
Sample records for tarantula brachypelma boehmei

  1. A case of zootherapy with the tarantula Brachypelma vagans Ausserer, 1875 in traditional medicine of the Chol Mayan ethnic group in Mexico

    Directory of Open Access Journals (Sweden)

    Rojo Roberto


    Full Text Available Abstract Background In practically every human culture, the use of arthropods as medicinal resources has been reported. In Mexico, the Mayan people mainly use plants but occasionally also animals and minerals in their medicine. This article is the first to report the traditional use of the tarantula Brachypelma vagans by medicine men in the Chol community, an ancient indigenous group that inhabits the southeastern part of Mexico. We also describe the utility of such arachnids in traditional medicine. Methods This study was carried out in different Chol communities in the states of Chiapas and Campeche (southeastern Mexico from 2003 until 2007. We interviewed the local medicine men, patients and non-Chol people in each village visited to collect information about the rituals involved and the effectiveness of this traditional medicine and also their opinion of this traditional medicine. Results In all independent villages, the people who present an illness called 'aire de tarantula' or tarantula wind with symptoms including chest pain, coughing and asthma, were treated by the medicine man (called 'hierbatero' with a tarantula-based beverage. From village to village, the beverage has a similar base composition but some variations occur in additional ingredients depending on the individual medicine man. Like in all traditional Mayan medicine, the ritual of the ceremony consists of drinking the tarantula-based beverage and this is principally accompanied by chants and burning of incense. Conclusions The recipe of the tarantula-based beverage and the procedure of this ritual ceremony were fairly constant in all the villages visited. Our work shows that despite the tarantula's bad image in several cultures, in others positive use is made of these spiders, as in modern medicine.

  2. Tarantula spider (United States)

    ... page: // Tarantula spider bite To use the sharing features on this ... This article describes the effects of a tarantula spider bite. The class of insects to which the ...

  3. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  4. The Hubble Tarantula Treasury Project (United States)

    Sabbi, Elena; Lennon, D. J.; Anderson, J.; Van Der Marel, R. P.; Aloisi, A.; Boyer, M. L.; Cignoni, M.; De Marchi, G.; de Mink, S. E.; Evans, C. J.; Gallagher, J. S.; Gordon, K. D.; Gouliermis, D.; Grebel, E.; Koekemoer, A. M.; Larsen, S. S.; Panagia, N.; Ryon, J. E.; Smith, L. J.; Tosi, M.; Zaritsky, D. F.


    The Tarantula Nebula (a.k.a. 30 Doradus) in the Large Magellanic Cloud is one of the most famous objects in astronomy, with first astronomical references being more than 150 years old. Today the Tarantula Nebula and its ionizing cluster R136 are considered one of the few known starburst regions in the Local Group and an ideal test bed to investigate the temporal and spatial evolution of a prototypical starburst on a sub-cluster scale. The Hubble Tarantula Treasury Project (HTTP) is a panchromatic imaging survey of the stellar populations and ionized gas in the Tarantula Nebula that reaches into the sub-solar mass regime (eBook that explains how stars form and evolve using images from HTTP. The eBook utilizes emerging technology that works in conjunction with the built-in accessibility features in the Apple iPad to allow totally blind users to interactively explore complex astronomical images.

  5. Tarantula Hairs as Corneal Foreign Bodies

    Directory of Open Access Journals (Sweden)

    Brian C. Stagg


    Full Text Available Purpose: To report a case of tarantula hairs found in the cornea and discuss treatment. Case Report: A 16-year-old male presented with a 6-week history of right ocular irritation that began after letting his pet tarantula crawl on his face. Slit-lamp examination of the right eye revealed the presence of approximately 16 dark foreign bodies that had the appearance of small hairs. The foreign bodies were removed from the nasal region of the right cornea using Jewelers forceps, and the patient was prescribed a combination neomycin, polymyxin B, and dexamethasone ointment (Maxitrol®, given 4 times per day. Results: The patient presented for follow-up 2 weeks later, with resolution of symptoms. Conclusion: Effective treatment of keratitis caused by tarantula hairs includes taking a detailed history, conducting a careful slit-lamp examination, removal of any accessible hairs, and initiation of treatment with a topical steroid as determined by the clinical picture.

  6. Tarantula: Killing driver bugs before they hatch

    DEFF Research Database (Denmark)

    Lawall, Julia Laetitia; Muller, Gilles; Urunuela, Richard


    The Linux operating system is undergoing continual evolution. Evolution in the kernel and generic driver modules often triggers the need for corresponding evolutions in specific device drivers. Such collateral evolutions are tedious, because of the large number of device drivers, and error......-prone, because of the complexity of the code modifications involved. We propose an automatic tool, Tarantula, to aid in this process. In this paper, we examine some recent evolutions in Linux and the collateral evolutions they trigger, and assess the corresponding requirements on Tarantula....

  7. Symphony of colours in the Tarantula (United States)


    hi-res Size hi-res: 1058 Kb Credits: ESA/NASA, ESO and Danny LaCrue Symphony of colours in the Tarantula The Tarantula is situated 170 000 light-years away in the Large Magellanic Cloud (LMC) in the southern sky and is clearly visible to the naked eye as a large milky patch. Astronomers believe that this smallish irregular galaxy is currently going through a violent period in its life. It is orbiting around the Milky Way and has had several close encounters with it. It is believed that the interaction with the Milky Way has caused an episode of energetic star formation - part of which is visible as the Tarantula Nebula. Just above the centre of the image there is a huge cluster of very hot stars called R136. The stars in R136 are also among the most massive stars we know. R136 is also a very young cluster, its oldest stars being 'just' 5 million years old or so. Its smallest stars, however, are still forming, so astronomers observe R136 to try to understand the early stages of stellar evolution. Near the lower edge of the image we find the star cluster Hodge 301. Hodge 301 is almost 10 times older than R136. Some of the stars in Hodge 301 are so old that they have already exploded as supernovae. The shockwave from this explosion has compressed the gas in the Tarantula into the filaments and sheets that are seen around the cluster. This mosaic of the Tarantula Nebula consists of images from the NASA/ESA Hubble Space Telescope’s Wide Field and Planetary Camera 2 (WFPC2) and was created by 23 year old amateur astronomer Danny LaCrue. The image was constructed by 15 individual exposures taken through three narrow-band filters allowing light from ionised oxygen (501 nm, shown as blue), hydrogen-alpha (656 nm, shown as green) and ionised sulphur (672 nm, shown as red). The exposure time for the individual WFPC2 images vary between 800 and 2800 seconds in each filter. The Hubble data have been superimposed onto images taken through matching narrow-band filters with the

  8. The VLT-FLAMES Tarantula survey

    NARCIS (Netherlands)

    Markova, N.; Evans, C.J.; Bastian, N.; Beletsky, Y.; Bestenlehner, J.; Brott, I.; Cantiello, M.; Carraro, G.; Clark, J.S.; Crowther, P.A.; de Koter, A.; de Mink, S.E.; Doran, E.; Dufton, P.L.; Dunstall, P.; Gieles, M.; Graefener, G.; Henault-Brunet, V.; Herrero, A.; Howarth, I.D.; Langer, N.; Lennon, D.J.; Maiz-Appellaniz, J.; Najarro, F.; Puls, J.; Sana, H.A.A.; Simon-Diaz, S.; Smartts, S.J.; Stroud, V.E.; Taylor, W.D.; van Loon, J.T.; Vink, J.S.; Walborn, N.R.


