taurus Molecular Cloud. Our extinction measurements are consistent with other optical extinction measurements but are typically 1 mag lower than near-IR measurements, likely the result of methodological differences and the presence of near-IR excesses in most CTTSs. As an illustration of the impact of accretion, spectral type, and extinction uncertainties on the H-R diagrams of young clusters, we find that the resulting luminosity spread of stars in the TWA is 15%-30%. The luminosity spread in the TWA and previously measured for binary stars in Taurus suggests that for a majority of stars, protostellar accretion rates are not large enough to

  5. MN Lup: X-RAYS FROM A WEAKLY ACCRETING T TAURI STAR

    International Nuclear Information System (INIS)

    Günther, H. M.; Wolk, S. J.; Wolter, U.; Robrade, J.

    2013-01-01

    Young T Tauri stars (TTS) are surrounded by an accretion disk, which over time disperses due to photoevaporation, accretion, and possibly planet formation. The accretion shock on the central star produces an UV/optical veiling continuum, line emission, and X-ray signatures. As the accretion rate decreases, the impact on the central star must change. In this article we study MN Lup, a young star where no indications of a disk are seen in IR observations. We present XMM-Newton and VLT/UVES observations, some of them taken simultaneously. The X-ray data show that MN Lup is an active star with L X /L bol close to the saturation limit. However, we find high densities (n e > 3 × 10 10 cm –3 ) in the X-ray grating spectrum. This can be well fitted using an accretion shock model with an accretion rate of 2 × 10 –11 M ☉ yr –1 . Despite the simple Hα line profile which has a broad component, but no absorption signatures as typically seen on accreting TTS, we find rotational modulation in Ca II K and in photospheric absorption lines. These line profile modulations do not clearly indicate the presence of a localized hot accretion spot on the star. In the Hα line we see a prominence in absorption about 2R * above the stellar surface—the first of its kind on a TTS. MN Lup is also the only TTS where accretion is seen, but no dust disk is detected that could fuel it. We suggest that MN Lup presents a unique and short-lived state in the disk evolution. It may have lost its dust disk only recently and is now accreting the remaining gas at a very low rate.

  6. The Mysterious Dimmings of the T Tauri Star V1334 Tau

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, Joseph E.; Zhou, George; Cargile, Phillip A.; Relles, Howard M.; Latham, David W.; Eastman, Jason; Bieryla, Allyson; Esquerdo, Gilbert A.; Berlind, Perry; Calkins, Michael L.; Vanderburg, Andrew [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Stevens, Daniel J. [Department of Astronomy, The Ohio State University, Columbus, OH 43210 (United States); Osborn, Hugh P. [Department of Physics, University of Warwick, Gibbet Hill Road, Coventry, CV4 7AL (United Kingdom); Shappee, Benjamin J. [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States); Reed, Phillip A. [Department of Physical Sciences, Kutztown University, Kutztown, PA 19530 (United States); Lund, Michael B.; Stassun, Keivan G. [Department of Physics and Astronomy, Vanderbilt University, 6301 Stevenson Center, Nashville, TN 37235 (United States); Gaidos, Eric [Department of Geology and Geophysics, University of Hawai‘i at Mnoa, Honolulu, HI 96822 (United States); Ansdell, Megan [Institute for Astronomy, University of Hawai‘i at Manoa, Honolulu, HI 96822 (United States); Siverd, Robert J. [Las Cumbres Observatory Global Telescope Network, 6740 Cortona Drive, Suite 102, Santa Barbara, CA 93117 (United States); and others

    2017-02-20

    We present the discovery of two extended ∼0.12 mag dimming events of the weak-lined T Tauri star V1334. The start of the first event was missed but came to an end in late 2003, and the second began in 2009 February, and continues as of 2016 November. Since the egress of the current event has not yet been observed, it suggests a period of >13 years if this event is periodic. Spectroscopic observations suggest the presence of a small inner disk, although the spectral energy distribution shows no infrared excess. We explore the possibility that the dimming events are caused by an orbiting body (e.g., a disk warp or dust trap), enhanced disk winds, hydrodynamical fluctuations of the inner disk, or a significant increase in the magnetic field flux at the surface of the star. We also find a ∼0.32 day periodic photometric signal that persists throughout the 2009 dimming which appears to not be due to ellipsoidal variations from a close stellar companion. High-precision photometric observations of V1334 Tau during K2 campaign 13, combined with simultaneous photometric and spectroscopic observations from the ground, will provide crucial information about the photometric variability and its origin.

  7. The Mysterious Dimmings of the T Tauri Star V1334 Tau

    International Nuclear Information System (INIS)

    Rodriguez, Joseph E.; Zhou, George; Cargile, Phillip A.; Relles, Howard M.; Latham, David W.; Eastman, Jason; Bieryla, Allyson; Esquerdo, Gilbert A.; Berlind, Perry; Calkins, Michael L.; Vanderburg, Andrew; Stevens, Daniel J.; Osborn, Hugh P.; Shappee, Benjamin J.; Reed, Phillip A.; Lund, Michael B.; Stassun, Keivan G.; Gaidos, Eric; Ansdell, Megan; Siverd, Robert J.

    2017-01-01

    We present the discovery of two extended ∼0.12 mag dimming events of the weak-lined T Tauri star V1334. The start of the first event was missed but came to an end in late 2003, and the second began in 2009 February, and continues as of 2016 November. Since the egress of the current event has not yet been observed, it suggests a period of >13 years if this event is periodic. Spectroscopic observations suggest the presence of a small inner disk, although the spectral energy distribution shows no infrared excess. We explore the possibility that the dimming events are caused by an orbiting body (e.g., a disk warp or dust trap), enhanced disk winds, hydrodynamical fluctuations of the inner disk, or a significant increase in the magnetic field flux at the surface of the star. We also find a ∼0.32 day periodic photometric signal that persists throughout the 2009 dimming which appears to not be due to ellipsoidal variations from a close stellar companion. High-precision photometric observations of V1334 Tau during K2 campaign 13, combined with simultaneous photometric and spectroscopic observations from the ground, will provide crucial information about the photometric variability and its origin.

  8. ON THE TRANSITIONAL DISK CLASS: LINKING OBSERVATIONS OF T TAURI STARS AND PHYSICAL DISK MODELS

    International Nuclear Information System (INIS)

    Espaillat, C.; Andrews, S.; Qi, C.; Wilner, D.; Ingleby, L.; Calvet, N.; Hernández, J.; Furlan, E.; D'Alessio, P.; Muzerolle, J.

    2012-01-01

    Two decades ago 'transitional disks' (TDs) described spectral energy distributions (SEDs) of T Tauri stars with small near-IR excesses, but significant mid- and far-IR excesses. Many inferred this indicated dust-free holes in disks possibly cleared by planets. Recently, this term has been applied disparately to objects whose Spitzer SEDs diverge from the expectations for a typical full disk (FD). Here, we use irradiated accretion disk models to fit the SEDs of 15 such disks in NGC 2068 and IC 348. One group has a 'dip' in infrared emission while the others' continuum emission decreases steadily at all wavelengths. We find that the former have an inner disk hole or gap at intermediate radii in the disk and we call these objects 'transitional disks' and 'pre-transitional disks' (PTDs), respectively. For the latter group, we can fit these SEDs with FD models and find that millimeter data are necessary to break the degeneracy between dust settling and disk mass. We suggest that the term 'transitional' only be applied to objects that display evidence for a radical change in the disk's radial structure. Using this definition, we find that TDs and PTDs tend to have lower mass accretion rates than FDs and that TDs have lower accretion rates than PTDs. These reduced accretion rates onto the star could be linked to forming planets. Future observations of TDs and PTDs will allow us to better quantify the signatures of planet formation in young disks.

  9. Peculiarities and Variations in the Optical Spectrum of the RV Tauri-type Star R Sct

    Directory of Open Access Journals (Sweden)

    Kipper Tõnu

    2013-06-01

    Full Text Available We analyzed some new high resolution optical spectra of the semiregular RV Tauri-type star R Sct. Fundamental parameters were found to be Teff = 4500 K, log g = 0.0 and ξt = 4.0 km s−1. The results of chemical analysis show that R Sct is a metal-poor star with [Fe/H]≈ −0.5. The carbon content with respect to iron is significantly larger than in the Sun, [C/Fe]=0.84, but there is an evident deficiency of heavy elements. We found no tight correlation of the chemical abundances on the condensation temperatures of elements. This means that in R Sct the depletion by condensation into dust does not work, with possible exception of Ca and Sc. The luminosity derived from the Hipparcos parallax corresponds to a tip of the red-giant branch or slightly above it. Thus it is possible that R Sct evolved off the early-AGB when it has not yet experienced the third dredge-up in thermal pulses, or it is still located on AGB. The peculiarities of spectral features (emissions, line-splitting and the complicated time-variable radial velocities were also studied.

  10. VizieR Online Data Catalog: UV spectra of classical T Tauri stars (France+, 2014)

    Science.gov (United States)

    France, K.; Schindhelm, E.; Bergin, E. A.; Roueff, E.; Abgrall, H.

    2017-06-01

    We present 16 objects from the larger GTO + DAO T Tauri star samples described by Ardila et al. (2013ApJS..207....1A; focusing on the hot gas emission lines) and France et al. (2012, J/ApJ/756/171; focusing on the molecular circumstellar environment). Eleven of the 16 sources were observed as part of the DAO of Tau guest observing program (PID 11616; PI: G. Herczeg), four were part of the COS Guaranteed Time Observing program on protoplanetary disks (PIDs 11533 and 12036; PI: J. Green), and we have included archival STIS observations of the well-studied CTTS TW Hya (Herczeg et al. 2002ApJ...572..310H, 2004ApJ...607..369H), obtained through StarCAT (Ayres 2010, J/ApJS/187/149). The targets were selected by the availability of reconstructed Lyα spectra, as this emission line is a critical component to the intrinsic CTTS UV radiation field (Schindhelm et al. 2012ApJ...756L..23S) and has not been uniformly included in recent studies of the CTTS radiation field (e.g., Ingleby et al. 2011AJ....141..127I; Yang et al. 2012, J/ApJ/744/121). Most of the targets were observed with the medium-resolution FUV modes of COS (G130M and G160M; Green et al. 2012ApJ...744...60G). (2 data files).

  11. Photo-reverberation Mapping of a Protoplanetary Accretion Disk around a T Tauri Star

    Science.gov (United States)

    Meng, Huan Y. A.; Plavchan, Peter; Rieke, George H.; Cody, Ann Marie; Güth, Tina; Stauffer, John; Covey, Kevin; Carey, Sean; Ciardi, David; Duran-Rojas, Maria C.; Gutermuth, Robert A.; Morales-Calderón, María; Rebull, Luisa M.; Watson, Alan M.

    2016-05-01

    Theoretical models and spectroscopic observations of newborn stars suggest that protoplantary disks have an inner “wall” at a distance set by the disk interaction with the star. Around T Tauri stars, the size of this disk hole is expected to be on a 0.1 au scale that is unresolved by current adaptive optics imaging, though some model-dependent constraints have been obtained by near-infrared interferometry. Here we report the first measurement of the inner disk wall around a solar-mass young stellar object, YLW 16B in the ρ Ophiuchi star-forming region, by detecting the light-travel time of the variable radiation from the stellar surface to the disk. Consistent time lags were detected on two nights, when the time series in H (1.6 μm) and K (2.2 μm) bands were synchronized while the 4.5 μm emission lagged by 74.5 ± 3.2 s. Considering the nearly edge-on geometry of the disk, the inner rim should be 0.084 au from the protostar on average, with an error of order 0.01 au. This size is likely larger than the range of magnetospheric truncations and consistent with an optically and geometrically thick disk front at the dust sublimation radius at ˜1500 K. The widths of the cross-correlation functions between the data in different wavebands place possible new constraints on the geometry of the disk.

  12. THE BIMODALITY OF ACCRETION IN T TAURI STARS AND BROWN DWARFS

    International Nuclear Information System (INIS)

    Vorobyov, E. I.; Basu, Shantanu

    2009-01-01

    We present numerical solutions of the collapse of prestellar cores that lead to the formation and evolution of circumstellar disks. The disk evolution is then followed for up to three million years. A variety of models of different initial masses and rotation rates allow us to study disk accretion around brown dwarfs and low-mass T Tauri stars (TTSs), with central object mass M * sun , as well as intermediate- and upper-mass TTSs (0.2 M sun * sun ). Our models include self-gravity and allow for nonaxisymmetric motions. In addition to the self-consistently generated gravitational torques, we introduce an effective turbulent α-viscosity with α = 0.01, which allows us particularly to model accretion in the low-mass regime where disk self-gravity is diminishing. A range of models with observationally motivated values of the initial ratio of rotational-to-gravitational energy yield a correlation between mass accretion rate M-dot and M * that is relatively steep, as observed. Additionally, our modeling reveals evidence for a bimodality in the M-dot - M * correlation, with a steeper slope at lower masses and a shallower slope at intermediate and upper masses, as also implied by observations. Furthermore, we show that the neglect of disk self-gravity leads to a much steeper M-dot - M * relation for intermediate- and upper-mass TTSs. This demonstrates that an accurate treatment of global self-gravity is essential to understanding observations of circumstellar disks.

  13. THE PTF ORION PROJECT: A POSSIBLE PLANET TRANSITING A T-TAURI STAR

    Energy Technology Data Exchange (ETDEWEB)

    Van Eyken, Julian C.; Ciardi, David R.; Von Braun, Kaspar; Kane, Stephen R.; Plavchan, Peter; Akeson, Rachel L.; Beichman, Charles A.; Gelino, Dawn M. [NASA Exoplanet Science Institute, California Institute of Technology, 770 South Wilson Avenue, M/S 100-22, Pasadena, CA 91125 (United States); Bender, Chad F.; Mahadevan, Suvrath [Department of Astronomy and Astrophysics, The Pennsylvania State University, University Park, PA 16802 (United States); Brown, Timothy M.; Fulton, Benjamin J.; Shporer, Avi [Las Cumbres Observatory Global Telescope, Goleta, CA 93117 (United States); Crepp, Justin R. [Cahill Center for Astrophysics, California Institute of Technology, Pasadena, CA 91125 (United States); Howard, Andrew W.; Marcy, Geoffrey W. [Department of Astronomy, University of California, Berkeley, CA 94720-3411 (United States); Howell, Steve B. [NASA Ames Research Center, M/S 244-30, Moffett Field, CA 94035 (United States); Szkody, Paula [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Boden, Andrew F. [Caltech Optical Observatories, California Institute of Technology, Pasadena, CA 91125 (United States); Hoard, D. W., E-mail: vaneyken@ipac.caltech.edu [Spitzer Science Center, M/S 220-6, California Institute of Technology, Jet Propulsion Laboratory, Pasadena, CA 91125 (United States); and others

    2012-08-10

    We report observations of a possible young transiting planet orbiting a previously known weak-lined T-Tauri star in the 7-10 Myr old Orion-OB1a/25-Ori region. The candidate was found as part of the Palomar Transient Factory (PTF) Orion project. It has a photometric transit period of 0.448413 {+-} 0.000040 days, and appears in both 2009 and 2010 PTF data. Follow-up low-precision radial velocity (RV) observations and adaptive optics imaging suggest that the star is not an eclipsing binary, and that it is unlikely that a background source is blended with the target and mimicking the observed transit. RV observations with the Hobby-Eberly and Keck telescopes yield an RV that has the same period as the photometric event, but is offset in phase from the transit center by Almost-Equal-To - 0.22 periods. The amplitude (half range) of the RV variations is 2.4 km s{sup -1} and is comparable with the expected RV amplitude that stellar spots could induce. The RV curve is likely dominated by stellar spot modulation and provides an upper limit to the projected companion mass of M{sub p}sin i{sub orb} {approx}< 4.8 {+-} 1.2 M{sub Jup}; when combined with the orbital inclination, i{sub orb}, of the candidate planet from modeling of the transit light curve, we find an upper limit on the mass of the planetary candidate of M{sub p} {approx}< 5.5 {+-} 1.4 M{sub Jup}. This limit implies that the planet is orbiting close to, if not inside, its Roche limiting orbital radius, so that it may be undergoing active mass loss and evaporation.

  14. THE PTF ORION PROJECT: A POSSIBLE PLANET TRANSITING A T-TAURI STAR

    International Nuclear Information System (INIS)

    Van Eyken, Julian C.; Ciardi, David R.; Von Braun, Kaspar; Kane, Stephen R.; Plavchan, Peter; Akeson, Rachel L.; Beichman, Charles A.; Gelino, Dawn M.; Bender, Chad F.; Mahadevan, Suvrath; Brown, Timothy M.; Fulton, Benjamin J.; Shporer, Avi; Crepp, Justin R.; Howard, Andrew W.; Marcy, Geoffrey W.; Howell, Steve B.; Szkody, Paula; Boden, Andrew F.; Hoard, D. W.

    2012-01-01

    We report observations of a possible young transiting planet orbiting a previously known weak-lined T-Tauri star in the 7-10 Myr old Orion-OB1a/25-Ori region. The candidate was found as part of the Palomar Transient Factory (PTF) Orion project. It has a photometric transit period of 0.448413 ± 0.000040 days, and appears in both 2009 and 2010 PTF data. Follow-up low-precision radial velocity (RV) observations and adaptive optics imaging suggest that the star is not an eclipsing binary, and that it is unlikely that a background source is blended with the target and mimicking the observed transit. RV observations with the Hobby-Eberly and Keck telescopes yield an RV that has the same period as the photometric event, but is offset in phase from the transit center by ≈ – 0.22 periods. The amplitude (half range) of the RV variations is 2.4 km s –1 and is comparable with the expected RV amplitude that stellar spots could induce. The RV curve is likely dominated by stellar spot modulation and provides an upper limit to the projected companion mass of M p sin i orb ∼ Jup ; when combined with the orbital inclination, i orb , of the candidate planet from modeling of the transit light curve, we find an upper limit on the mass of the planetary candidate of M p ∼ Jup . This limit implies that the planet is orbiting close to, if not inside, its Roche limiting orbital radius, so that it may be undergoing active mass loss and evaporation.

  15. EVIDENCE FOR AN FU ORIONIS-LIKE OUTBURST FROM A CLASSICAL T TAURI STAR

    International Nuclear Information System (INIS)

    Miller, Adam A.; Poznanski, Dovi; Silverman, Jeffrey M.; Kleiser, Io K. W.; Cenko, S. Bradley; Bloom, Joshua S.; Filippenko, Alexei V.; Hillenbrand, Lynne A.; Kasliwal, Mansi M.; Ofek, Eran O.; Quimby, Robert M.; Covey, Kevin R.; Rojas-Ayala, Barbara; Muirhead, Philip S.; Law, Nicholas M.; Dekany, Richard G.; Rahmer, Gustavo; Hale, David; Smith, Roger; Nugent, Peter

    2011-01-01

    We present pre- and post-outburst observations of the new FU Orionis-like young stellar object PTF 10qpf (also known as LkHα 188-G4 and HBC 722). Prior to this outburst, LkHα 188-G4 was classified as a classical T Tauri star (CTTS) on the basis of its optical emission-line spectrum superposed on a K8-type photosphere and its photometric variability. The mid-infrared spectral index of LkHα 188-G4 indicates a Class II-type object. LkHα 188-G4 exhibited a steady rise by ∼1 mag over ∼11 months starting in August 2009, before a subsequent more abrupt rise of >3 mag on a timescale of ∼2 months. Observations taken during the eruption exhibit the defining characteristics of FU Orionis variables: (1) an increase in brightness by ∼>4 mag, (2) a bright optical/near-infrared reflection nebula appeared, (3) optical spectra are consistent with a G supergiant and dominated by absorption lines, the only exception being Hα which is characterized by a P Cygni profile, (4) near-infrared spectra resemble those of late K-M giants/supergiants with enhanced absorption seen in the molecular bands of CO and H 2 O, and (5) outflow signatures in H and He are seen in the form of blueshifted absorption profiles. LkHα 188-G4 is the first member of the FU Orionis-like class with a well-sampled optical to mid-infrared spectral energy distribution in the pre-outburst phase. The association of the PTF 10qpf outburst with the previously identified CTTS LkHα 188-G4 (HBC 722) provides strong evidence that FU Orionis-like eruptions represent periods of enhanced disk accretion and outflow, likely triggered by instabilities in the disk. The early identification of PTF 10qpf as an FU Orionis-like variable will enable detailed photometric and spectroscopic observations during its post-outburst evolution for comparison with other known outbursting objects.

  16. THE HERSCHEL DIGIT SURVEY OF WEAK-LINE T TAURI STARS: IMPLICATIONS FOR DISK EVOLUTION AND DISSIPATION

    International Nuclear Information System (INIS)

    Cieza, Lucas A.; Olofsson, Johan; Henning, Thomas; Harvey, Paul M.; Evans, Neal J. II; Najita, Joan; Merín, Bruno; Liebhart, Armin; Güdel, Manuel; Augereau, Jean-Charles; Pinte, Christophe

    2013-01-01

    As part of the 'Dust, Ice, and Gas In Time (DIGIT)' Herschel Open Time Key Program, we present Herschel photometry (at 70, 160, 250, 350, and 500 μm) of 31 weak-line T Tauri star (WTTS) candidates in order to investigate the evolutionary status of their circumstellar disks. Of the stars in our sample, 13 had circumstellar disks previously known from infrared observations at shorter wavelengths, while 18 of them had no previous evidence for a disk. We detect a total of 15 disks as all previously known disks are detected at one or more Herschel wavelengths and two additional disks are identified for the first time. The spectral energy distributions (SEDs) of our targets seem to trace the dissipation of the primordial disk and the transition to the debris disk regime. Of the 15 disks, 7 appear to be optically thick primordial disks, including 2 objects with SEDs indistinguishable from those of typical Classical T Tauri stars, 4 objects that have significant deficit of excess emission at all IR wavelengths, and 1 'pre-transitional' object with a known gap in the disk. Despite their previous WTTS classification, we find that the seven targets in our sample with optically thick disks show evidence for accretion. The remaining eight disks have weaker IR excesses similar to those of optically thin debris disks. Six of them are warm and show significant 24 μm Spitzer excesses, while the last two are newly identified cold debris-like disks with photospheric 24 μm fluxes, but significant excess emission at longer wavelengths. The Herschel photometry also places strong constraints on the non-detections, where systems with F 70 /F 70,* ∼> 5-15 and L disk /L * ∼> 10 –3 to 10 –4 can be ruled out. We present preliminary models for both the optically thick and optically thin disks and discuss our results in the context of the evolution and dissipation of circumstellar disks.

  17. HIGH-RESOLUTION OBSERVATIONS OF DUST CONTINUUM EMISSION AT 340 GHz FROM THE LOW-MASS T TAURI STAR FN TAURI

    International Nuclear Information System (INIS)

    Momose, Munetake; Ohashi, Nagayoshi; Kudo, Tomoyuki; Tamura, Motohide; Kitamura, Yoshimi

    2010-01-01

    FN Tau is a rare example of a very low-mass T Tauri star that exhibits a spatially resolved nebulosity in near-infrared scattering light. To directly derive the parameters of a circumstellar disk around FN Tau, observations of dust continuum emission at 340 GHz are carried out with the Submillimeter Array (SMA). A point-like dust continuum emission was detected with a synthesized beam of ∼0.''7 in FWHM. From the analysis of the visibility plot, the radius of the emission is estimated to be ≤0.''29, corresponding to 41 AU. This is much smaller than the radius of the nebulosity, 1.''85 for its brighter part at 1.6 μm. The 340 GHz continuum emission observed with the SMA and the photometric data at λ ≤ 70 μm are explained by a power-law disk model whose outer radius and mass are 41 AU and (0.24-5.9) x 10 -3 M sun , respectively, if the exponent of dust mass opacity (β) is assumed to be 0-2. The disk model cannot fully reproduce the flux density at 230 GHz obtained with the IRAM 30 m telescope, suggesting that there is another extended 'halo' component that is missed in the SMA observations. By requiring the halo not to be detected with the SMA, the lower limit to the size of the halo is evaluated to be between 174 AU and 574 AU, depending on the assumed β value. This size is comparable to the near-infrared nebulosity, implying that the halo unseen with the SMA corresponds to the origin of the near-infrared nebulosity. The halo can contain mass comparable to or at most 8 times greater than that of the inner power-law disk, but its surface density should be lower than that at the outer edge of the power-law disk by more than 1 order of magnitude. The physical nature of the halo is unclear, but it may be the periphery of a flared circumstellar disk that is not described well in terms of a power-law disk model, or a remnant of a protostellar envelope having flattened structure.

  18. Probing Signatures of a Distant Planet around the Young T-Tauri Star CI Tau Hosting a Possible Hot Jupiter

    Science.gov (United States)

    Konishi, Mihoko; Hashimoto, Jun; Hori, Yasunori

    2018-06-01

    We search for signatures of a distant planet around the two million-year-old classical T-Tauri star CI Tau hosting a hot-Jupiter candidate ({M}{{p}}\\sin i∼ 8.1 {M}Jupiter}) in an eccentric orbit (e ∼ 0.3). To probe the existence of an outer perturber, we reanalyzed 1.3 mm dust continuum observations of the protoplanetary disk around CI Tau obtained by the Atacama Large Millimeter/submillimeter Array (ALMA). We found a gap structure at ∼0.″8 in CI Tau’s disk. Our visibility fitting assuming an axisymmetric surface brightness profile suggested that the gap is located at a deprojected radius of 104.5 ± 1.6 au and has a width of 36.9 ± 2.9 au. The brightness temperature around the gap was calculated to be ∼2.3 K lower than that of the ambient disk. Gap-opening mechanisms such as secular gravitational instability (GI) and dust trapping can explain the gap morphology in the CI Tau disk. The scenario that an unseen planet created the observed gap structure cannot be ruled out, although the coexistence of an eccentric hot Jupiter and a distant planet around the young CI Tau would be challenging for gravitational scattering scenarios. The mass of the planet was estimated to be between ∼0.25 M Jupiter and ∼0.8 M Jupiter from the gap width and depth ({0.41}-0.06+0.04) in the modeled surface brightness image, which is lower than the current detection limits of high-contrast direct imaging. The young classical T-Tauri CI Tau may be a unique system for exploring the existence of a potential distant planet as well as the origin of an eccentric hot Jupiter.

  19. THE HERSCHEL DIGIT SURVEY OF WEAK-LINE T TAURI STARS: IMPLICATIONS FOR DISK EVOLUTION AND DISSIPATION

    Energy Technology Data Exchange (ETDEWEB)

    Cieza, Lucas A. [Institute for Astronomy, University of Hawaii at Manoa, Honolulu, HI 96822 (United States); Olofsson, Johan; Henning, Thomas [Max Planck Institute fuer Astronomie, Koenigstuhl 17, D-69117 Heidelberg (Germany); Harvey, Paul M.; Evans, Neal J. II [Department of Astronomy, University of Texas at Austin, 2515 Speedway, Stop C1400, Austin, TX 78712-1205 (United States); Najita, Joan [National Optical Astronomy Observatory, 950 N. Cherry Avenue, Tucson, AZ 86719 (United States); Merin, Bruno [Herschel Science Centre, European Space Astronomy Centre, ESA, P.O. Box 78, E-28691 Villanueva de la Canada, Madrid (Spain); Liebhart, Armin; Guedel, Manuel [Department of Astronomy, University of Vienna, Tuerkenschanzstr. 17, A-1180 Vienna (Austria); Augereau, Jean-Charles; Pinte, Christophe, E-mail: lcieza@ifa.hawaii.edu [UJF-Grenoble 1/CNRS-INSU, Institut de Planetologie et d' Astrophysique (IPAG) UMR 5274, BP 53, F-38041 Grenoble cedex 9 (France)

    2013-01-10

    As part of the 'Dust, Ice, and Gas In Time (DIGIT)' Herschel Open Time Key Program, we present Herschel photometry (at 70, 160, 250, 350, and 500 {mu}m) of 31 weak-line T Tauri star (WTTS) candidates in order to investigate the evolutionary status of their circumstellar disks. Of the stars in our sample, 13 had circumstellar disks previously known from infrared observations at shorter wavelengths, while 18 of them had no previous evidence for a disk. We detect a total of 15 disks as all previously known disks are detected at one or more Herschel wavelengths and two additional disks are identified for the first time. The spectral energy distributions (SEDs) of our targets seem to trace the dissipation of the primordial disk and the transition to the debris disk regime. Of the 15 disks, 7 appear to be optically thick primordial disks, including 2 objects with SEDs indistinguishable from those of typical Classical T Tauri stars, 4 objects that have significant deficit of excess emission at all IR wavelengths, and 1 'pre-transitional' object with a known gap in the disk. Despite their previous WTTS classification, we find that the seven targets in our sample with optically thick disks show evidence for accretion. The remaining eight disks have weaker IR excesses similar to those of optically thin debris disks. Six of them are warm and show significant 24 {mu}m Spitzer excesses, while the last two are newly identified cold debris-like disks with photospheric 24 {mu}m fluxes, but significant excess emission at longer wavelengths. The Herschel photometry also places strong constraints on the non-detections, where systems with F {sub 70}/F {sub 70,*} {approx}> 5-15 and L {sub disk}/L {sub *} {approx}> 10{sup -3} to 10{sup -4} can be ruled out. We present preliminary models for both the optically thick and optically thin disks and discuss our results in the context of the evolution and dissipation of circumstellar disks.

  20. TIME VARIABILITY OF EMISSION LINES FOR FOUR ACTIVE T TAURI STARS. I. OCTOBER–DECEMBER IN 2010

    International Nuclear Information System (INIS)

    Chou, Mei-Yin; Takami, Michihiro; Karr, Jennifer L.; Shang Hsien; Liu, Hauyu Baobab; Manset, Nadine; Beck, Tracy; Pyo, Tae-Soo; Chen, Wen-Ping; Panwar, Neelam

    2013-01-01

    We present optical spectrophotometric monitoring of four active T Tauri stars (DG Tau, RY Tau, XZ Tau, RW Aur A) at high spectral resolution (R ∼> 1 × 10 4 ), to investigate the correlation between time variable mass ejection seen in the jet/wind structure of the driving source and time variable mass accretion probed by optical emission lines. This may allow us to constrain the understanding of the jet/wind launching mechanism, the location of the launching region, and the physical link with magnetospheric mass accretion. In 2010, observations were made at six different epochs to investigate how daily and monthly variability might affect such a study. We perform comparisons between the line profiles we observed and those in the literature over a period of decades and confirm the presence of time variability separate from the daily and monthly variability during our observations. This is so far consistent with the idea that these line profiles have a long-term variability (3-20 yr) related to episodic mass ejection suggested by the structures in the extended flow components. We also investigate the correlations between equivalent widths and between luminosities for different lines. We find that these correlations are consistent with the present paradigm of steady magnetospheric mass accretion and emission line regions that are close to the star.

  1. TIME VARIABILITY OF EMISSION LINES FOR FOUR ACTIVE T TAURI STARS. I. OCTOBER-DECEMBER IN 2010

    Energy Technology Data Exchange (ETDEWEB)

    Chou, Mei-Yin; Takami, Michihiro; Karr, Jennifer L.; Shang Hsien; Liu, Hauyu Baobab [Institute of Astronomy and Astrophysics, Academia Sinica, P.O. Box 23-141, Taipei 10617, Taiwan (China); Manset, Nadine [Canada-France-Hawaii Telescope, 65-1238 Mamalahoa Hwy, Kamuela, HI 96743 (United States); Beck, Tracy [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Pyo, Tae-Soo [Subaru Telescope, 650 North Aohoku Place, Hilo, HI 96720 (United States); Chen, Wen-Ping; Panwar, Neelam [Institute of Astronomy, National Central University, Taoyuan County 32001, Taiwan (China)

    2013-04-15

    We present optical spectrophotometric monitoring of four active T Tauri stars (DG Tau, RY Tau, XZ Tau, RW Aur A) at high spectral resolution (R {approx}> 1 Multiplication-Sign 10{sup 4}), to investigate the correlation between time variable mass ejection seen in the jet/wind structure of the driving source and time variable mass accretion probed by optical emission lines. This may allow us to constrain the understanding of the jet/wind launching mechanism, the location of the launching region, and the physical link with magnetospheric mass accretion. In 2010, observations were made at six different epochs to investigate how daily and monthly variability might affect such a study. We perform comparisons between the line profiles we observed and those in the literature over a period of decades and confirm the presence of time variability separate from the daily and monthly variability during our observations. This is so far consistent with the idea that these line profiles have a long-term variability (3-20 yr) related to episodic mass ejection suggested by the structures in the extended flow components. We also investigate the correlations between equivalent widths and between luminosities for different lines. We find that these correlations are consistent with the present paradigm of steady magnetospheric mass accretion and emission line regions that are close to the star.

  2. Discussing the low fraction of disk-bearing T Tauri stars discovered near to the Sh2-296 nebula

    Science.gov (United States)

    Gregorio-Hetem, Jane

    2015-08-01

    A multiband study has been developed by our team in the direction of young star clusters associated to the Sh2-296 nebula aiming to unveil the star formation history of this galactic molecular cloud that shows a mixing of different age stellar groups. A sample of 58 pre-main sequence stars has been recently discovered by us in this region (Fernandes et al. 2015, MNRAS in press), based on optical spectral features. Only 41% of the sample shows evidence of IR excess revealing the presence of circumstellar disks. It is interesting to note that the targets were revealed by their strong X-ray emission, typically found in T Tauri stars (TTs) (Santos-Silva et al. 2015, in preparation) . In this case, it would be expected a larger number of disk-bearing stars and also the fraction of circumstellar emission (fc = Ldisk/Ltotal ) should be more significant in these objects. However, we verified that only 12% of the sample has fc > 30%. This low fraction is quite rare compared to most young star-forming regions, suggesting that some external factor has accelerated the disc dissipation. In the present work we explore the circumstellar structure of a subsample of 8 TTs associated to Sh2-296. The TTs were selected on the basis of their high circumstellar emission, which is estimated by SED fitting that uses near- to mid-IR data extracted from available catalogues (WISE, AKARI, MSX). The circumstellar characteristics are confronted to interstellar environment by comparing the stellar spatial distribution with 12CO maps (Nanten Survey, Fukui et al. ). Most of the TTs are projected against moderate molecular emission (33 Jy), but some of them are found in regions of lower levels of gas distribution (3.8 Jy). The similarities and differences found among the studied objects are discussed in order to better understand the formation and evolution of protostellar disks of the selected sample and their role in the star formation scenario nearby Sh2-296

  3. On the co-existence of chemically peculiar Bp stars, slowly pulsating B stars and constant B stars in the same part of the HR diagram

    NARCIS (Netherlands)

    Briquet, M.; Hubrig, S.; Cat, P. de; Aerts, C.C.; North, P.; Schöller, M.

    2007-01-01

    Aims. In order to better model massive B-type stars, we need to understand the physical processes taking place in slowly pulsating B (SPB) stars, chemically peculiar Bp stars, and non-pulsating normal B stars co-existing in the same part of the H-R diagram. Methods: We carry out a comparative study

  4. CHANDRA AND XMM-NEWTON X-RAY OBSERVATIONS OF THE HYPERACTIVE T TAURI STAR RY TAU

    Energy Technology Data Exchange (ETDEWEB)

    Skinner, Stephen L. [Center for Astrophysics and Space Astronomy (CASA), Univ. of Colorado, Boulder, CO 80309-0389 (United States); Audard, Marc [Dept. of Astronomy, University of Geneva, Ch. d’Ecogia 16, CH-1290 Versoix (Switzerland); Güdel, Manuel, E-mail: stephen.skinner@colorado.edu, E-mail: marc.audard@unige.ch, E-mail: manuel.guedel@univie.ac.at [Dept. of Astrophysics, Univ. of Vienna, Türkenschanzstr. 17, A-1180 Vienna (Austria)

    2016-07-20

    We present results of pointed X-ray observations of the accreting jet-driving T Tauri star RY Tau using Chandra and XMM-Newton . We obtained high-resolution grating spectra and excellent-quality CCD spectra and light curves with the objective of identifying the physical mechanisms underlying RY Tau’s bright X-ray emission. Grating spectra reveal numerous emission lines spanning a broad range of temperature superimposed on a hot continuum. The X-ray emission measure distribution is dominated by very hot plasma at T {sub hot} ∼ 50 MK, but higher temperatures were present during flares. A weaker cool plasma component is also present as revealed by low-temperature lines such as O viii. X-ray light curves show complex variability consisting of short-duration (∼hours) superhot flares accompanied by fluorescent Fe emission at 6.4 keV superimposed on a slowly varying (∼one day) component that may be tied to stellar rotation. The hot flaring component is undoubtedly of magnetic (e.g., coronal) origin. Soft- and hard-band light curves undergo similar slow variability implying that at least some of the cool plasma shares a common magnetic origin with the hot plasma. Any contribution to the X-ray emission from cool shocked plasma is small compared to the dominant hot component but production of individual low-temperature lines such as O viii in an accretion shock is not ruled out.

  5. Role of local absorption on the X-ray emission from MHD accretion shocks in classical T Tauri stars

    Directory of Open Access Journals (Sweden)

    Bonito

    2014-01-01

    Full Text Available Accretion processes onto classical T Tauri stars (CTTSs are believed to generate shocks at the stellar surface due to the impact of supersonic downflowing plasma. Although current models of accretion streams provide a plausible global picture of this process, several aspects are still unclear. For example, the observed X-ray luminosity in accretion shocks is, in general, well below the predicted value. A possible explanation discussed in the literature is in terms of significant absorption of the emission due to the thick surrounding medium. Here we consider a 2D MHD model describing an accretion stream propagating through the atmosphere of a CTTS and impacting onto its chromosphere. The model includes all the relevant physics, namely the gravity, the thermal conduction, and the radiative cooling, and a realistic description of the unperturbed stellar atmosphere (from the chromosphere to the corona. From the model results, we synthesize the X-ray emission emerging from the hot slab produced by the accretion shock, exploring different configurations and strengths of the stellar magnetic field. The synthesis includes the local absorption by the thick surrounding medium and the Doppler shift of lines due to the component of plasma velocity along the line-of-sight. We explore the effects of absorption on the emerging X-ray spectrum, considering different inclinations of the accretion stream with respect to the observer. Finally we compare our results with the observations.

  6. Water Formation and Destruction by 'Super' X-ray Flares from a T-Tauri Star in a Protoplanetary Disk

    Science.gov (United States)

    Waggoner, Abygail R.; Cleeves, L. Ilsedore

    2018-01-01

    We present models of H2O chemistry is protoplanetary disks in the presence of 'super' X-ray flares emitted by a T-Tauri star. We examine the time-evolving chemistry of H2O at radial locations from 1 to 20 AU at various vertical heights from the mid-plane to the surface of the disk. We find the gas-phase H2O abundance can be enhanced in the surface (Z/R ≥ 0.3) by more than a factor of approximately 3 - 5 by strong flares, i.e., those that increase the ionization rate by a factor of 100. Dissociative recombination of H3O+ , H2O adsorption onto grain, and photolysis of H2O are found to be the three dominant processes leading to a change in H2O abundance. We find X-ray flares have predominantly short- term (days) effects on gaseous H2O abundance, but some regions show a long-term (for the duration of the test about 15 days) decrease in gaseous H2O due to adsorption onto grains, which results in an increase (up to 200%) in ice H2O in regions where ice H2O is 10-8 abundance no are response in the ice is observed.Thanks to the National Science Foundation for funding this research as a part of the Smithsonian Astrophysical Observatory Research Experience for Undergraduates (SAO REU).

  7. A SPITZER IRS STUDY OF INFRARED VARIABILITY IN TRANSITIONAL AND PRE-TRANSITIONAL DISKS AROUND T TAURI STARS

    International Nuclear Information System (INIS)

    Espaillat, C.; Furlan, E.; D'Alessio, P.; Sargent, B.; Muzerolle, J.; Nagel, E.; Calvet, N.; Watson, Dan M.

    2011-01-01

    We present a Spitzer IRS study of variability in 14 T Tauri stars in the Taurus and Chamaeleon star-forming regions. The sample is composed of transitional and pre-transitional objects which contain holes and gaps in their disks. We detect variability between 5 and 38 μm in all but two of our objects on timescales of 2-3 years. Most of the variability observed can be classified as seesaw behavior, whereby the emission at shorter wavelengths varies inversely with the emission at longer wavelengths. For many of the objects we can reasonably reproduce the observed variability using irradiated disk models, particularly by changing the height of the inner disk wall by ∼20%. When the inner wall is taller, the emission at the shorter wavelengths is higher since the inner wall dominates the emission at 2-8 μm. The taller inner wall casts a larger shadow on the outer disk wall, leading to less emission at wavelengths beyond 20 μm where the outer wall dominates. We discuss how the possible presence of planets in these disks could lead to warps that cause changes in the height of the inner wall. We also find that crystalline silicates are common in the outer disks of our objects and that in the four disks in the sample with the most crystalline silicates, variability on timescales of 1 week is present. In addition to explaining the infrared variability described above, planets can create shocks and collisions which can crystallize the dust and lead to short timescale variability.

  8. CHANDRA X-RAY DETECTION OF THE ENIGMATIC FIELD STAR BP Psc

    International Nuclear Information System (INIS)

    Kastner, Joel H.; Montez, Rodolfo; Rodriguez, David; Zuckerman, B.; Perrin, Marshall D.; Grosso, Nicolas; Forveille, Thierry; Graham, James R.

    2010-01-01

    BP Psc is a remarkable emission-line field star that is orbited by a dusty disk and drives a parsec-scale system of jets. We report the detection by the Chandra X-ray Observatory of a weak X-ray point source coincident with the centroids of optical/IR and submillimeter continuum emission at BP Psc. As the star's photosphere is obscured throughout the visible and near-infrared, the Chandra X-ray source likely represents the first detection of BP Psc itself. The X-rays most likely originate with magnetic activity at BP Psc and hence can be attributed either to a stellar corona or to star-disk interactions. The log of the ratio of X-ray to bolometric luminosity, log(L X /L bol ), lies in the range -5.8 to -4.2. This is smaller than log(L X /L bol ) ratios typical of low-mass, pre-main sequence stars, but is well within the log(L X /L bol ) range observed for rapidly rotating (FK Com-type) G giant stars. Hence, the Chandra results favor an exotic model wherein the disk/jet system of BP Psc is the result of its very recently engulfing a companion star or a giant planet, as the primary star ascended the giant branch.

  9. 2.0 to 2.4 micron spectroscopy of T Tauri stars

    Science.gov (United States)

    Hamann, F.; Simon, M.; Ridgway, S. T.

    1988-03-01

    Velocity-resolved 2.0-2.5-micron observations of the T Tau stars T, DF, DG, DK, HL, and RY Tau, SU Aur, and GW Ori are presented. For each of these stars except SU Aur, the Brackett gamma line was detected in emission with line widths inthe range of about 130-230 km/s. The Brackett gamma line profile of SU Aur is complex, having components of both emission and absorption. The first measurement of CO band-head emission in DG Tau is reported, and it is shown that published radio continuum fluxes of young stars far exceed what could be produced in an envelope ionized by only the stellar photospheric Lyman continuum. The excess of radio emission is found to be much greater in low-luminosity sources (e.g., the T Tau stars).

  10. A hot Jupiter orbiting a 2-million-year-old solar-mass T Tauri star.

    Science.gov (United States)

    Donati, J F; Moutou, C; Malo, L; Baruteau, C; Yu, L; Hébrard, E; Hussain, G; Alencar, S; Ménard, F; Bouvier, J; Petit, P; Takami, M; Doyon, R; Collier Cameron, A

    2016-06-30

    Hot Jupiters are giant Jupiter-like exoplanets that orbit their host stars 100 times more closely than Jupiter orbits the Sun. These planets presumably form in the outer part of the primordial disk from which both the central star and surrounding planets are born, then migrate inwards and yet avoid falling into their host star. It is, however, unclear whether this occurs early in the lives of hot Jupiters, when they are still embedded within protoplanetary disks, or later, once multiple planets are formed and interact. Although numerous hot Jupiters have been detected around mature Sun-like stars, their existence has not yet been firmly demonstrated for young stars, whose magnetic activity is so intense that it overshadows the radial velocity signal that close-in giant planets can induce. Here we report that the radial velocities of the young star V830 Tau exhibit a sine wave of period 4.93 days and semi-amplitude 75 metres per second, detected with a false-alarm probability of less than 0.03 per cent, after filtering out the magnetic activity plaguing the spectra. We find that this signal is unrelated to the 2.741-day rotation period of V830 Tau and we attribute it to the presence of a planet of mass 0.77 times that of Jupiter, orbiting at a distance of 0.057 astronomical units from the host star. Our result demonstrates that hot Jupiters can migrate inwards in less than two million years, probably as a result of planet–disk interactions.

  11. Radial Velocity Survey of T Tauri Stars in Taurus-Auriga

    Science.gov (United States)

    Crockett, Christopher; Mahmud, N.; Huerta, M.; Prato, L.; Johns-Krull, C.; Hartigan, P.; Jaffe, D.

    2009-01-01

    Is the frequency of giant planet companions to young stars similar to that seen around old stars? Is the "brown dwarf desert" a product of how low-mass companion objects form, or of how they evolve? Some models indicate that both giant planets and brown dwarfs should be common at young ages within 3 AU of a primary star, but migration induced by massive disks drive brown dwarfs into the parent stars, leaving behind proportionally more giant planets. Our radial velocity survey of young stars will provide a census of the young giant planet and brown dwarf population in Taurus-Auriga. In this poster we present our progress in quantifying how spurious radial velocity signatures are caused by stellar activity and in developing models to help distinguish between companion induced and spot induced radial velocity variations. Early results stress the importance of complementary observations in both visible light and NIR. We present our technique to determine radial velocities by fitting telluric features and model stellar features to our observed spectra. Finally, we discuss ongoing observations at McDonald Observatory, KPNO, and the IRTF, and several new exoplanet host candidates.

  12. NARROW Na AND K ABSORPTION LINES TOWARD T TAURI STARS: TRACING THE ATOMIC ENVELOPE OF MOLECULAR CLOUDS

    Energy Technology Data Exchange (ETDEWEB)

    Pascucci, I.; Simon, M. N. [Lunar and Planetary Laboratory, The University of Arizona, Tucson, AZ 85721 (United States); Edwards, S. [Five College Astronomy Department, Smith College, Northampton, MA 01063 (United States); Heyer, M. [Department of Astronomy, University of Massachusetts, Amherst, MA 01003-9305 (United States); Rigliaco, E. [Institute for Astronomy, ETH Zurich, Wolfgang-Pauli-Strasse 27, CH-8093 Zurich (Switzerland); Hillenbrand, L. [Department of Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Gorti, U.; Hollenbach, D., E-mail: pascucci@lpl.arizona.edu [SETI Institute, Mountain View, CA 94043 (United States)

    2015-11-20

    We present a detailed analysis of narrow Na i and K i absorption resonance lines toward nearly 40 T Tauri stars in Taurus with the goal of clarifying their origin. The Na i λ5889.95 line is detected toward all but one source, while the weaker K i λ7698.96 line is detected in about two-thirds of the sample. The similarity in their peak centroids and the significant positive correlation between their equivalent widths demonstrate that these transitions trace the same atomic gas. The absorption lines are present toward both disk and diskless young stellar objects, which excludes cold gas within the circumstellar disk as the absorbing material. A comparison of Na i and CO detections and peak centroids demonstrates that the atomic gas and molecular gas are not co-located, the atomic gas being more extended than the molecular gas. The width of the atomic lines corroborates this finding and points to atomic gas about an order of magnitude warmer than the molecular gas. The distribution of Na i radial velocities shows a clear spatial gradient along the length of the Taurus molecular cloud filaments. This suggests that absorption is associated with the Taurus molecular cloud. Assuming that the gradient is due to cloud rotation, the rotation of the atomic gas is consistent with differential galactic rotation, whereas the rotation of the molecular gas, although with the same rotation axis, is retrograde. Our analysis shows that narrow Na i and K i absorption resonance lines are useful tracers of the atomic envelope of molecular clouds. In line with recent findings from giant molecular clouds, our results demonstrate that the velocity fields of the atomic and molecular gas are misaligned. The angular momentum of a molecular cloud is not simply inherited from the rotating Galactic disk from which it formed but may be redistributed by cloud–cloud interactions.

  13. NARROW Na AND K ABSORPTION LINES TOWARD T TAURI STARS: TRACING THE ATOMIC ENVELOPE OF MOLECULAR CLOUDS

    International Nuclear Information System (INIS)

    Pascucci, I.; Simon, M. N.; Edwards, S.; Heyer, M.; Rigliaco, E.; Hillenbrand, L.; Gorti, U.; Hollenbach, D.

    2015-01-01

    We present a detailed analysis of narrow Na i and K i absorption resonance lines toward nearly 40 T Tauri stars in Taurus with the goal of clarifying their origin. The Na i λ5889.95 line is detected toward all but one source, while the weaker K i λ7698.96 line is detected in about two-thirds of the sample. The similarity in their peak centroids and the significant positive correlation between their equivalent widths demonstrate that these transitions trace the same atomic gas. The absorption lines are present toward both disk and diskless young stellar objects, which excludes cold gas within the circumstellar disk as the absorbing material. A comparison of Na i and CO detections and peak centroids demonstrates that the atomic gas and molecular gas are not co-located, the atomic gas being more extended than the molecular gas. The width of the atomic lines corroborates this finding and points to atomic gas about an order of magnitude warmer than the molecular gas. The distribution of Na i radial velocities shows a clear spatial gradient along the length of the Taurus molecular cloud filaments. This suggests that absorption is associated with the Taurus molecular cloud. Assuming that the gradient is due to cloud rotation, the rotation of the atomic gas is consistent with differential galactic rotation, whereas the rotation of the molecular gas, although with the same rotation axis, is retrograde. Our analysis shows that narrow Na i and K i absorption resonance lines are useful tracers of the atomic envelope of molecular clouds. In line with recent findings from giant molecular clouds, our results demonstrate that the velocity fields of the atomic and molecular gas are misaligned. The angular momentum of a molecular cloud is not simply inherited from the rotating Galactic disk from which it formed but may be redistributed by cloud–cloud interactions

  14. Gas in the Terrestrial Planet Region of Disks: CO Fundamental Emission from T Tauri Stars

    Science.gov (United States)

    2003-06-01

    planetary systems: protoplanetary disks — stars: variables: other 1. INTRODUCTION As the likely birthplaces of planets, the inner regions of young...both low column density regions, such as disk gaps , and temperature inversion regions in disk atmospheres can produce significant emission. The esti...which planetary systems form. The moti- vation to study inner disks is all the more intense today given the discovery of planets outside the solar system

  15. Near-ultraviolet Excess in Slowly Accreting T Tauri Stars: Limits Imposed by Chromospheric Emission

    Science.gov (United States)

    Ingleby, Laura; Calvet, Nuria; Bergin, Edwin; Herczeg, Gregory; Brown, Alexander; Alexander, Richard; Edwards, Suzan; Espaillat, Catherine; France, Kevin; Gregory, Scott G.; Hillenbrand, Lynne; Roueff, Evelyne; Valenti, Jeff; Walter, Frederick; Johns-Krull, Christopher; Brown, Joanna; Linsky, Jeffrey; McClure, Melissa; Ardila, David; Abgrall, Hervé; Bethell, Thomas; Hussain, Gaitee; Yang, Hao

    2011-12-01

    Young stars surrounded by disks with very low mass accretion rates are likely in the final stages of inner disk evolution and therefore particularly interesting to study. We present ultraviolet (UV) observations of the ~5-9 Myr old stars RECX-1 and RECX-11, obtained with the Cosmic Origins Spectrograph and Space Telescope Imaging Spectrograph on the Hubble Space Telescope, as well as optical and near-infrared spectroscopic observations. The two stars have similar levels of near-UV emission, although spectroscopic evidence indicates that RECX-11 is accreting and RECX-1 is not. The line profiles of Hα and He I λ10830 in RECX-11 show both broad and narrow redshifted absorption components that vary with time, revealing the complexity of the accretion flows. We show that accretion indicators commonly used to measure mass accretion rates, e.g., U-band excess luminosity or the Ca II triplet line luminosity, are unreliable for low accretors, at least in the middle K spectral range. Using RECX-1 as a template for the intrinsic level of photospheric and chromospheric emission, we determine an upper limit of 3 × 10-10 M ⊙ yr-1 for RECX-11. At this low accretion rate, recent photoevaporation models predict that an inner hole should have developed in the disk. However, the spectral energy distribution of RECX-11 shows fluxes comparable to the median of Taurus in the near-infrared, indicating that substantial dust remains. Fluorescent H2 emission lines formed in the innermost disk are observed in RECX-11, showing that gas is present in the inner disk, along with the dust. This paper includes data gathered with the 6.5 m Magellan Telescopes located at Las Campanas Observatory, Chile.