    The Tarantula survey is an ESO Large Programme which has obtained multi- epochs spectroscopy of over 800 massive stars in the 30 Dor region in the Large Magelanic Cloud. Here we briefly describe the main drivers of the survey and the observational material derived.

  9. The VLT-FLAMES Tarantula Survey

    NARCIS (Netherlands)

    Evans, C.J.; Bastian, N.; Beletsky, Y.; Brott, I.; Cantiello, M.; Clark, J.S.; Crowther, P.A.; de Koter, A.; de Mink, S.E.; Dufton, P.L.; Dunstall, P.; Gieles, M.; Gräfener, G.; Hénault-Brunet, V.; Herrero, A.; Howarth, I.D.; Langer, N.; Lennon, D.J.; Maíz Apellániz, J.; Markova, N.; Najarro, F.; Puls, J.; Sana, H.; Simón-Díaz, S.; Smartt, S.J.; Stroud, V.E.; Taylor, W.D.; Trundle, C.; van Loon, J.T.; Vink, J.S.; Walborn, N.R.


    The Tarantula Survey is an ambitious ESO Large Programme that has obtained multi-epoch spectroscopy of over 1000 massive stars in the 30 Doradus region in the Large Magellanic Cloud. Here, we introduce the scientific motivations of the survey and give an overview of the observational sample.

  10. The VLT-FLAMES Tarantula survey

    NARCIS (Netherlands)

    Taylor, W.D.; Evans, C.J.; Henault-Brunet, V.; Bastian, N.; Beletsky, Y.; Bestenlehner, J.; Brott, I.; Cantiello, M.; Carraro, G.; Clark, J.S.; Crowther, P.A.; de Koter, A.; de Mink, S.E.; Doran, E.; Dufton, P.L.; Dunstall, P.; Gieles, M.; Grafener, G.; Herrero, A.; Howarth, I.D.; Langer, N.; Lennon, D.J.; Maiz-Apellaniz, J; Markova, N.; Najarro, P.; Puls, J.; Sana, H.A.A.; Simon-Diaz, S.; Smartt, S.J.; Stroud, V.E.; van Loon, J.T.; Vink, J.S.; Walborn, N.R.


    The VLT-FLAMES Tarantula Survey is an ESO Large Programme that has provided multi-epoch spectroscopy of over 1000 stars in the 30 Doradus region in the Large Magellanic Cloud. Armed with this unique dataset the assembled consortium is now addressing a broad range of fundamental questions in both

  11. The VLT FLAMES Tarantula Survey

    NARCIS (Netherlands)

    Evans, C.; Taylor, W.; Sana, H.; Hénault-Brunet, V.; Bagnoli, T.; Bastian, N.; Bestenlehner, J.; Bonanos, A.; Bressert, E.; Brott, I.; Campbell, M.; Cantiello, M.; Carraro, G.; Clark, S.; Costa, E.; Crowther, P.; de Koter, A.; de Mink, S.; Doran, E.; Dufton, P.; Dunstall, P.; Garcia, M.; Gieles, M.; Gräfener, G.; Herrero, A.; Howarth, I.; Izzard, R.; Köhler, K.; Langer, N.; Lennon, D.; Maíz Apellániz, J.; Markova, N.; Najarro, P.; Puls, J.; Ramirez, O.; Sabín-Sanjulián, C.; Simón-Díaz, S.; Smartt, S.; Stroud, V.; van Loon, J.; Vink, J.S.; Walborn, N.


    We introduce the VLT FLAMES Tarantula Survey, an ESO Large Programme from which we have obtained optical spectroscopy of over 800 massive stars in the spectacular 30 Doradus region of the Large Magellanic Cloud. A key feature is the use of multi-epoch observations to provide strong constraints on

  12. Hey! A Tarantula Bit Me! (United States)

    ... these spiders are not dangerous. They live in nests in the ground and are pretty timid, avoiding people whenever they can. What a Bite Looks and Feels Like If a person gets bitten by a tarantula, the bite will probably feel a lot like a bee sting , with pain in the area of the ...

  13. "Tarantula keratitis": a case report.

    LENUS (Irish Health Repository)

    McAnena, L


    A case of an 11-year-old boy presenting with a two-week history of a red, irritated right eye after handling a Chilean Rose Tarantula at an exotic pet exhibition. Examination revealed innumerable microscopic hairs embedded at all levels of the cornea. He was commenced on steroid drops with subjective and objective improvement at follow up.

  14. In Tarantula Territory (United States)


    The largest emission nebula in the sky, the Tarantula Nebula (also known as NGC 2070 or 30 Doradus ) is located in the Large Magellanic Cloud (LMC) , one of the satellite galaxies to our own Milky Way system. Seen far down in the southern sky at a distance of about 170,000 light-years, this beautiful nebula measures more than 1000 light-years across and extends over more than one third of a degree, almost, but not quite the size of the full moon. It received its descriptive name because of the unusual shape. It is a splendid object with a central cluster of hot and luminous young stars that powers strong emission from hydrogen and oxygen gas, making the Tarantula Nebula an easy and impressive target for observations, even with the unaided eye. It is well visible from ESO's mountain observatories at La Silla and Paranal in Chile and it has been the object of innumerable research programmes with many different telescopes. The present images of the Tarantula Nebula were obtained with the Wide-Field Imager (WFI) on the MPG/ESO 2.2-m telescope at the La Silla Observatory. This advanced digital camera has already produced many impressive pictures, cf. the WFI Photo Gallery [1]. As the name indicates, the WFI has a comparatively large field-of-view, 34 x 34 arcmin 2 , and it is therefore well suited to show the full extent of this stunning nebula. The WFI image PR Photo 14a/02 has been produced from 15 individual WFI-exposures obtained in September 2000. Details are available below about the way it was made. A large number of different and colourful objects are seen in this amazing image. The very complex nebulosity is prominent in most of the field; it predominantly emits red light from hydrogen atoms (the H-alpha spectral line at wavelength 656.2 nm) and green-blue light from hydrogen atoms (H-beta line at 486.2 nm) and oxygen ions (two [O III] lines at 495.7 and 500.7 nm). This emission is excited by the strong ultraviolet (UV) radiation emitted by hot young stars in