  16. Discovery of new dipper stars with K2: a window into the inner disc region of T Tauri stars

    Science.gov (United States)

    Hedges, Christina; Hodgkin, Simon; Kennedy, Grant

    2018-05-01

    In recent years, a new class of young stellar object (YSO) has been defined, referred to as dippers, where large transient drops in flux are observed. These dips are too large to be attributed to stellar variability, last from hours to days and can reduce the flux of a star by 10-50 per cent. This variability has been attributed to occultations by warps or accretion columns near the inner edge of circumstellar discs. Here, we present 95 dippers in the Upper Scorpius association and ρ Ophiuchus cloud complex found in K2 Campaign 2 data using supervised machine learning with a random forest classifier. We also present 30 YSOs that exhibit brightening events on the order of days, known as bursters. Not all dippers and bursters are known members, but all exhibit infrared excesses and are consistent with belonging to either of the two young star-forming regions. We find 21.0 ± 5.5 per cent of stars with discs are dippers for both regions combined. Our entire dipper sample consists only of late-type (KM) stars, but we show that biases limit dipper discovery for earlier spectral types. Using the dipper properties as a proxy, we find that the temperature at the inner disc edge is consistent with interferometric results for similar and earlier type stars.

  17. EXTENDED MAGNETOSPHERES IN PRE-MAIN-SEQUENCE EVOLUTION: FROM T TAURI STARS TO THE BROWN DWARF LIMIT

    Energy Technology Data Exchange (ETDEWEB)

    Gomez de Castro, Ana I.; Marcos-Arenal, Pablo [Grupo de Investigacion Complutense AEGORA, Universidad Complutense de Madrid, 28040 Madrid (Spain)

    2012-04-20

    Low-mass pre-main-sequence stars, i.e., T Tauri stars (TTSs), strongly radiate at high energies, from X-rays to the ultraviolet (UV). This excess radiation with respect to main-sequence cool stars (MSCSs) is associated with the accretion process, i.e., it is produced in the extended magnetospheres, in the accretion shocks on the stellar surface, and in the outflows. Although evidence of accretion shocks and outflow contribution to the high-energy excess have been recently addressed, there is not an updated revision of the magnetospheric contribution. This article addresses this issue. The UV observations of the TTSs in the well-known Taurus region have been analyzed together with the XMM-Newton observations compiled in the XEST survey. For the first time the high sensitivity of the Hubble Space Telescope UV instrumentation has allowed measurement of the UV line fluxes of TTSs to M8 type. UV- and X-ray-normalized fluxes have been determined to study the extent and properties of the TTS magnetospheres as a class. They have been compared with the atmospheres of the MSCSs. The main results from this analysis are (1) the normalized fluxes of all the tracers are correlated; this correlation is independent of the broad mass range and the hardness of the X-ray radiation field; (2) the TTS correlations are different than the MSCS correlations; (3) there is a very significant excess emission in O I in the TTSs compared with MSCSs that seems to be caused by recombination radiation from the disk atmosphere after photoionization by extreme UV radiation; the Fe II/Mg II recombination continuum has also been detected in several TTSs and most prominently in AA Tau; and (4) the normalized flux of the UV tracers anticorrelates with the strength of the X-ray flux, i.e., the stronger the X-ray surface flux is, the weaker the observed UV flux. This last behavior is counterintuitive within the framework of stellar dynamo theory and suggests that UV emission can be produced in the

  18. EMPIRICALLY ESTIMATED FAR-UV EXTINCTION CURVES FOR CLASSICAL T TAURI STARS

    Energy Technology Data Exchange (ETDEWEB)

    McJunkin, Matthew; France, Kevin [Laboratory for Atmospheric and Space Physics, University of Colorado, 600 UCB, Boulder, CO 80303-7814 (United States); Schindhelm, Eric [Southwest Research Institute, 1050 Walnut Street, Suite 300, Boulder, CO 80302 (United States); Herczeg, Gregory [Kavli Institute for Astronomy and Astrophysics, Peking University, Yi He Yuan Lu 5, Haidian Qu, 100871 Beijing (China); Schneider, P. Christian [ESA/ESTEC, Keplerlaan 1, 2201 AZ Noordwijk (Netherlands); Brown, Alex, E-mail: matthew.mcjunkin@colorado.edu [Center for Astrophysics and Space Astronomy, University of Colorado, 593 UCB, Boulder, CO 80309-0593 (United States)

    2016-09-10

    Measurements of extinction curves toward young stars are essential for calculating the intrinsic stellar spectrophotometric radiation. This flux determines the chemical properties and evolution of the circumstellar region, including the environment in which planets form. We develop a new technique using H{sub 2} emission lines pumped by stellar Ly α photons to characterize the extinction curve by comparing the measured far-ultraviolet H{sub 2} line fluxes with model H{sub 2} line fluxes. The difference between model and observed fluxes can be attributed to the dust attenuation along the line of sight through both the interstellar and circumstellar material. The extinction curves are fit by a Cardelli et al. (1989) model and the A {sub V} (H{sub 2}) for the 10 targets studied with good extinction fits range from 0.5 to 1.5 mag, with R {sub V} values ranging from 2.0 to 4.7. A {sub V} and R {sub V} are found to be highly degenerate, suggesting that one or the other needs to be calculated independently. Column densities and temperatures for the fluorescent H{sub 2} populations are also determined, with averages of log{sub 10}( N (H{sub 2})) = 19.0 and T = 1500 K. This paper explores the strengths and limitations of the newly developed extinction curve technique in order to assess the reliability of the results and improve the method in the future.

  19. THE SPITZER c2d SURVEY OF WEAK-LINE T TAURI STARS. III. THE TRANSITION FROM PRIMORDIAL DISKS TO DEBRIS DISKS

    International Nuclear Information System (INIS)

    Wahhaj, Zahed; Cieza, Lucas; Koerner, David W.; Case, April; Stapelfeldt, Karl R.; Chapman, Nicholas; Padgett, Deborah L.; Brooke, Tim; Keller, James R.; MerIn, Bruno; Evans, Neal J.; Harvey, Paul; Sargent, Anneila; Van Dishoeck, Ewine F.; Allen, Lori; Blake, Geoff; Mundy, Lee; Myers, Philip C.

    2010-01-01

    We present 3.6 to 70 μm Spitzer photometry of 154 weak-line T Tauri stars (WTTSs) in the Chamaeleon, Lupus, Ophiuchus, and Taurus star formation regions, all of which are within 200 pc of the Sun. For a comparative study, we also include 33 classical T Tauri stars which are located in the same star-forming regions. Spitzer sensitivities allow us to robustly detect the photosphere in the IRAC bands (3.6 to 8 μm) and the 24 μm MIPS band. In the 70 μm MIPS band, we are able to detect dust emission brighter than roughly 40 times the photosphere. These observations represent the most sensitive WTTSs survey in the mid- to far-infrared to date and reveal the frequency of outer disks (r = 3-50 AU) around WTTSs. The 70 μm photometry for half the c2d WTTSs sample (the on-cloud objects), which were not included in the earlier papers in this series, those of Padgett et al. and Cieza et al., are presented here for the first time. We find a disk frequency of 19% for on-cloud WTTSs, but just 5% for off-cloud WTTSs, similar to the value reported in the earlier works. WTTSs exhibit spectral energy distributions that are quite diverse, spanning the range from optically thick to optically thin disks. Most disks become more tenuous than L disk /L * = 2 x 10 -3 in 2 Myr and more tenuous than L disk /L * = 5 x 10 -4 in 4 Myr.

  20. Hydrodynamic ejection of bipolar flows from objects undergoing disk accretion: T Tauri stars, massive pre-main-sequence objects, and cataclysmic variables

    International Nuclear Information System (INIS)

    Torbett, M.V.

    1984-01-01

    A general mechanism is presented for generating pressure-driven winds that are intrinsically bipolar from objects undergoing disk accretion. The energy librated in a boundary layer shock as the disk matter impacts the central object is shown to be sufficient to eject a fraction βapprox.10 -2 to 10 -3 of the accreted mass. These winds are driven by a mechanism that accelerates the flow perpendicular to the plane of the disk and can therefore account for the bipolar geometry of the mass loss observed near young stars. The mass loss contained in these winds is comparable to that inferred for young stars. Thus, disk accretion-driven winds may constitute the T Tauri phase of stellar evolution. This mechanism is generally applicable, and thus massive pre-main-sequence objects as well as cataclysmic variables at times of enhanced accretion are predicted to eject bipolar outflows as well. Unmagnetized accreting neutron stas are also expected to eject bipolar flows. Since this mechanism requires stellar surfaces, however, it will not operate in disk accretion onto black holes

  1. VARIATIONS OF THE 10 μm SILICATE FEATURES IN THE ACTIVELY ACCRETING T TAURI STARS: DG Tau AND XZ Tau

    International Nuclear Information System (INIS)

    Bary, Jeffrey S.; Leisenring, Jarron M.; Skrutskie, Michael F.

    2009-01-01

    Using the Infrared Spectrograph aboard the Spitzer Space Telescope, we observed multiple epochs of 11 actively accreting T Tauri stars in the nearby Taurus-Auriga star-forming region. In total, 88 low-resolution mid-infrared spectra were collected over 1.5 years in Cycles 2 and 3. The results of this multi-epoch survey show that the 10 μm silicate complex in the spectra of two sources-DG Tau and XZ Tau-undergoes significant variations with the silicate feature growing both weaker and stronger over month- and year-long timescales. Shorter timescale variations on day- to week-long timescales were not detected within the measured flux errors. The time resolution coverage of this data set is inadequate for determining if the variations are periodic. Pure emission compositional models of the silicate complex in each epoch of the DG Tau and XZ Tau spectra provide poor fits to the observed silicate features. These results agree with those of previous groups that attempted to fit only single-epoch observations of these sources. Simple two-temperature, two-slab models with similar compositions successfully reproduce the observed variations in the silicate features. These models hint at a self-absorption origin of the diminution of the silicate complex instead of a compositional change in the population of emitting dust grains. We discuss several scenarios for producing such variability including disk shadowing, vertical mixing, variations in disk heating, and disk wind events associated with accretion outbursts.

  2. The wind and the magnetospheric accretion onto the T Tauri star S Coronae Australis at sub-au resolution

    Science.gov (United States)

    Gravity Collaboration; Garcia Lopez, R.; Perraut, K.; Caratti O Garatti, A.; Lazareff, B.; Sanchez-Bermudez, J.; Benisty, M.; Dougados, C.; Labadie, L.; Brandner, W.; Garcia, P. J. V.; Henning, Th.; Ray, T. P.; Abuter, R.; Amorim, A.; Anugu, N.; Berger, J. P.; Bonnet, H.; Buron, A.; Caselli, P.; Clénet, Y.; Coudé Du Foresto, V.; de Wit, W.; Deen, C.; Delplancke-Ströbele, F.; Dexter, J.; Eckart, A.; Eisenhauer, F.; Garcia Dabo, C. E.; Gendron, E.; Genzel, R.; Gillessen, S.; Haubois, X.; Haug, M.; Haussmann, F.; Hippler, S.; Hubert, Z.; Hummel, C. A.; Horrobin, M.; Jocou, L.; Kellner, S.; Kervella, P.; Kulas, M.; Kolb, J.; Lacour, S.; Le Bouquin, J.-B.; Léna, P.; Lippa, M.; Mérand, A.; Müller, E.; Ott, T.; Panduro, J.; Paumard, T.; Perrin, G.; Pfuhl, O.; Ramirez, A.; Rau, C.; Rohloff, R.-R.; Rousset, G.; Scheithauer, S.; Schöller, M.; Straubmeier, C.; Sturm, E.; Thi, W. F.; van Dishoeck, E.; Vincent, F.; Waisberg, I.; Wank, I.; Wieprecht, E.; Wiest, M.; Wiezorrek, E.; Woillez, J.; Yazici, S.; Zins, G.

    2017-12-01

    Aims: To investigate the inner regions of protoplanetary discs, we performed near-infrared interferometric observations of the classical T Tauri binary system S CrA. Methods: We present the first VLTI-GRAVITY high spectral resolution (R 4000) observations of a classical T Tauri binary, S CrA (composed of S CrA N and S CrA S and separated by 1.̋4), combining the four 8m telescopes in dual-field mode. Results: Our observations in the near-infrared K-band continuum reveal a disc around each binary component, with similar half-flux radii of about 0.1 au at d 130 pc, inclinations (i = 28 ± 3° and i = 22 ± 6°), and position angles (PA = 0°± 6° and PA = –2°± 12°), suggesting that they formed from the fragmentation of a common disc. The S CrA N spectrum shows bright He I and Brγ line emission exhibiting inverse P Cygni profiles, typically associated with infalling gas. The continuum-compensated Brγ line visibilities of S CrA N show the presence of a compact Brγ emitting region whose radius is about 0.06 au, which is twice as big as the truncation radius. This component is mostly tracing a wind. Moreover, a slight radius change between the blue- and red-shifted Brγ line components is marginally detected. Conclusions: The presence of an inverse P Cygni profile in the He I and Brγ lines, along with the tentative detection of a slightly larger size of the blue-shifted Brγ line component, hint at the simultaneous presence of a wind and magnetospheric accretion in S CrA N.

  3. Mixed poloidal-toroidal magnetic configuration and surface abundance distributions of the Bp star 36 Lyn

    Science.gov (United States)

    Oksala, M. E.; Silvester, J.; Kochukhov, O.; Neiner, C.; Wade, G. A.; the MiMeS Collaboration

    2018-01-01

    Previous studies of the chemically peculiar Bp star 36 Lyn revealed a moderately strong magnetic field, circumstellar material and inhomogeneous surface abundance distributions of certain elements. We present in this paper an analysis of 33 high signal-to-noise ratio, high-resolution Stokes IV observations of 36 Lyn obtained with the Narval spectropolarimeter at the Bernard Lyot Telescope at Pic du Midi Observatory. From these data, we compute new measurements of the mean longitudinal magnetic field, Bℓ, using the multiline least-squares deconvolution (LSD) technique. A rotationally phased Bℓ curve reveals a strong magnetic field, with indications for deviation from a pure dipole field. We derive magnetic maps and chemical abundance distributions from the LSD profiles, produced using the Zeeman-Doppler imaging code INVERSLSD. Using a spherical harmonic expansion to characterize the magnetic field, we find that the harmonic energy is concentrated predominantly in the dipole mode (ℓ = 1), with significant contribution from both the poloidal and toroidal components. This toroidal field component is predicted theoretically, but not typically observed for Ap/Bp stars. Chemical abundance maps reveal a helium enhancement in a distinct region where the radial magnetic field is strong. Silicon enhancements are located in two regions, also where the radial field is stronger. Titanium and iron enhancements are slightly offset from the helium enhancements, and are located in areas where the radial field is weak, close to the magnetic equator.

  4. 2.5D global-disk oscillation models of the Be shell star ζ Tauri. I. Spectroscopic and polarimetric analysis

    Science.gov (United States)

    Escolano, C.; Carciofi, A. C.; Okazaki, A. T.; Rivinius, T.; Baade, D.; Štefl, S.

    2015-04-01

    Context. A large number of Be stars exhibit intensity variations of their violet and red emission peaks in their H i lines observed in emission. This is the so-called V/R phenomenon, usually explained by the precession of a one-armed spiral density perturbation in the circumstellar disk. That global-disk oscillation scenario was confirmed, both observationally and theoretically, in the previous series of two papers analyzing the Be shell star ζ Tauri. The vertically averaged (2D) global-disk oscillation model used at the time was able to reproduce the V/R variations observed in Hα, as well as the spatially resolved interferometric data from AMBER/VLTI. Unfortunately, that model failed to reproduce the V/R phase of Br15 and the amplitude of the polarization variation, suggesting that the inner disk structure predicted by the model was incorrect. Aims: The first aim of the present paper is to quantify the temporal variations of the shell-line characteristics of ζ Tauri. The second aim is to better understand the physics underlying the V/R phenomenon by modeling the shell-line variations together with the V/R and polarimetric variations. The third aim is to test a new 2.5D disk oscillation model, which solves the set of equations that describe the 3D perturbed disk structure but keeps only the equatorial (i.e., 2D) component of the solution. This approximation was adopted to allow comparisons with the previous 2D model, and as a first step toward a future 3D model. Methods: We carried out an extensive analysis of ζ Tauri's spectroscopic variations by measuring various quantities characterizing its Balmer line profiles: red and violet emission peak intensities (for Hα, Hβ, and Br15), depth and asymmetry of the shell absorption (for Hβ, Hγ, and Hδ), and the respective position (i.e., radial velocity) of each component. We attempted to model the observed variations by implementing in the radiative transfer code HDUST the perturbed disk structure computed with a

  5. Photoelectric UBV-photometry of the In(YY) DR Tauri-type young star in 1982-1986

    International Nuclear Information System (INIS)

    Kolotilov, E.A.

    1987-01-01

    The results of photoelectric UBV-photometry carried out in 1982-1986 for DR TAU - the star which undergone nova-like brightness increase in 1965-1980 - are presented. The brightness variations of the star during the post-maximum period include several days lasting flares and much more rare deep minima. The averaged colour-brightness relations are as follows: the higher brightness, the bluer B - V colour and the redder U - B colour. However the fast variations on a time scale of days do not always follow this relation. The observed pattern of variability of DR Tau is in agreement with the model of young stars activity (Grinin, 1980) proposing the appearance of hot spots in stellar atmosphere due to accretion of gas. Some arguments for the binarity of DR Tau are presented

  6. Herschel GASPS spectral observations of T Tauri stars in Taurus. Unraveling far-infrared line emission from jets and discs

    NARCIS (Netherlands)

    Alonso-Martínez, M.; Riviere-Marichalar, P.; Meeus, G.; Kamp, I.; Fang, M.; Podio, L.; Dent, W. R. F.; Eiroa, C.

    2017-01-01

    Context. At early stages of stellar evolution young stars show powerful jets and/or outflows that interact with protoplanetary discs and their surroundings. Despite the scarce knowledge about the interaction of jets and/or outflows with discs, spectroscopic studies based on Herschel and ISO data

  7. Chemistry in T Tauri winds

    Energy Technology Data Exchange (ETDEWEB)

    Rawlings, J M.C.; Williams, D A; Canto, J

    1988-02-15

    The chemistry occurring in the winds of T Tauri stars is investigated. On the assumption that the wind is dust-free, then routes to H/sub 2/ are inhibited under the conditions in the wind, and subsequent chemistry does not produce substantial molecular abundances. The major losses to the chemical network lie in the geometrical dilution and collisional dissociation rather than in chemical destruction and photodissociation. Mass loading of the wind with dust and H/sub 2/ may, however, occur. This stimulates the chemistry and may in some circumstances lead to a conversion of approx.1-10 per cent of carbon into CO. This gives a column density of CO which is marginally detectable. A positive detection of CO at high wind velocities would imply that the winds must be cool and that mixing of molecular material from a disc, which may play a role in collimating the wind, or the remnants of a disc, must occur.

  8. Analysis of the nebulosities near T Tauri using digital computer image processing

    International Nuclear Information System (INIS)

    Lorre, J.J.

    1975-01-01

    Direct plates of T Tauri taken with the 120-inch (3 m) and 36-inch (91 cm) Lick reflectors were digitized and analyzed using digital computer image processing techniques. Luminous emission protrusions extending to as far as 13'' from T Tauri in position angles 170degree, 210degree, and 330degree are shown. These features are variable and may contain layered structure. The complex reflection nebula west of T Tauri (NGC 1555) appears to be an illuminated portion of a much larger dark nebula whose variability is due to obscuring material near the star

  9. A SOFIA FORCAST Grism Study of the Mineralogy of Dust in the Winds of Proto-planetary Nebulae: RV Tauri Stars and SRd Variables

    Energy Technology Data Exchange (ETDEWEB)

    Arneson, R. A.; Gehrz, R. D.; Woodward, C. E.; Shenoy, D. [Minnesota Institute for Astrophysics, School of Physics and Astronomy, University of Minnesota, 106 Pleasant Street S.E., Minneapolis, MN 55455 (United States); Helton, L. A. [USRA-SOFIA Science Center, NASA Ames Research Center, Moffett Field, CA 94035 (United States); Evans, A. [Astrophysics Group, Lennard Jones Laboratory, Keele University, Keele, Staffordshire ST5 5BG (United Kingdom); Keller, L. D. [Department of Physics and Astronomy, 264 Center for Natural Sciences, Ithaca College, Ithaca, NY 14850 (United States); Hinkle, K. H. [National Optical Astronomy Observatory, P.O. Box 26732, Tucson, AZ 85726 (United States); Jura, M. [Department of Physics and Astronomy, University of California, Los Angeles, CA 90095 (United States); Lebzelter, T. [Institute for Astrophysics (IfA), University of Vienna, Türkenschanzstrasse 17, A-1180 Vienna (Austria); Lisse, C. M. [Solar System Exploration Branch, Space Department, Johns Hopkins University Applied Physics Laboratory, Laurel, MD 20723 (United States); Rushton, M. T. [Astronomical Institute of the Romanian Academy, Str. Cutitul de Argint 5, Bucharest, 040557 (Romania); Mizrachi, J., E-mail: arneson@astro.umn.edu [Biomedical Engineering Department, Stony Brook University, Stony Brook, NY 11794 (United States)

    2017-07-01

    We present a SOFIA FORCAST grism spectroscopic survey to examine the mineralogy of the circumstellar dust in a sample of post-asymptotic giant branch (post-AGB) yellow supergiants that are believed to be the precursors of planetary nebulae. Our mineralogical model of each star indicates the presence of both carbon-rich and oxygen-rich dust species—contrary to simple dredge-up models—with a majority of the dust in the form of amorphous carbon and graphite. The oxygen-rich dust is primarily in the form of amorphous silicates. The spectra do not exhibit any prominent crystalline silicate emission features. For most of the systems, our analysis suggests that the grains are relatively large and have undergone significant processing, supporting the hypothesis that the dust is confined to a Keplerian disk and that we are viewing the heavily processed, central regions of the disk from a nearly face-on orientation. These results help to determine the physical properties of the post-AGB circumstellar environment and to constrain models of post-AGB mass loss and planetary nebula formation.

  10. EVOLUTION OF INTERMEDIATE-MASS X-RAY BINARIES DRIVEN BY THE MAGNETIC BRAKING OF AP/BP STARS. I. ULTRACOMPACT X-RAY BINARIES

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Wen-Cong [School of Physics and Electrical Information, Shangqiu Normal University, Shangqiu 476000 (China); Podsiadlowski, Philipp, E-mail: chenwc@pku.edu.cn [Department of Physics, University of Oxford, Oxford OX1 3RH (United Kingdom)

    2016-10-20

    It is generally believed that ultracompact X-ray binaries (UCXBs) evolved from binaries consisting of a neutron star accreting from a low-mass white dwarf (WD) or helium star where mass transfer is driven by gravitational radiation. However, the standard WD evolutionary channel cannot produce the relatively long-period (40–60 minutes) UCXBs with a high time-averaged mass-transfer rate. In this work, we explore an alternative evolutionary route toward UCXBs, where the companions evolve from intermediate-mass Ap/Bp stars with an anomalously strong magnetic field (100–10,000 G). Including the magnetic braking caused by the coupling between the magnetic field and an irradiation-driven wind induced by the X-ray flux from the accreting component, we show that intermediate-mass X-ray binaries (IMXBs) can evolve into UCXBs. Using the MESA code, we have calculated evolutionary sequences for a large number of IMXBs. The simulated results indicate that, for a small wind-driving efficiency f = 10{sup −5}, the anomalous magnetic braking can drive IMXBs to an ultra-short period of 11 minutes. Comparing our simulated results with the observed parameters of 15 identified UCXBs, the anomalous magnetic braking evolutionary channel can account for the formation of seven and eight sources with f = 10{sup −3}, and 10{sup −5}, respectively. In particular, a relatively large value of f can fit three of the long-period, persistent sources with a high mass-transfer rate. Though the proportion of Ap/Bp stars in intermediate-mass stars is only 5%, the lifetime of the UCXB phase is ≳2 Gyr, producing a relatively high number of observable systems, making this an alternative evolutionary channel for the formation of UCXBs.

  11. Chandra resolves the T Tauri binary system RW Aur

    Energy Technology Data Exchange (ETDEWEB)

    Skinner, Stephen L. [CASA, University of Colorado, Boulder, CO 80309-0389 (United States); Güdel, Manuel, E-mail: stephen.skinner@colorado.edu, E-mail: manuel.guedel@univie.ac.at [Department of Astrophysics, University of Vienna, Türkenschanzstr. 17, A-1180 Vienna (Austria)

    2014-06-20

    RW Aur is a multiple T Tauri system consisting of an early-K type primary (A) and a K5 companion (B) at a separation of 1.''4. RW Aur A drives a bipolar optical jet that is well characterized optically. We present results of a sensitive Chandra observation whose primary objective was to search for evidence of soft extended X-ray emission along the jet, as has been seen for a few other nearby T Tauri stars. The binary is clearly resolved by Chandra and both stars are detected as X-ray sources. The X-ray spectra of both stars reveal evidence for cool and hot plasma. Surprisingly, the X-ray luminosity of the less-massive secondary is at least twice that of the primary and is variable. The disparity is attributed to the primary whose X-ray luminosity is at the low end of the range for classical T Tauri stars of similar mass based on established correlations. Deconvolved soft-band images show evidence for slight outward elongation of the source structure of RW Aur A along the blueshifted jet axis inside the central arcsecond. In addition, a faint X-ray emission peak is present on the redshifted axis at an offset of 1.''2 ± 0.''2 from the star. Deprojected jet speeds determined from previous optical studies are too low to explain this faint emission peak as shock-heated jet plasma. Thus, unless flow speeds in the redshifted jet have been underestimated, other mechanisms such as magnetic jet heating may be involved.

  12. The Curious Case of PDS 11: A Nearby, >10 Myr Old, Classical T Tauri Binary System

    Energy Technology Data Exchange (ETDEWEB)

    Mathew, Blesson; Manoj, P. [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, Colaba, Mumbai 400005 (India); Bhatt, B. C.; Sahu, D. K.; Muneer, S. [Indian Institute of Astrophysics, Koramangala, Bangalore 560034 (India); Maheswar, G., E-mail: blesson.mathew@tifr.res.in [Aryabhatta Research Institute of Observational Sciences (ARIES), Nainital 263002 (India)

    2017-05-01

    We present results of our study of the PDS 11 binary system, which belongs to a rare class of isolated, high Galactic latitude T Tauri stars. Our spectroscopic analysis reveals that PDS 11 is an M2–M2 binary system with both components showing similar H α emission strengths. Both the components appear to be accreting and are classical T Tauri stars. The lithium doublet Li i  λ 6708, a signature of youth, is present in the spectrum of PDS 11A, but not in PDS 11B. From the application of lithium depletion boundary age-dating method and a comparison with the Li i  λ 6708 equivalent width distribution of moving groups, we estimated an age of 10–15 Myr for PDS 11A. Comparison with pre-main sequence evolutionary models indicates that PDS 11A is a 0.4 M {sub ⊙} T Tauri star at a distance of 114–131 pc. PDS 11 system does not appear to be associated with any known star-forming regions or moving groups. PDS 11 is a new addition, after TWA 30 and LDS 5606, to the interesting class of old, dusty, wide binary classical T Tauri systems in which both components are actively accreting.

  13. SHOCKS AND A GIANT PLANET IN THE DISK ORBITING BP PISCIUM?

    International Nuclear Information System (INIS)

    Melis, C.; Zuckerman, B.; Gielen, C.; Chen, C. H.; Rhee, Joseph H.; Song, Inseok

    2010-01-01

    Spitzer Infrared Spectrograph data support the interpretation that BP Piscium, a gas and dust enshrouded star residing at high Galactic latitude, is a first-ascent giant rather than a classical T Tauri star. Our analysis suggests that BP Piscium's spectral energy distribution can be modeled as a disk with a gap that is opened by a giant planet. Modeling the rich mid-infrared emission line spectrum indicates that the solid-state emitting grains orbiting BP Piscium are primarily composed of ∼75 K crystalline, magnesium-rich olivine; ∼75 K crystalline, magnesium-rich pyroxene; ∼200 K amorphous, magnesium-rich pyroxene; and ∼200 K annealed silica (cristobalite). These dust grains are all sub-micron sized. The giant planet and gap model also naturally explains the location and mineralogy of the small dust grains in the disk. Disk shocks that result from disk-planet interaction generate the highly crystalline dust which is subsequently blown out of the disk mid-plane and into the disk atmosphere.

  14. X-ray sources in regions of star formation. II. The pre-main-sequence G star HDE 283572

    International Nuclear Information System (INIS)

    Walter, F.M.; Brown, A.; Linsky, J.L.; Rydgren, A.E.; Vrba, F.; Joint Institute for Laboratory Astrophysics, Boulder, CO; Computer Sciences Corp., El Segundo, CA; Naval Observatory, Flagstaff, AZ)

    1987-01-01

    This paper reports the detection of HDE 283572, a ninth-magnitude G star 8 arcmin south of RY Tau, as a bright X-ray source. The observations reveal this object to be a fairly massive (about 2 solar masses) pre-main-sequence star associated with the Taurus-Auriga star formation complex. It exhibits few of the characteristics of the classical T Tauri stars and is a good example of a naked T Tauri star. The star is a mid-G subgiant, of about three solar radii and rotates with a period of 1.5 d. The coronal and chromospheric surface fluxes are similar to those of the most active late type stars (excluding T Tauri stars). The X-ray and UV lines most likely arise in different atmospheric structures. Radiative losses are some 1000 times the quiet solar value and compare favorably with those of T Tauri stars. 49 references

  15. The Surface of V410 Tauri

    Science.gov (United States)

    Rice, J. B.; Strassmeier, K. G.; Kopf, M.

    2011-02-01

    We present Doppler images of the weak-lined T Tauri star V410 Tau obtained with two different Doppler-imaging codes. The images are consistent and show a cool extended spot, symmetric about the pole, at a temperature approximately 750 K below the average photospheric value. Smaller cool spots are found fairly uniformly distributed at latitudes below the polar cap with temperatures about 450 K below the average photospheric temperature. Resolution on the stellar surface is limited to about 7° of arc, so structure within these spots is not visible. Also at lower latitudes are hotter features with temperatures up to 1000 K above the photosphere. A trial Doppler image using a TiO molecular feature reproduced the cool polar cap at a temperature about 100 K below the value from the atomic line images. The equatorial features, however, were not properly reproduced since Doppler imaging relies on information in the wings of lines for reconstructing equatorial features, and for V410 Tau these molecular band lines overlap. In 1993, V410 Tau had a large photometric amplitude resulting from the concentration of cool spots on the hemisphere of the star visible at phase 0°, a phenomenon known as preferred longitude. In contrast, the small photometric amplitude observed currently is due to a strong symmetric polar spot and the uniform distribution in longitude of equatorial cool and warm spots. This redistribution of surface features may be the beginning of a slow "flip-flop" for V410 Tau where spot locations alternate between preferred longitudes. Flare events linked to two of the hotter spots in the Doppler image were observed.

  16. Putting atomic diffusion theory of magnetic ApBp stars to the test: evaluation of the predictions of time-dependent diffusion models

    Science.gov (United States)

    Kochukhov, O.; Ryabchikova, T. A.

    2018-02-01

    A series of recent theoretical atomic diffusion studies has address the challenging problem of predicting inhomogeneous vertical and horizontal chemical element distributions in the atmospheres of magnetic ApBp stars. Here we critically assess the most sophisticated of such diffusion models - based on a time-dependent treatment of the atomic diffusion in a magnetized stellar atmosphere - by direct comparison with observations as well by testing the widely used surface mapping tools with the spectral line profiles predicted by this theory. We show that the mean abundances of Fe and Cr are grossly underestimated by the time-dependent theoretical diffusion model, with discrepancies reaching a factor of 1000 for Cr. We also demonstrate that Doppler imaging inversion codes, based either on modelling of individual metal lines or line-averaged profiles simulated according to theoretical three-dimensional abundance distribution, are able to reconstruct correct horizontal chemical spot maps despite ignoring the vertical abundance variation. These numerical experiments justify a direct comparison of the empirical two-dimensional Doppler maps with theoretical diffusion calculations. This comparison is generally unfavourable for the current diffusion theory, as very few chemical elements are observed to form overabundance rings in the horizontal field regions as predicted by the theory and there are numerous examples of element accumulations in the vicinity of radial field zones, which cannot be explained by diffusion calculations.

  17. Ionization ratios and elemental abundances in the atmosphere of 68 Tauri

    Science.gov (United States)

    Aouina, A.; Monier, R.

    2017-12-01

    We have derived the ionization ratios of twelve elements in the atmosphere of the star 68 Tauri (HD 27962) using an ATLAS9 model atmosphere with 72 layers computed for the effective temperature and surface gravity of the star. We then computed a grid of synthetic spectra generated by SYNSPEC49 based on an ATLAS9 model atmosphere in order to model one high resolution spectrum secured by one of us (RM) with the échelle spectrograph SOPHIE at Observatoire de Haute Provence. We could determine the abundances of several elements in their dominant ionization stage, including those defining the Am phenomenon. We thus provide new abundance determinations for 68 Tauri using updated accurate atomic data retrieved from the NIST database which extend previous abundance works.

  18. BP volume reduction equipment

    International Nuclear Information System (INIS)

    Kitamura, Yoshinori; Muroo, Yoji; Hamanaka, Isao

    2003-01-01

    A new type of burnable poison (BP) volume reduction system is currently being developed. Many BP rods, a subcomponent of spent fuel assemblies are discharged from nuclear power reactors. This new system reduces the overall volume of BP rods. The main system consists of BP rod cutting equipment, equipment for the recovery of BP cut pieces, and special transport equipment for the cut rods. The equipment is all operated by hydraulic press cylinders in water to reduce operator exposure to radioactivity. (author)

  19. The Weak-Line T Tauri Star V410 Tau

    Science.gov (United States)

    2003-01-01

    700052 Tashkent, Uzbekistan 7 USRA/USNO Flagstaff Station, PO Box 1149, Flagstaff, AZ 86002-1149, USA 8 Thüringer Landessternwarte, Karl ... Schwarzschild -Observatorium, Sternwarte 5, 07778 Tautenburg, Germany 9 Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138, USA 10

  20. ROTATION PERIODS OF OPEN-CLUSTER STARS .3.

    NARCIS (Netherlands)

    PROSSER, CF; SHETRONE, MD; DASGUPTA, A; BACKMAN, DE; LAAKSONEN, BD; BAKER, SW; MARSCHALL, LA; WHITNEY, BA; KUIJKEN, K; STAUFFER, [No Value

    We present the results from a photometric monitoring program of 15 open cluster stars and one weak-lined T Tauri star during late 1993/early 1994. Several slow rotators which are members of the Alpha Persei, Pleiades, and Hyades open clusters have been monitored and period estimates derived. Using

  1. Turbulent mixing layers in supersonic protostellar outflows, with application to DG Tauri

    Science.gov (United States)

    White, M. C.; Bicknell, G. V.; Sutherland, R. S.; Salmeron, R.; McGregor, P. J.

    2016-01-01

    Turbulent entrainment processes may play an important role in the outflows from young stellar objects at all stages of their evolution. In particular, lateral entrainment of ambient material by high-velocity, well-collimated protostellar jets may be the cause of the multiple emission-line velocity components observed in the microjet-scale outflows driven by classical T Tauri stars. Intermediate-velocity outflow components may be emitted by a turbulent, shock-excited mixing layer along the boundaries of the jet. We present a formalism for describing such a mixing layer based on Reynolds decomposition of quantities measuring fundamental properties of the gas. In this model, the molecular wind from large disc radii provides a continual supply of material for entrainment. We calculate the total stress profile in the mixing layer, which allows us to estimate the dissipation of turbulent energy, and hence the luminosity of the layer. We utilize MAPPINGS IV shock models to determine the fraction of total emission that occurs in [Fe II] 1.644 μm line emission in order to facilitate comparison to previous observations of the young stellar object DG Tauri. Our model accurately estimates the luminosity and changes in mass outflow rate of the intermediate-velocity component of the DG Tau approaching outflow. Therefore, we propose that this component represents a turbulent mixing layer surrounding the well-collimated jet in this object. Finally, we compare and contrast our model to previous work in the field.

  2. Photometric light curves for ten rapidly rotating stars in Alpha Persei, the Pleiades, and the field

    Science.gov (United States)

    Prosser, Charles F.; Schild, Rudolph E.; Stauffer, John R.; Jones, Burton F.

    1993-01-01

    We present the results from a photometric monitoring program of ten rapidly rotating stars observed during 1991 using the FLWO 48-in. telescope. Brightness variations for an additional six cluster stars observed with the Lick 40-in. telescope are also given. The periods and light curves for seven Alpha Persei members, two Pleiades members, and one naked T Tauri field star are reported.

  3. CURVED WALLS: GRAIN GROWTH, SETTLING, AND COMPOSITION PATTERNS IN T TAURI DISK DUST SUBLIMATION FRONTS

    Energy Technology Data Exchange (ETDEWEB)

    McClure, M. K.; Calvet, N.; Hartmann, L.; Ingleby, L. [Department of Astronomy, The University of Michigan, 500 Church Street, 830 Dennison Building., Ann Arbor, MI 48109 (United States); D' Alessio, P. [Centro de Radioastronomía y Astrofísica, Universidad Nacional Autónoma de México, 58089 Morelia, Michoacán (Mexico); Espaillat, C. [Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Sargent, B. [Center for Imaging Science and Laboratory for Multiwavelength Astrophysics, Rochester Institute of Technology, 54 Lomb Memorial Drive, Rochester, NY 14623 (United States); Watson, D. M. [Department of Physics and Astronomy, University of Rochester, Rochester, NY 14627 (United States); Hernández, J., E-mail: melisma@umich.edu, E-mail: ncalvet@umich.edu, E-mail: lhartm@umich.edu, E-mail: lingleby@umich.edu, E-mail: p.dalessio@astrosmo.unam.mx, E-mail: cespaillat@cfa.harvard.edu, E-mail: baspci@rit.edu, E-mail: dmw@pas.rochester.edu, E-mail: hernandj@cida.ve [Centro de Investigaciones de Astronomía (CIDA), Mérida 5101-A (Venezuela, Bolivarian Republic of)

    2013-10-01

    The dust sublimation walls of disks around T Tauri stars represent a directly observable cross-section through the disk atmosphere and midplane. Their emission properties can probe the grain size distribution and composition of the innermost regions of the disk, where terrestrial planets form. Here we calculate the inner dust sublimation wall properties for four classical T Tauri stars with a narrow range of spectral types and inclination angles and a wide range of mass accretion rates to determine the extent to which the walls are radially curved. Best fits to the near- and mid-IR excesses are found for curved, two-layer walls in which the lower layer contains larger, hotter, amorphous pyroxene grains with Mg/(Mg+Fe) = 0.6 and the upper layer contains submicron, cooler, mixed amorphous olivine and forsterite grains. As the mass accretion rates decrease from 10{sup –8} to 10{sup –10} M{sub ☉} yr{sup –1}, the maximum grain size in the lower layer decreases from ∼3 to 0.5 μm. We attribute this to a decrease in fragmentation and turbulent support for micron-sized grains with decreasing viscous heating. The atmosphere of these disks is depleted of dust with dust-gas mass ratios 1 × 10{sup –4} of the interstellar medium (ISM) value, while the midplane is enhanced to eight times the ISM value. For all accretion rates, the wall contributes at least half of the flux in the optically thin 10 μm silicate feature. Finally, we find evidence for an iron gradient in the disk, suggestive of that found in our solar system.

  4. CURVED WALLS: GRAIN GROWTH, SETTLING, AND COMPOSITION PATTERNS IN T TAURI DISK DUST SUBLIMATION FRONTS

    International Nuclear Information System (INIS)

    McClure, M. K.; Calvet, N.; Hartmann, L.; Ingleby, L.; D'Alessio, P.; Espaillat, C.; Sargent, B.; Watson, D. M.; Hernández, J.

    2013-01-01

    The dust sublimation walls of disks around T Tauri stars represent a directly observable cross-section through the disk atmosphere and midplane. Their emission properties can probe the grain size distribution and composition of the innermost regions of the disk, where terrestrial planets form. Here we calculate the inner dust sublimation wall properties for four classical T Tauri stars with a narrow range of spectral types and inclination angles and a wide range of mass accretion rates to determine the extent to which the walls are radially curved. Best fits to the near- and mid-IR excesses are found for curved, two-layer walls in which the lower layer contains larger, hotter, amorphous pyroxene grains with Mg/(Mg+Fe) = 0.6 and the upper layer contains submicron, cooler, mixed amorphous olivine and forsterite grains. As the mass accretion rates decrease from 10 –8 to 10 –10 M ☉ yr –1 , the maximum grain size in the lower layer decreases from ∼3 to 0.5 μm. We attribute this to a decrease in fragmentation and turbulent support for micron-sized grains with decreasing viscous heating. The atmosphere of these disks is depleted of dust with dust-gas mass ratios 1 × 10 –4 of the interstellar medium (ISM) value, while the midplane is enhanced to eight times the ISM value. For all accretion rates, the wall contributes at least half of the flux in the optically thin 10 μm silicate feature. Finally, we find evidence for an iron gradient in the disk, suggestive of that found in our solar system

  5. BP's emissions trading system

    International Nuclear Information System (INIS)

    Victor, David G.; House, Joshua C.

    2006-01-01

    Between 1998 and 2001, BP reduced its emissions of greenhouse gases by more than 10%. BP's success in cutting emissions is often equated with its use of an apparently market-based emissions trading program. However no independent study has ever examined the rules and operation of BP's system and the incentives acting on managers to reduce emissions. We use interviews with key managers and with traders in several critical business units to explore the bound of BP's success with emissions trading. No money actually changed hands when permits were traded, and the main effect of the program was to create awareness of money-saving emission controls rather than strong price incentives. We show that the trading system did not operate like a 'textbook' cap and trade scheme. Rather, the BP system operated much like a 'safety valve' trading system, where managers let the market function until the cost of doing so surpassed what the company was willing to tolerate

  6. FDG goes BP

    International Nuclear Information System (INIS)

    Chan, J.G.

    2000-01-01

    Full text: A monograph for Fluorodeoxyglucose F-18 Injection (FDG) was first released in Supplement 1 of the United States Pharmacopoeia 1990 (USP 90) on 1 November 1989 to become effective on 1 January 1990. As this was the only monograph available until recently it served as the applicable standard to be followed. The Therapeutic Goods Act states that the British Pharmacopoeia (BP) is the precedent to be followed in Australia and implies that if a monograph exists for a finished product then this needs to be applied to achieve a certain standard of quality. If the monograph does not exist in the BP then other pharmacopoeia monographs can be sourced starting with the European Pharmacopoeia (Ph Eur) then the USP. A monograph for FDG first appeared in the Ph Eur in a 1999 Supplement (effective 1 January 1999 and now included in the Ph Eur 2000) and then in the BP 1999 (effective 1 December 1999). The Commonwealth Government Gazette (Notice 48, 1/12/99) published that the BP 99 was adopted on the 1st December 1999. Since then manufacturers have been required to comply with the monograph for FDG in the BP 99. This presentation looks at the content of the BP 99 monograph and compares it with that in the USP. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

  7. Water Depletion in the Disk Atmosphere of Herbig AeBe Stars

    NARCIS (Netherlands)

    Fedele, D.; Pascucci, I.; Brittain, S.; Kamp, I.; Woitke, P.; Williams, J. P.; Dent, W. R. F.; Thi, W. -F.

    2011-01-01

    We present high-resolution (R similar to 100,000) L-band spectroscopy of 11 Herbig AeBe stars with circumstellar disks. The observations were obtained with the VLT/CRIRES to detect hot water and hydroxyl radical emission lines previously detected in disks around T Tauri stars. OH emission lines are

  8. A Multi-Fiber Spectroscopic Search for Low-mass Young Stars in Orion OB1

    Science.gov (United States)

    Loerincs, Jacqueline; Briceno, Cesar; Calvet, Nuria; Mateo, Mario L.; Hernandez, Jesus

    2017-01-01

    We present here results of a low resolution spectroscopic followup of candidate low-mass pre-main sequence stars in the Orion OB1 association. Our targets were selected from the CIDA Variability Survey of Orion (CVSO), and we used the Michigan/Magellan Fiber Spectrograph (M2FS) on the Magellan Clay 6.5m telescope to obtain spectra of 500 candidate T Tauri stars distributed in seven 0.5 deg diameter fields, adding to a total area of ~5.5 deg2. We identify young stars by looking at the distinctive Hα 6563 Å emission and Lithium Li I 6707 Å absorption features characteristic of young low mass pre-main sequence stars. Furthermore, by measuring the strength of their Hα emission lines, confirmed T Tauri stars can be classified as either Classical T Tauris (CTTS) or Weak-line T Tauris (WTTS), which give indication of whether the star is actively accreting material from a gas and dust disk surrounding the star, which may be the precursor of a planetary system. We confirm a total of 90 T Tauri stars, of which 50% are newly identified young members of Orion; out of the 49 new detections,15 are accreting CTTS, and of these all but one are found in the OB1b sub-region. This result is in line with our previous findings that this region is much younger than the more extended Orion OB1a sub-association. The M2FS results add to our growing census of young stars in Orion, that is allowing us to characterize in a systematic and consistent way the distribution of stellar ages across the entire complex, in order to building a complete picture of star formation in this, one of nearest most active sites of star birth.

  9. Absolute dimensions of eclipsing binaries XXVII. V1130 tauri

    DEFF Research Database (Denmark)

    Clausen, Jens Viggo; Olsen, E, H.; Helt, B. E.

    2010-01-01

    stars: evolution / stars: fundamental parameters / stars: individual: V1130¿Tau / binaries: eclipsing / techniques: photometric / techniques: radial velocities Udgivelsesdato: 17 Feb.......stars: evolution / stars: fundamental parameters / stars: individual: V1130¿Tau / binaries: eclipsing / techniques: photometric / techniques: radial velocities Udgivelsesdato: 17 Feb....

  10. ACCRETION AND MAGNETIC RECONNECTION IN THE CLASSICAL T TAURI BINARY DQ TAU

    International Nuclear Information System (INIS)

    Tofflemire, Benjamin M.; Mathieu, Robert D.; Ardila, David R.; Akeson, Rachel L.; Ciardi, David R.; Johns-Krull, Christopher; Herczeg, Gregory J.; Quijano-Vodniza, Alberto

    2017-01-01

    The theory of binary star formation predicts that close binaries ( a < 100 au) will experience periodic pulsed accretion events as streams of material form at the inner edge of a circumbinary disk (CBD), cross a dynamically cleared gap, and feed circumstellar disks or accrete directly onto the stars. The archetype for the pulsed accretion theory is the eccentric, short-period, classical T Tauri binary DQ Tau. Low-cadence (∼daily) broadband photometry has shown brightening events near most periastron passages, just as numerical simulations would predict for an eccentric binary. Magnetic reconnection events (flares) during the collision of stellar magnetospheres near periastron could, however, produce the same periodic, broadband behavior when observed at a one-day cadence. To reveal the dominant physical mechanism seen in DQ Tau’s low-cadence observations, we have obtained continuous, moderate-cadence, multiband photometry over 10 orbital periods, supplemented with 27 nights of minute-cadence photometry centered on four separate periastron passages. While both accretion and stellar flares are present, the dominant timescale and morphology of brightening events are characteristic of accretion. On average, the mass accretion rate increases by a factor of five near periastron, in good agreement with recent models. Large variability is observed in the morphology and amplitude of accretion events from orbit to orbit. We argue that this is due to the absence of stable circumstellar disks around each star, compounded by inhomogeneities at the inner edge of the CBD and within the accretion streams themselves. Quasiperiodic apastron accretion events are also observed, which are not predicted by binary accretion theory.

  11. ACCRETION AND MAGNETIC RECONNECTION IN THE CLASSICAL T TAURI BINARY DQ TAU

    Energy Technology Data Exchange (ETDEWEB)

    Tofflemire, Benjamin M.; Mathieu, Robert D. [Department of Astronomy, University of Wisconsin–Madison, 475 North Charter Street, Madison, WI 53706 (United States); Ardila, David R. [The Aerospace Corporation, M2-266, El Segundo, CA 90245 (United States); Akeson, Rachel L.; Ciardi, David R. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States); Johns-Krull, Christopher [Department of Physics and Astronomy, Rice University, Houston, TX 77005 (United States); Herczeg, Gregory J. [The Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); Quijano-Vodniza, Alberto [University of Nariño Observatory, Pasto, Nariño (Colombia)

    2017-01-20

    The theory of binary star formation predicts that close binaries ( a < 100 au) will experience periodic pulsed accretion events as streams of material form at the inner edge of a circumbinary disk (CBD), cross a dynamically cleared gap, and feed circumstellar disks or accrete directly onto the stars. The archetype for the pulsed accretion theory is the eccentric, short-period, classical T Tauri binary DQ Tau. Low-cadence (∼daily) broadband photometry has shown brightening events near most periastron passages, just as numerical simulations would predict for an eccentric binary. Magnetic reconnection events (flares) during the collision of stellar magnetospheres near periastron could, however, produce the same periodic, broadband behavior when observed at a one-day cadence. To reveal the dominant physical mechanism seen in DQ Tau’s low-cadence observations, we have obtained continuous, moderate-cadence, multiband photometry over 10 orbital periods, supplemented with 27 nights of minute-cadence photometry centered on four separate periastron passages. While both accretion and stellar flares are present, the dominant timescale and morphology of brightening events are characteristic of accretion. On average, the mass accretion rate increases by a factor of five near periastron, in good agreement with recent models. Large variability is observed in the morphology and amplitude of accretion events from orbit to orbit. We argue that this is due to the absence of stable circumstellar disks around each star, compounded by inhomogeneities at the inner edge of the CBD and within the accretion streams themselves. Quasiperiodic apastron accretion events are also observed, which are not predicted by binary accretion theory.

  12. The impact of Einstein observations on our understanding of low mass star formation

    International Nuclear Information System (INIS)

    Walter, F.M.

    1990-01-01

    Prior to 1980, the world of pre-main sequence stars, if not well understood, was at least well defined. The Herbig and Rao (1972) catalog listed 69 pre-main sequence stars in Tau-Aur, with the vast majority clearly being T Tauri stars. The characteristics of the classical T Tauri stars include strong Hα emission, with W λ (Hα)>5-10A; forbidden line emission; continuum ultraviolet and IR excesses; veiling of the absorption line spectrum; significant stellar variability; Li I λ6707A absorption; and association with dark clouds and/or emission nebulosities. Star forming regions were observed extensively with the Einstein Observatory, and showed the abundance of stellar X-ray sources in the Orion Nebula. About 1/3 of the known T Tauri stars were detected as X-ray sources, yet the vast majority of the X-ray sources detected were coincident with anonymous stars not suspected to be pre-main sequence stars. In the grand tradition of X-ray astronomy, X-ray astronomers trooped to telescopes to identify the optical counterparts. It was shown that 5 of the counterparts were K7-M0 stars, above the main sequence, with strong Li I absorption and that these stars were kinematic members of the Tau-Aur star formation complex. Since then, additional members of this class of naked T Tauri Stars (NTTS) have been studied, and charts provided for X-ray selected pre-main sequence star candidates in the general vicinity of Tau-Aur. Thirty five X-ray sources have been selected and optically confirmed as NTTS in Tau-Aur

  13. Observations of Hα-emission stars in the young cluster NGC 2264

    International Nuclear Information System (INIS)

    Rydgren, A.E.

    1979-01-01

    UBVRI photometry is given for a sample of 25 late-type Hα-emission stars in the young cluster NGC 2264. The stars are in the magnitude range 12< or =V<16. Some but not all appear to be T Tauri stars. The color--color diagrams support the view that the deviations from normal photospheric colors (due to ''spectral veiling'' and line emission) decrease with increasing wavelength between the U and I filters. In the (V, V-R) diagram, the Hα-emission stars lie in a well-defined pre-main-sequence band. Within this sample, there is a trend toward stronger line emission and spectral veiling with later spectral type. All of the likely legitimate T Tauri stars have inferred spectral types later than about K3. The question of cluster membership for stars in the cluster field with very small proper motions is considered

  14. The distribution of silicon on BP Boo

    International Nuclear Information System (INIS)

    Hatzes, A.P.