  15. Tarantula toxins use common surfaces for interacting with Kv and ASIC ion channels. (United States)

    Gupta, Kanchan; Zamanian, Maryam; Bae, Chanhyung; Milescu, Mirela; Krepkiy, Dmitriy; Tilley, Drew C; Sack, Jon T; Yarov-Yarovoy, Vladimir; Kim, Jae Il; Swartz, Kenton J


    Tarantula toxins that bind to voltage-sensing domains of voltage-activated ion channels are thought to partition into the membrane and bind to the channel within the bilayer. While no structures of a voltage-sensor toxin bound to a channel have been solved, a structural homolog, psalmotoxin (PcTx1), was recently crystalized in complex with the extracellular domain of an acid sensing ion channel (ASIC). In the present study we use spectroscopic, biophysical and computational approaches to compare membrane interaction properties and channel binding surfaces of PcTx1 with the voltage-sensor toxin guangxitoxin (GxTx-1E). Our results show that both types of tarantula toxins interact with membranes, but that voltage-sensor toxins partition deeper into the bilayer. In addition, our results suggest that tarantula toxins have evolved a similar concave surface for clamping onto α-helices that is effective in aqueous or lipidic physical environments.

  16. Explosive Model Tarantula V1/JWL++ Calibration of LX-17: #2

    Energy Technology Data Exchange (ETDEWEB)

    Souers, P C; Vitello, P


    Tarantula V1 is a kinetic package for reactive flow codes that seeks to describe initiation, failure, dead zones and detonation simultaneously. The most important parameter is P1, the pressure between the initiation and failure regions. Both dead zone formation and failure can be largely controlled with this knob. However, V1 does failure with low settings and dead zones with higher settings, so that it cannot fulfill its purpose in the current format. To this end, V2 is under test. The derivation of the initiation threshold P0 is discussed. The derivation of the initiation pressure-tau curve as an output of Tarantula shows that the initiation package is sound. A desensitization package is also considered.

  17. TARANTULA 2011 in JWL++

    Energy Technology Data Exchange (ETDEWEB)

    Souers, P C; Haylett, D; Vitello, P


    Using square zoning, the 2011 version of the kinetic package Tarantula matches cylinder data, cylinder dead zones, and cylinder failure with the same settings for the first time. The key is the use of maximum pressure rather than instantaneous pressure. Runs are at 40, 200 and 360 z/cm using JWL++ as the host model. The model also does run-to-detonation, thin-pulse initiation with a P-t curve and air gap crossing, all in cylindrical geometry. Two sizes of MSAD/LX-10/LX-17 snowballs work somewhat with these settings, but are too weak, so that divergent detonation is a challenge for the future. Butterfly meshes are considered but do not appear to solve the issue.

  18. Observations on the use of tarantula burrows by the anurans Leptodactylus bufonius (Leptodactylidae and Rhinella major (Bufonidae in the Dry Chaco ecoregion of Bolivia

    Directory of Open Access Journals (Sweden)

    Christopher M. Schalk


    Full Text Available Some species of anurans have been observed utilizing burrows of other animals, such as rodents and tarantulas. Here we report the observations of two anuran species, Leptodactylus bufonius and Rhinella major, utilizing the burrows of tarantulas (Acanthoscurria sp.; Family Theraphosidae in the dry Chaco ecoregion of Bolivia. Both species of anurans never co-occurred with tarantulas in the burrows and used burrows that were wider in diameter and closer to breeding ponds as compared to the total available tarantula burrows in the area. These burrows may serve as refuges from predators, especially for conspicuous, calling males.

  19. Lessons from a tarantula: new insights into muscle thick filament and myosin interacting-heads motif structure and function. (United States)

    Alamo, Lorenzo; Koubassova, Natalia; Pinto, Antonio; Gillilan, Richard; Tsaturyan, Andrey; Padrón, Raúl


    The tarantula skeletal muscle X-ray diffraction pattern suggested that the myosin heads were helically arranged on the thick filaments. Electron microscopy (EM) of negatively stained relaxed tarantula thick filaments revealed four helices of heads allowing a helical 3D reconstruction. Due to its low resolution (5.0 nm), the unambiguous interpretation of densities of both heads was not possible. A resolution increase up to 2.5 nm, achieved by cryo-EM of frozen-hydrated relaxed thick filaments and an iterative helical real space reconstruction, allowed the resolving of both heads. The two heads, "free" and "blocked", formed an asymmetric structure named the "interacting-heads motif" (IHM) which explained relaxation by self-inhibition of both heads ATPases. This finding made tarantula an exemplar system for thick filament structure and function studies. Heads were shown to be released and disordered by Ca 2+ -activation through myosin regulatory light chain phosphorylation, leading to EM, small angle X-ray diffraction and scattering, and spectroscopic and biochemical studies of the IHM structure and function. The results from these studies have consequent implications for understanding and explaining myosin super-relaxed state and thick filament activation and regulation. A cooperative phosphorylation mechanism for activation in tarantula skeletal muscle, involving swaying constitutively Ser35 mono-phosphorylated free heads, explains super-relaxation, force potentiation and post-tetanic potentiation through Ser45 mono-phosphorylated blocked heads. Based on this mechanism, we propose a swaying-swinging, tilting crossbridge-sliding filament for tarantula muscle contraction.

  20. The VLT-FLAMES Tarantula Survey. XXII. Multiplicity properties of the B-type stars

    NARCIS (Netherlands)

    Dunstall, P.R.; Dufton, P.L.; Sana, H.; Evans, C.J.; Howarth, I.D.; Simón-Díaz, S.; de Mink, S.E.; Langer, N.; Maíz Apellániz, J.; Taylor, W.D.