    1990-01-01

    A version of the Doppler imaging technique which incorporates the principles of maximum entropy reconstruction is used to derive the silicon distribution on the Ap star BP Boo (HR 5857). The method used made it possible to detect an error in the published photometric period and a new value of 1.29557 d was determined. The silicon distribution consists of two depleted spots of unequal area separated by about 180deg in longitude. These spots may coincide with the location of the magnetic poles of the star as in the case of γ 2 Ari. Near the larger of the depleted silicon spots is a spot of enhanced abundance. The unequal area of the depleted spots as well as the close proximity of the enhanced spot to one of the depleted regions suggests the presence of non-axisymmetric magnetic field lines. (author)

  15. Analysis of 45-years of Eclipse Timings of the Hyades (K2 V+ DA) Eclipsing Binary V471 Tauri

    Science.gov (United States)

    Marchioni, Lucas; Guinan, Edward; Engle, Scott

    2018-01-01

    V471 Tau is an important detached 0.521-day eclipsing binary composed of a K2 V and a hot DA white dwarf star. This system resides in the Hyades star cluster located approximately 153 Ly from us. V471 Tau is considered to be the end-product of common-envelope binary star evolution and is currently a pre-CV system. V471 Tau serves as a valuable astrophysical laboratory for studying stellar evolution, white dwarfs, stellar magnetic dynamos, and possible detection of low mass companions using the Light Travel Time (LTT) Effects. Since its discovery as an eclipsing binary in 1970, photometry has been carried out and many eclipse timings have been determined. We have performed an analysis of the available photometric data available on V471 Tauri. The binary system has been the subject of analyses regarding the orbital period. From this analysis several have postulated the existence of a third body in the form of a brown dwarf that is causing periodic variations in the system’s apparent period. In this study we combine ground based data with photometry secured recently from the Kepler K2 mission. After detrending and phasing the available data, we are able to compare the changing period of the eclipsing binary system against predictions on the existence of this third body. The results of the analysis will be presented. This research is sponsored by grants from NASA and NSF for which we are very grateful.

  16. Infrared Astronomy and Star Formation

    International Nuclear Information System (INIS)

    Evans, N.J.

    1985-01-01

    Infrared astronomy is a natural tool to use in studying star formation because infrared light penetrates the surrounding dust and because protostars are expected to emit infrared light. Infrared mapping and photometry have revealed many compact sources, often embedded in more extensive warm dust associated with a molecular cloud core. More detailed study of these objects is now beginning, and traditional interpretations are being questioned. Some compact sources are now thought to be density enhancements which are not self-luminous. Infrared excesses around young stars may not always be caused by circumstellar dust; speckle measurements have shown that at least some of the excess toward T Tauri is caused by an infrared companion. Spectroscopic studies of the dense, star-forming cores and of the compact objects themselves have uncovered a wealth of new phenomena, including the widespread occurence of energetic outflows. New discoveries with IRAS and with other planned infrared telescopes will continue to advance this field. (author)

  17. HDE 245059: A WEAK-LINED T TAURI BINARY REVEALED BY CHANDRA AND KECK

    International Nuclear Information System (INIS)

    Baldovin-Saavedra, C.; Audard, M.; Duchene, G.; Guedel, M.; Skinner, S.L.; Paerels, F. B. S.; Ghez, A.; McCabe, C.

    2009-01-01

    We present the Chandra High Energy Transmission Grating Spectrometer and Keck observations of HDE 245059, a young weak-lined T Tauri star (WTTS), member of the pre-main-sequence group in the λ Orionis Cluster. Our high spatial resolution, near-infrared observations with Keck reveal that HDE 245059 is in fact a binary separated by 0.''87, probably composed of two WTTS based on their color indices. Based on this new information we have obtained an estimate of the masses of the binary components; ∼3 M sun and ∼2.5 M sun for the north and south components, respectively. We have also estimated the age of the system to be ∼2-3 Myr. We detect both components of the binary in the zeroth-order Chandra image and in the grating spectra. The light curves show X-ray variability of both sources and in particular a flaring event in the weaker southern component. The spectra of both stars show similar features: a combination of cool and hot plasma as demonstrated by several iron lines from Fe XVII to Fe XXV and a strong bremsstrahlung continuum at short wavelengths. We have fitted the combined grating and zeroth-order spectrum (considering the contribution of both stars) in XSPEC. The coronal abundances and emission measure distribution for the binary have been obtained using different methods, including a continuous emission measure distribution and a multi-temperature approximation. In all cases we have found that the emission is dominated by plasma between ∼8 and ∼15 MK a soft component at ∼4 MK and a hard component at ∼50 MK are also detected. The value of the hydrogen column density was low, N H ∼ 8 x 10 19 cm -2 , likely due to the clearing of the inner region of the λ Orionis cloud, where HDE 245059 is located. The abundance pattern shows an inverse first ionization potential effect for all elements from O to Fe, the only exception being Ca. To obtain the properties of the binary components, a 3-T model was fitted to the individual zeroth-order spectra

  18. Rotation and kinematics of the premain-sequence stars in Taurus-Auriga with Ca II emission

    Science.gov (United States)

    Hartmann, Lee W.; Soderblom, David R.; Stauffer, John R.

    1987-01-01

    Radial velocities and v sin i values for the stars in the Taurus-Auriga region that were found to have strong Ca II H and K emission by Herbig, Vrba, and Rydgren 'HVR', (1986) are reported. Most of the velocities are determined to better than 2 km/s precision. The kinematic properties of the Ca II emission stars with strong Li are found to be indistinguishable from conventional T Tauris in Taurus-Auriga, contrary to HVR. These Li-rich stars also rotate like T Tauris. Most of the stars that lack Li are probable or possible members of the Hyades, in the foreground, and are among the brightest and most active stars in that cluster for their spectral types. It is suggested following Jones and Herbig (1979), that the apparent absence of low-mass stars older than 10 Myr in Taurus-Auriga is real, and is due to the finite lifetime of the cloud.

  19. Rotation and kinematics of the premain-sequence stars in Taurus-Auriga with CA II emission

    Science.gov (United States)

    Hartmann, Lee W.; Soderblom, David R.; Stauffer, John R.

    1987-04-01

    The authors report radial velocities and v sin i values for the stars in the Taurus-Auriga region that were found to have strong Ca II H and K emission by Herbig, Vrba, and Rydgren (HVR). Most of the velocities are determined to better than 2 km s-1 precision. The authors find the kinematic properties of the Ca II emission stars with strong Li to be indistinguishable from conventional T Tauris in Taurus-Auriga, contrary to HVR. These Li-rich stars also rotate like T Tauris. Most of the stars that lack Li are probable or possible members of the Hyades, in the foreground, and are among the brightest and most active stars in that cluster for their spectral types. The authors suggest, following Jones and Herbig, that the apparent absence of low-mass stars older than 10 Myr in Taurus-Auriga is real, and is due to the finite lifetime of the cloud.

  20. Herbig-Haro objects and T Tauri nebulae

    International Nuclear Information System (INIS)

    Boehm, K.H.

    1975-01-01

    The empirical information about Herbig-Haro objects and T Tauri nebulae is summarized. We emphasize especially the importance of the spectroscopic and spectrophotometric data. Relative and (preliminary) absolute emission line fluxes are presented and discussed. We consider the radial velocity data and the detection of a faint blue continuum in Herbig-Haro objects as important from a theoretical point of view. The direct interpretation of the emission line spectra is simple and leads to values of the electron temperature, electron density, density inhomogeneities, filling factors, degree of ionization and chemical abundances. The relevant procedures are discussed in some detail. The possible role of the Herbig-Haro objects in the early phases of stellar evolution is discussed. (orig./BJ) [de

  1. PLANETARY SYSTEM FORMATION IN THE PROTOPLANETARY DISK AROUND HL TAURI

    Energy Technology Data Exchange (ETDEWEB)

    Akiyama, Eiji; Hasegawa, Yasuhiro; Hayashi, Masahiko; Iguchi, Satoru, E-mail: eiji.akiyama@nao.ac.jp, E-mail: yasuhiro.hasegawa@nao.ac.jp [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan)

    2016-02-20

    We reprocess the Atacama Large Millimeter/Submillimeter Array (ALMA) long-baseline science verification data taken toward HL Tauri. Assuming the observed gaps are opened up by currently forming, unseen bodies, we estimate the mass of such hypothetical bodies based on the following two approaches: the Hill radius analysis and a more elaborate approach developed from the angular momentum transfer analysis in gas disks. For the former, the measured gap widths are used for estimating the mass of the bodies, while for the latter, the measured gap depths are utilized. We show that their masses are comparable to or less than the mass of Jovian planets. By evaluating Toomre’s gravitational instability (GI) condition and cooling effect, we find that the GI might be a mechanism to form the bodies in the outer region of the disk. As the disk might be gravitationally unstable only in the outer region of the disk, inward planetary migration would be needed to construct the current architecture of the observed disk. We estimate the gap-opening mass and show that type II migration might be able to play such a role. Combining GIs with inward migration, we conjecture that all of the observed gaps may be a consequence of bodies that might have originally formed at the outer part of the disk, and have subsequently migrated to the current locations. While ALMA’s unprecedented high spatial resolution observations can revolutionize our picture of planet formation, more dedicated observational and theoretical studies are needed to fully understand the HL Tauri images.

  2. Pulsed Accretion in the T Tauri Binary TWA 3A

    Energy Technology Data Exchange (ETDEWEB)

    Tofflemire, Benjamin M.; Mathieu, Robert D. [Department of Astronomy, University of Wisconsin–Madison, 475 North Charter Street, Madison, WI 53706 (United States); Herczeg, Gregory J. [The Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); Akeson, Rachel L.; Ciardi, David R. [NASA Exoplanet Science Institute, IPAC/Caltech, Pasadena, CA 91125 (United States)

    2017-06-20

    TWA 3A is the most recent addition to a small group of young binary systems that both actively accrete from a circumbinary disk and have spectroscopic orbital solutions. As such, it provides a unique opportunity to test binary accretion theory in a well-constrained setting. To examine TWA 3A’s time-variable accretion behavior, we have conducted a two-year, optical photometric monitoring campaign, obtaining dense orbital phase coverage (∼20 observations per orbit) for ∼15 orbital periods. From U -band measurements we derive the time-dependent binary mass accretion rate, finding bursts of accretion near each periastron passage. On average, these enhanced accretion events evolve over orbital phases 0.85 to 1.05, reaching their peak at periastron. The specific accretion rate increases above the quiescent value by a factor of ∼4 on average but the peak can be as high as an order of magnitude in a given orbit. The phase dependence and amplitude of TWA 3A accretion is in good agreement with numerical simulations of binary accretion with similar orbital parameters. In these simulations, periastron accretion bursts are fueled by periodic streams of material from the circumbinary disk that are driven by the binary orbit. We find that TWA 3A’s average accretion behavior is remarkably similar to DQ Tau, another T Tauri binary with similar orbital parameters, but with significantly less variability from orbit to orbit. This is only the second clear case of orbital-phase-dependent accretion in a T Tauri binary.

  3. PLANETARY SYSTEM FORMATION IN THE PROTOPLANETARY DISK AROUND HL TAURI

    International Nuclear Information System (INIS)

    Akiyama, Eiji; Hasegawa, Yasuhiro; Hayashi, Masahiko; Iguchi, Satoru

    2016-01-01

    We reprocess the Atacama Large Millimeter/Submillimeter Array (ALMA) long-baseline science verification data taken toward HL Tauri. Assuming the observed gaps are opened up by currently forming, unseen bodies, we estimate the mass of such hypothetical bodies based on the following two approaches: the Hill radius analysis and a more elaborate approach developed from the angular momentum transfer analysis in gas disks. For the former, the measured gap widths are used for estimating the mass of the bodies, while for the latter, the measured gap depths are utilized. We show that their masses are comparable to or less than the mass of Jovian planets. By evaluating Toomre’s gravitational instability (GI) condition and cooling effect, we find that the GI might be a mechanism to form the bodies in the outer region of the disk. As the disk might be gravitationally unstable only in the outer region of the disk, inward planetary migration would be needed to construct the current architecture of the observed disk. We estimate the gap-opening mass and show that type II migration might be able to play such a role. Combining GIs with inward migration, we conjecture that all of the observed gaps may be a consequence of bodies that might have originally formed at the outer part of the disk, and have subsequently migrated to the current locations. While ALMA’s unprecedented high spatial resolution observations can revolutionize our picture of planet formation, more dedicated observational and theoretical studies are needed to fully understand the HL Tauri images

  4. A magnetic study of spotted UV Ceti flare stars and related late-type dwarfs

    Science.gov (United States)

    Vogt, S. S.

    1980-09-01

    A multichannel photoelectric Zeeman analyzer has been used to investigate the magnetic nature of the spotted UV Ceti flare stars. Magnetic observations were obtained on a sample of 19 program objects, of which 5 were currently spotted dKe-dMe stars, 7 were normal dK-dM stars, 7 were UV Ceti flare stars, and 1 was a possible post-T Tauri star. Contrary to most previously published observations and theoretical expectations, no magnetic fields were detected on any of these objects from either the absorption lines or the H-alpha emission line down to an observational uncertainty level of 100-160 gauss (standard deviation).

  5. Magnetic fields in beta Cep, SPB, and Be stars

    OpenAIRE

    Schoeller, M.; Hubrig, S.; Briquet, M.; Ilyin, I.

    2013-01-01

    Recent observational and theoretical results emphasize the potential significance of magnetic fields for structure, evolution, and environment of massive stars. Depending on their spectral and photometric behavior, the upper main-sequence B-type stars are assigned to different groups, such as beta Cep stars and slowly pulsating B (SPB) stars, He-rich and He-deficient Bp stars, Be stars, BpSi stars, HgMn stars, or normal B-type stars. All these groups are characterized by different magnetic fi...

  6. Inter-Division IV/V WG on Active OB Stars

    NARCIS (Netherlands)

    Owocki, S.; Aerts, C.; Fabregat, J.; Gies, D.; Henrichs, H.F.; McDavid, D.; Porter, J.; Rivinius, T.; Peters, G.; Stefl, S.

    2007-01-01

    Our group studies active early-type (OB) stars, with historical focus on classical Be stars, but extending in recent years to include Slowly Pulsating B-stars (SPB), Beta-Cephei stars, the strongly magnetic Bp stars, Luminous Blue Vairiable (LBV) stars, and B[e] stars. An overall goal is to

  7. Mid-infrared interferometric variability of DG Tauri: Implications for the inner-disk structure

    Science.gov (United States)

    Varga, J.; Gabányi, K. É.; Ábrahám, P.; Chen, L.; Kóspál, Á.; Menu, J.; Ratzka, Th.; van Boekel, R.; Dullemond, C. P.; Henning, Th.; Jaffe, W.; Juhász, A.; Moór, A.; Mosoni, L.; Sipos, N.

    2017-08-01

    Context. DG Tau is a low-mass pre-main sequence star, whose strongly accreting protoplanetary disk exhibits a so-far enigmatic behavior: its mid-infrared thermal emission is strongly time-variable, even turning the 10 μm silicate feature from emission to absorption temporarily. Aims: We look for the reason for the spectral variability at high spatial resolution and at multiple epochs. Methods: Infrared interferometry can spatially resolve the thermal emission of the circumstellar disk, also giving information about dust processing. We study the temporal variability of the mid-infrared interferometric signal, observed with the VLTI/MIDI instrument at six epochs between 2011 and 2014. We fit a geometric disk model to the observed interferometric signal to obtain spatial information about the disk. We also model the mid-infrared spectra by template fitting to characterize the profile and time dependence of the silicate emission. We use physically motivated radiative transfer modeling to interpret the mid-infrared interferometric spectra. Results: The inner disk (r 1-3 au) spectra show a crystalline silicate feature in emission, similar to the spectra of comet Hale-Bopp. The striking difference between the inner and outer disk spectral feature is highly unusual among T Tauri stars. The mid-infrared variability is dominated by the outer disk. The strength of the silicate feature changed by more than a factor of two. Between 2011 and 2014 the half-light radius of the mid-infrared-emitting region decreased from 1.15 to 0.7 au. Conclusions: For the origin of the absorption we discuss four possible explanations: a cold obscuring envelope, an accretion heated inner disk, a temperature inversion on the disk surface and a misaligned inner geometry. The silicate emission in the outer disk can be explained by dusty material high above the disk plane, whose mass can change with time, possibly due to turbulence in the disk. Based on observations made with the ESO Very Large

  8. The reduced kinome of Ostreococcus tauri: core eukaryotic signalling components in a tractable model species.

    Science.gov (United States)

    Hindle, Matthew M; Martin, Sarah F; Noordally, Zeenat B; van Ooijen, Gerben; Barrios-Llerena, Martin E; Simpson, T Ian; Le Bihan, Thierry; Millar, Andrew J

    2014-08-02

    The current knowledge of eukaryote signalling originates from phenotypically diverse organisms. There is a pressing need to identify conserved signalling components among eukaryotes, which will lead to the transfer of knowledge across kingdoms. Two useful properties of a eukaryote model for signalling are (1) reduced signalling complexity, and (2) conservation of signalling components. The alga Ostreococcus tauri is described as the smallest free-living eukaryote. With less than 8,000 genes, it represents a highly constrained genomic palette. Our survey revealed 133 protein kinases and 34 protein phosphatases (1.7% and 0.4% of the proteome). We conducted phosphoproteomic experiments and constructed domain structures and phylogenies for the catalytic protein-kinases. For each of the major kinases families we review the completeness and divergence of O. tauri representatives in comparison to the well-studied kinomes of the laboratory models Arabidopsis thaliana and Saccharomyces cerevisiae, and of Homo sapiens. Many kinase clades in O. tauri were reduced to a single member, in preference to the loss of family diversity, whereas TKL and ABC1 clades were expanded. We also identified kinases that have been lost in A. thaliana but retained in O. tauri. For three, contrasting eukaryotic pathways - TOR, MAPK, and the circadian clock - we established the subset of conserved components and demonstrate conserved sites of substrate phosphorylation and kinase motifs. We conclude that O. tauri satisfies our two central requirements. Several of its kinases are more closely related to H. sapiens orthologs than S. cerevisiae is to H. sapiens. The greatly reduced kinome of O. tauri is therefore a suitable model for signalling in free-living eukaryotes.

  9. Cold CO Gas in the Envelopes of FU Orionis-type Young Eruptive Stars

    Energy Technology Data Exchange (ETDEWEB)

    Kóspál, Á.; Ábrahám, P.; Moór, A. [Konkoly Observatory, Research Centre for Astronomy and Earth Sciences, Hungarian Academy of Sciences, Konkoly-Thege Miklós út 15-17, 1121 Budapest (Hungary); Csengeri, T.; Güsten, R. [Max-Planck-Institut für Radioastronomie, Auf dem Hügel 69, D-53121 Bonn (Germany); Henning, Th. [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany)

    2017-02-20

    FU Orionis-type objects (FUors) are young stellar objects experiencing large optical outbursts due to highly enhanced accretion from the circumstellar disk onto the star. FUors are often surrounded by massive envelopes, which play a significant role in the outburst mechanism. Conversely, the subsequent eruptions might gradually clear up the obscuring envelope material and drive the protostar on its way to become a disk-only T Tauri star. Here we present an APEX {sup 12}CO and {sup 13}CO survey of eight southern and equatorial FUors. We measure the mass of the gaseous material surrounding our targets, locate the source of the CO emission, and derive physical parameters for the envelopes and outflows, where detected. Our results support the evolutionary scenario where FUors represent a transition phase from envelope-surrounded protostars to classical T Tauri stars.

  10. Observational diagnostics of accretion on young stars and brown dwarfs

    Science.gov (United States)

    Stelzer, Beate; Argiroffi, Costanza

    I present a summary of recent observational constraints on the accretion properties of young stars and brown dwarfs with focus on the high-energy emission. In their T Tauri phase young stars assemble a few percent of their mass by accretion from a disk. Various observational signatures of disks around pre-main sequence stars and the ensuing accretion process are found in the IR and optical regime: e.g. excess emission above the stellar photosphere, strong and broad emission lines, optical veiling. At high energies evidence for accretion is less obvious, and the X-ray emission from stars has historically been ascribed to magnetically confined coronal plasmas. While being true for the bulk of the emission, new insight obtained from XMM-Newton and Chandra observations has unveiled contributions from accretion and outflow processes to the X-ray emission from young stars. Their smaller siblings, the brown dwarfs, have been shown to undergo a T Tauri phase on the basis of optical/IR observations of disks and measurements of accretion rates. Most re-cently, first evidence was found for X-rays produced by accretion in a young brown dwarf, complementing the suspected analogy between stars and substellar objects.

  11. CSI 2264: Probing the inner disks of AA Tauri-like systems in NGC 2264

    Science.gov (United States)

    McGinnis, P. T.; Alencar, S. H. P.; Guimarães, M. M.; Sousa, A. P.; Stauffer, J.; Bouvier, J.; Rebull, L.; Fonseca, N. N. J.; Venuti, L.; Hillenbrand, L.; Cody, A. M.; Teixeira, P. S.; Aigrain, S.; Favata, F.; Fűrész, G.; Vrba, F. J.; Flaccomio, E.; Turner, N. J.; Gameiro, J. F.; Dougados, C.; Herbst, W.; Morales-Calderón, M.; Micela, G.

    2015-05-01

    Context. The classical T Tauri star (CTTS) AA Tau has presented photometric variability that was attributed to an inner disk warp, caused by the interaction between the inner disk and an inclined magnetosphere. Previous studies of the young cluster NGC 2264 have shown that similar photometric behavior is common among CTTS. Aims: The goal of this work is to investigate the main causes of the observed photometric variability of CTTS in NGC 2264 that present AA Tau-like light curves, and verify if an inner disk warp could be responsible for their observed variability. Methods: In order to understand the mechanism causing these stars' photometric behavior, we investigate veiling variability in their spectra and u - r color variations and estimate parameters of the inner disk warp using an occultation model proposed for AA Tau. We also compare infrared Spitzer IRAC and optical CoRoT light curves to analyze the dust responsible for the occultations. Results: AA Tau-like variability proved to be transient on a timescale of a few years. We ascribe this variability to stable accretion regimes and aperiodic variability to unstable accretion regimes and show that a transition, and even coexistence, between the two is common. We find evidence of hot spots associated with occultations, indicating that the occulting structures could be located at the base of accretion columns. We find average values of warp maximum height of 0.23 times its radial location, consistent with AA Tau, with variations of on average 11% between rotation cycles. We also show that extinction laws in the inner disk indicate the presence of grains larger than interstellar grains. Conclusions: The inner disk warp scenario is consistent with observations for all but one star with AA Tau-like variability in our sample. AA Tau-like systems are fairly common, comprising 14% of CTTS observed in NGC 2264, though this number increases to 35% among systems of mass 0.7 M⊙ ≲ M ≲ 2.0 M⊙. Assuming random

  12. A catalog of pre-main-sequence emission-line stars with IRAS source associations

    International Nuclear Information System (INIS)

    Weintraub, D.A.

    1990-01-01

    To aid in finding premain-sequence (PMS) emission-line stars that might have dusty circumstellar environments, 361 PMS stars that are associated with 304 separate IRAS sources were identified. These stars include 200 classical T Tauri stars, 25 weak-lined (naked) T Tauri stars, 56 Herbig Ae/Be stars, six FU Orionis stars, and two SU Aurigae stars. All six of the FU Orionis stars surveyed by IRAS were detected. Of the PMS-IRAS Point Source Catalog (PSC) associations, 90 are new and are not noted in the PSC. The other 271 entries include 104 that are correctly identified in the PSC but have not yet appeared in the literature, 56 more that can be found in both the PSC and in the published and unpublished iterature, and 111 that are in the literature but not in the PSC. Spectral slope diagrams constructed from the 12-, 25-, and 60-micron flux densities reveal unique distributions for the different PMS subclasses; these diagrams may help identify the best candidate PMS stars for observations of circumstellar dust. 30 refs

  13. Neutron stars

    International Nuclear Information System (INIS)

    Irvine, J.M.

    1978-01-01

    The subject is covered in chapters entitled: introduction (resume of stellar evolution, gross characteristics of neutron stars); pulsars (pulsar characteristics, pulsars as neutron stars); neutron star temperatures (neutron star cooling, superfluidity and superconductivity in neutron stars); the exterior of neutron stars (the magnetosphere, the neutron star 'atmosphere', pulses); neutron star structure; neutron star equations of state. (U.K.)

  14. Student Measurements of STFA 10AB (Theta Tauri)

    Science.gov (United States)

    Gillette, Sean; Estrada, Chris; Estrada, Reed; Aguilera, Sophia; Chavez, Valerie; Givens, Jalynn; Lindorfer, Sarah; Michels, Kaylie; Mobley, Makenzie; Reder, Gabriel; Renteria, Kayla; Shattles, Jenna; Wilkin, Aiden; Woodbury, Maisy; Rhoades, Breauna; Rhoades, Mark

    2017-04-01

    Eighth grade students at Vanguard Preparatory School measured the double star STFA 10AB using a 22-inch Newtonian Alt/Az telescope and a Celestron Micro Guide eyepiece. Bellatrix was used as the calibration star. The calculated means of multiple observations of STFA 10AB resulted in a separation of 45.18,” a scale constant of 7.88 arcseconds per division, and position angle of 257.9°. These measurements were compared to the most recent values in the Washington Double Star Catalog.

  15. A statistical spectropolarimetric study of Herbig Ae/Be stars

    Science.gov (United States)

    Ababakr, K. M.; Oudmaijer, R. D.; Vink, J. S.

    2017-11-01

    We present H α linear spectropolarimetry of a large sample of Herbig Ae/Be stars. Together with newly obtained data for 17 objects, the sample contains 56 objects, the largest such sample to date. A change in linear polarization across the H α line is detected in 42 (75 per cent) objects, which confirms the previous finding that the circumstellar environment around these stars on small spatial scales has an asymmetric structure, which is typically identified with a disc. A second outcome of this research is that we confirm that Herbig Ae stars are similar to T Tauri stars in displaying a line polarization effect, while depolarization is more common among Herbig Be stars. This finding had been suggested previously to indicate that Herbig Ae stars form in the same manner than T Tauri stars through magnetospheric accretion. It appears that the transition between these two differing polarization line effects occurs around the B7-B8 spectral type. This would in turn not only suggest that Herbig Ae stars accrete in a similar fashion as lower mass stars, but also that this accretion mechanism switches to a different type of accretion for Herbig Be stars. We report that the magnitude of the line effect caused by electron scattering close to the stars does not exceed 2 per cent. Only a very weak correlation is found between the magnitude of the line effect and the spectral type or the strength of the H α line. This indicates that the detection of a line effect only relies on the geometry of the line-forming region and the geometry of the scattering electrons.

  16. Observations of red-giant variable stars by Aboriginal Australians

    Science.gov (United States)

    Hamacher, Duane W.

    2018-04-01

    Aboriginal Australians carefully observe the properties and positions of stars, including both overt and subtle changes in their brightness, for subsistence and social application. These observations are encoded in oral tradition. I examine two Aboriginal oral traditions from South Australia that describe the periodic changing brightness in three pulsating, red-giant variable stars: Betelgeuse (Alpha Orionis), Aldebaran (Alpha Tauri), and Antares (Alpha Scorpii). The Australian Aboriginal accounts stand as the only known descriptions of pulsating variable stars in any Indigenous oral tradition in the world. Researchers examining these oral traditions over the last century, including anthropologists and astronomers, missed the description of these stars as being variable in nature as the ethnographic record contained several misidentifications of stars and celestial objects. Arguably, ethnographers working on Indigenous Knowledge Systems should have academic training in both the natural and social sciences.

  17. Organic Molecules and Water in the Inner Disks of T Tauri Stars

    Science.gov (United States)

    2011-05-11

    603 Knez, C., et al. 2007, BAAS , 211, 5005 Kruger, A. J., Richter, M. J., Carr, J. S., Najita, J. R., Doppmann, G. W., & Seifahrt, A. 2011, ApJ, 729...Close, L. M., Hinz, P. M., Hoffmann, W. F., Greene, T. P., Males, J. R., & Beck , T. L. 2010, ApJ, 711, 1280 Tappe, A., Lada, C. J., Black, J. H

  18. TH28 (Krautter's star) and its string of Herbig-Haro objects

    International Nuclear Information System (INIS)

    Graham, J.A.; Heyer, M.H.

    1988-01-01

    A high-quality spectrogram of the unusual T Tauri-like star Th28 and its string of Herbig-Haro (HH) objects has been obtained. New velocities and line intensities for the star and the gaseous knots are reported, and data are given for a third HH object located 87 arcsec to the SE along the same collimation axis as defined by the other features. Th28 has a heliocentric velocity of +5 km/s which is close to the velocity of the CO in the area. The star's spectral type is probably in the G8-K2 range. 24 references

  19. Hearily reddened Hg-Mn star HD 29647

    International Nuclear Information System (INIS)

    Strajzhis, V.; Glagolevskij, Yu.V.; Romanyuk, I.I.; Bychkov, V.D.; AN SSSR, Nizhnij Arkhyz. Spetsial'naya Astrofizicheskaya Observatoriya)

    1982-01-01

    A heavily reddened HD 29647 (V=8sup(m).4) star is investigated using the 6-meter telescope spectrograms with dispersions 9 and 28 A/mm and photometric observations in the Vilnius seven- color system. Parameters Tsub(e)=15600 K (corresponding spectral type B5) and log g=3.70 from hydrogen lines and Balmer jump were obtained. HD 29647 is a peculiar star of the Hg-Mn type. The radial velocity of the star is+14.1+-1.0 km/s, almost identical with that of the dark Taurus cloud and its T Tauri-type variables. If the star is near the front edge of the dark cloud at the distance of 165 pc and has Esub(B-V)=1.06, its visual absolute magnitude is - 0sup(m).9. Photometric observations permit to suspect a slight varia bility in the U, P, and X colors [ru

  20. Photometric search for variable stars in the young open cluster Berkeley 59

    Science.gov (United States)

    Lata, Sneh; Pandey, A. K.; Maheswar, G.; Mondal, Soumen; Kumar, Brijesh

    2011-12-01

    We present the time series photometry of stars located in the extremely young open cluster Berkeley 59. Using the 1.04-m telescope at Aryabhatta Research Institute of Observational Sciences (ARIES), Nainital, we have identified 42 variables in a field of ˜13 × 13 arcmin2 around the cluster. The probable members of the cluster have been identified using a (V, V-I) colour-magnitude diagram and a (J-H, H-K) colour-colour diagram. 31 variables have been found to be pre-main-sequence stars associated with the cluster. The ages and masses of the pre-main-sequence stars have been derived from the colour-magnitude diagram by fitting theoretical models to the observed data points. The ages of the majority of the probable pre-main-sequence variable candidates range from 1 to 5 Myr. The masses of these pre-main-sequence variable stars have been found to be in the range of ˜0.3 to ˜3.5 M⊙, and these could be T Tauri stars. The present statistics reveal that about 90 per cent T Tauri stars have period dispersal of the discs of relatively massive stars.

  1. Identification and analysis of OsttaDSP, a phosphoglucan phosphatase from Ostreococcus tauri.

    Directory of Open Access Journals (Sweden)

    Julieta B Carrillo

    Full Text Available Ostreococcus tauri, the smallest free-living (non-symbiotic eukaryote yet described, is a unicellular green alga of the Prasinophyceae family. It has a very simple cellular organization and presents a unique starch granule and chloroplast. However, its starch metabolism exhibits a complexity comparable to higher plants, with multiple enzyme forms for each metabolic reaction. Glucan phosphatases, a family of enzymes functionally conserved in animals and plants, are essential for normal starch or glycogen degradation in plants and mammals, respectively. Despite the importance of O. tauri microalgae in evolution, there is no information available concerning the enzymes involved in reversible phosphorylation of starch. Here, we report the molecular cloning and heterologous expression of the gene coding for a dual specific phosphatase from O. tauri (OsttaDSP, homologous to Arabidopsis thaliana LSF2. The recombinant enzyme was purified to electrophoretic homogeneity to characterize its oligomeric and kinetic properties accurately. OsttaDSP is a homodimer of 54.5 kDa that binds and dephosphorylates amylopectin. Also, we also determined that residue C162 is involved in catalysis and possibly also in structural stability of the enzyme. Our results could contribute to better understand the role of glucan phosphatases in the metabolism of starch in green algae.

  2. Oxygen-rich Mass Loss with a Pinch of Salt: NaCl in the Circumstellar Gas of IK Tauri and VY Canis Majoris

    Science.gov (United States)

    Milam, S. N.; Apponi, A. J.; Woolf, N. J.; Ziurys, L. M.

    2007-10-01

    The NaCl molecule has been observed in the circumstellar envelopes of VY Canis Majoris (VY CMa) and IK Tauri (IK Tau)-the first identifications of a metal refractory in oxygen-rich shells of evolved stars. Five rotational transitions of NaCl at 1 and 2 mm were detected toward VY CMa and three 1 mm lines were observed toward IK Tau, using the telescopes of the Arizona Radio Observatory. In both objects, the line widths of the NaCl profiles were extremely narrow relative to those of other molecules, indicating that sodium chloride has not reached the terminal outflow velocity in either star, likely a result of early condensation onto grains. Modeling the observed spectra suggests abundances, relative to H2, of f~5×10-9 in VY CMa and f~4×10-9 in IK Tau, with source sizes of 0.5" and 0.3", respectively. The extent of these sources is consistent with the size of the dust acceleration zones in both stars. NaCl therefore appears to be at least as abundant in O-rich shells as compared to C-rich envelopes, where f~(0.2-2)×10-9, although it appears to condense out earlier in the O-rich case. Chemical equilibrium calculations indicate that NaCl is the major carrier of sodium at T~1100 K for oxygen-rich stars, with predicted fractional abundances in good agreement with the observations. These measurements suggest that crystalline salt may be an important condensate for sodium in both C- and O-rich circumstellar shells.

  3. Symbiotic stars

    International Nuclear Information System (INIS)

    Boyarchuk, A.A.

    1975-01-01

    There are some arguments that the symbiotic stars are binary, where one component is a red giant and the other component is a small hot star which is exciting a nebula. The symbiotic stars belong to the old disc population. Probably, symbiotic stars are just such an evolutionary stage for double stars as planetary nebulae for single stars. (Auth.)

  4. CLASSICAL T TAURI-LIKE OUTFLOW ACTIVITY IN THE BROWN DWARF MASS REGIME

    International Nuclear Information System (INIS)

    Whelan, E. T.; Ray, T. P.; Podio, L.; Bacciotti, F.; Randich, S.

    2009-01-01

    Over the last number of years, spectroscopic studies have strongly supported the assertion that protostellar accretion and outflow activity persist to the lowest masses. Indeed, previous to this work, the existence of three brown dwarf (BD) outflows had been confirmed by us. In this paper, we present the results of our latest investigation of BD outflow activity and report on the discovery of two new outflows. Observations to date have concentrated on studying the forbidden emission line (FEL) regions of young BDs and in all cases data have been collected using the UV-Visual Echelle Spectrometer (UVES) on the ESO Very Large Telescope. Offsets in the FEL regions are recovered using spectro-astrometry. Here, ISO-Oph 32 is shown to drive a blueshifted outflow with a radial velocity of 10-20 km s -1 and spectro-astrometric analysis constrains the position angle of this outflow to 240 0 ± 7 0 . The BD candidate, ISO-ChaI 217 is found to have a bipolar outflow bright in several key forbidden lines (V RAD = -20 km s -1 , +40 km s -1 ) and with a P.A. of 193 0 -209 0 . A striking feature of the ISO-ChaI 217 outflow is the strong asymmetry between the red- and blueshifted lobes. This asymmetry is revealed in the relative brightness of the two lobes (redshifted lobe is brighter), the factor of 2 difference in radial velocity (the redshifted lobe is faster) and the difference in the electron density (again higher in the red lobe). Such asymmetries are common in jets from low-mass protostars and the observation of a marked asymmetry at such a low mass ( sun ) supports the idea that BD outflow activity is scaled down from low-mass protostellar activity. Also note that although asymmetries are unexceptional, it is uncommon for the redshifted lobe to be the brightest as some obscuration by the accretion disk is assumed. This phenomenon has only been observed in one other source, the classical T Tauri (CTTS) star RW Aur. The physical mechanism responsible for the brightening of

  5. Self-regulating star formation and disk structure

    International Nuclear Information System (INIS)

    Dopita, M.A.

    1987-01-01

    Star formation processes determine the disk structure of galaxies. Stars heavier than about 1 solar mass determine the chemical evolution of the system and are produced at a rate which maintains (by the momentum input of the stars) the phase structure, pressure, and vertical velocity dispersion of the gas. Low mass stars are produced quiescently within molecular clouds, and their associated T-Tauri winds maintain the support of molecular clouds and regulate the star formation rate. Inefficient cooling suppresses this mode of star formation at low metallicity. Applied to the solar neighborhood, such a model can account for age/metallicity relationships, the increase in the O/Fe ratio at low metallicity, the paucity of metal-poor G and K dwarf stars, the missing mass in the disk and, possibly, the existence of a metal-poor thick disk. For other galaxies, it accounts for constant w-velocity dispersion of the gas, the relationship between gas content and specific rates of star formation, the surface brightness/metallicity relationship and for the shallow radial gradients in both star formation rates and HI content. 71 references

  6. BP report of the business year 1979

    Energy Technology Data Exchange (ETDEWEB)

    1980-01-01

    The paper presents a survey about the development of the energy- and petroleum market during the year 1979. A commentary of the German BP A.G. and its activities is given here: personnel- and management policy, exploration, supply, refining and distribution, investigation, and development. After a survey about the business situation of the German BP A.G. the detailed annual balance sheets of 1979 of the German BP and of the whole enterprise are given.

  7. Life-cycle and genome of OtV5, a large DNA virus of the pelagic marine unicellular green alga Ostreococcus tauri.

    Directory of Open Access Journals (Sweden)

    Evelyne Derelle

    Full Text Available Large DNA viruses are ubiquitous, infecting diverse organisms ranging from algae to man, and have probably evolved from an ancient common ancestor. In aquatic environments, such algal viruses control blooms and shape the evolution of biodiversity in phytoplankton, but little is known about their biological functions. We show that Ostreococcus tauri, the smallest known marine photosynthetic eukaryote, whose genome is completely characterized, is a host for large DNA viruses, and present an analysis of the life-cycle and 186,234 bp long linear genome of OtV5. OtV5 is a lytic phycodnavirus which unexpectedly does not degrade its host chromosomes before the host cell bursts. Analysis of its complete genome sequence confirmed that it lacks expected site-specific endonucleases, and revealed the presence of 16 genes whose predicted functions are novel to this group of viruses. OtV5 carries at least one predicted gene whose protein closely resembles its host counterpart and several other host-like sequences, suggesting that horizontal gene transfers between host and viral genomes may occur frequently on an evolutionary scale. Fifty seven percent of the 268 predicted proteins present no similarities with any known protein in Genbank, underlining the wealth of undiscovered biological diversity present in oceanic viruses, which are estimated to harbour 200Mt of carbon.

  8. BP - bisnis põhjas? / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2010-01-01

    Seoses Mehhiko lahe naftareostusega ootab BP-d kuni 21 mld. dollari suurune trahv, kahjude hüvitamiseks peab BP müüma osa oma varast. Ekspertide hinnangul tähendavad Mehhiko lahe sündmused suuri muutusi kogu naftaäris

  9. Abundâncias químicas de estrelas T Tauri fracas

    Science.gov (United States)

    Rojas, G. A.; Gregorio-Hetem, J.

    2003-08-01

    Apresentamos resultados do estudo de 44 estrelas pré-seqüência principal, para as quais buscamos realizar uma classificação espectroscópica e determinar parâmetros estelares e abundâncias químicas. A amostra foi escolhida da seguinte maneira : 21 objetos selecionados a partir de catálogos de objetos jovens, como o Pico dos Dias Survey e o Herbig Bell Catalogue, e 23 objetos selecionados a partir de contrapartidas ópticas de fontes de raios X detectadas pelo satélite ROSAT. Dentre 24 objetos previamente classificados como estrelas T Tauri Fracas, apenas 7 revelaram ser realmente pertencentes à essa classe, sendo os demais objetos T Tauri Clássicas ou estrelas evoluídas da pré-seqüência principal. Esse resultado demonstra que o critério mais utilizado para distinguir as T Tauri Clássicas das T Tauri Fracas, baseado na largura equivelente da emissão Ha, não é suficiente para determinar o estágio evolutivo desses objetos. Para o cálculo de parâmetros estelares e abundâncias, foram escolhidas as estrelas que apresentam características ideais para esse tipo de estudo, como ausência de velamento, baixa velocidade de rotação e espectros com razão sinal-ruído adequada. Os parâmetros estelares como temperatura efetiva e gravidade foram determinados através do equilíbrio de excitação e ionização das linhas de Ferro, e as abundâncias químicas foram calculadas utilizando o método de síntese espectral. Serão apresentados os parâmetros estelares e as abundâncias de Lítio para toda a amostra, e abundâncias de vários elementos quimicos para 7 estrelas estudadas em maior detalhe

  10. The millimeter IRAM-30 m line survey toward IK Tauri

    Science.gov (United States)

    Velilla Prieto, L.; Sánchez Contreras, C.; Cernicharo, J.; Agúndez, M.; Quintana-Lacaci, G.; Bujarrabal, V.; Alcolea, J.; Balança, C.; Herpin, F.; Menten, K. M.; Wyrowski, F.

    2017-01-01

    Aims: We aim to investigate the physical and chemical properties of the molecular envelope of the oxygen-rich AGB star IK Tau. Methods: We carried out a millimeter wavelength line survey between 79 and 356 GHz with the IRAM-30 m telescope. We analysed the molecular lines detected in IK Tau using the population diagram technique to derive rotational temperatures and column densities. We conducted a radiative transfer analysis of the SO2 lines, which also helped us to verify the validity of the approximated method of the population diagram for the rest of the molecules. Results: For the first time in this source we detected rotational lines in the ground vibrational state of HCO+, NS, NO, and H2CO, as well as several isotopologues of molecules previously identified, namely, C18O, Si17O, Si18O, 29SiS, 30SiS, Si34S, H13CN, 13CS, C34S, H234S, 34SO, and 34SO2. We also detected several rotational lines in vibrationally excited states of SiS and SiO isotopologues, as well as rotational lines of H2O in the vibrationally excited state ν2 = 2. We have also increased the number of rotational lines detected of molecules that were previously identified toward IK Tau, including vibrationally excited states, enabling a detailed study of the molecular abundances and excitation temperatures. In particular, we highlight the detection of NS and H2CO with fractional abundances of f(NS) 10-8 and f(H2CO) [10-7-10-8]. Most of the molecules display rotational temperatures between 15 and 40 K. NaCl and SiS isotopologues display rotational temperatures higher than the average ( 65 K). In the case of SO2 a warm component with Trot 290 K is also detected. Conclusions: With a total of 350 lines detected of 34 different molecular species (including different isotopologues), IK Tau displays a rich chemistry for an oxygen-rich circumstellar envelope. The detection of carbon bearing molecules like H2CO, as well as the discrepancies found between our derived abundances and the predictions from

  11. X-shooter spectroscopy of FU Tauri A

    Science.gov (United States)

    Stelzer, B.; Alcalá, J. M.; Scholz, A.; Natta, A.; Randich, S.; Covino, E.

    2013-03-01

    We have analyzed a broad-band optical and near-infrared spectrum of FU Tau A, which is a presumed young brown dwarf in the Taurus star forming region that has intrigued both theorists and observers by its overluminosity in the Hertzsprung-Russell (HR) diagram with respect to standard pre-main sequence evolutionary models. FU Tau A is brighter than any other Taurus member of the same or similar spectral type, and various phenomena (accretion, activity, binarity) have been put forth as possible explanations. The new data, obtained with the X-shooter spectrograph at the Very Large Telescope, include an unprecedented wealth of information on stellar parameters and simultaneously observed accretion and outflow indicators for FU Tau A. We present the first measurements of gravity (log g = 3.5 ± 0.5), radial velocity (RV = 22.5 ± 2.9 km s-1), rotational velocity (vsini = 20 ± 5 km s-1), and lithium equivalent width (EWLi = 430 ± 20 mÅ) for FU Tau A. From the rotational velocity and the published period we infer a disk inclination of i ≳ 50°. The lithium content is much lower than theoretically expected for such a young very low-mass object, adding another puzzling feature to this object's properties. We determine the mass accretion rate of FU Tau A from comparison of the luminosities of 20 emission lines to empirical calibrations from the literature and find a mean of log Ṁacc [M⊙/yr] = -9.9 with standard deviation σ = 0.2. The accretion rate determined independently from modeling of the excess emission in the Balmer and Paschen continua is consistent with this value. The corresponding accretion luminosity is too low to make a significant contribution to the bolometric luminosity. Strong magnetic activity affecting the stellar parameters or binarity of FU Tau A, both combined with extreme youth, may be responsible for its position in the HR diagram. The existence of an outflow in FU Tau A is demonstrated through the first detection of forbidden emission lines

  12. BP Investment Exceeds $4 Bln in china

    Institute of Scientific and Technical Information of China (English)

    Wang Ping

    2008-01-01

    @@ British Petroleum (BP) recently signed a series of agreements with China including those in clean energy and wind power generation, during British Prime Minister Gordon Brown's visit to China in mid-January.

  13. BP teatas harvast edusammust / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Naftakompanii BP teatas, et suudab Mehhiko lahest päevas kinni püüda sinna lekkinud 10 000 barrelit naftat. Tegu on ajutise lahendusega, lõplikult peaks naftavoo peatama merepõhja puuritavad nn. asenduskaevud

  14. Stars and Star Myths.

    Science.gov (United States)

    Eason, Oliver

    Myths and tales from around the world about constellations and facts about stars in the constellations are presented. Most of the stories are from Greek and Roman mythology; however, a few Chinese, Japanese, Polynesian, Arabian, Jewish, and American Indian tales are also included. Following an introduction, myths are presented for the following 32…

  15. CLOSE COMPANIONS TO YOUNG STARS. I. A LARGE SPECTROSCOPIC SURVEY IN CHAMAELEON I AND TAURUS-AURIGA

    International Nuclear Information System (INIS)

    Nguyen, Duy Cuong; Brandeker, Alexis; Van Kerkwijk, Marten H.; Jayawardhana, Ray

    2012-01-01

    We present the results of a multiplicity survey of 212 T Tauri stars in the Chamaeleon I and Taurus-Auriga star-forming regions, based on high-resolution spectra from the Magellan Clay 6.5 m telescope. From these data, we achieved a typical radial velocity (RV) precision of ∼80 m s –1 with slower rotators yielding better precision, in general. For 174 of these stars, we obtained multi-epoch data with sufficient time baselines to identify binaries based on RV variations. We identified eight close binaries and four close triples, of which three and two, respectively, are new discoveries. The spectroscopic multiplicity fractions we find for Chamaeleon I (7%) and Taurus-Auriga (6%) are similar to each other, and to the results of field star surveys in the same mass and period regime. However, unlike the results from imaging surveys, the frequency of systems with close companions in our sample is not seen to depend on primary mass. Additionally, we do not find a strong correlation between accretion and close multiplicity. This implies that close companions are not likely the main source of the accretion shut down observed in weak-lined T Tauri stars. Our results also suggest that sufficient RV precision can be achieved for at least a subset of slowly rotating young stars to search for hot Jupiter planets.

  16. Hints for Small Disks around Very Low Mass Stars and Brown Dwarfs

    International Nuclear Information System (INIS)

    Hendler, Nathanial P.; Mulders, Gijs D.; Pascucci, Ilaria; Greenwood, Aaron; Kamp, Inga; Henning, Thomas; Ménard, François; Dent, William R. F.; II, Neal J. Evans

    2017-01-01

    The properties of disks around brown dwarfs and very low mass stars (hereafter VLMOs) provide important boundary conditions on the process of planet formation and inform us about the numbers and masses of planets than can form in this regime. We use the Herschel Space Observatory PACS spectrometer to measure the continuum and [O i] 63 μ m line emission toward 11 VLMOs with known disks in the Taurus and Chamaeleon I star-forming regions. We fit radiative transfer models to the spectral energy distributions of these sources. Additionally, we carry out a grid of radiative transfer models run in a regime that connects the luminosity of our sources with brighter T Tauri stars. We find that VLMO disks with sizes 1.3–78 au, smaller than typical T Tauri disks, fit well the spectral energy distributions assuming that disk geometry and dust properties are stellar mass independent. Reducing the disk size increases the disk temperature, and we show that VLMOs do not follow previously derived disk temperature–stellar luminosity relationships if the disk outer radius scales with stellar mass. Only 2 out of 11 sources are detected in [O i] despite a better sensitivity than was achieved for T Tauri stars, suggesting that VLMO disks are underluminous. Using thermochemical models, we show that smaller disks can lead to the unexpected [O i] 63 μ m nondetections in our sample. The disk outer radius is an important factor in determining the gas and dust observables. Hence, spatially resolved observations with ALMA—to establish if and how disk radii scale with stellar mass—should be pursued further.

  17. Hints for Small Disks around Very Low Mass Stars and Brown Dwarfs

    Energy Technology Data Exchange (ETDEWEB)

    Hendler, Nathanial P.; Mulders, Gijs D.; Pascucci, Ilaria [Lunar and Planetary Laboratory, The University of Arizona, Tucson, AZ 85721 (United States); Greenwood, Aaron; Kamp, Inga [Kapteyn Astronomical Institute, University of Groningen, Postbus 800, 9700 AV Groningen (Netherlands); Henning, Thomas [Max Planck Institute for Astronomy, Konigstuhl 17, D-69117 Heidelberg (Germany); Ménard, François [Univ. Grenoble Alpes, CNRS, IPAG, F-38000 Grenoble (France); Dent, William R. F. [Department of Engineering, Atacama Large Millimeter/submillimeter Array (ALMA) Santiago Central Offices, Alonso de Córdova 3107, Vitacura, Casilla 763 0355, Santiago (Chile); II, Neal J. Evans, E-mail: equant@lpl.arizona.edu [Department of Astronomy, The University of Texas at Austin, Austin, TX 78712 (United States)

    2017-06-01

    The properties of disks around brown dwarfs and very low mass stars (hereafter VLMOs) provide important boundary conditions on the process of planet formation and inform us about the numbers and masses of planets than can form in this regime. We use the Herschel Space Observatory PACS spectrometer to measure the continuum and [O i] 63 μ m line emission toward 11 VLMOs with known disks in the Taurus and Chamaeleon I star-forming regions. We fit radiative transfer models to the spectral energy distributions of these sources. Additionally, we carry out a grid of radiative transfer models run in a regime that connects the luminosity of our sources with brighter T Tauri stars. We find that VLMO disks with sizes 1.3–78 au, smaller than typical T Tauri disks, fit well the spectral energy distributions assuming that disk geometry and dust properties are stellar mass independent. Reducing the disk size increases the disk temperature, and we show that VLMOs do not follow previously derived disk temperature–stellar luminosity relationships if the disk outer radius scales with stellar mass. Only 2 out of 11 sources are detected in [O i] despite a better sensitivity than was achieved for T Tauri stars, suggesting that VLMO disks are underluminous. Using thermochemical models, we show that smaller disks can lead to the unexpected [O i] 63 μ m nondetections in our sample. The disk outer radius is an important factor in determining the gas and dust observables. Hence, spatially resolved observations with ALMA—to establish if and how disk radii scale with stellar mass—should be pursued further.

  18. Ülehomme on õpetajate päev - milline oli teie parim õpetaja? / Toomas Edur, Tauri Tallermaa, Irene Käosaar...[jt.

    Index Scriptorium Estoniae

    2009-01-01

    Küsimusele vastavad Rahvusooper Estonia balleti kunstiline juht Toomas Edur, koolitaja Tauri Tallermaa, haridus- ja teadusministeeriumi osakonnajuhataja Irene Käosaar, Tartu Karlova Gümnaasiumi direktor Undel Kokk ja näitleja Andrus Vaarik

  19. Time-dependent Models of Magnetospheric Accretion onto Young Stars

    Energy Technology Data Exchange (ETDEWEB)

    Robinson, C. E.; Espaillat, C. C. [Department of Astronomy, Boston University, 725 Commonwealth Avenue, Boston, MA 02215 (United States); Owen, J. E. [Institute for Advanced Study, Einstein Drive, Princeton, NJ 08540 (United States); Adams, F. C., E-mail: connorr@bu.edu [Physics Department, University of Michigan, Ann Arbor, MI 48109 (United States)

    2017-04-01

    Accretion onto Classical T Tauri stars is thought to take place through the action of magnetospheric processes, with gas in the inner disk being channeled onto the star’s surface by the stellar magnetic field lines. Young stars are known to accrete material in a time-variable manner, and the source of this variability remains an open problem, particularly on the shortest (∼day) timescales. Using one-dimensional time-dependent numerical simulations that follow the field line geometry, we find that for plausibly realistic young stars, steady-state transonic accretion occurs naturally in the absence of any other source of variability. However, we show that if the density in the inner disk varies smoothly in time with ∼day-long timescales (e.g., due to turbulence), this complication can lead to the development of shocks in the accretion column. These shocks propagate along the accretion column and ultimately hit the star, leading to rapid, large amplitude changes in the accretion rate. We argue that when these shocks hit the star, the observed time dependence will be a rapid increase in accretion luminosity, followed by a slower decline, and could be an explanation for some of the short-period variability observed in accreting young stars. Our one-dimensional approach bridges previous analytic work to more complicated multi-dimensional simulations and observations.

  20. Time-dependent Models of Magnetospheric Accretion onto Young Stars

    International Nuclear Information System (INIS)

    Robinson, C. E.; Espaillat, C. C.; Owen, J. E.; Adams, F. C.

    2017-01-01

    Accretion onto Classical T Tauri stars is thought to take place through the action of magnetospheric processes, with gas in the inner disk being channeled onto the star’s surface by the stellar magnetic field lines. Young stars are known to accrete material in a time-variable manner, and the source of this variability remains an open problem, particularly on the shortest (∼day) timescales. Using one-dimensional time-dependent numerical simulations that follow the field line geometry, we find that for plausibly realistic young stars, steady-state transonic accretion occurs naturally in the absence of any other source of variability. However, we show that if the density in the inner disk varies smoothly in time with ∼day-long timescales (e.g., due to turbulence), this complication can lead to the development of shocks in the accretion column. These shocks propagate along the accretion column and ultimately hit the star, leading to rapid, large amplitude changes in the accretion rate. We argue that when these shocks hit the star, the observed time dependence will be a rapid increase in accretion luminosity, followed by a slower decline, and could be an explanation for some of the short-period variability observed in accreting young stars. Our one-dimensional approach bridges previous analytic work to more complicated multi-dimensional simulations and observations.

  1. NEW CANDIDATE ERUPTIVE YOUNG STARS IN LYNDS 1340

    Energy Technology Data Exchange (ETDEWEB)

    Kun, M.; Moór, A.; Szegedi-Elek, E. [Konkoly Observatory, H-1121 Budapest, Konkoly Thege út 15-17 (Hungary); Apai, D. [Department of Astronomy and Department of Planetary Sciences, The University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); O' Linger-Luscusk, J. [California Institute of Technology, 1200 East California Avenue, Pasadena, CA 91125 (United States); Stecklum, B. [Thüringer Landessternwarte Tautenburg, Sternwarte 5, D-07778 Tautenburg (Germany); Wolf-Chase, G., E-mail: kun@konkoly.hu [Astronomy Department, Adler Planetarium, 1300 South Lake Shore Drive, Chicago, IL 60605 (United States)

    2014-11-10

    We report on the discovery of three candidate eruptive young stars, found during our comprehensive multi-wavelength study of the young stellar population of the dark cloud L1340. These stars are as follows. (1) IRAS 02224+7227 (2MASS 02270555+7241167, HH 487S) exhibited FUor-like spectrum in our low-resolution optical spectra. The available photometric data restrict its luminosity to 23 L {sub ☉} < L {sub bol} < 59 L {sub ☉}. (2) 2MASS 02263797+7304575, identified as a classical T Tauri star during our Hα survey, exhibited an EXor-type brightening in 2005 November at the time of the Sloan Digital Sky Survey observations of the region. (3) 2MASS 02325605+7246055, a low-mass embedded young star, associated with a fan-shaped infrared nebula, underwent an outburst between the DSS 1 and DSS 2 surveys, leading to the appearance of a faint optical nebula. Our [S II] and Hα images, as well as the Spitzer Infrared Array Camera 4.5 μm images, revealed Herbig-Haro objects associated with this star. Our results suggest that amplitudes and timescales of outbursts do not necessarily correlate with the evolutionary stage of the stars.

  2. NEAR-INFRARED IMAGING OF THE STAR-FORMING REGIONS SH2-157 AND SH2-152

    International Nuclear Information System (INIS)

    Chen Yafeng; Yang Ji; Zeng Qin; Yao Yongqiang; Sato, Shuji

    2009-01-01

    Near-infrared JHK' and H 2 v = 1-0 S (1) imaging observations of the star-forming regions Sh2-157 and Sh2-152 are presented. The data reveal a cluster of young stars associated with H 2 line emission in each region. Additionally, many IR point sources are found in the dense core of each molecular cloud. Most of these sources exhibit infrared color excesses typical of T Tauri stars, Herbig Ae/Be stars, and protostars. Several display the characteristics of massive stars. We calculate histograms of the K'-magnitude and [H - K'] color for all sources, as well as two-color and color-magnitude diagrams. The stellar populations inside and outside the clusters are similar, suggesting that these systems are rather evolved. Shock-driven H 2 emission knots are also detected, which may be related to evident subclusters in an earlier evolutionary stage.

  3. COMPLEX VARIABILITY OF THE Hα EMISSION LINE PROFILE OF THE T TAURI BINARY SYSTEM KH 15D: THE INFLUENCE OF ORBITAL PHASE, OCCULTATION BY THE CIRCUMBINARY DISK, AND ACCRETION PHENOMENA

    International Nuclear Information System (INIS)

    Hamilton, Catrina M.; Johns-Krull, Christopher M.; Mundt, Reinhard; Herbst, William; Winn, Joshua N.

    2012-01-01

    We have obtained 48 high-resolution echelle spectra of the pre-main-sequence eclipsing binary system KH 15D (V582 Mon, P = 48.37 days, e ∼ 0.6, M A = 0.6 M ☉ , M B = 0.7 M ☉ ). The eclipses are caused by a circumbinary disk (CBD) seen nearly edge on, which at the epoch of these observations completely obscured the orbit of star B and a large portion of the orbit of star A. The spectra were obtained over five contiguous observing seasons from 2001/2002 to 2005/2006 while star A was fully visible, fully occulted, and during several ingress and egress events. The Hα line profile shows dramatic changes in these time series data over timescales ranging from days to years. A fraction of the variations are due to 'edge effects' and depend only on the height of star A above or below the razor sharp edge of the occulting disk. Other observed variations depend on the orbital phase: the Hα emission line profile changes from an inverse P-Cygni-type profile during ingress to an enhanced double-peaked profile, with both a blue and a red emission component, during egress. Each of these interpreted variations are complicated by the fact that there is also a chaotic, irregular component present in these profiles. We find that the complex data set can be largely understood in the context of accretion onto the stars from a CBD with gas flows as predicted by the models of eccentric T Tauri binaries put forward by Artymowicz and Lubow, Günther and Kley, and de Val-Borro et al. In particular, our data provide strong support for the pulsed accretion phenomenon, in which enhanced accretion occurs during and after perihelion passage.

  4. Spectroscopy of bright Algol-type semi-detached close binary system HU Tauri (HR 1471)

    Science.gov (United States)

    Parthasarathy, M.

    2018-01-01

    Radial velocities of the primary component (B8V) of HU Tauri derived from the photographic spectra obtained during January 1974 to December 1974 and spectroscopic orbital elements from the analysis of the radial velocity curve of the B8V primary are given. The H line of the late type secondary component is clearly detected on the photographic spectra taken around the quadratures and radial velocities of the secondary component are derived. The radial velocity semi amplitudes of the primary (K) and secondary (K) are found to be 60 km/sec and 234 km/sec respectively. The mass ratio M/M = K/K is found to be 0.2564. The detection of the H line of the secondary is confirmed from the high resolution spectra that I obtained during 1981 and 1983 at quadratures using the 2.1-m McDonald observatory Otto Struve reflector telescope and high resolution coude Reticon spectrograph.

  5. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star.......Denne rapport beskriver numeriske beregninger af forskellige flydergeometrier for bølgeenergianlæget Wave Star....

  6. X-ray stars observed in LAMOST spectral survey

    Science.gov (United States)

    Lu, Hong-peng; Zhang, Li-yun; Han, Xianming L.; Shi, Jianrong

    2018-05-01

    X-ray stars have been studied since the beginning of X-ray astronomy. Investigating and studying the chromospheric activity from X-ray stellar optical spectra is highly significant in providing insights into stellar magnetic activity. The big data of LAMOST survey provides an opportunity for researching stellar optical spectroscopic properties of X-ray stars. We inferred the physical properties of X-ray stellar sources from the analysis of LAMOST spectra. First, we cross-matched the X-ray stellar catalogue (12254 X-ray stars) from ARXA with LAMOST data release 3 (DR3), and obtained 984 good spectra from 713 X-ray sources. We then visually inspected and assigned spectral type to each spectrum and calculated the equivalent width (EW) of Hα line using the Hammer spectral typing facility. Based on the EW of Hα line, we found 203 spectra of 145 X-ray sources with Hα emission above the continuum. For these spectra we also measured the EWs of Hβ, Hγ, Hδ and Ca ii IRT lines of these spectra. After removing novae, planetary nebulae and OB-type stars, we found there are 127 X-ray late-type stars with Hα line emission. By using our spectra and results from the literature, we found 53 X-ray stars showing Hα variability; these objects are Classical T Tauri stars (CTTs), cataclysmic variables (CVs) or chromospheric activity stars. We also found 18 X-ray stars showing obvious emissions in the Ca ii IRT lines. Of the 18 X-ray stars, 16 are CTTs and 2 are CVs. Finally, we discussed the relationships between the EW of Hα line and X-ray flux.

  7. Based on BP Neural Network Stock Prediction

    Science.gov (United States)

    Liu, Xiangwei; Ma, Xin

    2012-01-01

    The stock market has a high profit and high risk features, on the stock market analysis and prediction research has been paid attention to by people. Stock price trend is a complex nonlinear function, so the price has certain predictability. This article mainly with improved BP neural network (BPNN) to set up the stock market prediction model, and…

  8. AGB nucleosynthesis in the Large Magellanic Cloud. Detailed abundance analysis of the RV Tauri star MACHO 47.2496.8

    NARCIS (Netherlands)

    Reyniers, M.; Abia, C.; van Winckel, H.; Lloyd Evans, T.; Decin, L.K.E.; Eriksson, K.; Pollard, K.R.

    2007-01-01

    Context: .Abundance analysis of post-AGB objects as probes of AGB nucleosynthesis. Aims: .A detailed photospheric abundance study is performed on the carbon-rich post-AGB candidate MACHO 47.2496.8 in the LMC. Methods: .High-resolution, high signal-to-noise ESO VLT-UVES spectra of MACHO 47.2496.8 are

  9. Ultraviolet observations of cool stars. III. Chromospheric and coronal lines in α Tauri, β Geminorum, and α Bootis

    International Nuclear Information System (INIS)

    McClintock, W.; Linsky, J.L.; Henry, R.C.; Moos, H.W.; Gerola, H.

    1975-01-01

    The ultraviolet spectrometer of the Princeton Experiment Package aboard the Copernicus satellite has been used to obtain high-resolution measurements of Lα, the Mg ii lambda2800 doublet, and upper limits on the Si iii lambda1206 line in the K giants α Tau and β Gem. The intensities and line shapes are compared with earlier observations of α Boo. The Lα and Mg ii profiles for α Tau resemble those for α Boo, in that they are highly asymmetrical, while β Gem shows much more symmetrical profiles. The asymmetries for all lines except for those of α Boo and Mg ii lines of α Tau could be due to interstellar absorption. In the case of β Gem only, the O v intercombination line at 1218 A is observed, suggesting a well-developed corona substantially cooler than that of the Sun. The Lα profiles of α Tau and β Gem are consistent with the low interstellar hydrogen abundance in the solar neighborhood previously obtained from a similar observation of the α Boo Lα profile. The strength of the Mg ii lambda2796 line can be used to measure transition region and coronal pressures, and indicates a decrease in both with later spectral type and/or increasing luminosity

  10. AcEST: BP918406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000113_B06 468 Adiantum capillus-veneris mRNA. clone: YMU001_000113_B06. BP918406 - Show BP918406...is mRNA. clone: YMU001_000113_B06. Accession BP918406 Tissue type prothallium Developmental stage - Contig I...programs, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-vene...ams, Nucleic Acids Res. 25:3389-3402. Query= BP918406|Adiantum capillus-veneris m

  11. AcEST: BP918011 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E11 519 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E11. BP918011 - Show BP91801...is mRNA. clone: YMU001_000108_E11. Accession BP918011 Tissue type prothallium Developmental stage - Contig I...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiant...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918011|Adiantum cap

  12. 884 Cal.BP and all that

    International Nuclear Information System (INIS)

    Switsur, Roy

    1986-01-01

    A history of the development of the technique of radiocarbon dating highlights the two problems with this method. The first is calibration; the radiocarbon calendar is not linear. However two independent experiments to provide high precision measurements in tree rings have resulted in a high precision calibration curve. The second is how to denote radiocarbon ages and calibrated dates, as this depends on how the dendrochronology time scale used in the calibration is transferred to the actual calendar. If the zero of the dendroscale is transferred from the origin of the Christian calendar to AD 1950, radiocarbon ages are designated CAL BP (BP = before present). There is an alternative method which results in CAL AD and CAL BC. A suggestion for a standard notation is made to avoid the confusion of two systems. (U.K.)

  13. BP Oil Company's approach to risk management

    International Nuclear Information System (INIS)

    Fryman, C.E.

    1996-01-01

    The oil and chemical industries face major challenges in deciding how to handle the numerous recommendations coming from various audits, reviews and studies conducted in the functional areas of personnel health and safety, loss prevention, and environmental protection. And, the number of recommendations continues to grow with time, as regulations and normal business requirements are met. BP Oil has developed a methodology for risk ranking the events leading to specific recommendations and then determining the cost-effectiveness of the recommendations in reducing the risk. The author completed successful pilot tests of this methodology at two of BP Oil's petroleum refineries, examining the recommendations from process hazards analyses and studies completed over the past few years. The methodology has since been implemented throughout their petroleum refining, distribution, transportation, and retail business streams

  14. Radio stars

    International Nuclear Information System (INIS)

    Hjellming, R.M.

    1976-01-01

    Any discussion of the radio emission from stars should begin by emphasizing certain unique problems. First of all, one must clarify a semantic confusion introduced into radio astronomy in the late 1950's when most new radio sources were described as radio stars. All of these early 'radio stars' were eventually identified with other galactic and extra-galactic objects. The study of true radio stars, where the radio emission is produced in the atmosphere of a star, began only in the 1960's. Most of the work on the subject has, in fact, been carried out in only the last few years. Because the real information about radio stars is quite new, it is not surprising that major aspects of the subject are not at all understood. For this reason this paper is organized mainly around three questions: what is the available observational information; what physical processes seem to be involved; and what working hypotheses look potentially fruitful. (Auth.)

  15. BP's driving safety strategy

    Energy Technology Data Exchange (ETDEWEB)

    Herman, B. [BP Canada Energy Company, Calgary, AB (Canada)

    2006-07-01

    This presentation focused on why it is important to drive safely. It addressed driver fatigue as well as BP's global driving standard. The Standard applies to all BP employees and contractors that drive any vehicle on BP business and consists of 10 mandatory elements focusing on safety of the driver, the safety of the journey, and the safety of the vehicle. The driving standards focus on several themes, including skill and competency of the driver, safety of the journey, and safety of the vehicle. Fatigue causes more than 20 per cent of motorway accidents and is the most frequent cause of accidental death of truck drivers. The presentation also discussed vehicle data recorders, driving immersion, and Driving Safety Program results. Journey management, driver training, vehicle inspections and policies, and statistics on vehicle incidents were also provided. The presentation revealed that a lack of pre-trip journey management, inadequate training or recall of training, and not following safe driving practices were major contributors to incident occurrences. It also revealed that traveling on gravel or ice and avoiding wildlife were factors in many vehicle incidents. 1 tab., 1 fig.

  16. Shooting stars

    International Nuclear Information System (INIS)

    Maurette, M.; Hammer, C.

    1985-01-01

    A shooting star passage -even a star shower- can be sometimes easily seen during moonless black night. They represent the partial volatilization in earth atmosphere of meteorites or micrometeorites reduced in cosmic dusts. Everywhere on earth, these star dusts are searched to be gathered. This research made one year ago on the Greenland ice-cap is this article object; orbit gathering projects are also presented [fr

  17. MHD Simulations of Magnetized Stars in the Propeller Regime of Accretion

    Directory of Open Access Journals (Sweden)

    Lii Patrick

    2014-01-01

    Full Text Available Accreting magnetized stars may be in the propeller regime of disc accretion in which the angular velocity of the stellar magnetosphere exceeds that of the inner disc. In these systems, the stellar magnetosphere acts as a centrifugal barrier and inhibits matter accretion onto the rapidly rotating star. Instead, the matter accreting through the disc accumulates at the disc-magnetosphere interface where it picks up angular momentum and is ejected from the system as a wide-angled outflow which gradually collimates at larger distances from the star. If the ejection rate is lower than the accretion rate, the matter will accumulate at the boundary faster than it can be ejected; in this case, accretion onto the star proceeds through an episodic accretion instability in which the episodes of matter accumulation are followed by a brief episode of simultaneous ejection and accretion of matter onto the star. In addition to the matter dominated wind component, the propeller outflow also exhibits a well-collimated, magnetically-dominated Poynting jet which transports energy and angular momentum away from the star. The propeller mechanism may explain some of the weakly-collimated jets and winds observed around some T Tauri stars as well as the episodic variability present in their light curves. It may also explain some of the quasi-periodic variability observed in cataclysmic variables, millisecond pulsars and other magnetized stars.

  18. Geir Hønneland, Russia and the Arctic: Environment, Identity and Foreign Policy & Leif Christian Jensen, International Relations in the Arctic: Norway and the Struggle for Power in the New North (London/New York: IB Tauris, 2016

    Directory of Open Access Journals (Sweden)

    Romain Chuffart

    2017-03-01

    Full Text Available A review of the books: Geir Hønneland, Russia and the Arctic: Environment, Identity and Foreign Policy (London/New York: IB Tauris, 2016; and Leif Christian Jensen, International Relations in the Arctic: Norway and the Struggle for Power in the New North (London/New York: IB Tauris, 2016

  19. Star Polymers.

    Science.gov (United States)

    Ren, Jing M; McKenzie, Thomas G; Fu, Qiang; Wong, Edgar H H; Xu, Jiangtao; An, Zesheng; Shanmugam, Sivaprakash; Davis, Thomas P; Boyer, Cyrille; Qiao, Greg G

    2016-06-22

    Recent advances in controlled/living polymerization techniques and highly efficient coupling chemistries have enabled the facile synthesis of complex polymer architectures with controlled dimensions and functionality. As an example, star polymers consist of many linear polymers fused at a central point with a large number of chain end functionalities. Owing to this exclusive structure, star polymers exhibit some remarkable characteristics and properties unattainable by simple linear polymers. Hence, they constitute a unique class of technologically important nanomaterials that have been utilized or are currently under audition for many applications in life sciences and nanotechnologies. This article first provides a comprehensive summary of synthetic strategies towards star polymers, then reviews the latest developments in the synthesis and characterization methods of star macromolecules, and lastly outlines emerging applications and current commercial use of star-shaped polymers. The aim of this work is to promote star polymer research, generate new avenues of scientific investigation, and provide contemporary perspectives on chemical innovation that may expedite the commercialization of new star nanomaterials. We envision in the not-too-distant future star polymers will play an increasingly important role in materials science and nanotechnology in both academic and industrial settings.

  20. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Brorsen, Michael; Frigaard, Peter

    Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star.......Nærværende rapport beskriver numeriske beregninger af den hydrodynamiske interaktion mellem 5 flydere i bølgeenergianlægget Wave Star....

  1. Star Imager

    DEFF Research Database (Denmark)

    Madsen, Peter Buch; Jørgensen, John Leif; Thuesen, Gøsta

    1997-01-01

    The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol.......The version of the star imager developed for Astrid II is described. All functions and features are described as well as the operations and the software protocol....

  2. Radio stars

    International Nuclear Information System (INIS)

    Hjellming, R.M.; Gibson, D.M.

    1985-01-01

    Studies of stellar radio emission became an important field of research in the 1970's and have now expanded to become a major area of radio astronomy with the advent of new instruments such as the Very Large Array in New Mexico and transcontinental telescope arrays. This volume contains papers from the workshop on stellar continuum radio astronomy held in Boulder, Colorado, and is the first book on the rapidly expanding field of radio emission from stars and stellar systems. Subjects covered include the observational and theoretical aspects of stellar winds from both hot and cool stars, radio flares from active double star systems and red dwarf stars, bipolar flows from star-forming regions, and the radio emission from X-ray binaries. (orig.)

  3. Robustness of circadian clocks to daylight fluctuations: hints from the picoeucaryote Ostreococcus tauri.

    Directory of Open Access Journals (Sweden)

    Quentin Thommen

    Full Text Available The development of systemic approaches in biology has put emphasis on identifying genetic modules whose behavior can be modeled accurately so as to gain insight into their structure and function. However, most gene circuits in a cell are under control of external signals and thus, quantitative agreement between experimental data and a mathematical model is difficult. Circadian biology has been one notable exception: quantitative models of the internal clock that orchestrates biological processes over the 24-hour diurnal cycle have been constructed for a few organisms, from cyanobacteria to plants and mammals. In most cases, a complex architecture with interlocked feedback loops has been evidenced. Here we present the first modeling results for the circadian clock of the green unicellular alga Ostreococcus tauri. Two plant-like clock genes have been shown to play a central role in the Ostreococcus clock. We find that their expression time profiles can be accurately reproduced by a minimal model of a two-gene transcriptional feedback loop. Remarkably, best adjustment of data recorded under light/dark alternation is obtained when assuming that the oscillator is not coupled to the diurnal cycle. This suggests that coupling to light is confined to specific time intervals and has no dynamical effect when the oscillator is entrained by the diurnal cycle. This intriguing property may reflect a strategy to minimize the impact of fluctuations in daylight intensity on the core circadian oscillator, a type of perturbation that has been rarely considered when assessing the robustness of circadian clocks.

  4. ATM signaling and 53BP1

    International Nuclear Information System (INIS)

    Zgheib, Omar; Huyen, Yentram; DiTullio, Richard A.; Snyder, Andrew; Venere, Monica; Stavridi, Elena S.; Halazonetis, Thanos D.

    2005-01-01

    The ATM (mutated in Ataxia-Telangiectasia) protein kinase is an important player in signaling the presence of DNA double strand breaks (DSBs) in higher eukaryotes. Recent studies suggest that ATM monitors the presence of DNA DSBs indirectly, through DNA DSB-induced changes in chromatin structure. One of the proteins that sense these chromatin structure changes is 53BP1, a DNA damage checkpoint protein conserved in all eukaryotes and the putative ortholog of the S. cerevisiae RAD9 protein. We review here the mechanisms by which ATM is activated in response to DNA DSBs, as well as key ATM substrates that control cell cycle progression, apoptosis and DNA repair

  5. Sediment Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  6. Air Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  7. Waste Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  8. Air Monitoring Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  9. Surface Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  10. Water Sampling Data for BP Spill/Deepwater Horizon

    Data.gov (United States)

    U.S. Environmental Protection Agency — The Deepwater Horizon oil spill (also referred to as the BP oil spill) began on 20 April 2010 in the Gulf of Mexico on the BP-operated Macondo Prospect. Following...

  11. Symbiotic stars

    International Nuclear Information System (INIS)

    Kafatos, M.; Michalitsianos, A.G.

    1984-01-01

    Among the several hundred million binary systems estimated to lie within 3000 light years of the solar system, a tiny fraction, no more than a few hundred, belong to a curious subclass whose radiation has a wavelength distribution so peculiar that it long defied explanation. Such systems radiate strongly in the visible region of the spectrum, but some of them do so even more strongly at both shorter and longer wavelengths: in the ultraviolet region and in the infrared and radio regions. This odd distribution of radiation is best explained by the pairing of a cool red giant star and an intensely hot small star that is virtually in contact with its larger companion. Such objects have become known as symbiotic stars. On photographic plate only the giant star can be discerned, but evidence for the existence of the hot companion has been supplied by satellite-born instruments capable of detecting ultraviolet radiation. The spectra of symbiotic stars indicate that the cool red giant is surrounded by a very hot ionized gas. Symbiotic stars also flared up in outbursts indicating the ejection of material in the form of a shell or a ring. Symbiotic stars may therefore represent a transitory phase in the evolution of certain types of binary systems in which there is substantial transfer of matter from the larger partner to the smaller

  12. AcEST: BP918019 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F08 47 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F08. BP918019 - Show BP91801... mRNA. clone: YMU001_000108_F08. Accession BP918019 Tissue type prothallium Developmental stage - Contig ID

  13. X-ray sources associated with young stellar objects in the star formation region CMa R1

    Science.gov (United States)

    Santos-Silva, Thais; Gregorio-Hetem, Jane; Montmerle, Thierry

    2013-07-01

    In previous works we studied the star formation scenario in the molecular cloud Canis Major R1 (CMa R1), derived from the existence of young stellar population groups near the Be stars Z CMa and GU CMa. Using data from the ROSAT X-ray satellite, having a field-of-view of ~ 1° in diameter, Gregorio-Hetem et al. (2009) discovered in this region young stellar objects mainly grouped in two clusters of different ages, with others located in between. In order to investigate the nature of these objects and to test a possible scenario of sequential star formation in this region, four fields (each 30 arcmin diameter, with some overlap) have been observed with the XMM-Newton satellite, with a sensitivity about 10 times better than ROSAT. The XMM-Newton data are currently under analysis. Preliminary results indicate the presence of about 324 sources, most of them apparently having one or more near-infrared counterparts showing typical colors of young stars. The youth of the X-ray sources was also confirmed by X-ray hardness ratio diagrams (XHRD), in different energy bands, giving an estimate of their Lx/Lbol ratios. In addition to these results, we present a detailed study of the XMM field covering the cluster near Z CMa. Several of these sources were classified as T Tauri and Herbig Ae/Be stars, using optical spectroscopy obtained with Gemini telescopes, in order to validate the use of XHRD applied to the entire sample. This classification is also used to confirm the relation between the luminosities in the near-infrared and X-ray bands expected for the T Tauri stars in CMa R1. In the present work we show the results of the study based on the spectra of about 90 sources found nearby Z CMa. We checked that the X-ray spectra (0.3 to 10 keV) of young objects is different from that observed in field stars and extragalactic objects. Some of the candidates also have light curve showing flares that are typical of T Tauri stars, which confirms the young nature of these X

  14. Star formation

    International Nuclear Information System (INIS)

    Woodward, P.R.

    1978-01-01

    Theoretical models of star formation are discussed beginning with the earliest stages and ending in the formation of rotating, self-gravitating disks or rings. First a model of the implosion of very diffuse gas clouds is presented which relies upon a shock at the edge of a galactic spiral arm to drive the implosion. Second, models are presented for the formation of a second generation of massive stars in such a cloud once a first generation has formed. These models rely on the ionizing radiation from massive stars or on the supernova shocks produced when these stars explode. Finally, calculations of the gravitational collapse of rotating clouds are discussed with special focus on the question of whether rotating disks or rings are the result of such a collapse. 65 references

  15. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Byggeri og Anlæg med bølgeenergianlæget Wave Star....

  16. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Andersen, Thomas Lykke

    Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star.......Nærværende rapport beskriver modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star....

  17. STARS no star on Kauai

    International Nuclear Information System (INIS)

    Jones, M.

    1993-01-01

    The island of Kuai, home to the Pacific Missile Range Facility, is preparing for the first of a series of Star Wars rocket launches expected to begin early this year. The Strategic Defense Initiative plans 40 launches of the Stategic Target System (STARS) over a 10-year period. The focus of the tests appears to be weapons and sensors designed to combat multiple-warhead ICBMs, which will be banned under the START II Treaty that was signed in January. The focus of this article is to express the dubious value of testing the STARS at a time when their application will not be an anticipated problem

  18. Flare stars

    International Nuclear Information System (INIS)

    Nicastro, A.J.

    1981-01-01

    The least massive, but possibly most numerous, stars in a galaxy are the dwarf M stars. It has been observed that some of these dwarfs are characterized by a short increase in brightness. These stars are called flare stars. These flare stars release a lot of energy in a short amount of time. The process producing the eruption must be energetic. The increase in light intensity can be explained by a small area rising to a much higher temperature. Solar flares are looked at to help understand the phenomenon of stellar flares. Dwarfs that flare are observed to have strong magnetic fields. Those dwarf without the strong magnetic field do not seem to flare. It is believed that these regions of strong magnetic fields are associated with star spots. Theories on the energy that power the flares are given. Astrophysicists theorize that the driving force of a stellar flare is the detachment and collapse of a loop of magnetic flux. The mass loss due to stellar flares is discussed. It is believed that stellar flares are a significant contributor to the mass of interstellar medium in the Milky Way

  19. AcEST: BP919406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000124_G04 562 Adiantum capillus-veneris mRNA. clone: YMU001_000124_G04. BP919406 - Show BP919406...is mRNA. clone: YMU001_000124_G04. Accession BP919406 Tissue type prothallium Developmental stage - Contig I...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-...ucleic Acids Res. 25:3389-3402. Query= BP919406|Adiantum capillus-veneris mRNA, c

  20. AcEST: BP914061 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D09 599 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D09. BP91406...1 CL1730Contig1 Show BP914061 Clone id YMU001_000039_D09 Library YMU01 Length 599 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D09. Accession BP914061 Tissue type prothallium Developmental stag... a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adia...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914061|Adiantum capillus-veneris mRNA, c

  1. AcEST: BP914068 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E04 420 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E04. BP914068 - Show BP91406...is mRNA. clone: YMU001_000039_E04. Accession BP914068 Tissue type prothallium Developmental stage - Contig I...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91406...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914068|Adiantum capillus-veneris mRNA, clone:

  2. AcEST: BP913406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000029_H06 570 Adiantum capillus-veneris mRNA. clone: YMU001_000029_H06. BP913406 - Show BP913406...is mRNA. clone: YMU001_000029_H06. Accession BP913406 Tissue type prothallium Developmental stage - Contig I...arch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capillus-veneris mRNA, clone: YMU00...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913406|Adiantum capil...LDVTRGLVNGARGVVVAFES--GKHG---------------LPH 406 Query: 387 VRFACNRAEIVIGPDRQTVESGGMQVARRIQVPLILAWALSVHKCQGM

  3. AcEST: BP915406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_B11 433 Adiantum capillus-veneris mRNA. clone: YMU001_000071_B11. BP915406 - Show BP915406...is mRNA. clone: YMU001_000071_B11. Accession BP915406 Tissue type prothallium Developmental stage - Contig I...Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: Y...leic Acids Res. 25:3389-3402. Query= BP915406|Adiantum capillus-veneris mRNA, clone: YMU001_000071_B11. (433

  4. AcEST: BP914064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D12 560 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D12. BP91406...4 CL532Contig1 Show BP914064 Clone id YMU001_000039_D12 Library YMU01 Length 560 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_D12. Accession BP914064 Tissue type prothallium Developmental stage...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adiantum capillus-vener...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914064|Adi

  5. AcEST: BP912406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_F09 348 Adiantum capillus-veneris mRNA. clone: YMU001_000018_F09. BP912406... CL1894Contig1 Show BP912406 Clone id YMU001_000018_F09 Library YMU01 Length 348 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_F09. Accession BP912406 Tissue type prothallium Developmental stag...in database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406|Adiantum capillus-veneris mRNA...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912406

  6. AcEST: BP916406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000087_D01 556 Adiantum capillus-veneris mRNA. clone: YMU001_000087_D01. BP916406... CL1913Contig1 Show BP916406 Clone id YMU001_000087_D01 Library YMU01 Length 556 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000087_D01. Accession BP916406 Tissue type prothallium Developmental stag...ration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capill...database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916406|Adiantum capillus-veneris mRNA, c

  7. AcEST: BP917406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_D10 492 Adiantum capillus-veneris mRNA. clone: YMU001_000100_D10. BP917406... CL2033Contig1 Show BP917406 Clone id YMU001_000100_D10 Library YMU01 Length 492 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_D10. Accession BP917406 Tissue type prothallium Developmental stag...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917406...Nucleic Acids Res. 25:3389-3402. Query= BP917406|Adiantum capillus-veneris mRNA,

  8. AcEST: BP914406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000058_E09 562 Adiantum capillus-veneris mRNA. clone: YMU001_000058_E09. BP914406... CL513Contig1 Show BP914406 Clone id YMU001_000058_E09 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000058_E09. Accession BP914406 Tissue type prothallium Developmental stage...tion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406|Adiantum capillus...PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914406

  9. AcEST: BP921000 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D05 407 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D05. BP921000 - Show BP921000...is mRNA. clone: YMU001_000144_D05. Accession BP921000 Tissue type prothallium Developmental stage - Contig I...eneration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum cap...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921000|Adiantum capillus-veneris mRN

  10. AcEST: BP920140 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E03 489 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E03. BP92014...0 CL2574Contig1 Show BP920140 Clone id YMU001_000133_E03 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E03. Accession BP920140 Tissue type prothallium Developmental stag... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920140|Adian... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  11. AcEST: BP920147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F01 365 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F01. BP920147 - Show BP92014...is mRNA. clone: YMU001_000133_F01. Accession BP920147 Tissue type prothallium Developmental stage - Contig I...ch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920147|Adiantum capillus-veneris mRNA, clone: YMU001_...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9201

  12. AcEST: BP920143 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E07 533 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E07. BP92014...3 CL2377Contig1 Show BP920143 Clone id YMU001_000133_E07 Library YMU01 Length 533 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_E07. Accession BP920143 Tissue type prothallium Developmental stag...ms, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E0...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920143|Adiantum

  13. AcEST: BP920144 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E09 265 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E09. BP920144 - Show BP92014...is mRNA. clone: YMU001_000133_E09. Accession BP920144 Tissue type prothallium Developmental stage - Contig I...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP920144|Adiantum capillus-veneris mRNA, clone: YMU001...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  14. AcEST: BP920141 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E04 528 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E04. BP920141 - Show BP92014...is mRNA. clone: YMU001_000133_E04. Accession BP920141 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (528 lette...cleic Acids Res. 25:3389-3402. Query= BP920141|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E04. (52

  15. AcEST: BP920148 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F02 429 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F02. BP92014...8 CL3819Contig1 Show BP920148 Clone id YMU001_000133_F02 Library YMU01 Length 429 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F02. Accession BP920148 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920148|Adiantum capillus-vener...ed BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  16. AcEST: BP920145 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E11 274 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E11. BP920145 - Show BP92014...is mRNA. clone: YMU001_000133_E11. Accession BP920145 Tissue type prothallium Developmental stage - Contig I..., Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adiantum capillus-veneris mRNA, clone: YMU001_000133_E11.... database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920145|Adian

  17. AcEST: BP920142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E05 486 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E05. BP920142 - Show BP92014...is mRNA. clone: YMU001_000133_E05. Accession BP920142 Tissue type prothallium Developmental stage - Contig I...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris ...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920142|Adiantum capillus-veneris mRNA, clone: YMU001_0001

  18. AcEST: BP920998 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D03 529 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D03. BP92099...8 CL1935Contig1 Show BP920998 Clone id YMU001_000144_D03 Library YMU01 Length 529 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_D03. Accession BP920998 Tissue type prothallium Developmental stag...abase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-veneris mRNA, clon... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920998|Adiantum capillus-ven

  19. AcEST: BP920996 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D01 496 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D01. BP92099...6 CL262Contig1 Show BP920996 Clone id YMU001_000144_D01 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D01. Accession BP920996 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920996|Adiantum capillus-ve

  20. AcEST: BP920995 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C12 350 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C12. BP920995 - Show BP92099...is mRNA. clone: YMU001_000144_C12. Accession BP920995 Tissue type prothallium Developmental stage - Contig I...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ew generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  1. AcEST: BP912099 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_B05 315 Adiantum capillus-veneris mRNA. clone: YMU001_000015_B05. BP912099 - Show BP912099...is mRNA. clone: YMU001_000015_B05. Accession BP912099 Tissue type prothallium Developmental stage - Contig I...BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099...of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912099|Adiantum capillus-vene

  2. AcEST: BP918801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000117_F03 542 Adiantum capillus-veneris mRNA. clone: YMU001_000117_F03. BP918801 - Show BP918801...is mRNA. clone: YMU001_000117_F03. Accession BP918801 Tissue type prothallium Developmental stage - Contig I...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum capillus-veneris mRNA, clone: YMU0...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918801|Adiantum ca

  3. AcEST: BP916801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000091_G06 127 Adiantum capillus-veneris mRNA. clone: YMU001_000091_G06. BP916801... CL2168Contig1 Show BP916801 Clone id YMU001_000091_G06 Library YMU01 Length 127 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000091_G06. Accession BP916801 Tissue type prothallium Developmental stag...ds Res. 25:3389-3402. Query= BP916801|Adiantum capillus-veneris mRNA, clone: YMU0...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916801

  4. AcEST: BP918015 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F03 437 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F03. BP918015 - Show BP91801...is mRNA. clone: YMU001_000108_F03. Accession BP918015 Tissue type prothallium Developmental stage - Contig I.... 25:3389-3402. Query= BP918015|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F03. (437 letters) Data...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  5. AcEST: BP918013 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F01 490 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F01. BP918013 - Show BP91801...is mRNA. clone: YMU001_000108_F01. Accession BP918013 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...idylinositol-4-phosphate 5-kinase 1 OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2 Length = 801 Score = ..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  6. AcEST: BP918018 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F06 436 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F06. BP918018 - Show BP91801...is mRNA. clone: YMU001_000108_F06. Accession BP918018 Tissue type prothallium Developmental stage - Contig I...cids Res. 25:3389-3402. Query= BP918018|Adiantum capillus-veneris mRNA, clone: YM...and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801

  7. AcEST: BP913801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000035_D11 562 Adiantum capillus-veneris mRNA. clone: YMU001_000035_D11. BP913801... CL482Contig1 Show BP913801 Clone id YMU001_000035_D11 Library YMU01 Length 562 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000035_D11. Accession BP913801 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP913801|Adiantum capillus-veneris mRNA, clone: YMU0

  8. AcEST: BP917801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000105_F04 280 Adiantum capillus-veneris mRNA. clone: YMU001_000105_F04. BP917801 - Show BP917801...is mRNA. clone: YMU001_000105_F04. Accession BP917801 Tissue type prothallium Developmental stage - Contig I...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-ve... Nucleic Acids Res. 25:3389-3402. Query= BP917801|Adiantum capillus-veneris mRNA, clone: YMU001_000105_F04.

  9. AcEST: BP918017 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F05 267 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F05. BP918017 - Show BP91801...is mRNA. clone: YMU001_000108_F05. Accession BP918017 Tissue type prothallium Developmental stage - Contig I...otein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris m...cleic Acids Res. 25:3389-3402. Query= BP918017|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F05. (26

  10. AcEST: BP911801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000009_C12 487 Adiantum capillus-veneris mRNA. clone: YMU001_000009_C12. BP911801 - Show BP911801...is mRNA. clone: YMU001_000009_C12. Accession BP911801 Tissue type prothallium Developmental stage - Contig I...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP911801.... 25:3389-3402. Query= BP911801|Adiantum capillus-veneris mRNA, clone: YMU001_000

  11. AcEST: BP915801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000077_B02 555 Adiantum capillus-veneris mRNA. clone: YMU001_000077_B02. BP915801 - Show BP915801...is mRNA. clone: YMU001_000077_B02. Accession BP915801 Tissue type prothallium Developmental stage - Contig I... Nucleic Acids Res. 25:3389-3402. Query= BP915801|Adiantum capillus-veneris mRNA, clone: YMU001_000077_B02. ...ST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP915801|A

  12. AcEST: BP920801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000141_G10 454 Adiantum capillus-veneris mRNA. clone: YMU001_000141_G10. BP920801... CL819Contig1 Show BP920801 Clone id YMU001_000141_G10 Library YMU01 Length 454 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000141_G10. Accession BP920801 Tissue type prothallium Developmental stage... Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-veneris mRNA, clone: ...ion of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920801|Adiantum capillus-

  13. AcEST: BP912801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_A07 527 Adiantum capillus-veneris mRNA. clone: YMU001_000023_A07. BP912801 - Show BP912801...is mRNA. clone: YMU001_000023_A07. Accession BP912801 Tissue type prothallium Developmental stage - Contig I...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912801...es. 25:3389-3402. Query= BP912801|Adiantum capillus-veneris mRNA, clone: YMU001_0

  14. AcEST: BP918012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_E12 547 Adiantum capillus-veneris mRNA. clone: YMU001_000108_E12. BP918012 - Show BP91801...is mRNA. clone: YMU001_000108_E12. Accession BP918012 Tissue type prothallium Developmental stage - Contig I...grams, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108...ms, Nucleic Acids Res. 25:3389-3402. Query= BP918012|Adiantum capillus-veneris mRNA, clone: YMU001_000108_E1

  15. STAR FORMATION ACROSS THE W3 COMPLEX

    Energy Technology Data Exchange (ETDEWEB)

    Román-Zúñiga, Carlos G.; Ybarra, Jason E.; Tapia, Mauricio [Instituto de Astronomía, Universidad Nacional Autónoma de México, Unidad Académica en Ensenada, Km 103 Carr. Tijuana–Ensenada, Ensenada 22860 (Mexico); Megías, Guillermo D. [Facultad de Física. Universidad de Sevilla. Dpto. Física Atómica, Molecular y Nuclear, Sevilla, E-41080 (Spain); Lada, Elizabeth A. [Astronomy Department, University of Florida, 211 Bryant Space Sciences Center, FL 32611 (United States); Alves, Joáo F. [Institute of Astronomy, University of Vienna, Türkenschanzstr. 17, A-1180 Vienna (Austria)

    2015-09-15

    We present a multi-wavelength analysis of the history of star formation in the W3 complex. Using deep, near-infrared ground-based images combined with images obtained with Spitzer and Chandra observatories, we identified and classified young embedded sources. We identified the principal clusters in the complex and determined their structure and extension. We constructed extinction-limited samples for five principal clusters and constructed K-band luminosity functions that we compare with those of artificial clusters with varying ages. This analysis provided mean ages and possible age spreads for the clusters. We found that IC 1795, the centermost cluster of the complex, still hosts a large fraction of young sources with circumstellar disks. This indicates that star formation was active in IC 1795 as recently as 2 Myr ago, simultaneous to the star-forming activity in the flanking embedded clusters, W3-Main and W3(OH). A comparison with carbon monoxide emission maps indicates strong velocity gradients in the gas clumps hosting W3-Main and W3(OH) and shows small receding clumps of gas at IC 1795, suggestive of rapid gas removal (faster than the T Tauri timescale) in the cluster-forming regions. We discuss one possible scenario for the progression of cluster formation in the W3 complex. We propose that early processes of gas collapse in the main structure of the complex could have defined the progression of cluster formation across the complex with relatively small age differences from one group to another. However, triggering effects could act as catalysts for enhanced efficiency of formation at a local level, in agreement with previous studies.

  16. NEAR-INFRARED VARIABILITY IN YOUNG STARS IN CYGNUS OB7

    Energy Technology Data Exchange (ETDEWEB)

    Rice, Thomas S. [Department of Astronomy, Harvard University, 60 Garden Street, Cambridge, MA 02138 (United States); Wolk, Scott J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Aspin, Colin [Institute for Astronomy, University of Hawaii at Manoa, 640 N Aohoku Pl, Hilo, HI 96720 (United States)

    2012-08-10

    We present the first results from a 124 night J, H, K near-infrared monitoring campaign of the dark cloud L 1003 in Cygnus OB7, an active star-forming region. Using three seasons of UKIRT observations spanning 1.5 years, we obtained high-quality photometry on 9200 stars down to J = 17 mag, with photometric uncertainty better than 0.04 mag. On the basis of near-infrared excesses from disks, we identify 30 pre-main-sequence stars, including 24 which are newly discovered. We analyze those stars and find that the NIR excesses are significantly variable. All 9200 stars were monitored for photometric variability; among the field star population, {approx}160 exhibited near-infrared variability (1.7% of the sample). Of the 30 young stellar objects (YSOs), 28 of them (93%) are variable at a significant level. Of the 30 YSOs, twenty-five have near-infrared excess consistent with simple disk-plus-star classical T Tauri models. Nine of these (36%) drift in color space over the course of these observations and/or since Two Micron All Sky Survey observations such that they cross the boundary defining the NIR excess criteria; effectively, they have a transient near-infrared excess. Thus, time-series JHK observations can be used to obtain a more complete sample of disk-bearing stars than single-epoch JHK observations. About half of the YSOs have color-space variations parallel to either the classical T Tauri star locus or a hybrid track which includes the dust reddening trajectory. This indicates that the NIR variability in YSOs that possess accretion disks arises from a combination of variable extinction and changes in the inner accretion disk: either in accretion rate, central hole size, and/or the inclination of the inner disk. While some variability may be due to stellar rotation, the level of variability on the individual stars can exceed a magnitude. This is a strong empirical suggestion that protoplanetary disks are quite dynamic and exhibit more complex activity on short

  17. A search for magnetic fields in Lambda Bootis stars

    International Nuclear Information System (INIS)

    Bohlender, D.A.; Landstreet, J.D.

    1990-01-01

    We have searched a sample of λ Boo stars for magnetic fields similar to those observed in the magnetic Ap and Bp stars, using a Balmer-line Zeeman analyser. Apart from one dubious measurement, no fields are detected in our sample. It appears that magnetic fields of the λ Boo stars, if they exist, are significantly smaller than those found in magnetic upper main-sequence stars of similar spectral type; this conclusion is supported at about the 90 or 95 per cent confidence level by the present data. (author)

  18. The embedded young stars in the Taurus-Auriga molecular cloud. I - Models for spectral energy distributions

    Science.gov (United States)

    Kenyon, Scott J.; Calvet, Nuria; Hartmann, Lee

    1993-01-01

    We describe radiative transfer calculations of infalling, dusty envelopes surrounding pre-main-sequence stars and use these models to derive physical properties for a sample of 21 heavily reddened young stars in the Taurus-Auriga molecular cloud. The density distributions needed to match the FIR peaks in the spectral energy distributions of these embedded sources suggest mass infall rates similar to those predicted for simple thermally supported clouds with temperatures about 10 K. Unless the dust opacities are badly in error, our models require substantial departures from spherical symmetry in the envelopes of all sources. These flattened envelopes may be produced by a combination of rotation and cavities excavated by bipolar flows. The rotating infall models of Terebey et al. (1984) models indicate a centrifugal radius of about 70 AU for many objects if rotation is the only important physical effect, and this radius is reasonably consistent with typical estimates for the sizes of circumstellar disks around T Tauri stars.

  19. Symbiotic stars

    Science.gov (United States)

    Kafatos, M.; Michalitsianos, A. G.

    1984-01-01

    The physical characteristics of symbiotic star systems are discussed, based on a review of recent observational data. A model of a symbiotic star system is presented which illustrates how a cool red-giant star is embedded in a nebula whose atoms are ionized by the energetic radiation from its hot compact companion. UV outbursts from symbiotic systems are explained by two principal models: an accretion-disk-outburst model which describes how material expelled from the tenuous envelope of the red giant forms an inwardly-spiralling disk around the hot companion, and a thermonuclear-outburst model in which the companion is specifically a white dwarf which superheats the material expelled from the red giant to the point where thermonuclear reactions occur and radiation is emitted. It is suspected that the evolutionary course of binary systems is predetermined by the initial mass and angular momentum of the gas cloud within which binary stars are born. Since red giants and Mira variables are thought to be stars with a mass of one or two solar mass, it is believed that the original cloud from which a symbiotic system is formed can consist of no more than a few solar masses of gas.

  20. BP180 dysfunction triggers spontaneous skin inflammation in mice.

    Science.gov (United States)

    Zhang, Yang; Hwang, Bin-Jin; Liu, Zhen; Li, Ning; Lough, Kendall; Williams, Scott E; Chen, Jinbo; Burette, Susan W; Diaz, Luis A; Su, Maureen A; Xiao, Shengxiang; Liu, Zhi

    2018-06-04

    BP180, also known as collagen XVII, is a hemidesmosomal component and plays a key role in maintaining skin dermal/epidermal adhesion. Dysfunction of BP180, either through genetic mutations in junctional epidermolysis bullosa (JEB) or autoantibody insult in bullous pemphigoid (BP), leads to subepidermal blistering accompanied by skin inflammation. However, whether BP180 is involved in skin inflammation remains unknown. To address this question, we generated a BP180-dysfunctional mouse strain and found that mice lacking functional BP180 (termed Δ NC16A ) developed spontaneous skin inflammatory disease, characterized by severe itch, defective skin barrier, infiltrating immune cells, elevated serum IgE levels, and increased expression of thymic stromal lymphopoietin (TSLP). Severe itch is independent of adaptive immunity and histamine, but dependent on increased expression of TSLP by keratinocytes. In addition, a high TSLP expression is detected in BP patients. Our data provide direct evidence showing that BP180 regulates skin inflammation independently of adaptive immunity, and BP180 dysfunction leads to a TSLP-mediated itch. The newly developed mouse strain could be a model for elucidation of disease mechanisms and development of novel therapeutic strategies for skin inflammation and BP180-related skin conditions.

  1. Dark stars

    DEFF Research Database (Denmark)

    Maselli, Andrea; Pnigouras, Pantelis; Nielsen, Niklas Grønlund

    2017-01-01

    to the formation of compact objects predominantly made of dark matter. Considering both fermionic and bosonic (scalar φ4) equations of state, we construct the equilibrium structure of rotating dark stars, focusing on their bulk properties and comparing them with baryonic neutron stars. We also show that these dark......Theoretical models of self-interacting dark matter represent a promising answer to a series of open problems within the so-called collisionless cold dark matter paradigm. In case of asymmetric dark matter, self-interactions might facilitate gravitational collapse and potentially lead...... objects admit the I-Love-Q universal relations, which link their moments of inertia, tidal deformabilities, and quadrupole moments. Finally, we prove that stars built with a dark matter equation of state are not compact enough to mimic black holes in general relativity, thus making them distinguishable...

  2. Multivalent display of the antimicrobial peptides BP100 and BP143

    Directory of Open Access Journals (Sweden)

    Imma Güell

    2012-12-01

    Full Text Available Carbohydrates are considered as promising templates for the display of multiple copies of antimicrobial peptides. Herein, we describe the design and synthesis of chimeric structures containing two or four copies of the antimicrobial peptides KKLFKKILKYL-NH2 (BP100 and KKLfKKILKYL-NH2 (BP143 attached to the carbohydrate template cyclodithioerythritol (cDTE or α-D-galactopyranoside (Galp. The synthesis involved the preparation of the corresponding peptide aldehyde followed by coupling to an aminooxy-functionalized carbohydrate template. After purification, the multivalent display systems were obtained in high purities (90–98% and in good yields (42–64%. These compounds were tested against plant and human pathogenic bacteria and screened for their cytotoxicity on eukaryotic cells. They showed lower MIC values than the parent peptides against the bacteria analyzed. In particular, the carbopeptides derived from cDTE and Galp, which contained two or four copies of BP100, respectively, were 2- to 8-fold more active than the monomeric peptide against the phytopathogenic bacteria. These results suggest that preassembling antimicrobial peptides to multimeric structures is not always associated with a significant improvement of the activity. In contrast, the carbopeptides synthesized were active against human red blood cells pointing out that peptide preassembly is critical for the hemolytic activity. Notably, peptide preassembly resulted in an enhanced bactericidal effect.

  3. The evolution of surface magnetic fields in young solar-type stars II: the early main sequence (250-650 Myr)

    Science.gov (United States)

    Folsom, C. P.; Bouvier, J.; Petit, P.; Lèbre, A.; Amard, L.; Palacios, A.; Morin, J.; Donati, J.-F.; Vidotto, A. A.