    We investigate the multiplicity properties of 408 B-type stars observed in the 30 Doradus region of the Large Magellanic Cloud with multi-epoch spectroscopy from the VLT-FLAMES Tarantula Survey (VFTS). We use a cross-correlation method to estimate relative radial velocities from the helium and metal

  1. The Tarantula Festival: Joy and Distress in Upper Aragon

    Directory of Open Access Journals (Sweden)

    Tausiet, María


    Full Text Available Tarantism (a mythically-based, ritualized reaction to the bite of the dreaded tarantula in the belief that the victim could only be cured by music and dance had existed in Italy since time immemorial; yet it manifested itself also in Spain, where it has been far less studied, at least from the perspective of cultural history. Tarantism was certainly known in Aragon until well into the 20th century, as reported by informants in Fraga (Huesca who recall “The Tarantula Festival,” by which all forms of individual suffering were communally exorcised through the power of sympathy and neighbourly solidarity.

    El tarantismo (fenómeno mítico-ritual según el cual quienes eran picados por la temida tarántula sólo podían recuperarse mediante la música y el baile se manifestó desde antiguo en Italia, pero también en España, donde no ha sido tan estudiado, al menos desde la perspectiva de la historia cultural. De la vigencia de dicho fenómeno en Aragón hasta bien entrado el siglo XX dan cuenta las entrevistas en Fraga (Huesca con varios informantes acerca de la llamada “Fiesta de la Tarántula”: una forma comunitaria de exorcizar todo tipo de desgracias individuales, gracias al poder de la compasión y la solidaridad vecinal.

  2. New species of Southeast Asian Dwarf Tarantula from Thailand: Phlogiellus Pocock, 1897 (Theraphosidae, Selenocosmiinae

    Directory of Open Access Journals (Sweden)

    Narin Chomphuphuang


    Full Text Available A new record of the tarantula genus Phlogiellus Pocock, 1897 from Thailand is described. Distributional data, natural history, morphological characters, and illustrations of male and female are provided. The Thai specimens belong to a new species, Phlogiellus longipalpus sp. n. The diagnosis of the new species and related species are discussed.

  3. The VLT-FLAMES Tarantula Survey. XVIII. Classifications and radial velocities of the B-type stars

    NARCIS (Netherlands)

    Evans, C.J.; Kennedy, M.B.; Dufton, P.L.; Howarth, I.D.; Walborn, N.R.; Markova, N.; Clark, J.S.; de Mink, S.E.; de Koter, A.; Dunstall, P.R.; Hénault-Brunet, V.; Maíz Apellániz, J.; McEvoy, C.M.; Sana, H.; Simón-Díaz, S.; Taylor, W.D.; Vink, J.S.


    We present spectral classifications for 438 B-type stars observed as part of the VLT-FLAMES Tarantula Survey (VFTS) in the 30 Doradus region of the Large Magellanic Cloud. Radial velocities are provided for 307 apparently single stars, and for 99 targets with radial-velocity variations which are

  4. The VLT-FLAMES Tarantula Survey. IX. The interstellar medium seen through diffuse interstellar bands and neutral sodium

    NARCIS (Netherlands)

    van Loon, J.Th.; Bailey, M.; Tatton, B.L.; Maíz Apellániz, J.; Crowther, P.A.; de Koter, A.; Evans, C.J.; Hénault-Brunet, V.; Howarth, I.D.; Richter, P.; Sana, H.; Simón-Díaz, S.; Taylor, W.; Walborn, N.R.


    Context. The Tarantula Nebula (a.k.a. 30 Dor) is a spectacular star-forming region in the Large Magellanic Cloud (LMC), seen through gas in the Galactic disc and halo. Diffuse interstellar bands (DIBs) offer a unique probe of the diffuse, cool-warm gas in these regions. Aims. The aim is to use DIBs


    Energy Technology Data Exchange (ETDEWEB)

    Cignoni, M. [Department of Physics—University of Pisa, Largo Pontecorvo, 3 Pisa, I-56127 (Italy); Sabbi, E.; Marel, R. P. van der; Aloisi, A.; Panagia, N. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD, 21218 (United States); Lennon, D. J. [European Space Astronomy Centre, Apdo. de Correo 78, E-28691 Villanueva de la Canada, Madrid (Spain); Tosi, M. [INAF-Osservatorio Astronomico di Bologna, Via Ranzani 1, I-40127 Bologna (Italy); Grebel, E. K. [Astronomisches Rechen-Institut, Zentrum für Astronomie der Universität Heidelberg, Mönchhofstr. 12-14, D-69120 Heidelberg (Germany); Gallagher, J. S. III [Department of Astronomy, University of Wisconsin-Madison, WI 53706 (United States); Marchi, G. de [European Space Research and Technology Centre, Keplerlaan 1, NL-2200 AG Noordwijk (Netherlands); Gouliermis, D. A. [Zentrum für Astronomie der Universität Heidelberg, Institut für Theoretische Astrophysik, Albert-Ueberle-Str. 2, D-69120 Heidelberg (Germany); Larsen, S. [Department of Astrophysics, Radboud University, P.O. Box 9010, NL-6500 GL Nijmegen (Netherlands); Smith, L. J., E-mail: [European Space Agency and Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States)


    Based on color–magnitude diagrams (CMDs) from the Hubble Space Telescope  Hubble Tarantula Treasury Project (HTTP) survey, we present the star formation history of Hodge 301, the oldest star cluster in the Tarantula Nebula. The HTTP photometry extends faint enough to reach, for the first time, the cluster pre-main sequence (PMS) turn-on, where the PMS joins the main sequence. Using the location of this feature, along with synthetic CMDs generated with the latest PARSEC models, we find that Hodge 301 is older than previously thought, with an age between 26.5 and 31.5 Myr. From this age, we also estimate that between 38 and 61 Type II supernovae exploded in the region. The same age is derived from the main sequence turn-off, whereas the age derived from the post-main sequence stars is younger and between 20 and 25 Myr. Other relevant parameters are a total stellar mass of ≈8800 ± 800  M {sub ⊙} and average reddening E ( B − V ) ≈ 0.22–0.24 mag, with a differential reddening δE ( B − V ) ≈ 0.04 mag.

  6. The VLT-FLAMES Tarantula Survey. III. A very massive star in apparent isolation from the massive cluster R136

    NARCIS (Netherlands)

    Bestenlehner, J.M.; Vink, J.S.; Gräfener, G.; Najarro, F.; Evans, C.J.; Bastian, N.; Bonanos, A.Z.; Bressert, E.; Crowther, P.A.; Doran, E.; Friedrich, K.; Hénault-Brunet, V.; Herrero, A.; de Koter, A.; Langer, N.; Lennon, D.J.; Maíz Apellániz, J.; Sana, H.; Soszynski, I.; Taylor, W.D.


    VFTS 682 is located in an active star-forming region, at a projected distance of 29 pc from the young massive cluster R136 in the Tarantula Nebula of the Large Magellanic Cloud. It was previously reported as a candidate young stellar object, and more recently spectroscopically revealed as a

  7. The sale of tarantulas in Cambodia for food or medicine: is it sustainable?

    Directory of Open Access Journals (Sweden)

    A.L. Yen


    Full Text Available The sale of tarantulas for either human consumption or for preparation of medicines has become more widespread in Cambodia over the last 10-20 years. With increased media exposure, the trade seems to be increasing, but there are serious questions as to its sustainability because of possible over-collecting of the spiders and also loss of habitats. This note outlines some of the fundamental questions that need to be addressed if this spider trade is to be sustainable or else we could see the loss of an important link in the forest food chain.

  8. An Investigation of Amphitheater-Headed Canyon Distribution, Morphology Variation, and Longitudinal Profile Controls in Escalante and Tarantula Mesa, Utah. (United States)

    Ryan, A. J.; Whipple, K. X.


    Amphitheater-headed canyons are primarily distinguished from typical fluvial channels by their abrupt headwall terminations. A key goal in the study of river canyons is to establish a reliable link between form and formation processes. This is of particular significance for Mars, where, if such links can be established, amphitheater-headed canyons could be used to determine ancient erosion mechanisms and, by inference, climate conditions. Type examples in arid regions on Earth, such as in Escalante River, Utah, previously have been interpreted as products of groundwater seepage erosion. We investigate amphitheater-headed canyons in Escalante and Tarantula Mesa where variations in canyon head morphology may hold clues for the relative roles of rock properties and fluvial and groundwater processes. In lower Escalante, amphitheaters are only present where canyons have breached the Navajo Sandstone - Kayenta Formation contact. In some canyons, amphitheater development appears to have been inhibited by an abundance of coarse bedload. In Tarantula Mesa, canyons have a variety of headwalls, from amphitheaters to stepped knickzones. Headwall morphology distribution is directly related to the spatially variable presence of knickpoint-forming, fine-grained interbeds within cliff-forming sandstones. Amphitheaters only form where the sandstone unit is undisrupted by these interbeds. Finally, most canyons in Escalante and Tarantula Mesa, regardless of substrate lithology, amphitheater presence, or groundwater spring intensity, are well described by a slope-area power law relationship with regionally constant concavity and normalized steepness indices. This suggests that all channels here are subject to the same erosion rates, independent of groundwater weathering intensity. Thus: 1) variations in canyon headwall form do not necessary relate to differences in fluvial history, 2) stratigraphic variations are clearly of importance in sedimentary canyon systems, and 3) although

  9. Hubble Tarantula Treasury Project - VI. Identification of Pre-Main-Sequence Stars using Machine Learning techniques (United States)

    Ksoll, Victor F.; Gouliermis, Dimitrios A.; Klessen, Ralf S.; Grebel, Eva K.; Sabbi, Elena; Anderson, Jay; Lennon, Daniel J.; Cignoni, Michele; de Marchi, Guido; Smith, Linda J.; Tosi, Monica; van der Marel, Roeland P.


    The Hubble Tarantula Treasury Project (HTTP) has provided an unprecedented photometric coverage of the entire star-burst region of 30 Doradus down to the half Solar mass limit. We use the deep stellar catalogue of HTTP to identify all the pre-main-sequence (PMS) stars of the region, i.e., stars that have not started their lives on the main-sequence yet. The photometric distinction of these stars from the more evolved populations is not a trivial task due to several factors that alter their colour-magnitude diagram positions. The identification of PMS stars requires, thus, sophisticated statistical methods. We employ Machine Learning Classification techniques on the HTTP survey of more than 800,000 sources to identify the PMS stellar content of the observed field. Our methodology consists of 1) carefully selecting the most probable low-mass PMS stellar population of the star-forming cluster NGC2070, 2) using this sample to train classification algorithms to build a predictive model for PMS stars, and 3) applying this model in order to identify the most probable PMS content across the entire Tarantula Nebula. We employ Decision Tree, Random Forest and Support Vector Machine classifiers to categorise the stars as PMS and Non-PMS. The Random Forest and Support Vector Machine provided the most accurate models, predicting about 20,000 sources with a candidateship probability higher than 50 percent, and almost 10,000 PMS candidates with a probability higher than 95 percent. This is the richest and most accurate photometric catalogue of extragalactic PMS candidates across the extent of a whole star-forming complex.

  10. Clinical presentation and outcome of Sri-Lankan Ornamental Tarantula Poecilotheria fasciata spider bite: a case report

    Directory of Open Access Journals (Sweden)

    NP Dinamithra


    Full Text Available We report on a 19-year-old boy with visible muscle spasms admitted to the hospitals 24 hours after spider bite. He was treated effectively with intravenous calcium gluconate followed by oral calcium supplements and made a full recovery 48 hours after the incident. Although no specific treatment exists in Srilanka, it has been suggested that calcium supplements may be beneficial to relieve the muscle spasms. Our patient made a full recovery with calcium supplements suggesting the treatment with calcium is beneficial in relieving the pain and muscle spasms caused by Sri-Lankan Ornamental Tarantula Poecilotheria fasciata.

  11. A novel tarantula toxin stabilizes the deactivated voltage sensor of bacterial sodium channel. (United States)

    Tang, Cheng; Zhou, Xi; Nguyen, Phuong Tran; Zhang, Yunxiao; Hu, Zhaotun; Zhang, Changxin; Yarov-Yarovoy, Vladimir; DeCaen, Paul G; Liang, Songping; Liu, Zhonghua


    Voltage-gated sodium channels (Na V s) are activated by transiting the voltage sensor from the deactivated to the activated state. The crystal structures of several bacterial Na V s have captured the voltage sensor module (VSM) in an activated state, but structure of the deactivated voltage sensor remains elusive. In this study, we sought to identify peptide toxins stabilizing the deactivated VSM of bacterial Na V s. We screened fractions from several venoms and characterized a cystine knot toxin called JZTx-27 from the venom of tarantula Chilobrachys jingzhao as a high-affinity antagonist of the prokaryotic Na V s Ns V Ba (nonselective voltage-gated Bacillus alcalophilus ) and NaChBac (bacterial sodium channel from Bacillus halodurans ) (IC 50 = 112 nM and 30 nM, respectively). JZTx-27 was more efficacious at weaker depolarizing voltages and significantly slowed the activation but accelerated the deactivation of Ns V Ba, whereas the local anesthetic drug lidocaine was shown to antagonize Ns V Ba without affecting channel gating. Mutation analysis confirmed that JZTx-27 bound to S3-4 linker of Ns V Ba, with F98 being the critical residue in determining toxin affinity. All electrophysiological data and in silico analysis suggested that JZTx-27 trapped VSM of Ns V Ba in one of the deactivated states. In mammalian Na V s, JZTx-27 preferably inhibited the inactivation of Na V 1.5 by targeting the fourth transmembrane domain. To our knowledge, this is the first report of peptide antagonist for prokaryotic Na V s. More important, we proposed that JZTx-27 stabilized the Ns V Ba VSM in the deactivated state and may be used as a probe to determine the structure of the deactivated VSM of Na V s.-Tang, C., Zhou, X., Nguyen, P. T., Zhang, Y., Hu, Z., Zhang, C., Yarov-Yarovoy, V., DeCaen, P. G., Liang, S., Liu, Z. A novel tarantula toxin stabilizes the deactivated voltage sensor of bacterial sodium channel. © FASEB.