    2018-03-01

    There is a large change in surface rotation rates of sun-like stars on the pre-main sequence and early main sequence. Since these stars have dynamo-driven magnetic fields, this implies a strong evolution of their magnetic properties over this time period. The spin-down of these stars is controlled by interactions between stellar and magnetic fields, thus magnetic evolution in turn plays an important role in rotational evolution. We present here the second part of a study investigating the evolution of large-scale surface magnetic fields in this critical time period. We observed stars in open clusters and stellar associations with known ages between 120 and 650 Myr, and used spectropolarimetry and Zeeman Doppler Imaging to characterize their large-scale magnetic field strength and geometry. We report 15 stars with magnetic detections here. These stars have masses from 0.8 to 0.95 M⊙, rotation periods from 0.326 to 10.6 d, and we find large-scale magnetic field strengths from 8.5 to 195 G with a wide range of geometries. We find a clear trend towards decreasing magnetic field strength with age, and a power law decrease in magnetic field strength with Rossby number. There is some tentative evidence for saturation of the large-scale magnetic field strength at Rossby numbers below 0.1, although the saturation point is not yet well defined. Comparing to younger classical T Tauri stars, we support the hypothesis that differences in internal structure produce large differences in observed magnetic fields, however for weak-lined T Tauri stars this is less clear.

  4. Discovery of three x-ray luminous pre-main-sequence stars

    International Nuclear Information System (INIS)

    Feigelson, E.D.; Kriss, G.A.

    1981-01-01

    Three X-ray sources found serendipitously in Einstein images of the Taurus-Auriga cloud complex were observed at the McGraw-Hill Observatory and are found to be associated with approx.12 mag stars with weak Hα emission. The stars lie on the edges of dark clouds and are spectroscopically similar to the least active emission-line pre-main-sequence stars. Although they lie well above the ZAMS in the H-R diagram, they do not exhibit ultraviolet excess, strong optical variability, or evidence for mass outflow/inflow characteristics of the more active T Tauri stars. Their only unusual property is high X-ray luminosity (approx.10 30 ergs s1). It is suggested that the X-ray emission from pre-main-sequence stars is not closely linked to the conditions giving rise to their unusual spectroscopic properties. The emission may instead represent an enhanced form of the coronal activity producing X-rays observed in late-type main-sequence stars

  5. Face recognition based on improved BP neural network

    Directory of Open Access Journals (Sweden)

    Yue Gaili

    2017-01-01

    Full Text Available In order to improve the recognition rate of face recognition, face recognition algorithm based on histogram equalization, PCA and BP neural network is proposed. First, the face image is preprocessed by histogram equalization. Then, the classical PCA algorithm is used to extract the features of the histogram equalization image, and extract the principal component of the image. And then train the BP neural network using the trained training samples. This improved BP neural network weight adjustment method is used to train the network because the conventional BP algorithm has the disadvantages of slow convergence, easy to fall into local minima and training process. Finally, the BP neural network with the test sample input is trained to classify and identify the face images, and the recognition rate is obtained. Through the use of ORL database face image simulation experiment, the analysis results show that the improved BP neural network face recognition method can effectively improve the recognition rate of face recognition.

  6. Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?

    Directory of Open Access Journals (Sweden)

    K. M. Usrey

    2014-01-01

    Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.

  7. High-cadence, High-resolution Spectroscopic Observations of Herbig Stars HD 98922 and V1295 Aquila

    Energy Technology Data Exchange (ETDEWEB)

    Aarnio, Alicia N.; Monnier, John D.; Calvet, Nuria; Che, Xiao [Department of Astronomy, University of Michigan, 311 West Hall, 1085 S. University Avenue, Ann Arbor, MI 48109 (United States); Harries, Tim J.; Kraus, Stefan; Acreman, David [Department of Physics and Astronomy, University of Exeter, Stocker Road, Exeter EX4 4QL (United Kingdom)

    2017-10-10

    Recent observational work has indicated that mechanisms for accretion and outflow in Herbig Ae/Be star–disk systems may differ from magnetospheric accretion (MA) as it is thought to occur in T Tauri star–disk systems. In this work, we assess the temporal evolution of spectral lines probing accretion and mass loss in Herbig Ae/Be systems and test for consistency with the MA paradigm. For two Herbig Ae/Be stars, HD 98922 (B9e) and V1295 Aql (A2e), we have gathered multi-epoch (∼years) and high-cadence (∼minutes) high-resolution optical spectra to probe a wide range of kinematic processes. Employing a line equivalent width evolution correlation metric introduced here, we identify species co-evolving (indicative of common line origin) via novel visualization. We interferometrically constrain often problematically degenerate parameters, inclination and inner-disk radius, allowing us to focus on the structure of the wind, magnetosphere, and inner gaseous disk in radiative transfer models. Over all timescales sampled, the strongest variability occurs within the blueshifted absorption components of the Balmer series lines; the strength of variability increases with the cadence of the observations. Finally, high-resolution spectra allow us to probe substructure within the Balmer series’ blueshifted absorption components: we observe static, low-velocity features and time-evolving features at higher velocities. Overall, we find the observed line morphologies and variability are inconsistent with a scaled-up T Tauri MA scenario. We suggest that as magnetic field structure and strength change dramatically with increasing stellar mass from T Tauri to Herbig Ae/Be stars, so too may accretion and outflow processes.

  8. High-cadence, High-resolution Spectroscopic Observations of Herbig Stars HD 98922 and V1295 Aquila

    International Nuclear Information System (INIS)

    Aarnio, Alicia N.; Monnier, John D.; Calvet, Nuria; Che, Xiao; Harries, Tim J.; Kraus, Stefan; Acreman, David

    2017-01-01

    Recent observational work has indicated that mechanisms for accretion and outflow in Herbig Ae/Be star–disk systems may differ from magnetospheric accretion (MA) as it is thought to occur in T Tauri star–disk systems. In this work, we assess the temporal evolution of spectral lines probing accretion and mass loss in Herbig Ae/Be systems and test for consistency with the MA paradigm. For two Herbig Ae/Be stars, HD 98922 (B9e) and V1295 Aql (A2e), we have gathered multi-epoch (∼years) and high-cadence (∼minutes) high-resolution optical spectra to probe a wide range of kinematic processes. Employing a line equivalent width evolution correlation metric introduced here, we identify species co-evolving (indicative of common line origin) via novel visualization. We interferometrically constrain often problematically degenerate parameters, inclination and inner-disk radius, allowing us to focus on the structure of the wind, magnetosphere, and inner gaseous disk in radiative transfer models. Over all timescales sampled, the strongest variability occurs within the blueshifted absorption components of the Balmer series lines; the strength of variability increases with the cadence of the observations. Finally, high-resolution spectra allow us to probe substructure within the Balmer series’ blueshifted absorption components: we observe static, low-velocity features and time-evolving features at higher velocities. Overall, we find the observed line morphologies and variability are inconsistent with a scaled-up T Tauri MA scenario. We suggest that as magnetic field structure and strength change dramatically with increasing stellar mass from T Tauri to Herbig Ae/Be stars, so too may accretion and outflow processes.

  9. Hybrid stars

    Indian Academy of Sciences (India)

    Hybrid stars. AsHOK GOYAL. Department of Physics and Astrophysics, University of Delhi, Delhi 110 007, India. Abstract. Recently there have been important developments in the determination of neutron ... number and the electric charge. ... available to the system to rearrange concentration of charges for a given fraction of.

  10. Pulsating stars

    CERN Document Server

    Catelan, M?rcio

    2014-01-01

    The most recent and comprehensive book on pulsating stars which ties the observations to our present understanding of stellar pulsation and evolution theory.  Written by experienced researchers and authors in the field, this book includes the latest observational results and is valuable reading for astronomers, graduate students, nuclear physicists and high energy physicists.

  11. Variable stars

    International Nuclear Information System (INIS)

    Feast, M.W.; Wenzel, W.; Fernie, J.D.; Percy, J.R.; Smak, J.; Gascoigne, S.C.B.; Grindley, J.E.; Lovell, B.; Sawyer Hogg, H.B.; Baker, N.; Fitch, W.S.; Rosino, L.; Gursky, H.

    1976-01-01

    A critical review of variable stars is presented. A fairly complete summary of major developments and discoveries during the period 1973-1975 is given. The broad developments and new trends are outlined. Essential problems for future research are identified. (B.R.H. )

  12. AcEST: BP912612 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000020_H07 512 Adiantum capillus-veneris mRNA. clone: YMU001_000020_H07. BP912612 - Show BP912612... Clone id YMU001_000020_H07 Library YMU01 Length 512 Definition Adiantum capillus-vener...is mRNA. clone: YMU001_000020_H07. Accession BP912612 Tissue type prothallium Developmental stage - Contig I...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912612|Adiantum cap...illus-veneris mRNA, clone: YMU001_000020_H07. (512 letters) Database: uniprot_sprot.fasta 412,525 sequences;

  13. AcEST: BP912712 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000022_A07 476 Adiantum capillus-veneris mRNA. clone: YMU001_000022_A07. BP912712 - Show BP912712...is mRNA. clone: YMU001_000022_A07. Accession BP912712 Tissue type prothallium Developmental stage - Contig I...cleic Acids Res. 25:3389-3402. Query= BP912712|Adiantum capillus-veneris mRNA, cl...one: YMU001_000022_A07. (476 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total let...8%), Positives = 39/69 (56%), Gaps = 4/69 (5%) Frame = +3 Query: 123 TSRRKSNHDQY--LPNYKVGTVHLLLGVKDQHLVSKIDI

  14. AcEST: BP912126 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D08 484 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D08. BP912126 CL412...4Contig1 Show BP912126 Clone id YMU001_000015_D08 Library YMU01 Length 484 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D08. Accession BP912126 Tissue type prothallium Developmental stage - Contig ID CL412...-BLAST: a new generation of protein database search programs, Nucleic Acids Res. ...25:3389-3402. Query= BP912126|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D08. (484 letters) Databa

  15. AcEST: BP912212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000016_D11 457 Adiantum capillus-veneris mRNA. clone: YMU001_000016_D11. BP912212... CL1085Contig1 Show BP912212 Clone id YMU001_000016_D11 Library YMU01 Length 457 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000016_D11. Accession BP912212 Tissue type prothallium Developmental stag...f protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912212...|Adiantum capillus-veneris mRNA, clone: YMU001_000016_D11. (457 letters) Database: uniprot_sprot.fasta 412

  16. AcEST: BP912312 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000017_F01 489 Adiantum capillus-veneris mRNA. clone: YMU001_000017_F01. BP912312... CL1779Contig1 Show BP912312 Clone id YMU001_000017_F01 Library YMU01 Length 489 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000017_F01. Accession BP912312 Tissue type prothallium Developmental stag...on of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912312...|Adiantum capillus-veneris mRNA, clone: YMU001_000017_F01. (489 letters) Database: uniprot_sprot.fasta 412

  17. AcEST: BP912128 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D10 477 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D10. BP91212...8 CL2328Contig1 Show BP912128 Clone id YMU001_000015_D10 Library YMU01 Length 477 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D10. Accession BP912128 Tissue type prothallium Developmental stag... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...8|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D10. (461 letters) Database: uniprot_sprot.fasta 412

  18. AcEST: BP912012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000012_A06 542 Adiantum capillus-veneris mRNA. clone: YMU001_000012_A06. BP912012... CL2421Contig1 Show BP912012 Clone id YMU001_000012_A06 Library YMU01 Length 542 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000012_A06. Accession BP912012 Tissue type prothallium Developmental stag...rams, Nucleic Acids Res. 25:3389-3402. Query= BP912012|Adiantum capillus-veneris ...mRNA, clone: YMU001_000012_A06. (542 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 t

  19. AcEST: BP912123 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D05 496 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D05. BP91212...3 CL498Contig1 Show BP912123 Clone id YMU001_000015_D05 Library YMU01 Length 496 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D05. Accession BP912123 Tissue type prothallium Developmental stage...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...3|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D05. (478 letters) Database: uniprot_sprot.fasta 412

  20. AcEST: BP912912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000024_C05 413 Adiantum capillus-veneris mRNA. clone: YMU001_000024_C05. BP912912... CL1433Contig1 Show BP912912 Clone id YMU001_000024_C05 Library YMU01 Length 413 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000024_C05. Accession BP912912 Tissue type prothallium Developmental stag... of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912912|Adiantum capillus-ven...eris mRNA, clone: YMU001_000024_C05. (413 letters) Database: uniprot_sprot.fasta 412

  1. AcEST: BP919999 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000131_G09 554 Adiantum capillus-veneris mRNA. clone: YMU001_000131_G09. BP919999... CL2968Contig1 Show BP919999 Clone id YMU001_000131_G09 Library YMU01 Length 554 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000131_G09. Accession BP919999 Tissue type prothallium Developmental stag...b Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generatio...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919999|Adiantum capillus-ve

  2. AcEST: BP913636 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000032_E04 520 Adiantum capillus-veneris mRNA. clone: YMU001_000032_E04. BP913636... CL2643Contig1 Show BP913636 Clone id YMU001_000032_E04 Library YMU01 Length 520 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000032_E04. Accession BP913636 Tissue type prothallium Developmental stag...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP913636|Adiantum capillus-veneris mRNA, clone: YMU001_00003...tative phospholipid-transporting ATPase ... 149 8e-36 sp|Q9LNQ4|ALA4_ARATH Putati

  3. AcEST: BP920997 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D02 534 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D02. BP92099...7 CL10Contig1 Show BP920997 Clone id YMU001_000144_D02 Library YMU01 Length 534 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000144_D02. Accession BP920997 Tissue type prothallium Developmental stage ...a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920997|Adian...BLAST: a new generation of protein database search programs, Nucleic Acids Res. 2

  4. AcEST: BP917373 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000100_A08 270 Adiantum capillus-veneris mRNA. clone: YMU001_000100_A08. BP917373 CL2373...Contig1 Show BP917373 Clone id YMU001_000100_A08 Library YMU01 Length 270 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000100_A08. Accession BP917373 Tissue type prothallium Developmental stage - Contig ID CL2373...search programs, Nucleic Acids Res. 25:3389-3402. Query= BP917373|Adiantum capillus-veneris mRNA, clone: YMU...EGAVKHVGVLSS 206 K+ GC+S G SRHGES V KE H SS Sbjct: 473 KKEKGCSSPGSSRHGESHKGVSHTPI

  5. Star Products and Applications

    OpenAIRE

    Iida, Mari; Yoshioka, Akira

    2010-01-01

    Star products parametrized by complex matrices are defined. Especially commutative associative star products are treated, and star exponentials with respect to these star products are considered. Jacobi's theta functions are given as infinite sums of star exponentials. As application, several concrete identities are obtained by properties of the star exponentials.

  6. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  7. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    International Nuclear Information System (INIS)

    Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia

    2012-01-01

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.

  8. STAR FORMATION ASSOCIATED WITH THE SUPERNOVA REMNANT IC443

    International Nuclear Information System (INIS)

    Xu Jinlong; Wang Junjie; Miller, Martin

    2011-01-01

    We have performed submillimeter and millimeter observations in CO lines toward supernova remnant (SNR) IC443. The CO molecular shell coincides well with the partial shell of the SNR detected in radio continuum observations. Broad emission lines and three 1720 MHz OH masers were detected in the CO molecular shell. The present observations have provided further evidence in support of the interaction between the SNR and the adjoining molecular clouds (MCs). The total mass of the MCs is 9.26 x 10 3 M sun . The integrated CO line intensity ratio (R I CO(3-2) /I CO(2-1) ) for the whole MC is between 0.79 and 3.40. The average value is 1.58, which is much higher than previous measurements of individual Galactic MCs. Higher line ratios imply that shocks have driven into the MCs. We conclude that high R I CO(3-2) /I CO(2-1) is identified as a good signature of the SNR-MC interacting system. Based on the IRAS Point Source Catalog and the Two Micron All Sky Survey near-infrared database, 12 protostellar object and 1666 young stellar object (YSO) candidates (including 154 classical T Tauri stars and 419 Herbig Ae/Be stars) are selected. In the interacting regions, the significant enhancement of the number of protostellar objects and YSOs indicates the presence of some recently formed stars. After comparing the characteristic timescales of star formation with the age of IC443, we conclude that the protostellar objects and YSO candidates are not triggered by IC443. For the age of the stellar winds shell, we have performed our calculation on the basis of a stellar wind shell expansion model. The results and analysis suggest that the formation of these stars may be triggered by the stellar winds of the IC443 progenitor.

  9. Further observations of the lambda 10830 He line in stars and their significance as a measure of stellar activity

    International Nuclear Information System (INIS)

    Zirin, H.

    1975-11-01

    Measurements of the lambda 10830 He line in 198 stars are given along with data on other features in that spectral range. Nearly 80% of all G and K stars show some lambda 10830; of these, half are variable and 1/4 show emission. It was confirmed that lambda 10830 is not found in M stars, is weak in F stars, and is particularly strong in close binaries. The line is found in emission in extremely late M and S stars, along with P gamma, but P gamma is not in emission in G and K stars with lambda 10830 emissions. Variable He emission and Ti I emission are found in the RV Tauri variables R Scuti and U Mon. In R Aqr the Fe XIII coronal line lambda 10747 and a line at lambda 11012, which may be singlet He or La II, are found, as well as lambda 10830 and P gamma. The nature of coronas or hot chromospheres in the various stars is discussed. It was concluded that the lambda 10830 intensity must be more or less proportional to the energy deposited in the chromosphere corona by non-thermal processes

  10. Wave Star

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter; Brorsen, Michael

    Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004.......Nærværende rapport beskriver foreløbige hovedkonklusioner på modelforsøg udført på Aalborg Universitet, Institut for Vand, Jord og Miljøteknik med bølgeenergianlægget Wave Star i perioden 13/9 2004 til 12/11 2004....

  11. AcEST: BP914065 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E01 548 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E01. BP91406...5 CL604Contig1 Show BP914065 Clone id YMU001_000039_E01 Library YMU01 Length 548 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000039_E01. Accession BP914065 Tissue type prothallium Developmental stage...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU0...cids Res. 25:3389-3402. Query= BP914065|Adiantum capillus-veneris mRNA, clone: YMU001_000039_E01. (548 lette

  12. AcEST: BP914069 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_E05 368 Adiantum capillus-veneris mRNA. clone: YMU001_000039_E05. BP91406...9 CL2761Contig1 Show BP914069 Clone id YMU001_000039_E05 Library YMU01 Length 368 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_E05. Accession BP914069 Tissue type prothallium Developmental stag...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001_0000...rch programs, Nucleic Acids Res. 25:3389-3402. Query= BP914069|Adiantum capillus-veneris mRNA, clone: YMU001

  13. AcEST: BP914060 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000039_D08 539 Adiantum capillus-veneris mRNA. clone: YMU001_000039_D08. BP91406...0 CL1835Contig1 Show BP914060 Clone id YMU001_000039_D08 Library YMU01 Length 539 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000039_D08. Accession BP914060 Tissue type prothallium Developmental stag...rotein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris ...Acids Res. 25:3389-3402. Query= BP914060|Adiantum capillus-veneris mRNA, clone: YMU001_000039_D08. (539 lett

  14. AcEST: BP920146 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_E12 401 Adiantum capillus-veneris mRNA. clone: YMU001_000133_E12. BP92014...6 CL388Contig1 Show BP920146 Clone id YMU001_000133_E12 Library YMU01 Length 401 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000133_E12. Accession BP920146 Tissue type prothallium Developmental stage...generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum ca...rams, Nucleic Acids Res. 25:3389-3402. Query= BP920146|Adiantum capillus-veneris mRNA, clone: YMU001_000133_

  15. AcEST: BP920149 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000133_F03 624 Adiantum capillus-veneris mRNA. clone: YMU001_000133_F03. BP92014...9 CL2860Contig1 Show BP920149 Clone id YMU001_000133_F03 Library YMU01 Length 624 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000133_F03. Accession BP920149 Tissue type prothallium Developmental stag...ic Acids Res. 25:3389-3402. Query= BP920149|Adiantum capillus-veneris mRNA, clone: YMU001_000133_F03. (624 l...n of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92014

  16. Around and beyond 53BP1 Nuclear Bodies.

    Science.gov (United States)

    Fernandez-Vidal, Anne; Vignard, Julien; Mirey, Gladys

    2017-12-05

    Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs) are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1), a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

  17. AcEST: BP920994 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C10 322 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C10. BP92099...4 CL2871Contig1 Show BP920994 Clone id YMU001_000144_C10 Library YMU01 Length 322 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C10. Accession BP920994 Tissue type prothallium Developmental stag...), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  18. AcEST: BP920990 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C03 445 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C03. BP92099...0 CL4123Contig1 Show BP920990 Clone id YMU001_000144_C03 Library YMU01 Length 445 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C03. Accession BP920990 Tissue type prothallium Developmental stag...97), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9209...LAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  19. AcEST: BP920999 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_D04 588 Adiantum capillus-veneris mRNA. clone: YMU001_000144_D04. BP92099...9 CL317Contig1 Show BP920999 Clone id YMU001_000144_D04 Library YMU01 Length 588 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_D04. Accession BP920999 Tissue type prothallium Developmental stage...nd PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099... and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP92099

  20. AcEST: BP920993 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C06 517 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C06. BP92099...3 CL547Contig1 Show BP920993 Clone id YMU001_000144_C06 Library YMU01 Length 517 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000144_C06. Accession BP920993 Tissue type prothallium Developmental stage...rograms, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum capillus-veneris mRNA, clone: YMU001_0001...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP920993|Adiantum

  1. AcEST: BP920991 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C04 521 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C04. BP92099...1 CL3173Contig1 Show BP920991 Clone id YMU001_000144_C04 Library YMU01 Length 521 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C04. Accession BP920991 Tissue type prothallium Developmental stag...s. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (521 letters) Dat...ucleic Acids Res. 25:3389-3402. Query= BP920991|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C04. (5

  2. AcEST: BP920992 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000144_C05 525 Adiantum capillus-veneris mRNA. clone: YMU001_000144_C05. BP92099...2 CL2523Contig1 Show BP920992 Clone id YMU001_000144_C05 Library YMU01 Length 525 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000144_C05. Accession BP920992 Tissue type prothallium Developmental stag...Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_000144_C05. (525 lett...ograms, Nucleic Acids Res. 25:3389-3402. Query= BP920992|Adiantum capillus-veneris mRNA, clone: YMU001_00014

  3. Around and beyond 53BP1 Nuclear Bodies

    Directory of Open Access Journals (Sweden)

    Anne Fernandez-Vidal

    2017-12-01

    Full Text Available Within the nucleus, sub-nuclear domains define territories where specific functions occur. Nuclear bodies (NBs are dynamic structures that concentrate nuclear factors and that can be observed microscopically. Recently, NBs containing the p53 binding protein 1 (53BP1, a key component of the DNA damage response, were defined. Interestingly, 53BP1 NBs are visualized during G1 phase, in daughter cells, while DNA damage was generated in mother cells and not properly processed. Unlike most NBs involved in transcriptional processes, replication has proven to be key for 53BP1 NBs, with replication stress leading to the formation of these large chromatin domains in daughter cells. In this review, we expose the composition and organization of 53BP1 NBs and focus on recent findings regarding their regulation and dynamics. We then concentrate on the importance of the replication stress, examine the relation of 53BP1 NBs with DNA damage and discuss their dysfunction.

  4. AcEST: BP919801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000129_C11 513 Adiantum capillus-veneris mRNA. clone: YMU001_000129_C11. BP919801... CL1Contig3 Show BP919801 Clone id YMU001_000129_C11 Library YMU01 Length 513 Definition Adiantum capil...lus-veneris mRNA. clone: YMU001_000129_C11. Accession BP919801 Tissue type prothallium Developmental stage -...es. 25:3389-3402. Query= BP919801|Adiantum capillus-veneris mRNA, clone: YMU001_000129_C11. (435 letters) Da...eration of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919801|Adiantum capil

  5. AcEST: BP918016 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000108_F04 434 Adiantum capillus-veneris mRNA. clone: YMU001_000108_F04. BP91801...6 CL3779Contig1 Show BP918016 Clone id YMU001_000108_F04 Library YMU01 Length 434 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000108_F04. Accession BP918016 Tissue type prothallium Developmental stag..., Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91801...ic Acids Res. 25:3389-3402. Query= BP918016|Adiantum capillus-veneris mRNA, clone: YMU001_000108_F04. (434 l

  6. AcEST: BP914801 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000063_A07 396 Adiantum capillus-veneris mRNA. clone: YMU001_000063_A07. BP914801... CL1121Contig1 Show BP914801 Clone id YMU001_000063_A07 Library YMU01 Length 396 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000063_A07. Accession BP914801 Tissue type prothallium Developmental stag...ped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801...ase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP914801|Adiantum capillus-veneris mRNA, clone:

  7. Ostreococcus tauri Luminescent Reporter Lines as Biosensors for Detecting Pollution From Copper-Mine Tailing Effluents in Coastal Environments

    Directory of Open Access Journals (Sweden)

    Carlos Henríquez-Castillo

    2018-05-01

    Full Text Available Phytoplankton cells are excellent biosensors for environmental monitoring and toxicity assessments in different natural systems. Green algae, in particular, appear to be more responsive to copper (Cu disturbances. This is interesting considering that Cu pollution in coastal environments has increased over the last century, with enormous repercussions to marine ecosystems. Unfortunately, no high-throughput method exists for the environmental monitoring of Cu toxicity in seawater. To assess potential uses as biosensors of Cu pollution, high-throughput screening was performed on five luminescence reporter lines constructed in the green algae Ostreococcus tauri RCC745. The reporter line expressing the iron storage ferritin protein fused to luciferase (Fer-Luc was the most sensitive, responding to Cu concentrations in the μM range. Fer-Luc was also the most sensitive reporter line for detecting toxicity in mining-derived polluted seawater predominantly contaminated by soluble Cu. Nevertheless, the Cyclin-Dependent-Kinase A (CDKA reporter was most suitable for detecting the toxicity of copper-mine tailing effluents containing other metals (e.g., iron. These results highlight that Ostreococcus biosensors can serve as a reliable, inexpensive, and automated, high-throughput laboratory approach for performing seawater analyses of coastal areas subjected to metal disturbances. When challenged with Cu, O. tauri not only evidenced a rapid, transcriptional response for the tested genes, but also showed changes in a broad range of genes, especially as related to the stress response. Overall, the obtained results reinforce that a single biosensor is insufficient when dealing with complex mixtures of toxic compounds in natural environments.

  8. DISK EVOLUTION IN THE THREE NEARBY STAR-FORMING REGIONS OF TAURUS, CHAMAELEON, AND OPHIUCHUS

    International Nuclear Information System (INIS)

    Furlan, E.; Watson, Dan M.; McClure, M. K.

    2009-01-01

    We analyze samples of Spitzer Infrared Spectrograph spectra of T Tauri stars in the Ophiuchus, Taurus, and Chamaeleon I star-forming regions, whose median ages lie in the <1-2 Myr range. The median mid-infrared spectra of objects in these three regions are similar in shape, suggesting, on average, similar disk structures. When normalized to the same stellar luminosity, the medians follow each other closely, implying comparable mid-infrared excess emission from the circumstellar disks. We use the spectral index between 13 and 31 μm and the equivalent width of the 10 μm silicate emission feature to identify objects whose disk configuration departs from that of a continuous, optically thick accretion disk. Transitional disks, whose steep 13-31 μm spectral slope and near-IR flux deficit reveal inner disk clearing, occur with about the same frequency of a few percent in all three regions. Objects with unusually large 10 μm equivalent widths are more common (20%-30%); they could reveal the presence of disk gaps filled with optically thin dust. Based on their medians and fraction of evolved disks, T Tauri stars in Taurus and Chamaeleon I are very alike. Disk evolution sets in early, since already the youngest region, the Ophiuchus core (L1688), has more settled disks with larger grains. Our results indicate that protoplanetary disks show clear signs of dust evolution at an age of a few Myr, even as early as ∼1 Myr, but age is not the only factor determining the degree of evolution during the first few million years of a disk's lifetime.

  9. Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

    Directory of Open Access Journals (Sweden)

    D. Wong

    2013-01-01

    Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

  10. Tunneling in BP-MoS2 heterostructure

    Science.gov (United States)

    Liu, Xiaochi; Qu, Deshun; Kim, Changsik; Ahmed, Faisal; Yoo, Won Jong

    Tunnel field effect transistor (TFET) is considered to be a leading option for achieving SS mV/dec. In this work, black phosphorus (BP) and molybdenum disulfide (MoS2) heterojunction devices are fabricated. We find that thin BP flake and MoS2 form normal p-n junctions, tunneling phenomena can be observed when BP thickness increases to certain level. PEO:CsClO4 is applied on the surface of the device together with a side gate electrode patterned together with source and drain electrodes. The Fermi level of MoS2 on top of BP layer can be modulated by the side gating, and this enables to vary the MoS2-BP tunnel diode property from off-state to on-state. Since tunneling is the working mechanism of MoS2-BP junction, and PEO:CsClO4\\ possesses ultra high dielectric constant and small equivalent oxide thickness (EOT), a low SS of 55 mV/dec is obtained from MoS2-BP TFET. This work was supported by the Global Research Laboratory and Global Frontier R&D Programs at the Center for Hybrid Interface Materials, both funded by the Ministry of Science, ICT & Future Planning via the National Research Foundation of Korea (NRF).

  11. Gas and dust in regions of recent star formation

    International Nuclear Information System (INIS)

    Cardelli, J.A.

    1985-01-01

    A variety of observations of gas and dust were obtained in two regions of recent star formation for the purpose of determining basic physical properties. The analyses center on extinction and scattering in the Orion complex and extinction and atomic and molecular absorption near the center of rho Oph molecular cloud. In Orion, the visual extinction towards theta/sup 1,2/Ori indicates that, for the grains responsible for the visual extinction, the average size has increased on the order of 20 to 30%. The subsequent increase in absolute visual extinction has resulted in an apparent lowering of the uv extinction via normalization in the visual. Analysis of small-angle scattering in NGC 1999 in the uv indicates that the phase function (g) changes from about 0.60 near lambda 4000 A to about 0.25 near lambda 1400 A. This seems to imply that the observed continua of H-H 1 and 2 cannot be the result of small angle scattering from imbedded T Tauri stars. For four lines of sight near the center of the rho Oph molecular cloud, the determined column densities of CH extend the relation N(CH) α N(H 2 ) to densities as large as log N(H 2 ) approximately greater than or equal to 21. For CN, the relation N(CN) α N(H 2 ) 3 is extended to log N(H 2 ) approx. = 21

  12. Transitional Disks Associated with Intermediate-Mass Stars: Results of the SEEDS YSO Survey

    Science.gov (United States)

    Grady, C.; Fukagawa, M.; Maruta, Y.; Ohta, Y.; Wisniewski, J.; Hashimoto, J.; Okamoto, Y.; Momose, M.; Currie, T.; McElwain, M.; hide

    2014-01-01

    Protoplanetary disks are where planets form, grow, and migrate to produce the diversity of exoplanet systems we observe in mature systems. Disks where this process has advanced to the stage of gap opening, and in some cases central cavity formation, have been termed pre-transitional and transitional disks in the hope that they represent intermediate steps toward planetary system formation. Recent reviews have focussed on disks where the star is of solar or sub-solar mass. In contrast to the sub-millimeter where cleared central cavities predominate, at H-band some T Tauri star transitional disks resemble primordial disks in having no indication of clearing, some show a break in the radial surface brightness profile at the inner edge of the outer disk, while others have partially to fully cleared gaps or central cavities. Recently, the Meeus Group I Herbig stars, intermediate-mass PMS stars with IR spectral energy distributions often interpreted as flared disks, have been proposed to have transitional and pre-transitional disks similar to those associated with solar-mass PMS stars, based on thermal-IR imaging, and sub-millimeter interferometry. We have investigated their appearance in scattered light as part of the Strategic Exploration of Exoplanets and Disks with Subaru (SEEDS), obtaining H-band polarimetric imagery of 10 intermediate-mass stars with Meeus Group I disks. Augmented by other disks with imagery in the literature, the sample is now sufficiently large to explore how these disks are similar to and differ from T Tauri star disks. The disk morphologies seen in the Tauri disks are also found for the intermediate-mass star disks, but additional phenomena are found; a hallmark of these disks is remarkable individuality and diversity which does not simply correlate with disk mass or stellar properties, including age, including spiral arms in remnant envelopes, arms in the disk, asymmetrically and potentially variably shadowed outer disks, gaps, and one disk

  13. VLBA DETERMINATION OF THE DISTANCE TO NEARBY STAR-FORMING REGIONS. IV. A PRELIMINARY DISTANCE TO THE PROTO-HERBIG AeBe STAR EC 95 IN THE SERPENS CORE

    International Nuclear Information System (INIS)

    Dzib, Sergio; Loinard, Laurent; Rodriguez, Luis F.; Mioduszewski, Amy J.; Boden, Andrew F.; Torres, Rosa M.

    2010-01-01

    Using the Very Long Base Array, we observed the young stellar object EC 95 in the Serpens cloud core at eight epochs from 2007 December to 2009 December. Two sources are detected in our field and are shown to form a tight binary system. The primary (EC 95a) is a 4-5 M sun proto-Herbig AeBe object (arguably the youngest such object known), whereas the secondary (EC 95b) is most likely a low-mass T Tauri star. Interestingly, both sources are non-thermal emitters. While T Tauri stars are expected to power a corona because they are convective while they go down the Hayashi track, intermediate-mass stars approach the main sequence on radiative tracks. Thus, they are not expected to have strong superficial magnetic fields, and should not be magnetically active. We review several mechanisms that could produce the non-thermal emission of EC 95a and argue that the observed properties of EC 95a might be most readily interpreted if it possessed a corona powered by a rotation-driven convective layer. Using our observations, we show that the trigonometric parallax of EC 95 is π = 2.41 ± 0.02 mas, corresponding to a distance of 414.9 +4.4 -4.3 pc. We argue that this implies a distance to the Serpens core of 415 ± 5 pc and a mean distance to the Serpens cloud of 415 ± 25 pc. This value is significantly larger than previous estimates (d ∼ 260 pc) based on measurements of the extinction suffered by stars in the direction of Serpens. A possible explanation for this discrepancy is that these previous observations picked out foreground dust clouds associated with the Aquila Rift system rather than Serpens itself.

  14. AcEST: BP912124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D06 531 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D06. BP91212...4 CL2988Contig1 Show BP912124 Clone id YMU001_000015_D06 Library YMU01 Length 531 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D06. Accession BP912124 Tissue type prothallium Developmental stag...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912124|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D06. (531 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total

  15. AcEST: BP912125 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D07 558 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D07. BP912125 - Show BP91212...is mRNA. clone: YMU001_000015_D07. Accession BP912125 Tissue type prothallium Developmental stage - Contig I...ein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912125|Adiantum capillus-veneris mRN...A, clone: YMU001_000015_D07. (558 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tota...copeptide repeat-containing protein At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12

  16. AcEST: BP912120 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D01 500 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D01. BP912120 - Show BP91212...is mRNA. clone: YMU001_000015_D01. Accession BP912120 Tissue type prothallium Developmental stage - Contig I...elated Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum Align length 130 Score (bit) 124.0 E-va...: a new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP91212...0|Adiantum capillus-veneris mRNA, clone: YMU001_000015_D01. (500 letters) Database: uniprot_sprot.fasta 412

  17. AcEST: BP921212 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000147_A09 361 Adiantum capillus-veneris mRNA. clone: YMU001_000147_A09. BP921212 - Show BP921212...is mRNA. clone: YMU001_000147_A09. Accession BP921212 Tissue type prothallium Developmental stage - Contig I...protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP921212|Adiantum capillus-veneris... mRNA, clone: YMU001_000147_A09. (361 letters) Database: uniprot_sprot.fasta 412,...itol-4,5-bisphosphate 3-ki... 30 2.9 sp|O14338|YB33_SCHPO Uncharacterized serine-rich protein C2F12.0... 29

  18. AcEST: BP912812 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000023_B07 575 Adiantum capillus-veneris mRNA. clone: YMU001_000023_B07. BP912812... CL2610Contig1 Show BP912812 Clone id YMU001_000023_B07 Library YMU01 Length 575 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000023_B07. Accession BP912812 Tissue type prothallium Developmental stag... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912812|Adiant...um capillus-veneris mRNA, clone: YMU001_000023_B07. (575 letters) Database: uniprot_sprot.fasta 412,525 sequ

  19. AcEST: BP912122 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D04 544 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D04. BP91212...2 CL3363Contig1 Show BP912122 Clone id YMU001_000015_D04 Library YMU01 Length 544 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000015_D04. Accession BP912122 Tissue type prothallium Developmental stag...obium aromaticivorans (strain DSM 12444) Align length 58 Score (bit) 33.1 E-value 0.89 Report BLASTX 2.2.19 ...w generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912122|Adiantum

  20. AcEST: BP912127 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D09 582 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D09. BP912127 - Show BP91212...is mRNA. clone: YMU001_000015_D09. Accession BP912127 Tissue type prothallium Developmental stage - Contig I...n database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912127|Adiantum capillus-veneris mRNA,... clone: YMU001_000015_D09. (582 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total ...p|P42825|DNAJ2_ARATH Chaperone protein dnaJ 2 OS=Arabidopsis th... 79 2e-14 sp|Q09912|PSI1_SCHPO Protein psi

  1. AcEST: BP912112 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_C08 546 Adiantum capillus-veneris mRNA. clone: YMU001_000015_C08. BP912112 - Show BP912112...is mRNA. clone: YMU001_000015_C08. Accession BP912112 Tissue type prothallium Developmental stage - Contig I...Arabidopsis thaliana Align length 171 Score (bit) 121.0 E-value 3.0e-27 Report BLASTX 2.2.19 [Nov-02-2008] R... protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912112|Adiantum capillus-veneri...s mRNA, clone: YMU001_000015_C08. (546 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765

  2. AcEST: BP912412 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000018_G03 551 Adiantum capillus-veneris mRNA. clone: YMU001_000018_G03. BP912412... CL4248Contig1 Show BP912412 Clone id YMU001_000018_G03 Library YMU01 Length 551 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000018_G03. Accession BP912412 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912412|Adiantum capillus-veneris mR...NA, clone: YMU001_000018_G03. (551 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 tot

  3. AcEST: BP912512 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_D01 513 Adiantum capillus-veneris mRNA. clone: YMU001_000019_D01. BP912512... CL17Contig1 Show BP912512 Clone id YMU001_000019_D01 Library YMU01 Length 513 Definition Adiantum capi...llus-veneris mRNA. clone: YMU001_000019_D01. Accession BP912512 Tissue type prothallium Developmental stage ...earch programs, Nucleic Acids Res. 25:3389-3402. Query= BP912512|Adiantum capillus-veneris mRNA, clone: YMU0...01_000019_D01. (489 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Sear

  4. AcEST: BP912129 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000015_D11 268 Adiantum capillus-veneris mRNA. clone: YMU001_000015_D11. BP91212...9 CL691Contig1 Show BP912129 Clone id YMU001_000015_D11 Library YMU01 Length 268 Definition Adiantum cap...illus-veneris mRNA. clone: YMU001_000015_D11. Accession BP912129 Tissue type prothallium Developmental stage...tabase search programs, Nucleic Acids Res. 25:3389-3402. Query= BP912129|Adiantum capillus-veneris mRNA, clo...ne: YMU001_000015_D11. (268 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total lett

  5. BP Spill in the Gulf of Mexico Sediment Data

    Data.gov (United States)

    U.S. Environmental Protection Agency — In response to the BP oil spill, EPA monitored sediment near the spill. While emergency response data collection has ended, results continue to be available on this...

  6. AcEST: BP913939 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000038_B01 468 Adiantum capillus-veneris mRNA. clone: YMU001_000038_B01. BP913939 - Show BP913939...is mRNA. clone: YMU001_000038_B01. Accession BP913939 Tissue type prothallium Developmental stage - Contig I...Nucleic Acids Res. 25:3389-3402. Query= BP913939|Adiantum capillus-veneris mRNA, ... F member 3... 86 9e-17 sp|Q66H39|ABCF3_RAT ATP-binding cassette sub-family F member 3 O... 85 1e-16 sp|Q5R9...aracterized ABC transporter ATP-binding... 56 6e-08 sp|P63390|YHES_ECO57 Uncharacterized ABC transporter ATP

  7. BP erioperatsioon naftalekke peatamiseks nurjus / Jürgen Tamme

    Index Scriptorium Estoniae

    Tamme, Jürgen

    2010-01-01

    Naftakompanii BP katse peatada Mehhiko lahe naftaleke ebaõnnestus, nüüd püütakse reostust peatada uue toru paigaldamise abil. USA president Barack Obama avaldas taas rahulolematust naftakompaniiga. Kaart

  8. Evaluation of the Specificity of BP3385 for Bordetella pertussis

    Science.gov (United States)

    BP3385 has been proposed as a diagnostic PCR target for discriminating between Bordetella pertussis and other Bordetella species that also infect humans. Our results demonstrate this gene is also present in some strains of Bordetella hinzii and Bordetella bronchiseptica....

  9. BP/Mobil. Joint-venture directions for use

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    This paper analyzes the economical reasons which have led BP and Mobil companies to join their forces in 1996. Thanks to their complementarity and to their European implantation, the two companies could win the first or second position in petroleum products marketing in 8 European countries. The cumulated petrol sales and the number of petrol stations of the BP/Mobil joint venture are the highest in Europe (800 petrol stations in France). (J.S.)

  10. The human element of right-sizing. BP experiences

    International Nuclear Information System (INIS)

    Hollis, J.W.

    1994-01-01

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  11. Gear Fault Diagnosis Based on BP Neural Network

    Science.gov (United States)

    Huang, Yongsheng; Huang, Ruoshi

    2018-03-01

    Gear transmission is more complex, widely used in machinery fields, which form of fault has some nonlinear characteristics. This paper uses BP neural network to train the gear of four typical failure modes, and achieves satisfactory results. Tested by using test data, test results have an agreement with the actual results. The results show that the BP neural network can effectively solve the complex state of gear fault in the gear fault diagnosis.

  12. Bp'S Baku-Tbilisi-Ceyhan pipeline: the new corporate colonialism.

    Science.gov (United States)

    Marriott, James; Muttitt, Greg

    2006-01-01

    An international campaign was waged questioning the benefits of BP's Baku-Tbilisi-Ceyhan pipeline in an effort to avoid a "zone of sacrifice" there. This article is an offshoot of that effort and explains the contemporary struggle over the pipeline project. The authors describe the project's background and evaluate the actual and potential impacts of the project in which they consider eight areas. They also assess BP's capacity to confront resistance to the pipeline.

  13. The human element of right-sizing. BP experiences

    Energy Technology Data Exchange (ETDEWEB)

    Hollis, J W [BP Norge (Norway)

    1994-12-31

    BP (British Petroleum) Exploration has been engaged in a world-wide repositioning exercise to improve its business performance. Despite a 40% fall in average oil price, the profitability and revenues have both grown, while the workforce has more than halved. BP is now able to test itself against price assumptions as low as $ 14 a barrel and make as good a return as it was near to $ 20. The paper discusses such a process of repositioning

  14. Life of a star

    International Nuclear Information System (INIS)

    Henbest, Nigel.

    1988-01-01

    The paper concerns the theory of stellar evolution. A description is given of:- how a star is born, main sequence stars, red giants, white dwarfs, supernovae, neutron stars and black holes. A brief explanation is given of how the death of a star as a supernova can trigger off the birth of a new generation of stars. Classification of stars and the fate of our sun, are also described. (U.K.)

  15. 4977-bp mitochondrial DNA deletion in infertile patients with varicocele.

    Science.gov (United States)

    Gashti, N G; Salehi, Z; Madani, A H; Dalivandan, S T

    2014-04-01

    Varicocele is the abnormal inflexion and distension of veins of the pampiniform plexus within spermatic cord and is one of the amendable causes of male infertility. It can increase reactive oxygen species (ROS) production in semen and cause oxidative stress. The purpose of this study was to analyse spermatozoa mtDNA 4977-bp deletion in infertile men with varicocele. To detect 4977-bp deletion in spermatozoa mtDNA, semen samples of 60 infertile patients with clinical varicocele and 90 normal men from northern Iran were prepared. After extraction of spermatozoa total DNA, Gap polymerase chain reaction (Gap PCR) was performed. 4977-bp deletion was observed in 81.66% of patients with varicocele, while approximately 15.55% of controls had this deletion. As spermatozoa from patients with varicocele had a high frequency of occurrence of 4977-bp deletion in mtDNA [OR = 24.18, 95% confidence interval (CI) = 10.15-57.57, P deletion in spermatozoa and cause infertility in north Iranian men. However, to determine the relation between sperm mtDNA 4977-bp deletion and varicocele-induced infertility, larger population-based studies are needed. It is concluded that there is an association between sperm mtDNA 4977-bp deletion and varicocele-induced infertility in the population studied. © 2013 Blackwell Verlag GmbH.

  16. INTRINSIC COLORS, TEMPERATURES, AND BOLOMETRIC CORRECTIONS OF PRE-MAIN-SEQUENCE STARS

    Energy Technology Data Exchange (ETDEWEB)

    Pecaut, Mark J.; Mamajek, Eric E. [University of Rochester, Department of Physics and Astronomy, Rochester, NY 14627-0171 (United States)

    2013-09-01

    We present an analysis of the intrinsic colors and temperatures of 5-30 Myr old pre-main-sequence (pre-MS) stars using the F0- through M9-type members of nearby, negligibly reddened groups: the η Cha cluster, the TW Hydra Association, the β Pic Moving Group, and the Tucana-Horologium Association. To check the consistency of spectral types from the literature, we estimate new spectral types for 52 nearby pre-MS stars with spectral types F3 through M4 using optical spectra taken with the SMARTS 1.5 m telescope. Combining these new types with published spectral types and photometry from the literature (Johnson-Cousins BVI{sub C} , 2MASS JHK{sub S} and WISE W1, W2, W3, and W4), we derive a new empirical spectral type-color sequence for 5-30 Myr old pre-MS stars. Colors for pre-MS stars match dwarf colors for some spectral types and colors, but for other spectral types and colors, deviations can exceed 0.3 mag. We estimate effective temperatures (T {sub eff}) and bolometric corrections (BCs) for our pre-MS star sample through comparing their photometry to synthetic photometry generated using the BT-Settl grid of model atmosphere spectra. We derive a new T {sub eff} and BC scale for pre-MS stars, which should be a more appropriate match for T Tauri stars than often-adopted dwarf star scales. While our new T {sub eff} scale for pre-MS stars is within ≅100 K of dwarfs at a given spectral type for stars stars are ∼250 K cooler than their MS counterparts. Lastly, we present (1) a modern T {sub eff}, optical/IR color, and BC sequence for O9V-M9V MS stars based on an extensive literature survey, (2) a revised Q-method relation for dereddening UBV photometry of OB-type stars, and (3) introduce two candidate spectral standard stars as representatives of spectral types K8V and K9V.

  17. The structure and spectrum of the accretion shock in the atmospheres of young stars

    Science.gov (United States)

    Dodin, Alexandr

    2018-04-01

    The structure and spectrum of the accretion shock have been self-consistently simulated for a wide range of parameters typical for Classical T Tauri Stars (CTTS). Radiative cooling of the shocked gas was calculated, taking into account the self-absorption and non-equilibrium (time-dependent) effects in the level populations. These effects modify the standard cooling curve for an optically thin plasma in coronal equilibrium, however the shape of high-temperature (T > 3 × 105 K) part of the curve remains unchanged. The applied methods allow us to smoothly describe the transition from the cooling flow to the hydrostatic stellar atmosphere. Thanks to this approach, it has been found that the narrow component of He II lines is formed predominantly in the irradiated stationary atmosphere (hotspot), i.e. at velocities of the settling gas law via the full energy flux.

  18. LONG-TERM LIGHT CURVE OF HIGHLY VARIABLE PROTOSTELLAR STAR GM CEP

    International Nuclear Information System (INIS)

    Xiao Limin; Kroll, Peter; Henden, Arne A.

    2010-01-01

    We present data from the archival plates at Harvard College Observatory and Sonneberg Observatory showing the field of the solar-type pre-main-sequence star GM Cep. A total of 186 magnitudes of GM Cep have been measured on these archival plates, with 176 in blue sensitivity, six in visible, and four in red. We combine our data with data from the literature and from the American Association of Variable Star Observers to depict the long-term light curves of GM Cep in both B and V wavelengths. The light curves span from 1895 until now, with two densely sampled regions (1935-1945 in the B band, and 2006 until now in the V band). The long-term light curves do not show any fast rise behavior as predicted by an accretion mechanism. Both the light curves and the magnitude histograms confirm the conclusion that the light curves are dominated by dips (possibly from extinction) superposed on some quiescence state, instead of outbursts caused by accretion flares. Our result excludes the possibility of GM Cep being a FUor, EXor, or McNeil's Nebula-type star. Several special cases of T Tauri stars were checked, but none of these light curves were compatible with that of GM Cep. The lack of periodicity in the light curve excludes the possibility of GM Cep being a KH 15D system.

  19. O stars and Wolf-Rayet stars

    International Nuclear Information System (INIS)

    Conti, P.S.; Underhill, A.B.; Jordan, S.; Thomas, R.

    1988-01-01

    Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented

  20. O stars and Wolf-Rayet stars

    Science.gov (United States)

    Conti, Peter S.; Underhill, Anne B.; Jordan, Stuart (Editor); Thomas, Richard (Editor)

    1988-01-01

    Basic information is given about O and Wolf-Rayet stars indicating how these stars are defined and what their chief observable properties are. Part 2 of the volume discussed four related themes pertaining to the hottest and most luminous stars. Presented are: an observational overview of the spectroscopic classification and extrinsic properties of O and Wolf-Rayet stars; the intrinsic parameters of luminosity, effective temperature, mass, and composition of the stars, and a discussion of their viability; stellar wind properties; and the related issues concerning the efforts of stellar radiation and wind on the immediate interstellar environment are presented.

  1. The atomic and molecular content of disks around very low-mass stars and brown dwarfs

    Energy Technology Data Exchange (ETDEWEB)

    Pascucci, I. [Lunar and Planetary Laboratory, The University of Arizona, Tucson, AZ 85721 (United States); Herczeg, G. [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); Carr, J. S. [Naval Research Laboratory, Code 7211, Washington, DC 20375 (United States); Bruderer, S., E-mail: pascucci@lpl.arizona.edu [Max Planck Institute for Extraterrestrial Physics, Giessenbachstrasse 1, D-85748 Garching (Germany)

    2013-12-20

    There is growing observational evidence that disk evolution is stellar-mass-dependent. Here, we show that these dependencies extend to the atomic and molecular content of disk atmospheres. We analyze a unique dataset of high-resolution Spitzer/IRS spectra from eight very low mass star and brown dwarf disks. We report the first detections of Ne{sup +}, H{sub 2}, CO{sub 2}, and tentative detections of H{sub 2}O toward these faint and low-mass disks. Two of our [Ne II] 12.81 μm emission lines likely trace the hot (≥5000 K) disk surface irradiated by X-ray photons from the central stellar/sub-stellar object. The H{sub 2} S(2) and S(1) fluxes are consistent with arising below the fully or partially ionized surface traced by the [Ne II] emission in gas at ∼600 K. We confirm the higher C{sub 2}H{sub 2}/HCN flux and column density ratio in brown dwarf disks previously noted from low-resolution IRS spectra. Our high-resolution spectra also show that the HCN/H{sub 2}O fluxes of brown dwarf disks are on average higher than those of T Tauri disks. Our LTE modeling hints that this difference extends to column density ratios if H{sub 2}O lines trace warm ≥600 K disk gas. These trends suggest that the inner regions of brown dwarf disks have a lower O/C ratio than those of T Tauri disks, which may result from a more efficient formation of non-migrating icy planetesimals. An O/C = 1, as inferred from our analysis, would have profound implications on the bulk composition of rocky planets that can form around very low mass stars and brown dwarfs.

  2. Egyptian "Star Clocks"

    Science.gov (United States)

    Symons, Sarah

    Diagonal, transit, and Ramesside star clocks are tables of astronomical information occasionally found in ancient Egyptian temples, tombs, and papyri. The tables represent the motions of selected stars (decans and hour stars) throughout the Egyptian civil year. Analysis of star clocks leads to greater understanding of ancient Egyptian constellations, ritual astronomical activities, observational practices, and pharaonic chronology.

  3. MAGNETIC FIELDS OF STARS

    OpenAIRE

    Bychkov, V. D.; Bychkova, L. V.; Madej, J.