  12. Tarantula huwentoxin-IV inhibits neuronal sodium channels by binding to receptor site 4 and trapping the domain ii voltage sensor in the closed configuration. (United States)

    Xiao, Yucheng; Bingham, Jon-Paul; Zhu, Weiguo; Moczydlowski, Edward; Liang, Songping; Cummins, Theodore R


    Peptide toxins with high affinity, divergent pharmacological functions, and isoform-specific selectivity are powerful tools for investigating the structure-function relationships of voltage-gated sodium channels (VGSCs). Although a number of interesting inhibitors have been reported from tarantula venoms, little is known about the mechanism for their interaction with VGSCs. We show that huwentoxin-IV (HWTX-IV), a 35-residue peptide from tarantula Ornithoctonus huwena venom, preferentially inhibits neuronal VGSC subtypes rNav1.2, rNav1.3, and hNav1.7 compared with muscle subtypes rNav1.4 and hNav1.5. Of the five VGSCs examined, hNav1.7 was most sensitive to HWTX-IV (IC(50) approximately 26 nM). Following application of 1 microm HWTX-IV, hNav1.7 currents could only be elicited with extreme depolarizations (>+100 mV). Recovery of hNav1.7 channels from HWTX-IV inhibition could be induced by extreme depolarizations or moderate depolarizations lasting several minutes. Site-directed mutagenesis analysis indicated that the toxin docked at neurotoxin receptor site 4 located at the extracellular S3-S4 linker of domain II. Mutations E818Q and D816N in hNav1.7 decreased toxin affinity for hNav1.7 by approximately 300-fold, whereas the reverse mutations in rNav1.4 (N655D/Q657E) and the corresponding mutations in hNav1.5 (R812D/S814E) greatly increased the sensitivity of the muscle VGSCs to HWTX-IV. Our data identify a novel mechanism for sodium channel inhibition by tarantula toxins involving binding to neurotoxin receptor site 4. In contrast to scorpion beta-toxins that trap the IIS4 voltage sensor in an outward configuration, we propose that HWTX-IV traps the voltage sensor of domain II in the inward, closed configuration.

  13. The VLT-FLAMES Tarantula Survey. XII. Rotational velocities of the single O-type stars (United States)

    Ramírez-Agudelo, O. H.; Simón-Díaz, S.; Sana, H.; de Koter, A.; Sabín-Sanjulían, C.; de Mink, S. E.; Dufton, P. L.; Gräfener, G.; Evans, C. J.; Herrero, A.; Langer, N.; Lennon, D. J.; Maíz Apellániz, J.; Markova, N.; Najarro, F.; Puls, J.; Taylor, W. D.; Vink, J. S.


    Context. The 30 Doradus (30 Dor) region of the Large Magellanic Cloud, also known as the Tarantula nebula, is the nearest starburst region. It contains the richest population of massive stars in the Local Group, and it is thus the best possible laboratory to investigate open questions on the formation and evolution of massive stars. Aims: Using ground-based multi-object optical spectroscopy obtained in the framework of the VLT-FLAMES Tarantula Survey (VFTS), we aim to establish the (projected) rotational velocity distribution for a sample of 216 presumably single O-type stars in 30 Dor. The sample is large enough to obtain statistically significant information and to search for variations among subpopulations - in terms of spectral type, luminosity class, and spatial location - in the field of view. Methods: We measured projected rotational velocities, νesini, by means of a Fourier transform method and a profile fitting method applied to a set of isolated spectral lines. We also used an iterative deconvolution procedure to infer the probability density, P(νe), of the equatorial rotational velocity, νe. Results: The distribution of νesini shows a two-component structure: a peak around 80 kms-1 and a high-velocity tail extending up to ~600 kms-1. This structure is also present in the inferred distribution P(νe) with around 80% of the sample having 0 rate less than 20% of their break-up velocity. For the bulk of the sample, mass loss in a stellar wind and/or envelope expansion is not efficient enough to significantly spin down these stars within the first few Myr of evolution. If massive-star formation results in stars rotating at birth with a large portion of their break-up velocities, an alternative braking mechanism, possibly magnetic fields, is thus required to explain the present-day rotational properties of the O-type stars in 30 Dor. The presence of a sizeable population of fast rotators is compatible with recent population synthesis computations that

  14. Pharmacological characterization of potent and selective NaV1.7 inhibitors engineered from Chilobrachys jingzhao tarantula venom peptide JzTx-V.

    Directory of Open Access Journals (Sweden)

    Bryan D Moyer

    Full Text Available Identification of voltage-gated sodium channel NaV1.7 inhibitors for chronic pain therapeutic development is an area of vigorous pursuit. In an effort to identify more potent leads compared to our previously reported GpTx-1 peptide series, electrophysiology screening of fractionated tarantula venom discovered the NaV1.7 inhibitory peptide JzTx-V from the Chinese earth tiger tarantula Chilobrachys jingzhao. The parent peptide displayed nominal selectivity over the skeletal muscle NaV1.4 channel. Attribute-based positional scan analoging identified a key Ile28Glu mutation that improved NaV1.4 selectivity over 100-fold, and further optimization yielded the potent and selective peptide leads AM-8145 and AM-0422. NMR analyses revealed that the Ile28Glu substitution changed peptide conformation, pointing to a structural rationale for the selectivity gains. AM-8145 and AM-0422 as well as GpTx-1 and HwTx-IV competed for ProTx-II binding in HEK293 cells expressing human NaV1.7, suggesting that these NaV1.7 inhibitory peptides interact with a similar binding site. AM-8145 potently blocked native tetrodotoxin-sensitive (TTX-S channels in mouse dorsal root ganglia (DRG neurons, exhibited 30- to 120-fold selectivity over other human TTX-S channels and exhibited over 1,000-fold selectivity over other human tetrodotoxin-resistant (TTX-R channels. Leveraging NaV1.7-NaV1.5 chimeras containing various voltage-sensor and pore regions, AM-8145 mapped to the second voltage-sensor domain of NaV1.7. AM-0422, but not the inactive peptide analog AM-8374, dose-dependently blocked capsaicin-induced DRG neuron action potential firing using a multi-electrode array readout and mechanically-induced C-fiber spiking in a saphenous skin-nerve preparation. Collectively, AM-8145 and AM-0422 represent potent, new engineered NaV1.7 inhibitory peptides derived from the JzTx-V scaffold with improved NaV selectivity and biological activity in blocking action potential firing in both