    2008-01-01

    Now it is known about 1212 stars of the main sequence and giants (from them 610 stars - it is chemically peculiarity (CP) stars) for which direct measurements of magnetic fields were spent (Bychkov et al.,2008). Let's consider, what representations were generated about magnetic fields (MT) of stars on the basis of available observations data.

  4. Profile of NF-κBp(65/NFκBp50) among prostate specific antigen sera levels in prostatic pathologies.

    Science.gov (United States)

    Bouraoui, Y; Ben Jemaa, A; Rodriguez, G; Ben Rais, N; Fraile, B; Paniagua, R; Sellemi, S; Royuela, M; Oueslati, R

    2012-10-01

    The aim of this work was to characterise the immunoexpression of NF-κB (p50/p65) in human prostatic pathologies and to study its profiles of activation among sera prostate specific antigen antigen (PSA) according the three groups: 0-4ng/mL, 4-20ng/mL and >20ng/mL. Twenty-four men with benign prostate hyperplasia (BPH); 19 men with prostate cancer (PC) and five men with normal prostates (NP). Immunohistochemical and western blot analysis was performed. Serum levels of PSA were assayed by immulite autoanalyser. In BPH and PC samples, immunoexpressions were observed for NF-κBp65 and NF-κBp50; while in NP samples, only were detected NF-κBp50. PC samples showed immunoreactions to NF-κBp65 and NF-κBp50 more intense (respectively 24.18±0.67 and 28.23±2.01) than that observed in BPH samples (respectively18.46±2.04 and 18.66±1.59) with special localisation in the nucleus. Different profiles of NF-κBp65 immunoexpressions were observed and BPH patients with sera PSA levels between 0-4ng/mL presented a significant weak percentage compared to BPH patients with sera PSA levels between 4-20ng/mL and >20ng/mL. No immunoreactions to NF-κBp65 were observed in PC patients with sera PSA levels between 4-20ng/mL. The sensibility of both NF-κB and PSA to inflammation allowed confirming the relationship between these two molecules and its involvement in prostatic diseases progression (inflammatory and neoplasic). Copyright © 2011 Elsevier Masson SAS. All rights reserved.

  5. Compact stars

    Science.gov (United States)

    Estevez-Delgado, Gabino; Estevez-Delgado, Joaquin

    2018-05-01

    An analysis and construction is presented for a stellar model characterized by two parameters (w, n) associated with the compactness ratio and anisotropy, respectively. The reliability range for the parameter w ≤ 1.97981225149 corresponds with a compactness ratio u ≤ 0.2644959374, the density and pressures are positive, regular and monotonic decrescent functions, the radial and tangential speed of sound are lower than the light speed, moreover, than the plausible stability. The behavior of the speeds of sound are determinate for the anisotropy parameter n, admitting a subinterval where the speeds are monotonic crescent functions and other where we have monotonic decrescent functions for the same speeds, both cases describing a compact object that is also potentially stable. In the bigger value for the observational mass M = 2.05 M⊙ and radii R = 12.957 Km for the star PSR J0348+0432, the model indicates that the maximum central density ρc = 1.283820319 × 1018 Kg/m3 corresponds to the maximum value of the anisotropy parameter and the radial and tangential speed of the sound are monotonic decrescent functions.

  6. Label-free quantitative analysis of the casein kinase 2-responsive phosphoproteome of the marine minimal model species Ostreococcus tauri.

    Science.gov (United States)

    Le Bihan, Thierry; Hindle, Matthew; Martin, Sarah F; Barrios-Llerena, Martin E; Krahmer, Johanna; Kis, Katalin; Millar, Andrew J; van Ooijen, Gerben

    2015-12-01

    Casein kinase 2 (CK2) is a protein kinase that phosphorylates a plethora of cellular target proteins involved in processes including DNA repair, cell cycle control, and circadian timekeeping. CK2 is functionally conserved across eukaryotes, although the substrate proteins identified in a range of complex tissues are often different. The marine alga Ostreococcus tauri is a unicellular eukaryotic model organism ideally suited to efficiently study generic roles of CK2 in the cellular circadian clock. Overexpression of CK2 leads to a slow circadian rhythm, verifying functional conservation of CK2 in timekeeping. The proteome was analysed in wild-type and CK2-overexpressing algae at dawn and dusk, revealing that differential abundance of the global proteome across the day is largely unaffected by overexpression. However, CK2 activity contributed more strongly to timekeeping at dusk than at dawn. The phosphoproteome of a CK2 overexpression line and cells treated with CK2 inhibitor was therefore analysed and compared to control cells at dusk. We report an extensive catalogue of 447 unique CK2-responsive differential phosphopeptide motifs to inform future studies into CK2 activity in the circadian clock of more complex tissues. All MS data have been deposited in the ProteomeXchange with identifier PXD000975 (http://proteomecentral.proteomexchange.org/dataset/PXD000975). © 2015 The Authors. PROTEOMICS Published by Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Perfil de temperatura dos funis magnetosféricos de estrelas T Tauri com aquecimento alfvênico

    Science.gov (United States)

    Vasconcelos, M. J.

    2003-08-01

    Estrelas T Tauri Clássicas são objetos jovens circundados por discos de gás e poeira e que apresentam uma intensa atividade magnética. Seu espectro mostra linhas de emissão alargadas que são razoavelmente reproduzidas nos modelos de acresção magnetosférica. No entanto, o perfil de temperatura dos funis magnéticos é desconhecido. Aquecimento magnético compressional e difusão ambipolar foram considerados para estas estruturas, porém as temperaturas obtidas não são suficientes para explicar as observações. Neste trabalho, examinamos o aquecimento gerado pelo amortecimento de ondas Alfvén através de quatro mecanismos, os amortecimentos não-linear, turbulento, viscoso-resistivo e colisional como função da freqüência da onda. Inicialmente, a temperatura é ajustada para reproduzir as observações e o grau de turbulência requerido para que o mecanismo seja viável é calculado. Os resultados mostram que este é compatível com os dados observacionais. Apresentam-se, também, resultados preliminares do cálculo auto-consistente do perfil de temperatura dos funis, levando-se em conta fontes de aquecimento Alfvênica e fontes de resfriamento.

  8. Study on MPGA-BP of Gravity Dam Deformation Prediction

    Directory of Open Access Journals (Sweden)

    Xiaoyu Wang

    2017-01-01

    Full Text Available Displacement is an important physical quantity of hydraulic structures deformation monitoring, and its prediction accuracy is the premise of ensuring the safe operation. Most existing metaheuristic methods have three problems: (1 falling into local minimum easily, (2 slowing convergence, and (3 the initial value’s sensitivity. Resolving these three problems and improving the prediction accuracy necessitate the application of genetic algorithm-based backpropagation (GA-BP neural network and multiple population genetic algorithm (MPGA. A hybrid multiple population genetic algorithm backpropagation (MPGA-BP neural network algorithm is put forward to optimize deformation prediction from periodic monitoring surveys of hydraulic structures. This hybrid model is employed for analyzing the displacement of a gravity dam in China. The results show the proposed model is superior to an ordinary BP neural network and statistical regression model in the aspect of global search, convergence speed, and prediction accuracy.

  9. Preliminary Geological Findings on the BP-1 Simulant

    Science.gov (United States)

    Stoeser, D. B.; Rickman, D. L.; Wilson, S.

    2010-01-01

    A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.

  10. Neutron Stars and NuSTAR

    Science.gov (United States)

    Bhalerao, Varun

    2012-05-01

    My thesis centers around the study of neutron stars, especially those in massive binary systems. To this end, it has two distinct components: the observational study of neutron stars in massive binaries with a goal of measuring neutron star masses and participation in NuSTAR, the first imaging hard X-ray mission, one that is extremely well suited to the study of massive binaries and compact objects in our Galaxy. The Nuclear Spectroscopic Telescope Array (NuSTAR) is a NASA Small Explorer mission that will carry the first focusing high energy X-ray telescope to orbit. NuSTAR has an order-of-magnitude better angular resolution and has two orders of magnitude higher sensitivity than any currently orbiting hard X-ray telescope. I worked to develop, calibrate, and test CdZnTe detectors for NuSTAR. I describe the CdZnTe detectors in comprehensive detail here - from readout procedures to data analysis. Detailed calibration of detectors is necessary for analyzing astrophysical source data obtained by the NuSTAR. I discuss the design and implementation of an automated setup for calibrating flight detectors, followed by calibration procedures and results. Neutron stars are an excellent probe of fundamental physics. The maximum mass of a neutron star can put stringent constraints on the equation of state of matter at extreme pressures and densities. From an astrophysical perspective, there are several open questions in our understanding of neutron stars. What are the birth masses of neutron stars? How do they change in binary evolution? Are there multiple mechanisms for the formation of neutron stars? Measuring masses of neutron stars helps answer these questions. Neutron stars in high-mass X-ray binaries have masses close to their birth mass, providing an opportunity to disentangle the role of "nature" and "nurture" in the observed mass distributions. In 2006, masses had been measured for only six such objects, but this small sample showed the greatest diversity in masses

  11. Herschel Studies of the Evolution and Environs of Young Stars in the DIGIT, WISH, and FOOSH Programs

    Science.gov (United States)

    Green, Joel D.; DIGIT OT Key Project Team; WISH GT Key Project Team; FOOSH OT1 Team

    2012-01-01

    The Herschel Space Observatory has enabled us to probe the physical conditions of outer disks, envelopes, and outflows of young stellar objects, including embedded objects, Herbig Ae/Be disks, and T Tauri disks. We will report on results from three projects, DIGIT, WISH, and FOOSH. The DIGIT (Dust, Ice, and Gas in Time) program (PI: Neal Evans) utilizes the full spectral range of the PACS instrument to explore simultaneously the solid and gas-phase chemistry around sources in all of these stages. WISH (Water in Star Forming Regions with Herschel, PI Ewine van Dishoeck) focuses on observations of key lines with HIFI and line scans of selected spectral regions with PACS. FOOSH (FU Orionis Objects Surveyed with Herschel, PI Joel Green) studies FU Orionis objects with full range PACS and SPIRE scans. DIGIT includes examples of low luminosity protostars, while FOOSH studies the high luminosity objects during outburst states. Rotational ladders of highly excited CO and OH emission are detected in both disks and protostars. The highly excited lines are more commonly seen in the embedded phases, where there appear to be two temperature components. Intriguingly, water is frequently detected in spectra of embedded sources, but not in the disk spectra. In addition to gas features, we explore the extent of the newly detected 69 um forsterite dust feature in both T Tauri and Herbig Ae/Be stars. When analyzed along with the Spitzer-detected dust features, these provide constraints on a population of colder crystalline material. We will present some models of individual sources, as well as some broad statistics of the emission from these stages of star and planet formation.

  12. Acute Toxicity and Ecological Risk Assessment of Benzophenone-3 (BP-3 and Benzophenone-4 (BP-4 in Ultraviolet (UV-Filters

    Directory of Open Access Journals (Sweden)

    Yang Du

    2017-11-01

    Full Text Available Ultraviolet (UV-absorbing chemicals (UV filters are used in personal care products for the protection of human skin and hair from damage by UV radiation. Although these substances are released into the environment in the production and consumption processes, little is known about their ecotoxicology effects. The acute toxicity and potential ecological risk of UV filters benzophenone-3 (BP-3 and benzophenone-4 (BP-4 on Chlorella vulgaris, Daphnia magna, and Brachydanio rerio were analyzed in the present study. The EC50 values (96 h of BP-3 and BP-4 on C. vulgaris were 2.98 and 201.00 mg/L, respectively. The 48 h-LC50 of BP-3 and BP-4 on D. magna were 1.09 and 47.47 mg/L, respectively. The 96 h-LC50 of BP-3 and BP-4 on B. rerio were 3.89 and 633.00 mg/L, respectively. The toxicity of a mixture of BP-3 and BP-4 on C. vulgaris, D. magna, and B. rerio all showed antagonistic effects. The induced predicted no-effect concentrations of BP-3 and BP-4 by the assessment factor method were 1.80 × 10−3 and 0.47 mg/L, respectively, by assessment factor (AF method, which were both lower than the concentrations detected in the environment at present, verifying that BP-3 and BP-4 remain low-risk chemicals to the aquatic ecosystem.

  13. 200-BP-5 operable unit treatability test report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-04-01

    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.

  14. 200-BP-5 operable unit Technical Baseline report

    International Nuclear Information System (INIS)

    Jacques, I.D.; Kent, S.K.

    1991-10-01

    This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted

  15. 200-BP-5 operable unit treatability test report

    International Nuclear Information System (INIS)

    1996-04-01

    The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites

  16. Giant CP stars

    International Nuclear Information System (INIS)

    Loden, L.O.; Sundman, A.

    1989-01-01

    This study is part of an investigation of the possibility of using chemically peculiar (CP) stars to map local galactic structure. Correct luminosities of these stars are therefore crucial. CP stars are generally regarded as main-sequence or near-main-sequence objects. However, some CP stars have been classified as giants. A selection of stars, classified in literature as CP giants, are compared to normal stars in the same effective temperature interval and to ordinary 'non giant' CP stars. There is no clear confirmation of a higher luminosity for 'CP giants', than for CP stars in general. In addition, CP characteristics seem to be individual properties not repeated in a component star or other cluster members. (author). 50 refs., 5 tabs., 3 figs

  17. Bc→BP,BV Decays with the QCD Factorization Approach

    International Nuclear Information System (INIS)

    Chang, Qin; Wang, Na; Sun, Junfeng; Yang, Yueling

    2015-01-01

    We studied the nonleptonic B c →BP, BV decays with the QCD factorization approach. It is found that the Cabibbo favored processes of B c →B s π, B s ρ, B u K - are the promising decay channels with branching ratio larger than 1%, which should be observed earlier by the LHCb collaboration

  18. EST Table: BP124521 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP124521 epV32477 10/09/28 59 %/164 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  19. EST Table: BP123885 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123885 epV31590 10/09/28 57 %/174 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 55 %/163 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  20. EST Table: BP125106 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125106 fbpv0387 10/09/28 58 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/165 aa FBpp0212871|DsimGD14469-PA 10/08/28 n.h 10/09/1

  1. EST Table: BP125521 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125521 fbpv0944 10/09/28 59 %/165 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 56 %/164 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  2. EST Table: BP125005 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP125005 fbpv0197 10/09/28 58 %/185 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 58 %/173 aa FBpp0160847|DmojGI11630-PA 10/08/28 n.h 10/09/1

  3. TopBP1-mediated DNA processing during mitosis.

    Science.gov (United States)

    Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H

    2016-01-01

    Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.

  4. EST Table: BP117517 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP117517 ce--0464 10/09/28 63 %/173 aa ref|XP_002092422.1| GE14184 [Drosophila yakuba] gb|EDW92134.1| GE14...184 [Drosophila yakuba] 10/08/28 63 %/173 aa FBpp0259194|DyakGE14184-PA 10/08/28 35 %

  5. EST Table: BP121749 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121749 ceN-5256 10/09/28 100 %/172 aa ref|NP_001036831.1| saposin-related [Bombyx...|GB16561-PA 10/09/10 44 %/178 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...

  6. EST Table: BP121763 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121763 ceN-5273 10/09/28 99 %/184 aa ref|NP_001036831.1| saposin-related [Bombyx ...GB16561-PA 10/09/10 43 %/192 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 ceN- ...

  7. Note: Primer Amysat 001; Fragment size is 211bp

    Indian Academy of Sciences (India)

    Renuka

    Bhandara : Lanes 1–14 represent different strains of Bhandara Ecorace. Note: Primer Amysat 001; Fragment size is 211bp. Fig. 1. SSR profiles generated from genomic DNA of 16 strains from different individuals of (A.L, D. TV, D. BV, Modal, Sukinda, Raily, Bhandara) ecoraces of tasar silk worm, Antheraea mylitta using the.

  8. EST Table: BP182610 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182610 NRPG0829 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 NRPG ...

  9. EST Table: BP121050 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP121050 ceN-4078 10/09/28 35 %/122 aa ref|XP_967620.1| PREDICTED: similar to anopheles stephen...nl|Amel|GB19565-PA 10/09/10 35 %/122 aa gi|91093471|ref|XP_967620.1| PREDICTED: similar to anopheles stephensi ubiquitin, putative [Tribolium castaneum] FS914988 ceN- ...

  10. PM : Cabinet likely to choose TNK-BP

    Index Scriptorium Estoniae

    2005-01-01

    Tõenäoliselt saab Mazeikiu Nafta aktsiate ostjaks Suurbritannia-Vene ettevõte TNK-BP. Endiselt soovib ka Leedu Jukose osa naftakompaniist osta, kuid selleks raha laenamine võib mõjutada riigi majandust ja üleminekut eurole

  11. Cabinet chooses TNK-BP, but doors remain open

    Index Scriptorium Estoniae

    2005-01-01

    Leedu valitsus alustab Vene-Suurbritannia ühisfirmaga TNK-BP läbirääkimisi Mazeikiu Nafta aktsiaenamuse omandamiseks. Kuid samal ajal on võimalik alustada läbirääkimisi ka teiste võimalike investoritega

  12. Far-infrared investigation of the Taurus star-forming region using the IRAS database

    International Nuclear Information System (INIS)

    Hughes, J.D.

    1986-01-01

    The Taurus-Auriga complex was selected as the first molecular cloud to be investigated in this study. The Taurus clouds were defined as lying between 04h and 05h in R.A. and +16 to +31 degrees in Dec., then the IRAS point-source catalogue was searched for sources with good or moderate quality fluxes in all three of the shortest IRAS bands. The sources selected were then classified into subgroups according to their IRAS colors. Taurus is generally believed to be an area of low-mass star formation, having no luminous O-B associations within or near to the cloud complex. Once field stars, galaxies and planetary nebulae had been removed from the sample only the molecular cloud cores, T Tauri stars and a few emission-line A and B stars remained. The great majority of these objects are pre-main sequence in nature and, as stated by Chester (1985), main sequence stars without excess far-infrared emission would only be seen in Taurus if their spectral types were earlier than about A5 and then not 25 microns. By choosing our sample in this way we are naturally selecting the hotter and thus more evolved sources. To counteract this, the molecular cloud core-criterion was applied to soruces with good or moderate quality flux at 25, 60 and 100 microns, increasing the core sample by about one third. The candidate protostar B335 is only detected by IRAS at 60 and 100 microns while Taurus is heavily contaminated by cirrus at 100 microns. This means that detection at 25 microns is also required with those at 60 and 100 microns to avoid confusing a ridge of cirrus with a genuine protostar. The far-infrared luminosity function of these sources is then calculated and converted to the visual band by a standard method to compare with the field star luminosity function of Miller and Scalo

  13. Protoplanetary disks around intermediate-mass stars: the asset of imaging in the mid-infrared

    International Nuclear Information System (INIS)

    Doucet, Coralie

    2006-01-01

    The accrued efficiency of the instruments in many wavelengths has allowed to show that most young stellar objects were surrounded by circumstellar matter distributed in a disk. Direct imaging of such systems is very difficult because of their narrow angular size and their weak luminosity in comparison with the star. Nowadays, 50 % of low-mass pre-main sequence stars, i.e. T Tauri stars, are surrounded by a disk. This proportion is less obvious for intermediate-mass stars, like Herbig Ae stars, that are less numerous and whose direct disk detection is more difficult. Until now, only the interpretation of the Spectral Energy Distribution (SED) of such objects allows to have access to the geometry of the disk. But the solutions are degenerated and several parameters fit the same SED. It is essential to have direct images of the objects, the only evidence of the presence of disks. This PhD allows to show that mid-infrared imaging could rise a part of the degeneracy of the disk's parameters linked to the fit of the SED for several objects and gives constraints on the minimum external radius and inclination of the disk. We present a new observation mode with VISIR, the mid-infrared imager and spectrometer on the VLT (ESO, Chile): the so-called BURST mode. This mode allows to reach the diffraction limit of the telescope. Thanks to mid-infrared imaging with this instrument, we were able, for the first time, to have access to the geometry of a disk (flared structure) around a massive star that was, until now, only deduced from the SED modelling. (author) [fr

  14. Rates of star formation

    International Nuclear Information System (INIS)

    Larson, R.B.

    1977-01-01

    It is illustrated that a theoretical understanding of the formation and evolution of galaxies depends on an understanding of star formation, and especially of the factors influencing the rate of star formation. Some of the theoretical problems of star formation in galaxies, some approaches that have been considered in models of galaxy evolution, and some possible observational tests that may help to clarify which processes or models are most relevant are reviewed. The material is presented under the following headings: power-law models for star formation, star formation processes (conditions required, ways of achieving these conditions), observational indications and tests, and measures of star formation rates in galaxies. 49 references

  15. Energy production in stars

    International Nuclear Information System (INIS)

    Bethe, Hans.

    1977-01-01

    Energy in stars is released partly by gravitation, partly by nuclear reactions. For ordinary stars like our sun, nuclear reactions predominate. However, at the end of the life of a star very large amounts of energy are released by gravitational collapse; this can amount to as much as 10 times the total energy released nuclear reactions. The rotational energy of pulsars is a small remnant of the energy of gravitation. The end stage of small stars is generally a white dwarf, of heavy stars a neutron star of possibly a black hole

  16. Regular Generalized Star Star closed sets in Bitopological Spaces

    OpenAIRE

    K. Kannan; D. Narasimhan; K. Chandrasekhara Rao; R. Ravikumar

    2011-01-01

    The aim of this paper is to introduce the concepts of τ1τ2-regular generalized star star closed sets , τ1τ2-regular generalized star star open sets and study their basic properties in bitopological spaces.

  17. Direct measurement of interstellar extinction toward young stars using atomic hydrogen Lyα absorption

    Energy Technology Data Exchange (ETDEWEB)

    McJunkin, Matthew; France, Kevin; Brown, Alexander [Center for Astrophysics and Space Astronomy, University of Colorado, 389 UCB, Boulder, CO 80309 (United States); Schneider, P. C. [Hamburger Sternwarte, Gojenbergsweg 112, D-21029 Hamburg (Germany); Herczeg, Gregory J. [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100871 (China); Hillenbrand, Lynne [California Institute of Technology, Department of Astrophysics, MC105-24, 1200 E. California Blvd., Pasadena, CA 91125 (United States); Schindhelm, Eric [Southwest Research Institute, 1050 Walnut Street, Suite 300, Boulder, CO 80302 (United States); Edwards, Suzan, E-mail: matthew.mcjunkin@colorado.edu [Five College Astronomy Department, Smith College, Northampton, MA 01063 (United States)

    2014-01-10

    Interstellar reddening corrections are necessary to reconstruct the intrinsic spectral energy distributions (SEDs) of accreting protostellar systems. The stellar SED determines the heating and chemical processes that can occur in circumstellar disks. Measurement of neutral hydrogen absorption against broad Lyα emission profiles in young stars can be used to obtain the total H I column density (N(H I)) along the line of sight. We measure N(H I) with new and archival ultraviolet observations from the Hubble Space Telescope (HST) of 31 classical T Tauri and Herbig Ae/Be stars. The H I column densities range from log{sub 10}(N(H I)) ≈19.6-21.1, with corresponding visual extinctions of A{sub V} =0.02-0.72 mag, assuming an R{sub V} of 3.1. We find that the majority of the H I absorption along the line of sight likely comes from interstellar rather than circumstellar material. Extinctions derived from new HST blue-optical spectral analyses, previous IR and optical measurements, and new X-ray column densities on average overestimate the interstellar extinction toward young stars compared to the N(H I) values by ∼0.6 mag. We discuss possible explanations for this discrepancy in the context of a protoplanetary disk geometry.

  18. COOL YOUNG STARS IN THE NORTHERN HEMISPHERE: β PICTORIS AND AB DORADUS MOVING GROUP CANDIDATES

    International Nuclear Information System (INIS)

    Schlieder, Joshua E.; Simon, Michal; Lépine, Sébastien

    2012-01-01

    As part of our continuing effort to identify new, low-mass members of nearby, young moving groups (NYMGs), we present a list of young, low-mass candidates in the northern hemisphere. We used our proven proper-motion selection procedure and ROSAT X-ray and GALEX-UV activity indicators to identify 204 young stars as candidate members of the β Pictoris and AB Doradus NYMGs. Definitive membership assignment of a given candidate will require a measurement of its radial velocity and distance. We present a simple system of indices to characterize the young candidates and help prioritize follow-up observations. New group members identified in this candidate list will be high priority targets for (1) exoplanet direct imaging searches, (2) the study of post-T-Tauri astrophysics, (3) understanding recent local star formation, and (4) the study of local galactic kinematics. Information available now allows us to identify eight likely new members in the list. Two of these, a late-K and an early-M dwarf, we find to be likely members of the β Pic group. The other six stars are likely members of the AB Dor moving group. These include an M dwarf triple system, and three very cool objects that may be young brown dwarfs, making them the lowest-mass, isolated objects proposed in the AB Dor moving group to date.

  19. Quark core stars, quark stars and strange stars

    International Nuclear Information System (INIS)

    Grassi, F.

    1988-01-01

    A recent one flavor quark matter equation of state is generalized to several flavors. It is shown that quarks undergo a first order phase transition. In addition, this equation of state depends on just one parameter in the two flavor case, two parameters in the three flavor case, and these parameters are constrained by phenomenology. This equation of state is then applied to the hadron-quark transition in neutron stars and the determination of quark star stability, the investigation of strange matter stability and possible strange star existence. 43 refs., 6 figs

  20. 76 FR 69712 - Application To Export Electric Energy; BP Energy Company

    Science.gov (United States)

    2011-11-09

    ... DEPARTMENT OF ENERGY [OE Docket No. EA-315-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... BP Energy to transmit electric energy from the United States to Canada as a power marketer for a five...

  1. ENERGY STAR Certified Displays

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 7.0 ENERGY STAR Program Requirements for Displays that are effective as of July 1, 2016....

  2. ENERGY STAR Certified Boilers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.0 ENERGY STAR Program Requirements for Boilers that are effective as of October 1,...

  3. ENERGY STAR Certified Televisions

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 7.0 ENERGY STAR Program Requirements for Televisions that are effective as of October 30,...

  4. ENERGY STAR Certified Dehumidifiers

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 4.0 ENERGY STAR Program Requirements for Dehumidifiers that are effective as of October...

  5. Observations of central stars

    International Nuclear Information System (INIS)

    Lutz, J.H.

    1978-01-01

    Difficulties occurring in the observation of central stars of planetary nebulae are reviewed with emphasis on spectral classifications and population types, and temperature determination. Binary and peculiar central stars are discussed. (U.M.G.)

  6. ENERGY STAR Certified Telephones

    Data.gov (United States)

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 3.0 ENERGY STAR Program Requirements for Telephony (cordless telephones and VoIP...

  7. Wolf-Rayet stars

    Energy Technology Data Exchange (ETDEWEB)

    Sahade, J

    1981-12-01

    Aspects of the problems of the Wolf-Rayet stars related to their chemical composition, their evolutionary status, and their apparent dichotomy in two spectral sequences are discussed. Dogmas concerning WR stars are critically discussed, including the belief that WR stars lack hydrogen, that they are helium stars evolved from massive close binaries, and the existence of a second WR stage in which the star is a short-period single-lined binary. The relationship of WR stars with planetary nebulae is addressed, as is the membership of these stars in clusters and associations. The division of WR stars into WN and WC sequences is considered, questioning the reasonability of accounting for WR line formation in terms of abundance differences.

  8. Star formation: Cosmic feast

    Science.gov (United States)

    Scaringi, Simone

    2017-03-01

    Low-mass stars form through a process known as disk accretion, eating up material that orbits in a disk around them. It turns out that the same mechanism also describes the formation of more massive stars.

  9. CANDIDATE WATER VAPOR LINES TO LOCATE THE H{sub 2}O SNOWLINE THROUGH HIGH-DISPERSION SPECTROSCOPIC OBSERVATIONS. I. THE CASE OF A T TAURI STAR

    Energy Technology Data Exchange (ETDEWEB)

    Notsu, Shota; Ishimoto, Daiki [Department of Astronomy, Graduate School of Science, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Nomura, Hideko [Department of Earth and Planetary Science, Tokyo Institute of Technology, 2-12-1 Ookayama, Meguro-ku, Tokyo 152-8551 (Japan); Walsh, Catherine [Leiden Observatory, Leiden University, P.O. Box 9513, 2300 RA Leiden (Netherlands); Honda, Mitsuhiko [Department of Physics, School of Medicine, Kurume University, 67 Asahi-machi, Kurume, Fukuoka 830-0011 (Japan); Hirota, Tomoya [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Millar, T. J., E-mail: snotsu@kusastro.kyoto-u.ac.jp [Astrophysics Research Centre, School of Mathematics and Physics, Queen’s University Belfast, University Road, Belfast, BT7 1NN (United Kingdom)

    2016-08-20

    Inside the H{sub 2}O snowline of protoplanetary disks, water evaporates from the dust-grain surface into the gas phase, whereas it is frozen out onto the dust in the cold region beyond the snowline. H{sub 2}O ice enhances the solid material in the cold outer part of a disk, which promotes the formation of gas-giant planet cores. We can regard the H{sub 2}O snowline as the surface that divides the regions between rocky and gaseous giant planet formation. Thus observationally measuring the location of the H{sub 2}O snowline is crucial for understanding the planetesimal and planet formation processes, and the origin of water on Earth. In this paper, we find candidate water lines to locate the H{sub 2}O snowline through future high-dispersion spectroscopic observations. First, we calculate the chemical composition of the disk and investigate the abundance distributions of H{sub 2}O gas and ice, and the position of the H{sub 2}O snowline. We confirm that the abundance of H{sub 2}O gas is high not only in the hot midplane region inside the H{sub 2}O snowline but also in the hot surface layer of the outer disk. Second, we calculate the H{sub 2}O line profiles and identify those H{sub 2}O lines that are promising for locating the H{sub 2}O snowline: the identified lines are those that have small Einstein A coefficients and high upper state energies. The wavelengths of the candidate H{sub 2}O lines range from mid-infrared to sub-millimeter, and they overlap with the regions accessible to the Atacama Large Millimeter/sub-millimeter Array and future mid-infrared high-dispersion spectrographs (e.g., TMT/MICHI, SPICA).

  10. Autonomous Star Tracker Algorithms

    DEFF Research Database (Denmark)

    Betto, Maurizio; Jørgensen, John Leif; Kilsgaard, Søren

    1998-01-01

    Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances.......Proposal, in response to an ESA R.f.P., to design algorithms for autonomous star tracker operations.The proposal also included the development of a star tracker breadboard to test the algorithms performances....

  11. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jian-Ying; Ibragimov, Rashid

    2013-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting ...

  12. America's Star Libraries

    Science.gov (United States)

    Lyons, Ray; Lance, Keith Curry

    2009-01-01

    "Library Journal"'s new national rating of public libraries, the "LJ" Index of Public Library Service, identifies 256 "star" libraries. It rates 7,115 public libraries. The top libraries in each group get five, four, or three Michelin guide-like stars. All included libraries, stars or not, can use their scores to learn from their peers and improve…

  13. Microdeletion/microduplication of proximal 15q11.2 between BP1 and BP2: a susceptibility region for neurological dysfunction including developmental and language delay.

    Science.gov (United States)

    Burnside, Rachel D; Pasion, Romela; Mikhail, Fady M; Carroll, Andrew J; Robin, Nathaniel H; Youngs, Erin L; Gadi, Inder K; Keitges, Elizabeth; Jaswaney, Vikram L; Papenhausen, Peter R; Potluri, Venkateswara R; Risheg, Hiba; Rush, Brooke; Smith, Janice L; Schwartz, Stuart; Tepperberg, James H; Butler, Merlin G

    2011-10-01

    The proximal long arm of chromosome 15 has segmental duplications located at breakpoints BP1-BP5 that mediate the generation of NAHR-related microdeletions and microduplications. The classical Prader-Willi/Angelman syndrome deletion is flanked by either of the proximal BP1 or BP2 breakpoints and the distal BP3 breakpoint. The larger Type I deletions are flanked by BP1 and BP3 in both Prader-Willi and Angelman syndrome subjects. Those with this deletion are reported to have a more severe phenotype than individuals with either Type II deletions (BP2-BP3) or uniparental disomy 15. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes that are not imprinted. Reports of mutations or disturbed expression of these genes appear to impact behavioral and neurological function in affected individuals. Recently, reports of deletions and duplications flanked by BP1 and BP2 suggest an association with speech and motor delays, behavioral problems, seizures, and autism. We present a large cohort of subjects with copy number alteration of BP1 to BP2 with common phenotypic features. These include autism, developmental delay, motor and language delays, and behavioral problems, which were present in both cytogenetic groups. Parental studies demonstrated phenotypically normal carriers in several instances, and mildly affected carriers in others, complicating phenotypic association and/or causality. Possible explanations for these results include reduced penetrance, altered gene dosage on a particular genetic background, or a susceptibility region as reported for other areas of the genome implicated in autism and behavior disturbances.

  14. Validation of the Welch Allyn SureBP (inflation) and StepBP (deflation) algorithms by AAMI standard testing and BHS data analysis.

    Science.gov (United States)

    Alpert, Bruce S

    2011-04-01

    We evaluated two new Welch Allyn automated blood pressure (BP) algorithms. The first, SureBP, estimates BP during cuff inflation; the second, StepBP, does so during deflation. We followed the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard for testing and data analysis. The data were also analyzed using the British Hypertension Society analysis strategy. We tested children, adolescents, and adults. The requirements of the American National Standards Institute/Association for the Advancement of Medical Instrumentation SP10:2006 standard were fulfilled with respect to BP levels, arm sizes, and ages. Association for the Advancement of Medical Instrumentation SP10 Method 1 data analysis was used. The mean±standard deviation for the device readings compared with auscultation by paired, trained, blinded observers in the SureBP mode were -2.14±7.44 mmHg for systolic BP (SBP) and -0.55±5.98 mmHg for diastolic BP (DBP). In the StepBP mode, the differences were -3.61±6.30 mmHg for SBP and -2.03±5.30 mmHg for DBP. Both algorithms achieved an A grade for both SBP and DBP by British Hypertension Society analysis. The SureBP inflation-based algorithm will be available in many new-generation Welch Allyn monitors. Its use will reduce the time it takes to estimate BP in critical patient care circumstances. The device will not need to inflate to excessive suprasystolic BPs to obtain the SBP values. Deflation is rapid once SBP has been determined, thus reducing the total time of cuff inflation and reducing patient discomfort. If the SureBP fails to obtain a BP value, the StepBP algorithm is activated to estimate BP by traditional deflation methodology.

  15. BP-Mobil partnership. The common network takes place

    International Nuclear Information System (INIS)

    Anon.

    1997-01-01

    After the partnership between BP and Mobil was signed, the program of transformation of the petrol stations network started in November 1996 in the UK and concern 3300 stations in Europe and 800 stations in France. About 9100 stations will be transformed by the end of 1998. BP France is the operator for petroleum products (petrol, fuel, bitumens, LPG..) with a 70% share holding (30% for Mobil) while Mobil is the major shareholder (51%) for the lubricants and special products activities. The chemical, aviation nd maritime activities are not concerned. Thanks to the fusion of their down-file activities in Europe, the benefits of the partnership should reach 600 to 700 million of US Dollars each year. However the restructuring cost should reach 740 millions of US Dollars in two years, which doubles the initial estimation. Short paper. (J.S.)

  16. EST Table: BP183868 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP183868 P5PG0462 10/09/28 50 %/126 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 P5PG ...

  17. EST Table: BP126151 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP126151 ps4M0084 10/09/28 52 %/232 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 ps4M ...

  18. EST Table: BP182659 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182659 NRPG0886 10/09/28 51 %/153 aa ref|XP_001659582.1| xaa-pro dipeptidase pepd/pepq(e.coli...) [Aedes aegypti] gb|EAT39285.1| xaa-pro dipeptidase pepd/pepq(e.coli) [Aedes aegypti] 10/08/29 ...33738|ref|XP_971576.2| PREDICTED: similar to xaa-pro dipeptidase pepd/pepq(e.coli) [Tribolium castaneum] FS768084 NRPG ...

  19. Bank Organizational Structure Choice Dilemma. Case of PKO BP

    Directory of Open Access Journals (Sweden)

    Adam Szafarczyk

    2008-06-01

    Full Text Available Organizational structures are differing for different banks. They depend on individual bank economic situation, its technology, strategy and form of competition struggle. Usually the biggest EU banks are consists from formally or really independent divisions. The most common divisions are Retail Banking, Corporate Banking, Treasury and Investment, sometimes Insurance. PKO BP, the biggest Polish Bank, ought to change its structure due to implementation new IT system.

  20. EST Table: BP125370 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 10 56 %/150 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] FS906662 fbpv ... ...n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 55...BP125370 fbpv0758 10/09/28 56 %/150 aa ref|XP_967018.2| PREDICTED: similar to resti

  1. EST Table: BP182152 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP182152 NRPG0186 10/09/28 87 %/125 aa ref|NP_001098702.1| nanos-like protein [Bomb...yx mori] gb|ABS17681.1| nanos-like protein [Bombyx mori] 10/08/29 low homology 10/08/28 n.h 10/09/10 low homology 10/09/10 low homology 10/09/10 low homology NM_001105232 NRPG ...

  2. BP Canada Energy Company energy efficiency and GHG reduction opportunities

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, B. [BP Canada Energy Company, Calgary, AB (Canada)

    2004-07-01

    This paper presented an outline of the BP Canada Energy Company's energy efficiency program, which uses an innovative approach that relies on front line operations staff to generate, evaluate and implement ideas for energy reduction projects. An outline of the organization team was presented, with details of the small central Calgary group responsible for coordination, technical support and tracking of data. Key objectives of the team were identified as: the promotion of energy efficiency; sharing of best practices; and coordination of efforts at operations at both the development and corporate level. An outline of BP upstream operations and emissions reduction strategies was provided along with a timeline of BP Canada greenhouse gas (GHG) emissions and sustainable reductions projects. A chart representing energy savings through conversion to natural gas was also presented, sorted by project type. Results included over 400 GHG or energy reduction projects completed, with an average pay out of 30 months as well as 300,000 tonnes equivalent of GHGs reduced at an estimated value of of $13,000,000. Areas of focus for future projects include: compression; fired equipment; flaring; venting; and fugitive emissions. Strategies to reduce emissions in all areas of future research were also provided. tabs, figs.

  3. White Dwarf Stars

    OpenAIRE

    Kepler, S. O.; Romero, Alejandra Daniela; Pelisoli, Ingrid; Ourique, Gustavo

    2017-01-01

    White dwarf stars are the final stage of most stars, born single or in multiple systems. We discuss the identification, magnetic fields, and mass distribution for white dwarfs detected from spectra obtained by the Sloan Digital Sky Survey up to Data Release 13 in 2016, which lead to the increase in the number of spectroscopically identified white dwarf stars from 5000 to 39000. This number includes only white dwarf stars with log g >= 6.5 stars, i.e., excluding the Extremely Low Mass white dw...

  4. Rotating Stars in Relativity

    Directory of Open Access Journals (Sweden)

    Stergioulas Nikolaos

    2003-01-01

    Full Text Available Rotating relativistic stars have been studied extensively in recent years, both theoretically and observationally, because of the information they might yield about the equation of state of matter at extremely high densities and because they are considered to be promising sources of gravitational waves. The latest theoretical understanding of rotating stars in relativity is reviewed in this updated article. The sections on the equilibrium properties and on the nonaxisymmetric instabilities in f-modes and r-modes have been updated and several new sections have been added on analytic solutions for the exterior spacetime, rotating stars in LMXBs, rotating strange stars, and on rotating stars in numerical relativity.

  5. Nuclear physics of stars

    CERN Document Server

    Iliadis, Christian

    2015-01-01

    Most elements are synthesized, or ""cooked"", by thermonuclear reactions in stars. The newly formed elements are released into the interstellar medium during a star's lifetime, and are subsequently incorporated into a new generation of stars, into the planets that form around the stars, and into the life forms that originate on the planets. Moreover, the energy we depend on for life originates from nuclear reactions that occur at the center of the Sun. Synthesis of the elements and nuclear energy production in stars are the topics of nuclear astrophysics, which is the subject of this book

  6. Spectrographic study of λ 4200 silicon particular stars

    International Nuclear Information System (INIS)

    Didelon, Pierre

    1983-01-01

    This research thesis reports a spectrographic study of sample of particular stars belonging to the Si(II) λ 4200 subgroup which builds up the hot end of conventional 'Ap,Bp' stars. Twenty snapshots taken at the Haute-Provence observatory have been studied and compared with the observation of 17 standard stars. All these snapshots have been digitalised and processed. This allowed the identification of lines which indicated the presence of gallium and the absence of manganese which contradicts the close correlation between these elements that was generally admitted. An inexplicable and until now non observed duplication of Si(II) lines has also been observed. The problem of spectral classification of these stars has been studied. In order to study the concerned stars without calculation of atmospheric models, a comparative method between group stars and reference stars has been used. Results are discussed and seem to indicate an erratic and non-correlated behaviour of light elements (C, Mg, Ca, Si), and a presence of heavier elements (Ga, Sr) and rare earths (Eu, Gd) only when elements of the iron peak are stronger [fr

  7. Evolution of variable stars

    International Nuclear Information System (INIS)

    Becker, S.A.

    1986-08-01

    Throughout the domain of the H R diagram lie groupings of stars whose luminosity varies with time. These variable stars can be classified based on their observed properties into distinct types such as β Cephei stars, δ Cephei stars, and Miras, as well as many other categories. The underlying mechanism for the variability is generally felt to be due to four different causes: geometric effects, rotation, eruptive processes, and pulsation. In this review the focus will be on pulsation variables and how the theory of stellar evolution can be used to explain how the various regions of variability on the H R diagram are populated. To this end a generalized discussion of the evolutionary behavior of a massive star, an intermediate mass star, and a low mass star will be presented. 19 refs., 1 fig., 1 tab

  8. Star-Branched Polymers (Star Polymers)

    KAUST Repository

    Hirao, Akira; Hayashi, Mayumi; Ito, Shotaro; Goseki, Raita; Higashihara, Tomoya; Hadjichristidis, Nikolaos

    2015-01-01

    The synthesis of well-defined regular and asymmetric mixed arm (hereinafter miktoarm) star-branched polymers by the living anionic polymerization is reviewed in this chapter. In particular, much attention is being devoted to the synthetic

  9. ULTRA-LOW AMPLITUDE VARIABLES IN THE LARGE MAGELLANIC CLOUD-CLASSICAL CEPHEIDS, POP. II CEPHEIDS, RV TAU STARS, AND BINARY VARIABLES

    International Nuclear Information System (INIS)

    Robert Buchler, J.; Wood, Peter R.; Soszynski, Igor

    2009-01-01

    A search for variable stars with ultra-low amplitudes (ULAs), in the millimagnitude range, has been made in the combined MACHO and OGLE databases in the broad vicinity of the Cepheid instability strip in the HR diagram. A total of 25 singly periodic and 4 multiply periodic ULA objects have been uncovered. Our analysis does not allow us to distinguish between pulsational and ellipsoidal (binary) variabilities, nor between Large Magellanic Cloud (LMC) and foreground objects. However, the objects are strongly clustered and appear to be associated with the pulsational instability strips of LMC Pop. I and II variables. When combined with the ULA variables of Buchler et al., a total of 20 objects fall close to the classical Cepheid instability strip. However, they appear to fall on parallel period-magnitude (PM) relations that are shifted to slightly higher magnitude which would confer them a different evolutionary status. Low-amplitude RV Tauri and Pop. II Cepheids have been uncovered that do not appear in the MACHO or OGLE catalogs. Interestingly, a set of binaries seem to lie on a PM relation that is essentially parallel to that of the RV Tauri/Pop. II Cepheids.

  10. Functional characterization of the NhaA Na+/H+ antiporter from the green picoalga Ostreococcus tauri.

    Science.gov (United States)

    Dawut, Keatisuda; Sirisattha, Sophon; Hibino, Takashi; Kageyama, Hakuto; Waditee-Sirisattha, Rungaroon

    2018-07-01

    Transmembrane ion transport is a critical process in the cellular response to salt stress. Among the known functional membrane transporters that are involved in the salt stress response, Na + /H + antiporters have been extensively studied. These ubiquitous membrane proteins are crucial for salt tolerance and are associated with the regulation of internal pH, cell volume, morphogenesis, and vesicular trafficking. Molecular and functional analyses of Na + /H + antiporters have been characterized among taxa but little is known about algal Na + /H + antiporters. Here, we analyzed putative Na + /H + antiporters from the complete genome sequence of the marine picoalga Ostreococcus tauri. At least 10 putative Na + /H + antiporters belonging to the SOS1, NHX, and KEA/Kef families were found. Surprisingly, a bacterial type NhaA sequence (OtNhaA) was also found. Topological modeling of OtNhaA predicted 12 possible transmembrane segments with a long N-terminus. The full-length (FL_OtNhaA) and N-terminal truncated (ΔN112_OtNhaA) versions of OtNhaA were constructed, expressed in the salt-sensitive mutant Escherichia coli TO114, and functionally characterized. Complementation analysis revealed that FL_OtNhaA- and ΔN112_OtNhaA-expressing cells exhibited increased tolerance to high NaCl concentrations up to 700 mM. Antiporter activity assays showed that both FL_OtNhaA and ΔN112_OtNhaA proteins predominantly exhibited Na + /H + and Ca 2+ /H + antiporter activities at alkaline pH conditions. Intriguingly, the ΔN112_OtNhaA exhibited higher Na + /H + and Ca 2+ /H + antiporter activities compared to FL_OtNhaA. Kinetic analysis revealed that FL_OtNhaA has a high affinity for Na + and Ca 2+ ions with a K m of 1.1 ± 0.23 mM for Na + (at pH 8.5) and a K m of 0.3 ± 0.07 mM for Ca 2+ (at pH 8.5). Since NhaA has shown striking diversity among taxa, our results provide insight into the functional properties of the algal NhaA Na + /H + antiporter. These results will

  11. Star-Branched Polymers (Star Polymers)

    KAUST Repository

    Hirao, Akira

    2015-09-01

    The synthesis of well-defined regular and asymmetric mixed arm (hereinafter miktoarm) star-branched polymers by the living anionic polymerization is reviewed in this chapter. In particular, much attention is being devoted to the synthetic development of miktoarm star polymers since 2000. At the present time, the almost all types of multiarmed and multicomponent miktoarm star polymers have become feasible by using recently developed iterative strategy. For example, the following well-defined stars have been successfully synthesized: 3-arm ABC, 4-arm ABCD, 5-arm ABCDE, 6-arm ABCDEF, 7-arm ABCDEFG, 6-arm ABC, 9-arm ABC, 12-arm ABC, 13-arm ABCD, 9-arm AB, 17-arm AB, 33-arm AB, 7-arm ABC, 15-arm ABCD, and 31-arm ABCDE miktoarm star polymers, most of which are quite new and difficult to synthesize by the end of the 1990s. Several new specialty functional star polymers composed of vinyl polymer segments and rigid rodlike poly(acetylene) arms, helical polypeptide, or helical poly(hexyl isocyanate) arms are introduced.

  12. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9x10 -5

  13. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1994-01-01

    This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 x 10 5

  14. Feasibility study report for the 200-BP-1 operable unit

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9{times}10{sup {minus}5}.

  15. CN rings in full protoplanetary disks around young stars as probes of disk structure

    Science.gov (United States)

    Cazzoletti, P.; van Dishoeck, E. F.; Visser, R.; Facchini, S.; Bruderer, S.

    2018-01-01

    Aims: Bright ring-like structure emission of the CN molecule has been observed in protoplanetary disks. We investigate whether such structures are due to the morphology of the disk itself or if they are instead an intrinsic feature of CN emission. With the intention of using CN as a diagnostic, we also address to which physical and chemical parameters CN is most sensitive. Methods: A set of disk models were run for different stellar spectra, masses, and physical structures via the 2D thermochemical code DALI. An updated chemical network that accounts for the most relevant CN reactions was adopted. Results: Ring-shaped emission is found to be a common feature of all adopted models; the highest abundance is found in the upper outer regions of the disk, and the column density peaks at 30-100 AU for T Tauri stars with standard accretion rates. Higher mass disks generally show brighter CN. Higher UV fields, such as those appropriate for T Tauri stars with high accretion rates or for Herbig Ae stars or for higher disk flaring, generally result in brighter and larger rings. These trends are due to the main formation paths of CN, which all start with vibrationally excited H_2^* molecules, that are produced through far ultraviolet (FUV) pumping of H2. The model results compare well with observed disk-integrated CN fluxes and the observed location of the CN ring for the TW Hya disk. Conclusions: CN rings are produced naturally in protoplanetary disks and do not require a specific underlying disk structure such as a dust cavity or gap. The strong link between FUV flux and CN emission can provide critical information regarding the vertical structure of the disk and the distribution of dust grains which affects the UV penetration, and could help to break some degeneracies in the SED fitting. In contrast with C2H or c-C3H2, the CN flux is not very sensitive to carbon and oxygen depletion.

  16. BP and sustainable development and biodiversity in Azerbaijan

    International Nuclear Information System (INIS)

    Grant, Vidrine; Askerov, Faig

    2002-01-01

    Full text: BP takes its commitment to the environmental extremely seriously. BP believes it is essential to ensure that our operations and activities comply with the environmental standards in our PSAs and with the laws of Azerbaijan. To achieve this we have developed Environmental Operating Procedures. These procedures are currently being audited and we expect to receive ISO 14001 certification for all of our operations. Together with our Emergency Response and Oil Spill Response Plans we are able to manage our operations to ensure minimum impact and regulatory compliance. Additional, AIOC contributed to opening the Caspian Environmental Laboratory in 1999 to provide on a commercial basis, environmental services in Azerbaijan of an internationally recognized standard. We have conducted many other activities to promote biodiversity. In absence of the appropriate infrastructure we have built a waste management site at Serenja where we are currently disposing of synthetic based muds from our offshore drilling operations. We have also developed and implemented a Research and Monitoring Program in co-operation with representatives from SOCAR, Academy of Sciences, Azgipromorneftegaz and State Committee of Ecology. We have conducted Seals mortality investigation, Birds monitoring, Fish monitoring, Offshore surveys studying macrobenthos, water chemistry, sediments, groundwater monitoring, re-vegetation, etc. In developing our overall strategy BP has set some long term environmental aspirations or expectations: stop the use of halocarbons; to reduce Green House Gases by 10% by 20 lOin comparison with baseline data for 1990; stop venting and flaring; stop discharges to water of synthetic and oil based muds. BP recognizes that this is a goal. It is something we commit to and aspire to achieve and something we are wise enough to realize cannot be achieved overnight. None-the-less, it is something we constantly work towards. We also realize that this goal cannot be achieved in

  17. Risk assessment of logistics outsourcing based on BP neural network

    Science.gov (United States)

    Liu, Xiaofeng; Tian, Zi-you

    The purpose of this article is to evaluate the risk of the enterprises logistics outsourcing. To get this goal, the paper first analysed he main risks existing in the logistics outsourcing, and then set up a risk evaluation index system of the logistics outsourcing; second applied BP neural network into the logistics outsourcing risk evaluation and used MATLAB to the simulation. It proved that the network error is small and has strong practicability. And this method can be used by enterprises to evaluate the risks of logistics outsourcing.

  18. EST Table: BP183486 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available n (Reed-Steinberg cell-expressed intermediate filament-associated protein) [Tribolium castaneum] 10/08/29 56...43 aa gnl|Amel|GB30360-PB 10/09/10 54 %/174 aa gi|189241063|ref|XP_967018.2| PREDICTED: similar to restin (Reed-Steinberg cell-expres...sed intermediate filament-associated protein) [Tribolium castaneum] FS906662 NRPG ... ...BP183486 NRPG1970 10/09/28 54 %/174 aa ref|XP_967018.2| PREDICTED: similar to resti

  19. Assembly of human C-terminal binding protein (CtBP) into tetramers.

    Science.gov (United States)

    Bellesis, Andrew G; Jecrois, Anne M; Hayes, Janelle A; Schiffer, Celia A; Royer, William E

    2018-06-08

    C-terminal binding protein 1 (CtBP1) and CtBP2 are transcriptional coregulators that repress numerous cellular processes, such as apoptosis, by binding transcription factors and recruiting chromatin-remodeling enzymes to gene promoters. The NAD(H)-linked oligomerization of human CtBP is coupled to its co-transcriptional activity, which is implicated in cancer progression. However, the biologically relevant level of CtBP assembly has not been firmly established; nor has the stereochemical arrangement of the subunits above that of a dimer. Here, multi-angle light scattering (MALS) data established the NAD + - and NADH-dependent assembly of CtBP1 and CtBP2 into tetramers. An examination of subunit interactions within CtBP1 and CtBP2 crystal lattices revealed that both share a very similar tetrameric arrangement resulting from assembly of two dimeric pairs, with specific interactions probably being sensitive to NAD(H) binding. Creating a series of mutants of both CtBP1 and CtBP2, we tested the hypothesis that the crystallographically observed interdimer pairing stabilizes the solution tetramer. MALS data confirmed that these mutants disrupt both CtBP1 and CtBP2 tetramers, with the dimer generally remaining intact, providing the first stereochemical models for tetrameric assemblies of CtBP1 and CtBP2. The crystal structure of a subtle destabilizing mutant suggested that small structural perturbations of the hinge region linking the substrate- and NAD-binding domains are sufficient to weaken the CtBP1 tetramer. These results strongly suggest that the tetramer is important in CtBP function, and the series of CtBP mutants reported here can be used to investigate the physiological role of the tetramer. © 2018 Bellesis et al.