  15. The Tarantula Nebula as a template for extragalactic star forming regions from VLT/MUSE and HST/STIS (United States)

    Crowther, Paul A.; Caballero-Nieves, Saida M.; Castro, Norberto; Evans, Christopher J.


    We present VLT/MUSE observations of NGC 2070, the dominant ionizing nebula of 30 Doradus in the LMC, plus HST/STIS spectroscopy of its central star cluster R136. Integral Field Spectroscopy (MUSE) and pseudo IFS (STIS) together provides a complete census of all massive stars within the central 30×30 parsec2 of the Tarantula. We discuss the integrated far-UV spectrum of R136, of particular interest for UV studies of young extragalactic star clusters. Strong He iiλ1640 emission at very early ages (1-2 Myr) from very massive stars cannot be reproduced by current population synthesis models, even those incorporating binary evolution and very massive stars. A nebular analysis of the integrated MUSE dataset implies an age of ~4.5 Myr for NGC 2070. Wolf-Rayet features provide alternative age diagnostics, with the primary contribution to the integrated Wolf-Rayet bumps arising from R140 rather than the more numerous H-rich WN stars in R136. Caution should be used when interpreting spatially extended observations of extragalactic star-forming regions.

  16. Mapping the interaction site for the tarantula toxin hainantoxin-IV (β-TRTX-Hn2a) in the voltage sensor module of domain II of voltage-gated sodium channels. (United States)

    Cai, Tianfu; Luo, Ji; Meng, Er; Ding, Jiuping; Liang, Songping; Wang, Sheng; Liu, Zhonghua


    Peptide toxins often have pharmacological applications and are powerful tools for investigating the structure-function relationships of voltage-gated sodium channels (VGSCs). Although a group of potential VGSC inhibitors have been reported from tarantula venoms, little is known about the mechanism of their interaction with VGSCs. In this study, we showed that hainantoxin-IV (β-TRTX-Hn2a, HNTX-IV in brief), a 35-residue peptide from Ornithoctonus hainana venom, preferentially inhibited rNav1.2, rNav1.3 and hNav1.7 compared with rNav1.4 and hNav1.5. hNav1.7 was the most sensitive to HNTX-IV (IC50∼21nM). In contrast to many other tarantula toxins that affect VGSCs, HNTX-IV at subsaturating concentrations did not alter activation and inactivation kinetics in the physiological range of voltages, while very large depolarization above +70mV could partially activate toxin-bound hNav1.7 channel, indicating that HNTX-IV acts as a gating modifier rather than a pore blocker. Site-directed mutagenesis indicated that the toxin bound to site 4, which was located on the extracellular S3-S4 linker of hNav1.7 domain II. Mutants E753Q, D816N and E818Q of hNav1.7 decreased toxin affinity for hNav1.7 by 2.0-, 3.3- and 130-fold, respectively. In silico docking indicated that a three-toed claw substructure formed by residues with close contacts in the interface between HNTX-IV and hNav1.7 domain II stabilized the toxin-channel complex, impeding movement of the domain II voltage sensor and inhibiting hNav1.7 activation. Our data provide structural details for structure-based drug design and a useful template for the design of highly selective inhibitors of a specific subtype of VGSCs. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Discovery of a distinct superfamily of Kunitz-type toxin (KTT from tarantulas.

    Directory of Open Access Journals (Sweden)

    Chun-Hua Yuan

    Full Text Available BACKGROUND: Kuntiz-type toxins (KTTs have been found in the venom of animals such as snake, cone snail and sea anemone. The main ancestral function of Kunitz-type proteins was the inhibition of a diverse array of serine proteases, while toxic activities (such as ion-channel blocking were developed under a variety of Darwinian selection pressures. How new functions were grafted onto an old protein scaffold and what effect Darwinian selection pressures had on KTT evolution remains a puzzle. PRINCIPAL FINDINGS: Here we report the presence of a new superfamily of ktts in spiders (TARANTULAS: Ornithoctonus huwena and Ornithoctonus hainana, which share low sequence similarity to known KTTs and is clustered in a distinct clade in the phylogenetic tree of KTT evolution. The representative molecule of spider KTTs, HWTX-XI, purified from the venom of O. huwena, is a bi-functional protein which is a very potent trypsin inhibitor (about 30-fold more strong than BPTI as well as a weak Kv1.1 potassium channel blocker. Structural analysis of HWTX-XI in 3-D by NMR together with comparative function analysis of 18 expressed mutants of this toxin revealed two separate sites, corresponding to these two activities, located on the two ends of the cone-shape molecule of HWTX-XI. Comparison of non-synonymous/synonymous mutation ratios (omega for each site in spider and snake KTTs, as well as PBTI like body Kunitz proteins revealed high Darwinian selection pressure on the binding sites for Kv channels and serine proteases in snake, while only on the proteases in spider and none detected in body proteins, suggesting different rates and patterns of evolution among them. The results also revealed a series of key events in the history of spider KTT evolution, including the formation of a novel KTT family (named sub-Kuntiz-type toxins derived from the ancestral native KTTs with the loss of the second disulfide bridge accompanied by several dramatic sequence modifications

  18. Common molecular determinants of tarantula huwentoxin-IV inhibition of Na+ channel voltage sensors in domains II and IV. (United States)

    Xiao, Yucheng; Jackson, James O; Liang, Songping; Cummins, Theodore R


    The voltage sensors of domains II and IV of sodium channels are important determinants of activation and inactivation, respectively. Animal toxins that alter electrophysiological excitability of muscles and neurons often modify sodium channel activation by selectively interacting with domain II and inactivation by selectively interacting with domain IV. This suggests that there may be substantial differences between the toxin-binding sites in these two important domains. Here we explore the ability of the tarantula huwentoxin-IV (HWTX-IV) to inhibit the activity of the domain II and IV voltage sensors. HWTX-IV is specific for domain II, and we identify five residues in the S1-S2 (Glu-753) and S3-S4 (Glu-811, Leu-814, Asp-816, and Glu-818) regions of domain II that are crucial for inhibition of activation by HWTX-IV. These data indicate that a single residue in the S3-S4 linker (Glu-818 in hNav1.7) is crucial for allowing HWTX-IV to interact with the other key residues and trap the voltage sensor in the closed configuration. Mutagenesis analysis indicates that the five corresponding residues in domain IV are all critical for endowing HWTX-IV with the ability to inhibit fast inactivation. Our data suggest that the toxin-binding motif in domain II is conserved in domain IV. Increasing our understanding of the molecular determinants of toxin interactions with voltage-gated sodium channels may permit development of enhanced isoform-specific voltage-gating modifiers.