  20. Massive stars in galaxies

    International Nuclear Information System (INIS)

    Humphreys, R.M.

    1987-01-01

    The relationship between the morphologic type of a galaxy and the evolution of its massive stars is explored, reviewing observational results for nearby galaxies. The data are presented in diagrams, and it is found that the massive-star populations of most Sc spiral galaxies and irregular galaxies are similar, while those of Sb spirals such as M 31 and M 81 may be affected by morphology (via differences in the initial mass function or star-formation rate). Consideration is also given to the stability-related upper luminosity limit in the H-R diagram of hypergiant stars (attributed to radiation pressure in hot stars and turbulence in cool stars) and the goals of future observation campaigns. 88 references

  1. Evolution of massive stars

    International Nuclear Information System (INIS)

    Loore, C. de

    1984-01-01

    The evolution of stars with masses larger than 15 sun masses is reviewed. These stars have large convective cores and lose a substantial fraction of their matter by stellar wind. The treatment of convection and the parameterisation of the stellar wind mass loss are analysed within the context of existing disagreements between theory and observation. The evolution of massive close binaries and the origin of Wolf-Rayet Stars and X-ray binaries is also sketched. (author)

  2. Fast pulsars, strange stars

    International Nuclear Information System (INIS)

    Glendenning, N.K.

    1990-02-01

    The initial motivation for this work was the reported discovery in January 1989 of a 1/2 millisecond pulsar in the remnant of the spectacular supernova, 1987A. The status of this discovery has come into grave doubt as of data taken by the same group in February, 1990. At this time we must consider that the millisecond signal does not belong to the pulsar. The existence of a neutron star in remnant of the supernova is suspected because of recent observations on the light curve of the remnant, and of course by the neutrino burst that announced the supernova. However its frequency is unknown. I can make a strong case that a pulsar rotation period of about 1 ms divides those that can be understood quite comfortably as neutron stars, and those that cannot. What we will soon learn is whether there is an invisible boundary below which pulsar periods do not fall, in which case, all are presumable neutron stars, or whether there exist sub- millisecond pulsars, which almost certainly cannot be neutron stars. Their most plausible structure is that of a self-bound star, a strange-quark-matter star. The existence of such stars would imply that the ground state of the strong interaction is not, as we usually assume, hadronic matter, but rather strange quark matter. Let us look respectively at stars that are bound only by gravity, and hypothetical stars that are self-bound, for which gravity is so to speak, icing on the cake

  3. Covering tree with stars

    DEFF Research Database (Denmark)

    Baumbach, Jan; Guo, Jiong; Ibragimov, Rashid

    2015-01-01

    We study the tree edit distance problem with edge deletions and edge insertions as edit operations. We reformulate a special case of this problem as Covering Tree with Stars (CTS): given a tree T and a set of stars, can we connect the stars in by adding edges between them such that the resulting...... tree is isomorphic to T? We prove that in the general setting, CST is NP-complete, which implies that the tree edit distance considered here is also NP-hard, even when both input trees having diameters bounded by 10. We also show that, when the number of distinct stars is bounded by a constant k, CTS...

  4. Introduction to neutron stars

    Energy Technology Data Exchange (ETDEWEB)

    Lattimer, James M. [Dept. of Physics and Astronomy, Stony Brook University, Stony Brook, NY 11794-3800 (United States)

    2015-02-24

    Neutron stars contain the densest form of matter in the present universe. General relativity and causality set important constraints to their compactness. In addition, analytic GR solutions are useful in understanding the relationships that exist among the maximum mass, radii, moments of inertia, and tidal Love numbers of neutron stars, all of which are accessible to observation. Some of these relations are independent of the underlying dense matter equation of state, while others are very sensitive to the equation of state. Recent observations of neutron stars from pulsar timing, quiescent X-ray emission from binaries, and Type I X-ray bursts can set important constraints on the structure of neutron stars and the underlying equation of state. In addition, measurements of thermal radiation from neutron stars has uncovered the possible existence of neutron and proton superfluidity/superconductivity in the core of a neutron star, as well as offering powerful evidence that typical neutron stars have significant crusts. These observations impose constraints on the existence of strange quark matter stars, and limit the possibility that abundant deconfined quark matter or hyperons exist in the cores of neutron stars.

  5. Strangeon and Strangeon Star

    Science.gov (United States)

    Xiaoyu, Lai; Renxin, Xu

    2017-06-01

    The nature of pulsar-like compact stars is essentially a central question of the fundamental strong interaction (explained in quantum chromo-dynamics) at low energy scale, the solution of which still remains a challenge though tremendous efforts have been tried. This kind of compact objects could actually be strange quark stars if strange quark matter in bulk may constitute the true ground state of the strong-interaction matter rather than 56Fe (the so-called Witten’s conjecture). From astrophysical points of view, however, it is proposed that strange cluster matter could be absolutely stable and thus those compact stars could be strange cluster stars in fact. This proposal could be regarded as a general Witten’s conjecture: strange matter in bulk could be absolutely stable, in which quarks are either free (for strange quark matter) or localized (for strange cluster matter). Strange cluster with three-light-flavor symmetry is renamed strangeon, being coined by combining “strange nucleon” for the sake of simplicity. A strangeon star can then be thought as a 3-flavored gigantic nucleus, and strangeons are its constituent as an analogy of nucleons which are the constituent of a normal (micro) nucleus. The observational consequences of strangeon stars show that different manifestations of pulsarlike compact stars could be understood in the regime of strangeon stars, and we are expecting more evidence for strangeon star by advanced facilities (e.g., FAST, SKA, and eXTP).

  6. Interacting binary stars

    CERN Document Server

    Sahade, Jorge; Ter Haar, D

    1978-01-01

    Interacting Binary Stars deals with the development, ideas, and problems in the study of interacting binary stars. The book consolidates the information that is scattered over many publications and papers and gives an account of important discoveries with relevant historical background. Chapters are devoted to the presentation and discussion of the different facets of the field, such as historical account of the development in the field of study of binary stars; the Roche equipotential surfaces; methods and techniques in space astronomy; and enumeration of binary star systems that are studied

  7. Polarization of Be stars

    International Nuclear Information System (INIS)

    Johns, M.W.

    1975-01-01

    Linear polarization of starlight may be produced by electron scattering in the extended atmospheres of early type stars. Techniques are investigated for the measurement and interpretation of this polarization. Polarimetric observations were made of twelve visual double star systems in which at least one member was a B type star as a means of separating the intrinsic stellar polarization from the polarization produced in the interstellar medium. Four of the double stars contained a Be star. Evidence for intrinsic polarization was found in five systems including two of the Be systems, one double star with a short period eclipsing binary, and two systems containing only normal early type stars for which emission lines have not been previously reported. The interpretation of these observations in terms of individual stellar polarizations and their wavelength dependence is discussed. The theoretical basis for the intrinsic polarization of early type stars is explored with a model for the disk-like extended atmospheres of Be stars. Details of a polarimeter for the measurement of the linear polarization of astronomical point sources are also presented with narrow band (Δ lambda = 100A) measurements of the polarization of γ Cas from lambda 4000 to lambda 5800

  8. ENERGY STAR Unit Reports

    Data.gov (United States)

    Department of Housing and Urban Development — These quarterly Federal Fiscal Year performance reports track the ENERGY STAR qualified HOME units that Participating Jurisdictions record in HUD's Integrated...

  9. Effect of turmeric and curcumin on BP-DNA adducts.

    Science.gov (United States)

    Mukundan, M A; Chacko, M C; Annapurna, V V; Krishnaswamy, K

    1993-03-01

    Many human cancers that are widely prevalent today can be prevented through modifications in life-styles, of which diet appears to be an important agent. Several dietary constituents modulate the process of carcinogenesis and prevent genotoxicity. Many plant constituents including turmeric appear to be potent antimutagens and antioxidants. Therefore the modulatory effects of turmeric and curcumin on the levels of benzo[a]pyrene induced DNA adducts in the livers of rats were studied by the newly developed 32P-postlabelling assay method. Turmeric when fed at 0.1, 0.5 and 3% and the active principle of turmeric (curcumin) when fed at a level of 0.03% in the diet for 4 weeks significantly reduced the level of BP-DNA adducts including the major adduct dG-N2-BP, formed within 24 h in response to a single i.p. injection of benzo[a]pyrene. The significance of these effects in terms of the potential anticarcinogenic effects of turmeric is discussed. Further, these results strengthen the various other biological effects of turmeric which have direct relevance to anticarcinogenesis and chemoprevention.

  10. Research on AHP decision algorithms based on BP algorithm

    Science.gov (United States)

    Ma, Ning; Guan, Jianhe

    2017-10-01

    Decision making is the thinking activity that people choose or judge, and scientific decision-making has always been a hot issue in the field of research. Analytic Hierarchy Process (AHP) is a simple and practical multi-criteria and multi-objective decision-making method that combines quantitative and qualitative and can show and calculate the subjective judgment in digital form. In the process of decision analysis using AHP method, the rationality of the two-dimensional judgment matrix has a great influence on the decision result. However, in dealing with the real problem, the judgment matrix produced by the two-dimensional comparison is often inconsistent, that is, it does not meet the consistency requirements. BP neural network algorithm is an adaptive nonlinear dynamic system. It has powerful collective computing ability and learning ability. It can perfect the data by constantly modifying the weights and thresholds of the network to achieve the goal of minimizing the mean square error. In this paper, the BP algorithm is used to deal with the consistency of the two-dimensional judgment matrix of the AHP.

  11. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Directory of Open Access Journals (Sweden)

    Azamat Aslanukov

    2006-10-01

    Full Text Available The Ran-binding protein 2 (RanBP2 is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/- are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/- mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  12. RanBP2 modulates Cox11 and hexokinase I activities and haploinsufficiency of RanBP2 causes deficits in glucose metabolism.

    Science.gov (United States)

    Aslanukov, Azamat; Bhowmick, Reshma; Guruju, Mallikarjuna; Oswald, John; Raz, Dorit; Bush, Ronald A; Sieving, Paul A; Lu, Xinrong; Bock, Cheryl B; Ferreira, Paulo A

    2006-10-01

    The Ran-binding protein 2 (RanBP2) is a large multimodular and pleiotropic protein. Several molecular partners with distinct functions interacting specifically with selective modules of RanBP2 have been identified. Yet, the significance of these interactions with RanBP2 and the genetic and physiological role(s) of RanBP2 in a whole-animal model remain elusive. Here, we report the identification of two novel partners of RanBP2 and a novel physiological role of RanBP2 in a mouse model. RanBP2 associates in vitro and in vivo and colocalizes with the mitochondrial metallochaperone, Cox11, and the pacemaker of glycolysis, hexokinase type I (HKI) via its leucine-rich domain. The leucine-rich domain of RanBP2 also exhibits strong chaperone activity toward intermediate and mature folding species of Cox11 supporting a chaperone role of RanBP2 in the cytosol during Cox11 biogenesis. Cox11 partially colocalizes with HKI, thus supporting additional and distinct roles in cell function. Cox11 is a strong inhibitor of HKI, and RanBP2 suppresses the inhibitory activity of Cox11 over HKI. To probe the physiological role of RanBP2 and its role in HKI function, a mouse model harboring a genetically disrupted RanBP2 locus was generated. RanBP2(-/-) are embryonically lethal, and haploinsufficiency of RanBP2 in an inbred strain causes a pronounced decrease of HKI and ATP levels selectively in the central nervous system. Inbred RanBP2(+/-) mice also exhibit deficits in growth rates and glucose catabolism without impairment of glucose uptake and gluconeogenesis. These phenotypes are accompanied by a decrease in the electrophysiological responses of photosensory and postreceptoral neurons. Hence, RanBP2 and its partners emerge as critical modulators of neuronal HKI, glucose catabolism, energy homeostasis, and targets for metabolic, aging disorders and allied neuropathies.

  13. Correlation of expression of BP1, a homeobox gene, with estrogen receptor status in breast cancer

    International Nuclear Information System (INIS)

    Fu, Sidney W; Poola, Indira; Stephan, Dietrich A; Berg, Patricia E; Schwartz, Arnold; Stevenson, Holly; Pinzone, Joseph J; Davenport, Gregory J; Orenstein, Jan M; Gutierrez, Peter; Simmens, Samuel J; Abraham, Jessy

    2003-01-01

    BP1 is a novel homeobox gene cloned in our laboratory. Our previous studies in leukemia demonstrated that BP1 has oncogenic properties, including as a modulator of cell survival. Here BP1 expression was examined in breast cancer, and the relationship between BP1 expression and clinicopathological data was determined. Total RNA was isolated from cell lines, tumors, and matched normal adjacent tissue or tissue from autopsy. Reverse transcription polymerase chain reaction was performed to evaluate BP1 expression. Statistical analysis was accomplished with SAS. Analysis of 46 invasive ductal breast tumors demonstrated BP1 expression in 80% of them, compared with a lack of expression in six normal breast tissues and low-level expression in one normal breast tissue. Remarkably, 100% of tumors that were negative for the estrogen receptor (ER) were BP1-positive, whereas 73% of ER-positive tumors expressed BP1 (P = 0.03). BP1 expression was also associated with race: 89% of the tumors of African American women were BP1-positive, whereas 57% of those from Caucasian women expressed BP1 (P = 0.04). However, there was no significant difference in BP1 expression between grades I, II, and III tumors. Interestingly, BP1 mRNA expression was correlated with the ability of malignant cell lines to cause breast cancer in mice. Because BP1 is expressed abnormally in breast tumors, it could provide a useful target for therapy, particularly in patients with ER-negative tumors. The frequent expression of BP1 in all tumor grades suggests that activation of BP1 is an early event

  14. Polymer-Based Black Phosphorus (bP) Hybrid Materials by in Situ Radical Polymerization: An Effective Tool To Exfoliate bP and Stabilize bP Nanoflakes

    Science.gov (United States)

    2018-01-01

    Black phosphorus (bP) has been recently investigated for next generation nanoelectronic multifunctional devices. However, the intrinsic instability of exfoliated bP (the bP nanoflakes) toward both moisture and air has so far overshadowed its practical implementation. In order to contribute to fill this gap, we report here the preparation of new hybrid polymer-based materials where bP nanoflakes (bPn) exhibit a significantly improved stability. The new materials have been prepared by different synthetic paths including: (i) the mixing of conventionally liquid-phase exfoliated bP (in dimethyl sulfoxide, DMSO) with poly(methyl methacrylate) (PMMA) solution; (ii) the direct exfoliation of bP in a polymeric solution; (iii) the in situ radical polymerization after exfoliating bP in the liquid monomer (methyl methacrylate, MMA). This last methodology concerns the preparation of stable suspensions of bPn–MMA by sonication-assisted liquid-phase exfoliation (LPE) of bP in the presence of MMA followed by radical polymerization. The hybrids characteristics have been compared in order to evaluate the bP dispersion and the effectiveness of the bPn interfacial interactions with polymer chains aimed at their long-term environmental stabilization. The passivation of the bPn is particularly effective when the hybrid material is prepared by in situ polymerization. By using this synthetic methodology, the nanoflakes, even if with a gradient of dispersion (size of aggregates), preserve their chemical structure from oxidation (as proved by both Raman and 31P-solid state NMR studies) and are particularly stable to air and UV light exposure. The feasibility of this approach, capable of efficiently exfoliating bP while protecting the bPn, has been then verified by using different vinyl monomers (styrene and N-vinylpyrrolidone), thus obtaining hybrids where the nanoflakes are embedded in polymer matrices with a variety of intriguing thermal, mechanical, and solubility characteristics.

  15. DISK BRAKING IN YOUNG STARS: PROBING ROTATION IN CHAMAELEON I AND TAURUS-AURIGA

    International Nuclear Information System (INIS)

    Duy Cuong Nguyen; Jayawardhana, Ray; Van Kerkwijk, Marten H.; Damjanov, Ivana; Brandeker, Alexis; Scholz, Alexander

    2009-01-01

    We present a comprehensive study of rotation, disk, and accretion signatures for 144 T Tauri stars in the young (∼2 Myr old) Chamaeleon I and Taurus-Auriga star-forming regions based on multi-epoch high-resolution optical spectra from the Magellan Clay 6.5 m telescope supplemented by mid-infrared photometry from the Spitzer Space Telescope. In contrast to previous studies in the Orion Nebula Cluster and NGC 2264, we do not see a clear signature of disk braking in Tau-Aur and Cha I. We find that both accretors and non-accretors have similar distributions of vsin i. This result could be due to different initial conditions, insufficient time for disk braking, or a significant age spread within the regions. The rotational velocities in both regions show a clear mass dependence, with F-K stars rotating on average about twice as fast as M stars, consistent with results reported for other clusters of similar age. Similarly, we find the upper envelope of the observed values of specific angular momentum j varies as M 0.5 for our sample which spans a mass range of ∼0.16-3 M sun . This power law complements previous studies in Orion which estimated j ∝ M 0.25 for ∼ sun . Furthermore, the overall specific angular momentum of this ∼10 Myr population is five times lower than that of non-accretors in our sample, and implies a stellar braking mechanism other than disk braking could be at work. For a subsample of 67 objects with mid-infrared photometry, we examine the connection between accretion signatures and dusty disks: in the vast majority of cases (63/67), the two properties correlate well, which suggests that the timescale of gas accretion is similar to the lifetime of inner disks.

  16. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  17. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    International Nuclear Information System (INIS)

    Kanginakudru, Sriramana; DeSmet, Marsha; Thomas, Yanique; Morgan, Iain M.; Androphy, Elliot J.

    2015-01-01

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication

  18. INTCAL09 AND MARINE09 RADIOCARBON AGE CALIBRATION CURVES, 0-50,000 YEARS CAL BP

    NARCIS (Netherlands)

    Reimer, P. J.; Baillie, M. G. L.; Bard, E.; Bayliss, A.; Beck, J. W.; Blackwell, P. G.; Ramsey, C. Bronk; Buck, C. E.; Burr, G. S.; Edwards, R. L.; Friedrich, M.; Grootes, P. M.; Guilderson, T. P.; Hajdas, I.; Heaton, T. J.; Hogg, A. G.; Hughen, K. A.; Kaiser, K. F.; Kromer, B.; McCormac, F. G.; Manning, S. W.; Reimer, R. W.; Richards, D. A.; Southon, J. R.; Talamo, S.; Turney, C. S. M.; van der Plicht, J.; Weyhenmeye, C. E.; Weyhenmeyer, C.E.

    2009-01-01

    The IntCal04 and Marine04 radiocarbon calibration curves have been updated from 12 cal kBP (cal kBP is here defined as thousands of calibrated years before AD 1950), and extended to 50 cal kBP, utilizing newly available data sets that meet the IntCal Working Group criteria for pristine corals and

  19. 76 FR 69713 - Application To Export Electric Energy; BP Energy Company

    Science.gov (United States)

    2011-11-09

    ... DEPARTMENT OF ENERGY [OE Docket No. EA-314-A] Application To Export Electric Energy; BP Energy.... SUMMARY: BP Energy Company (BP Energy) has applied to renew its authority to transmit electric energy from... electric energy from the United States to Mexico as a power marketer for a five-year term using existing...

  20. Stars and Flowers, Flowers and Stars

    Science.gov (United States)

    Minti, Hari

    2012-12-01

    The author, a graduated from the Bucharest University (1964), actually living and working in Israel, concerns his book to variable stars and flowers, two domains of his interest. The analogies includes double stars, eclipsing double stars, eclipses, Big Bang. The book contains 34 chapters, each of which concerns various relations between astronomy and other sciences and pseudosciences such as Psychology, Religion, Geology, Computers and Astrology (to which the author is not an adherent). A special part of the book is dedicated to archeoastronomy and ethnoastronomy, as well as to history of astronomy. Between the main points of interest of these parts: ancient sanctuaries in Sarmizegetusa (Dacia), Stone Henge(UK) and other. The last chapter of the book is dedicated to flowers. The book is richly illustrated. It is designed for a wide circle of readers.

  1. The convective photosphere of the red supergiant CE Tauri. I. VLTI/PIONIER H-band interferometric imaging

    Science.gov (United States)

    Montargès, M.; Norris, R.; Chiavassa, A.; Tessore, B.; Lèbre, A.; Baron, F.

    2018-06-01

    Context. Red supergiant stars are one of the latest stages in the evolution of massive stars. Their photospheric convection may play an important role in the launching mechanism of their mass loss; however, its characteristics and dynamics are still poorly constrained. Aims: By observing red supergiant stars with near infrared interferometry at different epochs, we expect to reveal the evolution of bright convective features on their stellar surface. Methods: We observed the M2Iab-Ib red supergiant star CE Tau with the VLTI/PIONIER instrument in the H band at two different epochs separated by one month. Results: We derive the angular diameter of the star and basic stellar parameters, and reconstruct two reliable images of its H-band photosphere. The contrast of the convective pattern of the reconstructed images is 5 ± 1% and 6 ± 1% for our two epochs of observation. Conclusions: The stellar photosphere shows few changes between the two epochs. The contrast of the convective pattern is below the average contrast variations obtained on 30 randomly chosen snapshots of the best matching 3D radiative hydrodynamics simulation: 23 ± 1% for the original simulation images and 16 ± 1% for the maps degraded to the reconstruction resolution. We offer two hypotheses to explain this observation. CE Tau may be experiencing a quiet convective activity episode or it could be a consequence of its warmer effective temperature (hence its smaller radius) compared to the simulation. Based on observations collected at the European Organisation for Astronomical Research in the Southern Hemisphere under ESO programs 298.D-5005(A) and 298.D-5005(B).Reconstructed images as FITS files and basic stellar parameters are available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/614/A12Animated gif of the two epochs is available at http://https://www.aanda.org

  2. Modification of the Clinical Global Impressions (CGI) Scale for use in bipolar illness (BP): the CGI-BP.

    Science.gov (United States)

    Spearing, M K; Post, R M; Leverich, G S; Brandt, D; Nolen, W

    1997-12-05

    The Clinical Global Impressions Scale (CGI) was modified specifically for use in assessing global illness severity and change in patients with bipolar disorder. Criticisms of the original CGI were addressed by correcting inconsistencies in scaling, identifying time frames for comparison, clarifying definitions of illness severity and change, and separating out assessment of treatment side effects from illness improvement during treatment. A Detailed User's Guide was developed to train clinicians in the use of the new CGI-Bipolar Version (CGI-BP) for rating severity of manic and depressive episodes and the degree of change from the immediately preceding phase and from the worst phase of illness. The revised scale and manual provide a focused set of instructions to facilitate the reliability of these ratings of mania, depression, and overall bipolar illness during treatment of an acute episode or in longer-term illness prophylaxis. Interrater reliability of the scale was demonstrated in preliminary analyses. Thus, the modified CGI-BP is anticipated to be more useful than the original CGI in studies of bipolar disorder.

  3. EXOSAT observations of V471 Tauri - a 9.25 minute white dwarf pulsation and orbital phase dependent X-ray dips

    International Nuclear Information System (INIS)

    Jensen, K.A.; Swank, J.H.; Petre, P.; Guinan, E.F.; Sion, E.M.; Navy, E. O. Hulburt Center for Space Research, Washington, DC; Villanova Univ., PA)

    1986-01-01

    New results obtained from a 28 hr continuous observation of V471 Tauri with the EXOSAT satellite are reported. The detection of soft X-ray fluxes from both the white dwarf and the K dwarf, the discovery of a 9.25 minute pulsation from the white dwarf, and the discovery of orbital phase-related soft X-ray dips are discussed. The dips may be correlated with the triangular Lagrangian points of the binary orbit. The X-ray flux from the white dwarf is consistent with thermal models for a white dwarf photosphere with T(eff) of about 35,000 K, log g = 8.0-8.5, and log N(H) = 18.65 + or - 0.2. 25 references

  4. Science Through ARts (STAR)

    Science.gov (United States)

    Kolecki, Joseph; Petersen, Ruth; Williams, Lawrence

    2002-01-01

    Science Through ARts (STAR) is an educational initiative designed to teach students through a multidisciplinary approach to learning. This presentation describes the STAR pilot project, which will use Mars exploration as the topic to be integrated. Schools from the United Kingdom, Japan, the United States, and possibly eastern Europe are expected to participate in the pilot project.

  5. European Stars and Stripes

    National Research Council Canada - National Science Library

    Hendricks, Nancy

    1994-01-01

    The European Stars and Stripes (ES&S) organization publishes a daily newspaper, The Stars and Stripes, for DoD personnel stationed in Germany, Italy, the United Kingdom, and other DoD activities in the U.S. European Command...

  6. Nebraska STARS: Achieving Results

    Science.gov (United States)

    Roschewski, Pat; Isernhagen, Jody; Dappen, Leon

    2006-01-01

    In 2000, the state of Nebraska passed legislation requiring the assessment of student performance on content standards, but its requirements were very different from those of any other state. Nebraska created what has come to be known as STARS (School-based Teacher-led Assessment and Reporting System). Under STARS, each of Nebraska's nearly 500…

  7. Convective overshooting in stars

    NARCIS (Netherlands)

    Andrássy, R.

    2015-01-01

    Numerous observations provide evidence that the standard picture, in which convective mixing is limited to the unstable layers of a star, is incomplete. The mixing layers in real stars are significantly more extended than what the standard models predict. Some of the observations require changing

  8. By Draconis Stars

    Science.gov (United States)

    Bopp, Bernard W.

    An optical spectroscopic survey of dK-M stars has resulted in the discovery of several new H-alpha emission objects. Available optical data suggest these stars have a level of chromospheric activity midway between active BY Dra stars and quiet dM's. These "marginal" BY Dra stars are single objects that have rotation velocities slightly higher than that of quiet field stars but below that of active flare/BY Dra objects. The marginal BY Dra stars provide us with a class of objects rotating very near a "trigger velocity" (believed to be 5 km/s) which appears to divide active flare/BY Dra stars from quiet dM's. UV data on Mg II emission fluxes and strength of transition region features such as C IV will serve to fix activity levels in the marginal objects and determine chromosphere and transition-region heating rates. Simultaneous optical magnetic field measures will be used to explore the connection between fieldstrength/filling-factor and atmospheric heating. Comparison of these data with published information on active and quiet dM stars will yield information on the character of the stellar dynamo as it makes a transition from "low" to "high" activity.

  9. Observing Double Stars

    Science.gov (United States)

    Genet, Russell M.; Fulton, B. J.; Bianco, Federica B.; Martinez, John; Baxter, John; Brewer, Mark; Carro, Joseph; Collins, Sarah; Estrada, Chris; Johnson, Jolyon; Salam, Akash; Wallen, Vera; Warren, Naomi; Smith, Thomas C.; Armstrong, James D.; McGaughey, Steve; Pye, John; Mohanan, Kakkala; Church, Rebecca

    2012-05-01

    Double stars have been systematically observed since William Herschel initiated his program in 1779. In 1803 he reported that, to his surprise, many of the systems he had been observing for a quarter century were gravitationally bound binary stars. In 1830 the first binary orbital solution was obtained, leading eventually to the determination of stellar masses. Double star observations have been a prolific field, with observations and discoveries - often made by students and amateurs - routinely published in a number of specialized journals such as the Journal of Double Star Observations. All published double star observations from Herschel's to the present have been incorporated in the Washington Double Star Catalog. In addition to reviewing the history of visual double stars, we discuss four observational technologies and illustrate these with our own observational results from both California and Hawaii on telescopes ranging from small SCTs to the 2-meter Faulkes Telescope North on Haleakala. Two of these technologies are visual observations aimed primarily at published "hands-on" student science education, and CCD observations of both bright and very faint doubles. The other two are recent technologies that have launched a double star renaissance. These are lucky imaging and speckle interferometry, both of which can use electron-multiplying CCD cameras to allow short (30 ms or less) exposures that are read out at high speed with very low noise. Analysis of thousands of high speed exposures allows normal seeing limitations to be overcome so very close doubles can be accurately measured.

  10. The magnetic early B-type stars I: magnetometry and rotation

    Science.gov (United States)

    Shultz, M. E.; Wade, G. A.; Rivinius, Th; Neiner, C.; Alecian, E.; Bohlender, D.; Monin, D.; Sikora, J.; MiMeS Collaboration; BinaMIcS Collaboration

    2018-04-01

    The rotational and magnetic properties of many magnetic hot stars are poorly characterized, therefore the Magnetism in Massive Stars and Binarity and Magnetic Interactions in various classes of Stars collaborations have collected extensive high-dispersion spectropolarimetric data sets of these targets. We present longitudinal magnetic field measurements for 52 early B-type stars (B5-B0), with which we attempt to determine their rotational periods Prot. Supplemented with high-resolution spectroscopy, low-resolution Dominion Astrophysical Observatory circular spectropolarimetry, and archival Hipparcos photometry, we determined Prot for 10 stars, leaving only five stars for which Prot could not be determined. Rotational ephemerides for 14 stars were refined via comparison of new to historical magnetic measurements. The distribution of Prot is very similar to that observed for the cooler Ap/Bp stars. We also measured v sin i and vmac for all stars. Comparison to non-magnetic stars shows that v sin i is much lower for magnetic stars, an expected consequence of magnetic braking. We also find evidence that vmac is lower for magnetic stars. Least-squares deconvolution profiles extracted using single-element masks revealed widespread, systematic discrepancies in between different elements: this effect is apparent only for chemically peculiar stars, suggesting it is a consequence of chemical spots. Sinusoidal fits to H line measurements (which should be minimally affected by chemical spots), yielded evidence of surface magnetic fields more complex than simple dipoles in six stars for which this has not previously been reported; however, in all six cases, the second- and third-order amplitudes are small relative to the first-order (dipolar) amplitudes.

  11. Radioisotope dating beyond 50,000 years BP

    International Nuclear Information System (INIS)

    Beukens, R.P.

    1980-01-01

    A counting method for radiocarbon dating has been developed by the Toronto-Rochester-General Ionex group over the past two years using electrostatic tandem-accelerators as part of a mass spectrometer. The method uses very small samples of 1 mg or less and reaches high accuracy after counting for only a few hours. In principle this 14 C method can be used to date samples up to 100,000 years old but severe problems are anticipated with respect to sample contamination, particularly beyond 70,000 years BP. The counting method can also be applied to the detection of longer lived radioisotopes created in the upper atmosphere by the interaction of cosmic radiation, such as 36 Cl, 26 Al and 10 Be. (author)

  12. BP and Mobil present a united front in Europe

    International Nuclear Information System (INIS)

    Jackson, Kim.

    1997-01-01

    BP and Mobil announced the pooling of their European refining, marketing and lubricants businesses in February last year in an unprecedented step to cut costs and improve their competitive position in what is becoming an increasingly cut-throat market. Like their competitors, the two companies had been battling to contented with the continuing surplus refining capacity throughout Europe as well as significantly reduced profit margins on gasoline and other products sold at the pumps. This was particularly the case in the United Kingdom which is still reeling from the effects of the petrol pump price war waged over the past year and in France, too, where the hypermarkets are fiercely battling to retain their market share. (author)

  13. Neutron Stars and Pulsars

    CERN Document Server

    Becker, Werner

    2009-01-01

    Neutron stars are the most compact astronomical objects in the universe which are accessible by direct observation. Studying neutron stars means studying physics in regimes unattainable in any terrestrial laboratory. Understanding their observed complex phenomena requires a wide range of scientific disciplines, including the nuclear and condensed matter physics of very dense matter in neutron star interiors, plasma physics and quantum electrodynamics of magnetospheres, and the relativistic magneto-hydrodynamics of electron-positron pulsar winds interacting with some ambient medium. Not to mention the test bed neutron stars provide for general relativity theories, and their importance as potential sources of gravitational waves. It is this variety of disciplines which, among others, makes neutron star research so fascinating, not only for those who have been working in the field for many years but also for students and young scientists. The aim of this book is to serve as a reference work which not only review...

  14. Spectrophotometry of carbon stars

    Energy Technology Data Exchange (ETDEWEB)

    Oganesyan, R.K.; Karapetyan, M.S.; Nersisyan, S.E.

    1986-01-01

    The results are given of the spectrophotometric investigation of 56 carbon stars in the spectral range from 4000 to 6800 A with resolution 3 A. The observed energy distributions of these stars are determined relative to the flux at the wavelength /sub 0/ = 5556; they are presented in the form of graphs. The energy distributions have been obtained for the first time for 35 stars. Variation in the line Ba II 4554 A has been found in the spectra of St Cam, UU Aur, and RV Mon. Large changes have taken place in the spectra of RT UMa and SS Vir. It is noted that the spectra of carbon stars have a depression, this being situated in different spectral regions for individual groups of stars.

  15. Rotating stars in relativity.

    Science.gov (United States)

    Paschalidis, Vasileios; Stergioulas, Nikolaos

    2017-01-01

    Rotating relativistic stars have been studied extensively in recent years, both theoretically and observationally, because of the information they might yield about the equation of state of matter at extremely high densities and because they are considered to be promising sources of gravitational waves. The latest theoretical understanding of rotating stars in relativity is reviewed in this updated article. The sections on equilibrium properties and on nonaxisymmetric oscillations and instabilities in f -modes and r -modes have been updated. Several new sections have been added on equilibria in modified theories of gravity, approximate universal relationships, the one-arm spiral instability, on analytic solutions for the exterior spacetime, rotating stars in LMXBs, rotating strange stars, and on rotating stars in numerical relativity including both hydrodynamic and magnetohydrodynamic studies of these objects.

  16. On the evolution of stars

    International Nuclear Information System (INIS)

    Kippenhahn, R.

    1989-01-01

    A popular survey is given of the present knowledge on evolution and ageing of stars. Main sequence stars, white dwarf stars, and red giant stars are classified in the Hertzsprung-Russell (HR)-diagram by measurable quantities: surface temperature and luminosity. From the HR-diagram it can be concluded to star mass and age. Star-forming processes in interstellar clouds as well as stellar burning processes are illustrated. The changes occurring in a star due to the depletion of the nuclear energy reserve are described. In this frame the phenomena of planetary nebulae, supernovae, pulsars, neutron stars as well as of black holes are explained

  17. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    Energy Technology Data Exchange (ETDEWEB)

    Theodorakis, P E [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Avgeropoulos, A [Department of Materials Science and Engineering, University of Ioannina, 45110 Ioannina (Greece); Freire, J J [Departamento de Ciencias y Tecnicas FisicoquImicas, Universidad Nacional de Educacion a Distancia, Facultad de Ciencias, Senda del Rey 9, 28040 Madrid (Spain); Kosmas, M [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece); Vlahos, C [Department of Chemistry, University of Ioannina, 45110 Ioannina (Greece)

    2007-11-21

    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

  18. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    Science.gov (United States)

    Theodorakis, P. E.; Avgeropoulos, A.; Freire, J. J.; Kosmas, M.; Vlahos, C.

    2007-11-01

    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results.

  19. Monte Carlo simulation of star/linear and star/star blends with chemically identical monomers

    International Nuclear Information System (INIS)

    Theodorakis, P E; Avgeropoulos, A; Freire, J J; Kosmas, M; Vlahos, C

    2007-01-01

    The effects of chain size and architectural asymmetry on the miscibility of blends with chemically identical monomers, differing only in their molecular weight and architecture, are studied via Monte Carlo simulation by using the bond fluctuation model. Namely, we consider blends composed of linear/linear, star/linear and star/star chains. We found that linear/linear blends are more miscible than the corresponding star/star mixtures. In star/linear blends, the increase in the volume fraction of the star chains increases the miscibility. For both star/linear and star/star blends, the miscibility decreases with the increase in star functionality. When we increase the molecular weight of linear chains of star/linear mixtures the miscibility decreases. Our findings are compared with recent analytical and experimental results

  20. RanBP3 influences interactions between CRM1 and its nuclear protein export substrates

    OpenAIRE

    Englmeier, Ludwig; Fornerod, Maarten; Bischoff, F. Ralf; Petosa, Carlo; Mattaj, Iain W.; Kutay, Ulrike

    2001-01-01

    We investigated the role of RanBP3, a nuclear member of the Ran-binding protein 1 family, in CRM1-mediated protein export in higher eukaryotes. RanBP3 interacts directly with CRM1 and also forms a trimeric complex with CRM1 and RanGTP. However, RanBP3 does not bind to CRM1 like an export substrate. Instead, it can stabilize CRM1–export substrate interaction. Nuclear RanBP3 stimulates CRM1-dependent protein export in permeabilized cells. These data indicate that RanBP3 functions by a novel mec...

  1. AMP-activated protein kinase phosphorylates CtBP1 and down-regulates its activity

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jae-Hwan; Choi, Soo-Youn; Kang, Byung-Hee; Lee, Soon-Min [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); Park, Hyung Soon; Kang, Gum-Yong; Bang, Joo Young [Center for Biomedical Mass Spectrometry, Diatech Korea Co., Ltd., Seoul (Korea, Republic of); Cho, Eun-Jung [National Research Laboratory for Chromatin Dynamics, College of Pharmacy, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Youn, Hong-Duk, E-mail: hdyoun@snu.ac.kr [National Creative Research Center for Epigenome Reprogramming Network, Departments of Biomedical Sciences and Biochemistry and Molecular Biology, Ischemic/Hypoxic Disease Institute, Seoul National University College of Medicine, Seoul 110-799 (Korea, Republic of); WCU Department of Molecular Medicine and Biopharmaceutical Sciences, Graduate School of Convergence and Technology, Seoul National University, Seoul (Korea, Republic of)

    2013-02-01

    Highlights: ► AMPK phosphorylates CtBP1 on serine 158. ► AMPK-mediated phosphorylation of CtBP1 causes the ubiquitination and nuclear export of CtBP1. ► AMPK downregulates the CtBP1-mediated repression of Bax transcription. -- Abstract: CtBP is a transcriptional repressor which plays a significant role in the regulation of cell proliferation and tumor progression. It was reported that glucose withdrawal causes induction of Bax due to the dissociation of CtBP from the Bax promoter. However, the precise mechanism involved in the regulation of CtBP still remains unclear. In this study, we found that an activated AMP-activated protein kinase (AMPK) phosphorylates CtBP1 on Ser-158 upon metabolic stresses. Moreover, AMPK-mediated phosphorylation of CtBP1 (S158) attenuates the repressive function of CtBP1. We also confirmed that triggering activation of AMPK by various factors resulted in an increase of Bax gene expression. These findings provide connections of AMPK with CtBP1-mediated regulation of Bax expression for cell death under metabolic stresses.

  2. Star Cluster Structure from Hierarchical Star Formation

    Science.gov (United States)

    Grudic, Michael; Hopkins, Philip; Murray, Norman; Lamberts, Astrid; Guszejnov, David; Schmitz, Denise; Boylan-Kolchin, Michael

    2018-01-01

    Young massive star clusters (YMCs) spanning 104-108 M⊙ in mass generally have similar radial surface density profiles, with an outer power-law index typically between -2 and -3. This similarity suggests that they are shaped by scale-free physics at formation. Recent multi-physics MHD simulations of YMC formation have also produced populations of YMCs with this type of surface density profile, allowing us to narrow down the physics necessary to form a YMC with properties as observed. We show that the shallow density profiles of YMCs are a natural result of phase-space mixing that occurs as they assemble from the clumpy, hierarchically-clustered configuration imprinted by the star formation process. We develop physical intuition for this process via analytic arguments and collisionless N-body experiments, elucidating the connection between star formation physics and star cluster structure. This has implications for the early-time structure and evolution of proto-globular clusters, and prospects for simulating their formation in the FIRE cosmological zoom-in simulations.

  3. Making star teams out of star players.

    Science.gov (United States)

    Mankins, Michael; Bird, Alan; Root, James

    2013-01-01

    Top talent is an invaluable asset: In highly specialized or creative work, for instance, "A" players are likely to be six times as productive as "B" players. So when your company has a crucial strategic project, why not multiply all that firepower and have a team of your best performers tackle it? Yet many companies hesitate to do this, believing that all-star teams don't work: Big egos will get in the way. The stars won't be able to work with one another. They'll drive the team Leader crazy. Mankins, Bird, and Root of Bain & Company believe it's time to set aside that thinking. They have seen all-star teams do extraordinary work. But there is a right way and a wrong way to organize them. Before you can even begin to assemble such a team, you need to have the right talent management practices, so you hire and develop the best people and know what they're capable of. You have to give the team appropriate incentives and leaders and support staffers who are stars in their own right. And projects that are ill-defined or small scale are not for all-star teams. Use them only for critical missions, and make sure their objectives are clear. Even with the right setup, things can still go wrong. The wise executive will take steps to manage egos, prune non-team-players, and prevent average coworkers from feeling completely undervalued. She will also invest a lot of time in choosing the right team Leader and will ask members for lots of feedback to monitor how that leader is doing.

  4. Stability of boson stars

    International Nuclear Information System (INIS)

    Gleiser, M.

    1988-01-01

    Boson stars are gravitationally bound, spherically symmetric equilibrium configurations of cold, free, or interacting complex scalar fields phi. As these equilibrium configurations naturally present local anisotropy, it is sensible to expect departures from the well-known stability criteria for fluid stars. With this in mind, I investigate the dynamical instability of boson stars against charge-conserving, small radial perturbations. Following the method developed by Chandrasekhar, a variational base for determining the eigenfrequencies of the perturbations is found. This approach allows one to find numerically an upper bound for the central density where dynamical instability occurs. As applications of the formalism, I study the stability of equilibrium configurations obtained both for the free and for the self-interacting [with V(phi) = (λ/4)chemical bondphichemical bond 4 ] massive scalar field phi. Instabilities are found to occur not for the critical central density as in fluid stars but for central densities considerably higher. The departure from the results for fluid stars is sensitive to the coupling λ; the higher the value of λ, the more the stability properties of boson stars approach those of a fluid star. These results are linked to the fractional anisotropy at the radius of the configuration

  5. From clouds to stars

    International Nuclear Information System (INIS)

    Elmegreen, B.G.

    1982-01-01

    At the present time, the theory of star formation must be limited to what we know about the lowest density gas, or about the pre-main sequence stars themselves. We would like to understand two basic processes: 1) how star-forming clouds are created from the ambient interstellar gas in the first place, and 2) how small parts of these clouds condense to form individual stars. We are interested also in knowing what pre-main sequence stars are like, and how they can interact with their environment. These topics are reviewed in what follows. In this series of lectures, what we know about the formation of stars is tentatively described. The lectures begin with a description of the interstellar medium, and then they proceed along the same direction that a young star would follow during its creation, namely from clouds through the collapse phase and onto the proto-stellar phase. The evolution of viscous disks and two models for the formation of the solar system are described in the last lectures. The longest lectures, and the topics that are covered in most detail, are not necessarily the ones for which we have the most information. Physically intuitive explanations for the various processes are emphasized, rather then mathematical explanations. In some cases, the mathematical aspects are developed as well, but only when the equations can be used to give important numerical values for comparison with the observations

  6. Nuclear physics of stars

    CERN Document Server

    Iliadis, Christian

    2007-01-01

    Thermonuclear reactions in stars is a major topic in the field of nuclear astrophysics, and deals with the topics of how precisely stars generate their energy through nuclear reactions, and how these nuclear reactions create the elements the stars, planets and - ultimately - we humans consist of. The present book treats these topics in detail. It also presents the nuclear reaction and structure theory, thermonuclear reaction rate formalism and stellar nucleosynthesis. The topics are discussed in a coherent way, enabling the reader to grasp their interconnections intuitively. The book serves bo

  7. Entropy Production of Stars

    Directory of Open Access Journals (Sweden)

    Leonid M. Martyushev

    2015-06-01

    Full Text Available The entropy production (inside the volume bounded by a photosphere of main-sequence stars, subgiants, giants, and supergiants is calculated based on B–V photometry data. A non-linear inverse relationship of thermodynamic fluxes and forces as well as an almost constant specific (per volume entropy production of main-sequence stars (for 95% of stars, this quantity lies within 0.5 to 2.2 of the corresponding solar magnitude is found. The obtained results are discussed from the perspective of known extreme principles related to entropy production.

  8. INTERACTION OF CLOSE-IN PLANETS WITH THE MAGNETOSPHERE OF THEIR HOST STARS. II. SUPER-EARTHS AS UNIPOLAR INDUCTORS AND THEIR ORBITAL EVOLUTION

    International Nuclear Information System (INIS)

    Laine, Randy O.; Lin, Douglas N. C.

    2012-01-01

    Planets with several Earth masses and orbital periods of a few days have been discovered through radial velocity and transit surveys. Regardless of their formation mechanism, an important evolution issue is the efficiency of their retention in the proximity of their host stars. If these 'super-Earths' attained their present-day orbits during or shortly after the T Tauri phase of their host stars, a large fraction of these planets would have encountered an intense stellar magnetic field. These rocky planets have a higher conductivity than the atmosphere of their host stars and, therefore, the magnetic flux tube connecting them would slip though the envelope of the host stars faster than across the planets. The induced electromotive force across the planet's diameter leads to a potential drop which propagates along a flux tube away from the planet with an Alfvén speed. The foot of the flux tube would sweep across the stellar surface and the potential drop across the field lines drives a DC current analogous to that proposed for the electrodynamics of the Io-Jupiter system. The ohmic dissipation of this current produces potentially observable hot spots in the star envelope. It also heats the planet and leads to a torque which drives the planet's orbit to evolve toward both circularization and a state of synchronization with the spin of the star. The net effect is the damping of the planet's orbital eccentricity. Around slowly (or rapidly) spinning stars, this process also causes rocky planets with periods less than a few days to undergo orbital decay (or expansion/stagnation) within a few Myr. In principle, this effect can determine the retention efficiency of short-period hot Earths. We also estimate the ohmic dissipation interior to these planets and show that it can lead to severe structure evolution and potential loss of volatile material in them. However, these effects may be significantly weakened by the reconnection of the induced field.

  9. Carbon Stars T. Lloyd Evans

    Indian Academy of Sciences (India)

    that the features used in estimating luminosities of ordinary giant stars are just those whose abundance ... This difference between the spectral energy distributions (SEDs) of CH stars and the. J stars, which belong to .... that the first group was binaries, as for the CH stars of the solar vicinity, while those of the second group ...

  10. 4E-BP1 regulates the differentiation of white adipose tissue.

    Science.gov (United States)

    Tsukiyama-Kohara, Kyoko; Katsume, Asao; Kimura, Kazuhiro; Saito, Masayuki; Kohara, Michinori

    2013-07-01

    4E Binding protein 1 (4E-BP1) suppresses translation initiation. The absence of 4E-BP1 drastically reduces the amount of adipose tissue in mice. To address the role of 4E-BP1 in adipocyte differentiation, we characterized 4E-BP1(-/-) mice in this study. The lack of 4E-BP1 decreased the amount of white adipose tissue and increased the amount of brown adipose tissue. In 4E-BP1(-/-) MEF cells, PPARγ coactivator 1 alpha (PGC-1α) expression increased and exogenous 4E-BP1 expression suppressed PGC-1α expression. The level of 4E-BP1 expression was higher in white adipocytes than in brown adipocytes and showed significantly greater up-regulation in white adipocytes than in brown adipocytes during preadipocyte differentiation into mature adipocytes. The amount of PGC-1α was consistently higher in HB cells (a brown preadipocyte cell line) than in HW cells (a white preadipocyte cell line) during differentiation. Moreover, the ectopic over-expression of 4E-BP1 suppressed PGC-1α expression in white adipocytes, but not in brown adipocytes. Thus, the results of our study indicate that 4E-BP1 may suppress brown adipocyte differentiation and PGC-1α expression in white adipose tissues. © 2013 The Authors Genes to Cells © 2013 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.

  11. Intensive Versus Standard Blood Pressure Control in SPRINT-Eligible Participants of ACCORD-BP.

    Science.gov (United States)

    Buckley, Leo F; Dixon, Dave L; Wohlford, George F; Wijesinghe, Dayanjan S; Baker, William L; Van Tassell, Benjamin W

    2017-12-01

    We sought to determine the effect of intensive blood pressure (BP) control on cardiovascular outcomes in participants with type 2 diabetes mellitus (T2DM) and additional risk factors for cardiovascular disease (CVD). This study was a post hoc, multivariate, subgroup analysis of ACCORD-BP (Action to Control Cardiovascular Risk in Diabetes Blood Pressure) participants. Participants were eligible for the analysis if they were in the standard glucose control arm of ACCORD-BP and also had the additional CVD risk factors required for SPRINT (Systolic Blood Pressure Intervention Trial) eligibility. We used a Cox proportional hazards regression model to compare the effect of intensive versus standard BP control on CVD outcomes. The "SPRINT-eligible" ACCORD-BP participants were pooled with SPRINT participants to determine whether the effects of intensive BP control interacted with T2DM. The mean baseline Framingham 10-year CVD risk scores were 14.5% and 14.8%, respectively, in the intensive and standard BP control groups. The mean achieved systolic BP values were 120 and 134 mmHg in the intensive and standard BP control groups ( P control reduced the composite of CVD death, nonfatal myocardial infarction (MI), nonfatal stroke, any revascularization, and heart failure (hazard ratio 0.79; 95% CI 0.65-0.96; P = 0.02). Intensive BP control also reduced CVD death, nonfatal MI, and nonfatal stroke (hazard ratio 0.69; 95% CI 0.51-0.93; P = 0.01). Treatment-related adverse events occurred more frequently in participants receiving intensive BP control (4.1% vs. 2.1%; P = 0.003). The effect of intensive BP control on CVD outcomes did not differ between patients with and without T2DM ( P > 0.62). Intensive BP control reduced CVD outcomes in a cohort of participants with T2DM and additional CVD risk factors. © 2017 by the American Diabetes Association.

  12. AgSTAR

    Science.gov (United States)

    AgSTAR promotes biogas recovery projects, which generate renewable energy and other beneficial products from the anaerobic digestion of livestock manure and organic wastes while decreasing greenhouse gas emissions from the agriculture sector.

  13. Orbiting radiation stars

    International Nuclear Information System (INIS)

    Foster, Dean P; Langford, John; Perez-Giz, Gabe

    2016-01-01

    We study a spherically symmetric solution to the Einstein equations in which the source, which we call an orbiting radiation star (OR-star), is a compact object consisting of freely falling null particles. The solution avoids quantum scale regimes and hence neither relies upon nor ignores the interaction of quantum mechanics and gravitation. The OR-star spacetime exhibits a deep gravitational well yet remains singularity free. In fact, it is geometrically flat in the vicinity of the origin, with the flat region being of any desirable scale. The solution is observationally distinct from a black hole because a photon from infinity aimed at an OR-star escapes to infinity with a time delay. (paper)

  14. Cataclysmic Variable Stars

    Science.gov (United States)

    Hellier, Coel

    2001-01-01

    Cataclysmic variable stars are the most variable stars in the night sky, fluctuating in brightness continually on timescales from seconds to hours to weeks to years. The changes can be recorded using amateur telescopes, yet are also the subject of intensive study by professional astronomers. That study has led to an understanding of cataclysmic variables as binary stars, orbiting so closely that material transfers from one star to the other. The resulting process of accretion is one of the most important in astrophysics. This book presents the first account of cataclysmic variables at an introductory level. Assuming no previous knowledge of the field, it explains the basic principles underlying the variability, while providing an extensive compilation of cataclysmic variable light curves. Aimed at amateur astronomers, undergraduates, and researchers, the main text is accessible to those with no mathematical background, while supplementary boxes present technical details and equations.

  15. SX Phoenicis stars

    International Nuclear Information System (INIS)

    Nemec, J.; Mateo, M.

    1990-01-01

    The purpose of this paper is to review the basic observational information concerning SX Phe stars, including recent findings such as the discovery of about 40 low-luminosity variable stars in the Carina dwarf galaxy and identification of at least one SX Phe star in the metal-rich globular cluster M71. Direct evidence supporting the hypothesis that at least some BSs are binary systems comes from the discovery of two contact binaries and a semidetached binary among the 50 BSs in the globular cluster NGC 5466. Since these systems will coalesce on a time scale 500 Myr, it stands to reason that many (if not most) BSs are coalesced binaries. The merger hypothesis also explains the relatively-large masses (1.0-1.2 solar masses) that have been derived for SX Phe stars and halo BSs, and may also account for the nonvariable BSs in the 'SX Phe instability strip'. 132 refs

  16. The BP oil spill and the bounty of Plaquemines Parish.

    Science.gov (United States)

    Fertel, Randy

    2011-01-01

    The source of 25 to 30 percent of America's seafood, the Mississippi River Delta's cornucopian world is now uncertain. And yet, even if shrimp, oysters, and finfish are unaffected by the BP Oil Spill - a big if - one can already reflect on the passing of the culture once built upon gathering them. For almost three centuries, levees made life possible along the riverbanks and in the wetlands beyond. Those same levees also ensured the wetlands would eventually melt away into the Gulf. Cutting off the silt left behind during annual river inundations subjected the fragile land to erosion. Sulfur, natural gas, and oil production companies dug twenty thousand miles of canals to gain more direct routes to their fields and to pump out their mineral wealth. This caused salt-water intrusion that killed off plant life and caused more erosion. The world that sustained my Plaquemines ancestors was less subject to collapse following disasters not only because the ecosystem before the wetlands' ongoing loss was then more vibrant, complex, and robust; but also because their lives, especially their culinary lives, were more vibrant, complex, and robust. Life was hard, but when it came to putting food on the table, life followed the seasons.

  17. Mid-wavelength infrared unipolar nBp superlattice photodetector

    Science.gov (United States)

    Kazemi, Alireza; Myers, Stephen; Taghipour, Zahra; Mathews, Sen; Schuler-Sandy, Ted; Lee, Seunghyun; Cowan, Vincent M.; Garduno, Eli; Steenbergen, Elizabeth; Morath, Christian; Ariyawansa, Gamini; Scheihing, John; Krishna, Sanjay

    2018-01-01

    We report a Mid-Wavelength Infrared (MWIR) barrier photodetector based on the InAs/GaSb/AlSb type-II superlattice (T2SL) material system. The nBp design consists of a single unipolar barrier (InAs/AlSb SL) placed between a 4 μm thick p-doped absorber (InAs/GaSb SL) and an n-type contact layer (InAs/GaSb SL). At 80 K, the device exhibited a 50% cut-off wavelength of 5 μm, was fully turned-ON at zero bias and the measured QE was 50% (front side illumination with no AR coating) at 4.5 μm with a dark current density of 4.7 × 10-6 A/cm2 at Vb = 50 mV. At 150 K and Vb = 50 mV, the 50% cut-off wavelength increased to 5.3 μm, and the QE was 54% at 4.5 μm with a dark current of 5.0 × 10-4 A/cm2.

  18. Sounds of a Star

    Science.gov (United States)

    2001-06-01

    Acoustic Oscillations in Solar-Twin "Alpha Cen A" Observed from La Silla by Swiss Team Summary Sound waves running through a star can help astronomers reveal its inner properties. This particular branch of modern astrophysics is known as "asteroseismology" . In the case of our Sun, the brightest star in the sky, such waves have been observed since some time, and have greatly improved our knowledge about what is going on inside. However, because they are much fainter, it has turned out to be very difficult to detect similar waves in other stars. Nevertheless, tiny oscillations in a solar-twin star have now been unambiguously detected by Swiss astronomers François Bouchy and Fabien Carrier from the Geneva Observatory, using the CORALIE spectrometer on the Swiss 1.2-m Leonard Euler telescope at the ESO La Silla Observatory. This telescope is mostly used for discovering exoplanets (see ESO PR 07/01 ). The star Alpha Centauri A is the nearest star visible to the naked eye, at a distance of a little more than 4 light-years. The new measurements show that it pulsates with a 7-minute cycle, very similar to what is observed in the Sun . Asteroseismology for Sun-like stars is likely to become an important probe of stellar theory in the near future. The state-of-the-art HARPS spectrograph , to be mounted on the ESO 3.6-m telescope at La Silla, will be able to search for oscillations in stars that are 100 times fainter than those for which such demanding observations are possible with CORALIE. PR Photo 23a/01 : Oscillations in a solar-like star (schematic picture). PR Photo 23b/01 : Acoustic spectrum of Alpha Centauri A , as observed with CORALIE. Asteroseismology: listening to the stars ESO PR Photo 23a/01 ESO PR Photo 23a/01 [Preview - JPEG: 357 x 400 pix - 96k] [Normal - JPEG: 713 x 800 pix - 256k] [HiRes - JPEG: 2673 x 3000 pix - 2.1Mb Caption : PR Photo 23a/01 is a graphical representation of resonating acoustic waves in the interior of a solar-like star. Red and blue

  19. Spectrophotometry of carbon stars

    International Nuclear Information System (INIS)

    Gow, C.E.

    1975-01-01

    Observations of over one hundred carbon stars have been made with the Indiana rapid spectral scanner in the red and, when possible, in the visual and blue regions of the spectrum. Five distinct subtypes of carbon stars (Barium, CH, R, N, and hydrogen deficient) are represented in the list of observed stars, although the emphasis was placed on the N stars when the observations were made. The rapid scanner was operated in the continuous sweep mode with the exit slit set at twenty angstroms, however, seeing fluctuations and guiding errors smear the spectrum to an effective resolution of approximately thirty angstroms. Nightly observations of Hayes standard stars yielded corrections for atmospheric extinction and instrumental response. The reduction scheme rests on two assumptions, that thin clouds are gray absorbers and the wavelength dependence of the sky transparency does not change during the course of the night. Several stars have been observed in the blue region of the spectrum with the Indiana SIT vidicon spectrometer at two angstroms resolution. It is possible to derive a color temperature for the yellow--red spectral region by fitting a black-body curve through two chosen continuum points. Photometric indices were calculated relative to the blackbody curve to measure the C 2 Swan band strength, the shape of the CN red (6,1) band to provide a measure of the 12 C/ 13 C isotope ratio, and in the hot carbon stars (Barium, CH, and R stars) the strength of an unidentified feature centered at 400 angstroms. An extensive abundance grid of model atmospheres was calculated using a modified version of the computer code ATLAS

  20. Young Stars with SALT

    Energy Technology Data Exchange (ETDEWEB)

    Riedel, Adric R. [Department of Astronomy, California Institute of Technology, Pasadena, CA 91125 (United States); Alam, Munazza K.; Rice, Emily L.; Cruz, Kelle L. [Department of Astrophysics, The American Museum of Natural History, New York, NY 10024 (United States); Henry, Todd J., E-mail: arr@caltech.edu [RECONS Institute, Chambersburg, PA (United States)

    2017-05-10

    We present a spectroscopic and kinematic analysis of 79 nearby M dwarfs in 77 systems. All of these dwarfs are low-proper-motion southern hemisphere objects and were identified in a nearby star survey with a demonstrated sensitivity to young stars. Using low-resolution optical spectroscopy from the Red Side Spectrograph on the South African Large Telescope, we have determined radial velocities, H-alpha, lithium 6708 Å, and potassium 7699 Å equivalent widths linked to age and activity, and spectral types for all of our targets. Combined with astrometric information from literature sources, we identify 44 young stars. Eighteen are previously known members of moving groups within 100 pc of the Sun. Twelve are new members, including one member of the TW Hydra moving group, one member of the 32 Orionis moving group, 9 members of Tucana-Horologium, one member of Argus, and two new members of AB Doradus. We also find 14 young star systems that are not members of any known groups. The remaining 33 star systems do not appear to be young. This appears to be evidence of a new population of nearby young stars not related to the known nearby young moving groups.

  1. STAR facility tritium accountancy

    International Nuclear Information System (INIS)

    Pawelko, R. J.; Sharpe, J. P.; Denny, B. J.

    2008-01-01

    The Safety and Tritium Applied Research (STAR) facility has been established to provide a laboratory infrastructure for the fusion community to study tritium science associated with the development of safe fusion energy and other technologies. STAR is a radiological facility with an administrative total tritium inventory limit of 1.5 g (14,429 Ci) [1]. Research studies with moderate tritium quantities and various radionuclides are performed in STAR. Successful operation of the STAR facility requires the ability to receive, inventory, store, dispense tritium to experiments, and to dispose of tritiated waste while accurately monitoring the tritium inventory in the facility. This paper describes tritium accountancy in the STAR facility. A primary accountancy instrument is the tritium Storage and Assay System (SAS): a system designed to receive, assay, store, and dispense tritium to experiments. Presented are the methods used to calibrate and operate the SAS. Accountancy processes utilizing the Tritium Cleanup System (TCS), and the Stack Tritium Monitoring System (STMS) are also discussed. Also presented are the equations used to quantify the amount of tritium being received into the facility, transferred to experiments, and removed from the facility. Finally, the STAR tritium accountability database is discussed. (authors)

  2. Asteroseismology of white dwarf stars

    OpenAIRE

    Córsico, A. H.

    2014-01-01

    Most of low- and intermediate-mass stars that populate the Universe will end their lives as white dwarf stars. These ancient stellar remnants have encrypted inside a precious record of the evolutionary history of the progenitor stars, providing a wealth of information about the evolution of stars, star formation, and the age of a variety of stellar populations, such as our Galaxy and open and globular clusters. While some information like surface chemical composition, temperature and gravity ...

  3. A survey for variable young stars with small telescopes: First results from HOYS-CAPS

    Science.gov (United States)

    Froebrich, D.; Campbell-White, J.; Scholz, A.; Eislöffel, J.; Zegmott, T.; Billington, S. J.; Donohoe, J.; Makin, S. V.; Hibbert, R.; Newport, R. J.; Pickard, R.; Quinn, N.; Rodda, T.; Piehler, G.; Shelley, M.; Parkinson, S.; Wiersema, K.; Walton, I.

    2018-05-01

    Variability in Young Stellar Objects (YSOs) is one of their primary characteristics. Long-term, multi-filter, high-cadence monitoring of large YSO samples is the key to understand the partly unusual light-curves that many of these objects show. Here we introduce and present the first results of the HOYS-CAPScitizen science project which aims to perform such monitoring for nearby (d < 1 kpc) and young (age < 10 Myr) clusters and star forming regions, visible from the northern hemisphere, with small telescopes. We have identified and characterised 466 variable (413 confirmed young) stars in 8 young, nearby clusters. All sources vary by at least 0.2 mag in V, have been observed at least 15 times in V, R and I in the same night over a period of about 2 yrs and have a Stetson index of larger than 1. This is one of the largest samples of variable YSOs observed over such a time-span and cadence in multiple filters. About two thirds of our sample are classical T-Tauri stars, while the rest are objects with depleted or transition disks. Objects characterised as bursters show by far the highest variability. Dippers and objects whose variability is dominated by occultations from normal interstellar dust or dust with larger grains (or opaque material) have smaller amplitudes. We have established a hierarchical clustering algorithm based on the light-curve properties which allows the identification of the YSOs with the most unusual behaviour, and to group sources with similar properties. We discuss in detail the light-curves of the unusual objects V2492 Cyg, V350 Cep and 2MASS J21383981+5708470.

  4. CSI 2264: CHARACTERIZING YOUNG STARS IN NGC 2264 WITH STOCHASTICALLY VARYING LIGHT CURVES

    Energy Technology Data Exchange (ETDEWEB)

    Stauffer, John; Rebull, Luisa; Carey, Sean [Spitzer Science Center, California Institute of Technology, Pasadena, CA 91125 (United States); Cody, Ann Marie [NASA Ames Research Center, Kepler Science Office, Mountain View, CA 94035 (United States); Hillenbrand, Lynne A.; Carpenter, John [Astronomy Department, California Institute of Technology, Pasadena, CA 91125 (United States); Turner, Neal J. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Terebey, Susan [Department of Physics and Astronomy, 5151 State University Drive, California State University at Los Angeles, Los Angeles, CA 90032 (United States); Morales-Calderón, Maria [Centro de Astrobiología, Dpto. de Astrofísica, INTA-CSIC, P.O. BOX 78, E-28691, ESAC Campus, Villanueva de la Cañada, Madrid (Spain); Alencar, Silvia H. P.; McGinnis, Pauline; Sousa, Alana [Departamento de Física—ICEx—UFMG, Av. Antônio Carlos, 6627, 30270-901, Belo Horizonte, MG (Brazil); Bouvier, Jerome; Venuti, Laura [Université de Grenoble, Institut de Planétologie et d’Astrophysique de Grenoble (IPAG), F-38000 Grenoble (France); Hartmann, Lee; Calvet, Nuria [Department of Astronomy, University of Michigan, 500 Church Street, Ann Arbor, MI:48105 (United States); Micela, Giusi; Flaccomio, Ettore [INAF—Osservatorio Astronomico di Palermo, Piazza del Parlamento 1, I-90134, Palermo (Italy); Song, Inseok [Department of Physics and Astronomy, The University of Georgia, Athens, GA 30602-2451 (United States); Gutermuth, Rob, E-mail: stauffer@ipac.caltech.edu [Department of Astronomy, University of Massachusetts, Amherst, MA 01003 (United States); and others

    2016-03-15

    We provide CoRoT and Spitzer light curves and other supporting data for 17 classical T Tauri stars in NGC 2264 whose CoRoT light curves exemplify the “stochastic” light curve class as defined in 2014 by Cody et al. The most probable physical mechanism to explain the optical variability within this light curve class is time-dependent mass accretion onto the stellar photosphere, producing transient hot spots. Where we have appropriate spectral data, we show that the veiling variability in these stars is consistent in both amplitude and timescale with the optical light curve morphology. The veiling variability is also well-correlated with the strength of the He i 6678 Å emission line, predicted by models to arise in accretion shocks on or near the stellar photosphere. Stars with accretion burst light curve morphology also have variable mass accretion. The stochastic and accretion burst light curves can both be explained by a simple model of randomly occurring flux bursts, with the stochastic light curve class having a higher frequency of lower amplitude events. Members of the stochastic light curve class have only moderate mass accretion rates. Their Hα profiles usually have blueshifted absorption features, probably originating in a disk wind. The lack of periodic signatures in the light curves suggests that little of the variability is due to long-lived hot spots rotating into or out of our line of sight; instead, the primary driver of the observed photometric variability is likely to be instabilities in the inner disk that lead to variable mass accretion.

  5. PROTOPLANETARY DISK MASSES FROM STARS TO BROWN DWARFS

    International Nuclear Information System (INIS)

    Mohanty, Subhanjoy; Mortlock, Daniel; Greaves, Jane; Pascucci, Ilaria; Apai, Daniel; Scholz, Aleks; Thompson, Mark; Lodato, Giuseppe; Looper, Dagny

    2013-01-01

    We present SCUBA-2 850 μm observations of seven very low mass stars (VLMS) and brown dwarfs (BDs). Three are in Taurus and four in the TW Hydrae Association (TWA), and all are classical T Tauri (cTT) analogs. We detect two of the three Taurus disks (one only marginally), but none of the TWA ones. For standard grains in cTT disks, our 3σ limits correspond to a dust mass of 1.2 M ⊕ in Taurus and a mere 0.2 M ⊕ in the TWA (3-10× deeper than previous work). We combine our data with other submillimeter/millimeter (sub-mm/mm) surveys of Taurus, ρ Oph, and the TWA to investigate the trends in disk mass and grain growth during the cTT phase. Assuming a gas-to-dust mass ratio of 100:1 and fiducial surface density and temperature profiles guided by current data, we find the following. (1) The minimum disk outer radius required to explain the upper envelope of sub-mm/mm fluxes is ∼100 AU for intermediate-mass stars, solar types, and VLMS, and ∼20 AU for BDs. (2) While the upper envelope of apparent disk masses increases with M * from BDs to VLMS to solar-type stars, no such increase is observed from solar-type to intermediate-mass stars. We propose this is due to enhanced photoevaporation around intermediate stellar masses. (3) Many of the disks around Taurus and ρ Oph intermediate-mass and solar-type stars evince an opacity index of β ∼ 0-1, indicating significant grain growth. Of the only four VLMS/BDs in these regions with multi-wavelength measurements, three are consistent with considerable grain growth, though optically thick disks are not ruled out. (4) For the TWA VLMS (TWA 30A and B), combining our 850 μm fluxes with the known accretion rates and ages suggests substantial grain growth by 10 Myr, comparable to that in the previously studied TWA cTTs Hen 3-600A and TW Hya. The degree of grain growth in the TWA BDs (2M1207A and SSPM1102) remains largely unknown. (5) A Bayesian analysis shows that the apparent disk-to-stellar mass ratio has a roughly

  6. Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage

    DEFF Research Database (Denmark)

    Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon

    2015-01-01

    Lamins A/C have been implicated in DNA damage response pathways. We show that the DNA repair protein 53BP1 is a lamin A/C binding protein. In undamaged human dermal fibroblasts (HDF), 53BP1 is a nucleoskeleton protein. 53BP1 binds to lamins A/C via its Tudor domain, and this is abrogated by DNA...... damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...

  7. Expression of the Transcription Factor E4BP4 in Human Basophils

    DEFF Research Database (Denmark)

    Jensen, Bettina Margrethe; Gohr, Maria; Poulsen, Lars Kærgaard

    2014-01-01

    Rationale The cytokine IL-3 plays an important role for human basophil development, function and survival. IL-3 is also reported to induce the expression of the transcription factor E4BP4, but it is not known whether E4BP4 is expressed in basophils and influences basophil responsiveness. The aim...... by Alcian blue. RNA was extracted (0.005-0.02 µg RNA from 0.5 - 1 x 106 cells), and the corresponding cDNA analyzed by real-time PCR where E4BP4 expression was calculated as 2-(CT(E4BP4) - CT(β-actin)). E4BP4 protein expression was visualized in basophil lysates (107 cells/ml) by Western blot followed...... the transcription factor E4BP4 which might have an impact on basophil histamine release....

  8. A new BP Fourier algorithm and its application in English teaching evaluation

    Science.gov (United States)

    Pei, Xuehui; Pei, Guixin

    2017-08-01

    BP neural network algorithm has wide adaptability and accuracy when used in complicated system evaluation, but its calculation defects such as slow convergence have limited its practical application. The paper tries to speed up the calculation convergence of BP neural network algorithm with Fourier basis functions and presents a new BP Fourier algorithm for complicated system evaluation. First, shortages and working principle of BP algorithm are analyzed for subsequent targeted improvement; Second, the presented BP Fourier algorithm adopts Fourier basis functions to simplify calculation structure, designs new calculation transfer function between input and output layers, and conducts theoretical analysis to prove the efficiency of the presented algorithm; Finally, the presented algorithm is used in evaluating university English teaching and the application results shows that the presented BP Fourier algorithm has better performance in calculation efficiency and evaluation accuracy and can be used in evaluating complicated system practically.

  9. A robust star identification algorithm with star shortlisting

    Science.gov (United States)

    Mehta, Deval Samirbhai; Chen, Shoushun; Low, Kay Soon

    2018-05-01

    A star tracker provides the most accurate attitude solution in terms of arc seconds compared to the other existing attitude sensors. When no prior attitude information is available, it operates in "Lost-In-Space (LIS)" mode. Star pattern recognition, also known as star identification algorithm, forms the most crucial part of a star tracker in the LIS mode. Recognition reliability and speed are the two most important parameters of a star pattern recognition technique. In this paper, a novel star identification algorithm with star ID shortlisting is proposed. Firstly, the star IDs are shortlisted based on worst-case patch mismatch, and later stars are identified in the image by an initial match confirmed with a running sequential angular match technique. The proposed idea is tested on 16,200 simulated star images having magnitude uncertainty, noise stars, positional deviation, and varying size of the field of view. The proposed idea is also benchmarked with the state-of-the-art star pattern recognition techniques. Finally, the real-time performance of the proposed technique is tested on the 3104 real star images captured by a star tracker SST-20S currently mounted on a satellite. The proposed technique can achieve an identification accuracy of 98% and takes only 8.2 ms for identification on real images. Simulation and real-time results depict that the proposed technique is highly robust and achieves a high speed of identification suitable for actual space applications.

  10. Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

    Directory of Open Access Journals (Sweden)

    Tin Nguyen

    Full Text Available MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

  11. Interactions of the human MCM-BP protein with MCM complex components and Dbf4.

    Science.gov (United States)

    Nguyen, Tin; Jagannathan, Madhav; Shire, Kathy; Frappier, Lori

    2012-01-01

    MCM-BP was discovered as a protein that co-purified from human cells with MCM proteins 3 through 7; results which were recapitulated in frogs, yeast and plants. Evidence in all of these organisms supports an important role for MCM-BP in DNA replication, including contributions to MCM complex unloading. However the mechanisms by which MCM-BP functions and associates with MCM complexes are not well understood. Here we show that human MCM-BP is capable of interacting with individual MCM proteins 2 through 7 when co-expressed in insect cells and can greatly increase the recovery of some recombinant MCM proteins. Glycerol gradient sedimentation analysis indicated that MCM-BP interacts most strongly with MCM4 and MCM7. Similar gradient analyses of human cell lysates showed that only a small amount of MCM-BP overlapped with the migration of MCM complexes and that MCM complexes were disrupted by exogenous MCM-BP. In addition, large complexes containing MCM-BP and MCM proteins were detected at mid to late S phase, suggesting that the formation of specific MCM-BP complexes is cell cycle regulated. We also identified an interaction between MCM-BP and the Dbf4 regulatory component of the DDK kinase in both yeast 2-hybrid and insect cell co-expression assays, and this interaction was verified by co-immunoprecipitation of endogenous proteins from human cells. In vitro kinase assays showed that MCM-BP was not a substrate for DDK but could inhibit DDK phosphorylation of MCM4,6,7 within MCM4,6,7 or MCM2-7 complexes, with little effect on DDK phosphorylation of MCM2. Since DDK is known to activate DNA replication through phosphorylation of these MCM proteins, our results suggest that MCM-BP may affect DNA replication in part by regulating MCM phosphorylation by DDK.

  12. Crisis strategies in BP's Deepwater Horizon response : An image repair and situational crisis communication study

    OpenAIRE

    Johansson, Mikael

    2017-01-01

    The BP Deepwater Horizon crisis in 2010 was one the largest catastrophes in the history of the oil industry. BP was sued over the disaster, and lost several billion dollars. This study examines the crisis response strategies and/or image repair strategies, which can be found in BP's press releases following the Deepwater Horizon crisis. In particular, the study looks closer at what established crisis communication strategies could be discerned in the material, and how they are used discursive...

  13. BP reactivity to public speaking in stage 1 hypertension: influence of different task scenarios.

    Science.gov (United States)

    Palatini, Paolo; Bratti, Paolo; Palomba, Daniela; Bonso, Elisa; Saladini, Francesca; Benetti, Elisabetta; Casiglia, Edoardo

    2011-10-01

    To investigate the blood pressure (BP) reaction to public speaking performed according to different emotionally distressing scenarios in stage 1 hypertension. METHODS. We assessed 64 hypertensive and 30 normotensive subjects. They performed three speech tasks with neutral, anger and anxiety scenarios. BP was assessed with the Finometer beat-to-beat non-invasive recording system throughout the test procedure. For all types of speech, the systolic BP response was greater in the hypertensive than the normotensive subjects (all p public speaking is increased in stage 1 hypertension. A speech with anxiety or anger scenario elicits a greater diastolic BP reaction than tasks with neutral content.

  14. TopBP1 associates with NBS1 and is involved in homologous recombination repair

    International Nuclear Information System (INIS)

    Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya

    2007-01-01

    TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair

  15. Prediction of Industrial Electric Energy Consumption in Anhui Province Based on GA-BP Neural Network

    Science.gov (United States)

    Zhang, Jiajing; Yin, Guodong; Ni, Youcong; Chen, Jinlan

    2018-01-01

    In order to improve the prediction accuracy of industrial electrical energy consumption, a prediction model of industrial electrical energy consumption was proposed based on genetic algorithm and neural network. The model use genetic algorithm to optimize the weights and thresholds of BP neural network, and the model is used to predict the energy consumption of industrial power in Anhui Province, to improve the prediction accuracy of industrial electric energy consumption in Anhui province. By comparing experiment of GA-BP prediction model and BP neural network model, the GA-BP model is more accurate with smaller number of neurons in the hidden layer.

  16. BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer

    Science.gov (United States)

    Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225

  17. Research on wind field algorithm of wind lidar based on BP neural network and grey prediction

    Science.gov (United States)

    Chen, Yong; Chen, Chun-Li; Luo, Xiong; Zhang, Yan; Yang, Ze-hou; Zhou, Jie; Shi, Xiao-ding; Wang, Lei

    2018-01-01

    This paper uses the BP neural network and grey algorithm to forecast and study radar wind field. In order to reduce the residual error in the wind field prediction which uses BP neural network and grey algorithm, calculating the minimum value of residual error function, adopting the residuals of the gray algorithm trained by BP neural network, using the trained network model to forecast the residual sequence, using the predicted residual error sequence to modify the forecast sequence of the grey algorithm. The test data show that using the grey algorithm modified by BP neural network can effectively reduce the residual value and improve the prediction precision.

  18. Association of Autoantibodies to BP180 with Disease Activity in Greek Patients with Bullous Pemphigoid

    Directory of Open Access Journals (Sweden)

    Aikaterini Patsatsi

    2012-01-01

    Full Text Available 39 bullous pemphigoid (BP patients were studied to assess the clinical significance of anti-BP180 and anti-BP230 circulating autoantibodies of BP and correlate their titers with the clinical scores of the BP Disease Area Index (BPDAI and the Autoimmune Bullous Skin Disorder Intensity Score (ABSIS as well as with the intensity of pruritus measured by the BPDAI pruritus component. All parameters were evaluated by the time of diagnosis (baseline, month 3, and month 6. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with BPDAI component for the intensity of pruritus (, at baseline. At month 3, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . At month 6, titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (, and ABSIS (, values, as well as with the BPDAI component for the intensity of pruritus (, . There was no statistically significant correlation between titers of anti-BP230 autoantibodies and the BPDAI, ABSIS, and BPDAI component for the intensity of pruritus at the same time points.

  19. Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9

    International Nuclear Information System (INIS)

    Burgess, P.H.; Iles, W.J.

    1979-08-01

    The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)

  20. EFFICIENT SELECTION AND CLASSIFICATION OF INFRARED EXCESS EMISSION STARS BASED ON AKARI AND 2MASS DATA

    Energy Technology Data Exchange (ETDEWEB)

    Huang Yafang; Li Jinzeng [National Astronomical Observatories, Chinese Academy of Sciences, 20A Datun Road, Chaoyang District, Beijing 100012 (China); Rector, Travis A. [University of Alaska, 3211 Providence Drive, Anchorage, AK 99508 (United States); Mallamaci, Carlos C., E-mail: ljz@nao.cas.cn [Observatorio Astronomico Felix Aguilar, Universidad Nacional de San Juan (Argentina)

    2013-05-15

    The selection of young stellar objects (YSOs) based on excess emission in the infrared is easily contaminated by post-main-sequence stars and various types of emission line stars with similar properties. We define in this paper stringent criteria for an efficient selection and classification of stellar sources with infrared excess emission based on combined Two Micron All Sky Survey (2MASS) and AKARI colors. First of all, bright dwarfs and giants with known spectral types were selected from the Hipparcos Catalogue and cross-identified with the 2MASS and AKARI Point Source Catalogues to produce the main-sequence and the post-main-sequence tracks, which appear as expected as tight tracks with very small dispersion. However, several of the main-sequence stars indicate excess emission in the color space. Further investigations based on the SIMBAD data help to clarify their nature as classical Be stars, which are found to be located in a well isolated region on each of the color-color (C-C) diagrams. Several kinds of contaminants were then removed based on their distribution in the C-C diagrams. A test sample of Herbig Ae/Be stars and classical T Tauri stars were cross-identified with the 2MASS and AKARI catalogs to define the loci of YSOs with different masses on the C-C diagrams. Well classified Class I and Class II sources were taken as a second test sample to discriminate between various types of YSOs at possibly different evolutionary stages. This helped to define the loci of different types of YSOs and a set of criteria for selecting YSOs based on their colors in the near- and mid-infrared. Candidate YSOs toward IC 1396 indicating excess emission in the near-infrared were employed to verify the validity of the new source selection criteria defined based on C-C diagrams compiled with the 2MASS and AKARI data. Optical spectroscopy and spectral energy distributions of the IC 1396 sample yield a clear identification of the YSOs and further confirm the criteria defined

  1. EFFICIENT SELECTION AND CLASSIFICATION OF INFRARED EXCESS EMISSION STARS BASED ON AKARI AND 2MASS DATA

    International Nuclear Information System (INIS)

    Huang Yafang; Li Jinzeng; Rector, Travis A.; Mallamaci, Carlos C.

    2013-01-01

    The selection of young stellar objects (YSOs) based on excess emission in the infrared is easily contaminated by post-main-sequence stars and various types of emission line stars with similar properties. We define in this paper stringent criteria for an efficient selection and classification of stellar sources with infrared excess emission based on combined Two Micron All Sky Survey (2MASS) and AKARI colors. First of all, bright dwarfs and giants with known spectral types were selected from the Hipparcos Catalogue and cross-identified with the 2MASS and AKARI Point Source Catalogues to produce the main-sequence and the post-main-sequence tracks, which appear as expected as tight tracks with very small dispersion. However, several of the main-sequence stars indicate excess emission in the color space. Further investigations based on the SIMBAD data help to clarify their nature as classical Be stars, which are found to be located in a well isolated region on each of the color-color (C-C) diagrams. Several kinds of contaminants were then removed based on their distribution in the C-C diagrams. A test sample of Herbig Ae/Be stars and classical T Tauri stars were cross-identified with the 2MASS and AKARI catalogs to define the loci of YSOs with different masses on the C-C diagrams. Well classified Class I and Class II sources were taken as a second test sample to discriminate between various types of YSOs at possibly different evolutionary stages. This helped to define the loci of different types of YSOs and a set of criteria for selecting YSOs based on their colors in the near- and mid-infrared. Candidate YSOs toward IC 1396 indicating excess emission in the near-infrared were employed to verify the validity of the new source selection criteria defined based on C-C diagrams compiled with the 2MASS and AKARI data. Optical spectroscopy and spectral energy distributions of the IC 1396 sample yield a clear identification of the YSOs and further confirm the criteria defined

  2. Wolf-Rayet Stars

    Science.gov (United States)

    Hamann, Wolf-Rainer; Sander, Andreas; Todt, Helge

    Nearly 150 years ago, the French astronomers Charles Wolf and Georges Rayet described stars with very conspicuous spectra that are dominated by bright and broad emission lines. Meanwhile termed Wolf-Rayet Stars after their discoverers, those objects turned out to represent important stages in the life of massive stars. As the first conference in a long time that was specifically dedicated to Wolf-Rayet stars, an international workshop was held in Potsdam, Germany, from 1.-5. June 2015. About 100 participants, comprising most of the leading experts in the field as well as as many young scientists, gathered for one week of extensive scientific exchange and discussions. Considerable progress has been reported throughout, e.g. on finding such stars, modeling and analyzing their spectra, understanding their evolutionary context, and studying their circumstellar nebulae. While some major questions regarding Wolf-Rayet stars still remain open 150 years after their discovery, it is clear today that these objects are not just interesting stars as such, but also keystones in the evolution of galaxies. These proceedings summarize the talks and posters presented at the Potsdam Wolf-Rayet workshop. Moreover, they also include the questions, comments, and discussions emerging after each talk, thereby giving a rare overview not only about the research, but also about the current debates and unknowns in the field. The Scientific Organizing Committee (SOC) included Alceste Bonanos (Athens), Paul Crowther (Sheffield), John Eldridge (Auckland), Wolf-Rainer Hamann (Potsdam, Chair), John Hillier (Pittsburgh), Claus Leitherer (Baltimore), Philip Massey (Flagstaff), George Meynet (Geneva), Tony Moffat (Montreal), Nicole St-Louis (Montreal), and Dany Vanbeveren (Brussels).

  3. Models of symbiotic stars

    Science.gov (United States)

    Friedjung, Michael

    1993-01-01

    One of the most important features of symbiotic stars is the coexistence of a cool spectral component that is apparently very similar to the spectrum of a cool giant, with at least one hot continuum, and emission lines from very different stages of ionization. The cool component dominates the infrared spectrum of S-type symbiotics; it tends to be veiled in this wavelength range by what appears to be excess emission in D-type symbiotics, this excess usually being attributed to circumstellar dust. The hot continuum (or continua) dominates the ultraviolet. X-rays have sometimes also been observed. Another important feature of symbiotic stars that needs to be explained is the variability. Different forms occur, some variability being periodic. This type of variability can, in a few cases, strongly suggest the presence of eclipses of a binary system. One of the most characteristic forms of variability is that characterizing the active phases. This basic form of variation is traditionally associated in the optical with the veiling of the cool spectrum and the disappearance of high-ionization emission lines, the latter progressively appearing (in classical cases, reappearing) later. Such spectral changes recall those of novae, but spectroscopic signatures of the high-ejection velocities observed for novae are not usually detected in symbiotic stars. However, the light curves of the 'symbiotic nova' subclass recall those of novae. We may also mention in this connection that radio observations (or, in a few cases, optical observations) of nebulae indicate ejection from symbiotic stars, with deviations from spherical symmetry. We shall give a historical overview of the proposed models for symbiotic stars and make a critical analysis in the light of the observations of symbiotic stars. We describe the empirical approach to models and use the observational data to diagnose the physical conditions in the symbiotics stars. Finally, we compare the results of this empirical

  4. Elevated sensitivity to diet-induced obesity and insulin resistance in mice lacking 4E-BP1 and 4E-BP2.

    Science.gov (United States)

    Le Bacquer, Olivier; Petroulakis, Emmanuel; Paglialunga, Sabina; Poulin, Francis; Richard, Denis; Cianflone, Katherine; Sonenberg, Nahum

    2007-02-01

    The most common pathology associated with obesity is insulin resistance, which results in the onset of type 2 diabetes mellitus. Several studies have implicated the mammalian target of rapamycin (mTOR) signaling pathway in obesity. Eukaryotic translation initiation factor 4E-binding (eIF4E-binding) proteins (4E-BPs), which repress translation by binding to eIF4E, are downstream effectors of mTOR. We report that the combined disruption of 4E-BP1 and 4E-BP2 in mice increased their sensitivity to diet-induced obesity. Increased adiposity was explained at least in part by accelerated adipogenesis driven by increased expression of CCAAT/enhancer-binding protein delta (C/EBPdelta), C/EBPalpha, and PPARgamma coupled with reduced energy expenditure, reduced lipolysis, and greater fatty acid reesterification in the adipose tissue of 4E-BP1 and 4E-BP2 double KO mice. Increased insulin resistance in 4E-BP1 and 4E-BP2 double KO mice was associated with increased ribosomal protein S6 kinase (S6K) activity and impairment of Akt signaling in muscle, liver, and adipose tissue. These data clearly demonstrate the role of 4E-BPs as a metabolic brake in the development of obesity and reinforce the idea that deregulated mTOR signaling is associated with the development of the metabolic syndrome.

  5. The embedded young stars in the Taurus-Auriga molecular cloud. II - Models for scattered light images

    Science.gov (United States)

    Kenyon, Scott J.; Whitney, Barbara A.; Gomez, Mercedes; Hartmann, Lee

    1993-01-01

    We describe NIR imaging observations of embedded young stars in the Taurus-Auriga molecular cloud. We find a large range in J-K and H-K colors for these class I sources. The bluest objects have colors similar to the reddest T Tauri stars in the cloud; redder objects lie slightly above the reddening line for standard ISM dust and have apparent K extinctions of up to 5 mag. Most of these sources also show extended NIR emission on scales of 10-20 arcsec which corresponds to linear sizes of 1500-3000 AU. The NIR colors and nebular morphologies for this sample and the magnitude of linear polarization in several sources suggest scattered light produces most of the NIR emission in these objects. We present modeling results that suggest mass infall rates that agree with predictions for cold clouds and are generally consistent with rates estimated from radiative equilibrium models. For reasonable dust grain parameters, the range of colors and extinctions require flattened density distributions with polar cavities evacuated by bipolar outflows. These results support the idea that infall and outflow occur simultaneously in deeply embedded bipolar outflow sources. The data also indicate fairly large centrifugal radii and large inclinations to the rotational axis for a typical source.

  6. Circulation of Stars

    Science.gov (United States)

    Boitani, P.

    2016-01-01

    Since the dawn of man, contemplation of the stars has been a primary impulse in human beings, who proliferated their knowledge of the stars all over the world. Aristotle sees this as the product of primeval and perennial “wonder” which gives rise to what we call science, philosophy, and poetry. Astronomy, astrology, and star art (painting, architecture, literature, and music) go hand in hand through millennia in all cultures of the planet (and all use catasterisms to explain certain phenomena). Some of these developments are independent of each other, i.e., they take place in one culture independently of others. Some, on the other hand, are the product of the “circulation of stars.” There are two ways of looking at this. One seeks out forms, the other concentrates on the passing of specific lore from one area to another through time. The former relies on archetypes (for instance, with catasterism), the latter constitutes a historical process. In this paper I present some of the surprising ways in which the circulation of stars has occurred—from East to West, from East to the Far East, and from West to East, at times simultaneously.

  7. Four new Delta Scuti stars

    Science.gov (United States)

    Schutt, R. L.

    1991-01-01

    Four new Delta Scuti stars are reported. Power, modified into amplitude, spectra, and light curves are used to determine periodicities. A complete frequency analysis is not performed due to the lack of a sufficient time base in the data. These new variables help verify the many predictions that Delta Scuti stars probably exist in prolific numbers as small amplitude variables. Two of these stars, HR 4344 and HD 107513, are possibly Am stars. If so, they are among the minority of variable stars which are also Am stars.

  8. BP1, an Isoform of DLX4 Homeoprotein, Negatively Regulates BRCA1 in Sporadic Breast Cancer

    Science.gov (United States)

    Kluk, Brian J.; Fu, Yebo; Formolo, Trina A.; Zhang, Lei; Hindle, Anne K.; Man, Yan-gao; Siegel, Robert S.; Berg, Patricia E.; Deng, Chuxia; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Introduction: Several lines of evidence point to an important role for BP1, an isoform of DLX4 homeobox gene, in breast carcinogenesis and progression. BRCA1 is a well-known player in the etiology of breast cancer. While familial breast cancer is often marked by BRCA1 mutation and subsequent loss of heterozygosity, sporadic breast cancers exhibit reduced expression of wild type BRCA1, and loss of BRCA1 expression may result in tumor development and progression. Methods: The Cister algorithm and Genomatix program were used to identify potential BP1 binding sites in BRCA1 gene. Real-time PCR, Western blot and immunohistochemistry analysis were performed to verify the expression of BRCA1 and BP1 in cell lines and breast cancer tissues. Double-stranded siRNA transfection was carried out for silencing BP1 expression. ChIP and EMSA were used to confirm that BP1 specifically binds to BRCA1. Results: A putative BP1 binding site was identified in the first intron of BRCA1, which was confirmed by chromatin immunoprecipiation and electrophoresis mobility shift assay. BP1 and BRCA1 expression were inversely correlated in breast cancer cell lines and tissues, suggesting that BP1 may suppress BRCA1 transcription through consensus sequence binding. Conclusions: BP1 homeoprotein represses BRCA1 expression through direct binding to its first intron, which is consistent with a previous study which identified a novel transcriptional repressor element located more than 500 base pairs into the first intron of BRCA1, suggesting that the first intron plays an important role in the negative regulation of BRCA1. Although further functional studies are necessary to confirm its repressor activity towards BRCA1, the elucidation of the role of BP1 in breast tumorigenesis holds great promise in establishing BP1 as a novel target for drug therapy. PMID:20877436

  9. Neutron star/red giant encounters in globular clusters

    International Nuclear Information System (INIS)

    Bailyn, C.D.

    1988-01-01

    The author presents a simple expression for the amount by which xsub(crit) is diminished as a star evolves xsub(crit) Rsub(crit)/R*, where Rsub(crit) is the maximum distance of closest approach between two stars for which the tidal energy is sufficient to bind the system, and R* is the radius of the star on which tides are being raised. Also it is concluded that tidal capture of giants by neutron stars resulting in binary systems is unlikely in globular clusters. However, collisions between neutron stars and red giants, or an alternative process involving tidal capture of a main-sequence star into an initially detached binary system, may result either in rapidly rotating neutron stars or in white dwarf/neutron star binaries. (author)

  10. Heavy Metal Stars

    Science.gov (United States)

    2001-08-01

    La Silla Telescope Detects Lots of Lead in Three Distant Binaries Summary Very high abundances of the heavy element Lead have been discovered in three distant stars in the Milky Way Galaxy . This finding strongly supports the long-held view that roughly half of the stable elements heavier than Iron are produced in common stars during a phase towards the end of their life when they burn their Helium - the other half results from supernova explosions. All the Lead contained in each of the three stars weighs about as much as our Moon. The observations show that these "Lead stars" - all members of binary stellar systems - have been more enriched with Lead than with any other chemical element heavier than Iron. This new result is in excellent agreement with predictions by current stellar models about the build-up of heavy elements in stellar interiors. The new observations are reported by a team of Belgian and French astronomers [1] who used the Coude Echelle Spectrometer on the ESO 3.6-m telescope at the La Silla Observatory (Chile). PR Photo 26a/01 : A photo of HD 196944 , one of the "Lead stars". PR Photo 26b/01 : A CES spectrum of HD 196944 . The build-up of heavy elements Astronomers and physicists denote the build-up of heavier elements from lighter ones as " nucleosynthesis ". Only the very lightest elements (Hydrogen, Helium and Lithium [2]) were created at the time of the Big Bang and therefore present in the early universe. All the other heavier elements we now see around us were produced at a later time by nucleosynthesis inside stars. In those "element factories", nuclei of the lighter elements are smashed together whereby they become the nuclei of heavier ones - this process is known as nuclear fusion . In our Sun and similar stars, Hydrogen is being fused into Helium. At some stage, Helium is fused into Carbon, then Oxygen, etc. The fusion process requires positively charged nuclei to move very close to each other before they can unite. But with increasing

  11. Atomic diffusion in stars

    CERN Document Server

    Michaud, Georges; Richer, Jacques

    2015-01-01

    This book gives an overview of atomic diffusion, a fundamental physical process, as applied to all types of stars, from the main sequence to neutron stars. The superficial abundances of stars as well as their evolution can be significantly affected. The authors show where atomic diffusion plays an essential role and how it can be implemented in modelling.  In Part I, the authors describe the tools that are required to include atomic diffusion in models of stellar interiors and atmospheres. An important role is played by the gradient of partial radiative pressure, or radiative acceleration, which is usually neglected in stellar evolution. In Part II, the authors systematically review the contribution of atomic diffusion to each evolutionary step. The dominant effects of atomic diffusion are accompanied by more subtle effects on a large number of structural properties throughout evolution. One of the goals of this book is to provide the means for the astrophysicist or graduate student to evaluate the importanc...

  12. Dynamical Boson Stars

    Directory of Open Access Journals (Sweden)

    Steven L. Liebling

    2012-05-01

    Full Text Available The idea of stable, localized bundles of energy has strong appeal as a model for particles. In the 1950s, John Wheeler envisioned such bundles as smooth configurations of electromagnetic energy that he called geons, but none were found. Instead, particle-like solutions were found in the late 1960s with the addition of a scalar field, and these were given the name boson stars. Since then, boson stars find use in a wide variety of models as sources of dark matter, as black hole mimickers, in simple models of binary systems, and as a tool in finding black holes in higher dimensions with only a single Killing vector. We discuss important varieties of boson stars, their dynamic properties, and some of their uses, concentrating on recent efforts.

  13. GRACE star camera noise

    Science.gov (United States)

    Harvey, Nate

    2016-08-01

    Extending results from previous work by Bandikova et al. (2012) and Inacio et al. (2015), this paper analyzes Gravity Recovery and Climate Experiment (GRACE) star camera attitude measurement noise by processing inter-camera quaternions from 2003 to 2015. We describe a correction to star camera data, which will eliminate a several-arcsec twice-per-rev error with daily modulation, currently visible in the auto-covariance function of the inter-camera quaternion, from future GRACE Level-1B product releases. We also present evidence supporting the argument that thermal conditions/settings affect long-term inter-camera attitude biases by at least tens-of-arcsecs, and that several-to-tens-of-arcsecs per-rev star camera errors depend largely on field-of-view.

  14. Molecules in stars

    International Nuclear Information System (INIS)

    Tsuji, T.

    1986-01-01

    Recently, research related to molecules in stars has rapidly expanded because of progress in related fields. For this reason, it is almost impossible to cover all the topics related to molecules in stars. Thus, here the authors focus their attention on molecules in the atmospheres of cool stars and do not cover in any detail topics related to circumstellar molecules originating from expanding envelopes located far from the stellar surface. However, the authors do discuss molecules in quasi-static circumstellar envelopes (a recently discovered new component of circumstellar envelopes) located near the stellar surface, since molecular lines originating from such envelopes show little velocity shift relative to photospheric lines, and hence they directly affect the interpretation and analysis of stellar spectra

  15. CARBON NEUTRON STAR ATMOSPHERES

    International Nuclear Information System (INIS)

    Suleimanov, V. F.; Klochkov, D.; Werner, K.; Pavlov, G. G.

    2014-01-01

    The accuracy of measuring the basic parameters of neutron stars is limited in particular by uncertainties in the chemical composition of their atmospheres. For example, the atmospheres of thermally emitting neutron stars in supernova remnants might have exotic chemical compositions, and for one of them, the neutron star in Cas A, a pure carbon atmosphere has recently been suggested by Ho and Heinke. To test this composition for other similar sources, a publicly available detailed grid of the carbon model atmosphere spectra is needed. We have computed this grid using the standard local thermodynamic equilibrium approximation and assuming that the magnetic field does not exceed 10 8  G. The opacities and pressure ionization effects are calculated using the Opacity Project approach. We describe the properties of our models and investigate the impact of the adopted assumptions and approximations on the emergent spectra

  16. Instability and star evolution

    International Nuclear Information System (INIS)

    Mirzoyan, L.V.

    1981-01-01

    The observational data are discussed which testify that the phenomena of dynamical instability of stars and stellar systems are definite manifestations of their evolution. The study of these phenomena has shown that the instability is a regular phase of stellar evolution. It has resulted in the recognition of the most important regularities of the process of star formation concerning its nature. This became possible due to the discovery in 1947 of stellar associations in our Galaxy. The results of the study of the dynamical instability of stellar associations contradict the predictions of classical hypothesis of stellar condensation. These data supplied a basis for a new hypothesis on the formation of stars and nebulae by the decay of superdense protostars [ru

  17. The twinkling of stars

    International Nuclear Information System (INIS)

    Jakeman, E.; Parry, G.; Pike, E.R.; Pusey, P.N.

    1978-01-01

    This article collects together some of the main ideas and experimental results on the twinkling of stars. Statistical methods are used to characterise the features of the scintillation and to investigate the ways in which these depend on the zenith angle of the star, the bandwidth of the light and various other parameters. Some new results are included which demonstrate the advantages of using photon counting methods in experiments on stellar scintillation. Since the twinkling of stars is a consequence of the turbulence in the Earth's magnetic atmosphere then measurements can be used to deduce some features of the structure of the turbulence. Some of the experiments designed to do this are discussed and the results reported. (author)

  18. MASS LOSS IN PRE-MAIN-SEQUENCE STARS VIA CORONAL MASS EJECTIONS AND IMPLICATIONS FOR ANGULAR MOMENTUM LOSS

    Energy Technology Data Exchange (ETDEWEB)

    Aarnio, Alicia N. [Astronomy Department, University of Michigan, 830 Dennison Building, 500 Church Street, Ann Arbor, MI 48109 (United States); Matt, Sean P. [Laboratoire AIM Paris-Saclay, CEA/Irfu Universite Paris-Diderot CNRS/INSU, F-91191 Gif-sur-Yvette (France); Stassun, Keivan G., E-mail: aarnio@umich.edu [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States)

    2012-11-20

    We develop an empirical model to estimate mass-loss rates via coronal mass ejections (CMEs) for solar-type pre-main-sequence (PMS) stars. Our method estimates the CME mass-loss rate from the observed energies of PMS X-ray flares, using our empirically determined relationship between solar X-ray flare energy and CME mass: log (M {sub CME}[g]) = 0.63 Multiplication-Sign log (E {sub flare}[erg]) - 2.57. Using masses determined for the largest flaring magnetic structures observed on PMS stars, we suggest that this solar-calibrated relationship may hold over 10 orders of magnitude in flare energy and 7 orders of magnitude in CME mass. The total CME mass-loss rate we calculate for typical solar-type PMS stars is in the range 10{sup -12}-10{sup -9} M {sub Sun} yr{sup -1}. We then use these CME mass-loss rate estimates to infer the attendant angular momentum loss leading up to the main sequence. Assuming that the CME outflow rate for a typical {approx}1 M {sub Sun} T Tauri star is <10{sup -10} M {sub Sun} yr{sup -1}, the resulting spin-down torque is too small during the first {approx}1 Myr to counteract the stellar spin-up due to contraction and accretion. However, if the CME mass-loss rate is {approx}> 10{sup -10} M {sub Sun} yr{sup -1}, as permitted by our calculations, then the CME spin-down torque may influence the stellar spin evolution after an age of a few Myr.

  19. Weighing the Smallest Stars

    Science.gov (United States)

    2005-01-01

    VLT Finds Young, Very Low Mass Objects Are Twice As Heavy As Predicted Summary Thanks to the powerful new high-contrast camera installed at the Very Large Telescope, photos have been obtained of a low-mass companion very close to a star. This has allowed astronomers to measure directly the mass of a young, very low mass object for the first time. The object, more than 100 times fainter than its host star, is still 93 times as massive as Jupiter. And it appears to be almost twice as heavy as theory predicts it to be. This discovery therefore suggests that, due to errors in the models, astronomers may have overestimated the number of young "brown dwarfs" and "free floating" extrasolar planets. PR Photo 03/05: Near-infrared image of AB Doradus A and its companion (NACO SDI/VLT) A winning combination A star can be characterised by many parameters. But one is of uttermost importance: its mass. It is the mass of a star that will decide its fate. It is thus no surprise that astronomers are keen to obtain a precise measure of this parameter. This is however not an easy task, especially for the least massive ones, those at the border between stars and brown dwarf objects. Brown dwarfs, or "failed stars", are objects which are up to 75 times more massive than Jupiter, too small for major nuclear fusion processes to have ignited in its interior. To determine the mass of a star, astronomers generally look at the motion of stars in a binary system. And then apply the same method that allows determining the mass of the Earth, knowing the distance of the Moon and the time it takes for its satellite to complete one full orbit (the so-called "Kepler's Third Law"). In the same way, they have also measured the mass of the Sun by knowing the Earth-Sun distance and the time - one year - it takes our planet to make a tour around the Sun. The problem with low-mass objects is that they are very faint and will often be hidden in the glare of the brighter star they orbit, also when viewed

  20. General Relativity and Compact Stars

    International Nuclear Information System (INIS)

    Glendenning, Norman K.

    2005-01-01

    Compact stars--broadly grouped as neutron stars and white dwarfs--are the ashes of luminous stars. One or the other is the fate that awaits the cores of most stars after a lifetime of tens to thousands of millions of years. Whichever of these objects is formed at the end of the life of a particular luminous star, the compact object will live in many respects unchanged from the state in which it was formed. Neutron stars themselves can take several forms--hyperon, hybrid, or strange quark star. Likewise white dwarfs take different forms though only in the dominant nuclear species. A black hole is probably the fate of the most massive stars, an inaccessible region of spacetime into which the entire star, ashes and all, falls at the end of the luminous phase. Neutron stars are the smallest, densest stars known. Like all stars, neutron stars rotate--some as many as a few hundred times a second. A star rotating at such a rate will experience an enormous centrifugal force that must be balanced by gravity or else it will be ripped apart. The balance of the two forces informs us of the lower limit on the stellar density. Neutron stars are 10 14 times denser than Earth. Some neutron stars are in binary orbit with a companion. Application of orbital mechanics allows an assessment of masses in some cases. The mass of a neutron star is typically 1.5 solar masses. They can therefore infer their radii: about ten kilometers. Into such a small object, the entire mass of our sun and more, is compressed