  19. The VLT-FLAMES Tarantula Survey . XXIV. Stellar properties of the O-type giants and supergiants in 30 Doradus (United States)

    Ramírez-Agudelo, O. H.; Sana, H.; de Koter, A.; Tramper, F.; Grin, N. J.; Schneider, F. R. N.; Langer, N.; Puls, J.; Markova, N.; Bestenlehner, J. M.; Castro, N.; Crowther, P. A.; Evans, C. J.; García, M.; Gräfener, G.; Herrero, A.; van Kempen, B.; Lennon, D. J.; Maíz Apellániz, J.; Najarro, F.; Sabín-Sanjulián, C.; Simón-Díaz, S.; Taylor, W. D.; Vink, J. S.


    Context. The Tarantula region in the Large Magellanic Cloud (LMC) contains the richest population of spatially resolved massive O-type stars known so far. This unmatched sample offers an opportunity to test models describing their main-sequence evolution and mass-loss properties. Aims: Using ground-based optical spectroscopy obtained in the framework of the VLT-FLAMES Tarantula Survey (VFTS), we aim to determine stellar, photospheric and wind properties of 72 presumably single O-type giants, bright giants and supergiants and to confront them with predictions of stellar evolution and of line-driven mass-loss theories. Methods: We apply an automated method for quantitative spectroscopic analysis of O stars combining the non-LTE stellar atmosphere model fastwind with the genetic fitting algorithm pikaia to determine the following stellar properties: effective temperature, surface gravity, mass-loss rate, helium abundance, and projected rotational velocity. The latter has been constrained without taking into account the contribution from macro-turbulent motions to the line broadening. Results: We present empirical effective temperature versus spectral subtype calibrations at LMC-metallicity for giants and supergiants. The calibration for giants shows a +1kK offset compared to similar Galactic calibrations; a shift of the same magnitude has been reported for dwarfs. The supergiant calibrations, though only based on a handful of stars, do not seem to indicate such an offset. The presence of a strong upturn at spectral type O3 and earlier can also not be confirmed by our data. In the spectroscopic and classical Hertzsprung-Russell diagrams, our sample O stars are found to occupy the region predicted to be the core hydrogen-burning phase by state-of-the-art models. For stars initially more massive than approximately 60 M⊙, the giant phase already appears relatively early on in the evolution; the supergiant phase develops later. Bright giants, however, are not

  20. Species delimitation and phylogeography of Aphonopelma hentzi (Araneae, Mygalomorphae, Theraphosidae: cryptic diversity in North American tarantulas.

    Directory of Open Access Journals (Sweden)

    Chris A Hamilton

    Full Text Available The primary objective of this study is to reconstruct the phylogeny of the hentzi species group and sister species in the North American tarantula genus, Aphonopelma, using a set of mitochondrial DNA markers that include the animal "barcoding gene". An mtDNA genealogy is used to consider questions regarding species boundary delimitation and to evaluate timing of divergence to infer historical biogeographic events that played a role in shaping the present-day diversity and distribution. We aimed to identify potential refugial locations, directionality of range expansion, and test whether A. hentzi post-glacial expansion fit a predicted time frame.A Bayesian phylogenetic approach was used to analyze a 2051 base pair (bp mtDNA data matrix comprising aligned fragments of the gene regions CO1 (1165 bp and ND1-16S (886 bp. Multiple species delimitation techniques (DNA tree-based methods, a "barcode gap" using percent of pairwise sequence divergence (uncorrected p-distances, and the GMYC method consistently recognized a number of divergent and genealogically exclusive groups.The use of numerous species delimitation methods, in concert, provide an effective approach to dissecting species boundaries in this spider group; as well they seem to provide strong evidence for a number of nominal, previously undiscovered, and cryptic species. Our data also indicate that Pleistocene habitat fragmentation and subsequent range expansion events may have shaped contemporary phylogeographic patterns of Aphonopelma diversity in the southwestern United States, particularly for the A. hentzi species group. These findings indicate that future species delimitation approaches need to be analyzed in context of a number of factors, such as the sampling distribution, loci used, biogeographic history, breadth of morphological variation, ecological factors, and behavioral data, to make truly integrative decisions about what constitutes an evolutionary lineage recognized as a

  1. SVM-based prediction of propeptide cleavage sites in spider toxins identifies toxin innovation in an Australian tarantula.

    Directory of Open Access Journals (Sweden)

    Emily S W Wong

    Full Text Available Spider neurotoxins are commonly used as pharmacological tools and are a popular source of novel compounds with therapeutic and agrochemical potential. Since venom peptides are inherently toxic, the host spider must employ strategies to avoid adverse effects prior to venom use. It is partly for this reason that most spider toxins encode a protective proregion that upon enzymatic cleavage is excised from the mature peptide. In order to identify the mature toxin sequence directly from toxin transcripts, without resorting to protein sequencing, the propeptide cleavage site in the toxin precursor must be predicted bioinformatically. We evaluated different machine learning strategies (support vector machines, hidden Markov model and decision tree and developed an algorithm (SpiderP for prediction of propeptide cleavage sites in spider toxins. Our strategy uses a support vector machine (SVM framework that combines both local and global sequence information. Our method is superior or comparable to current tools for prediction of propeptide sequences in spider toxins. Evaluation of the SVM method on an independent test set of known toxin sequences yielded 96% sensitivity and 100% specificity. Furthermore, we sequenced five novel peptides (not used to train the final predictor from the venom of the Australian tarantula Selenotypus plumipes to test the accuracy of the predictor and found 80% sensitivity and 99.6% 8-mer specificity. Finally, we used the predictor together with homology information to predict and characterize seven groups of novel toxins from the deeply sequenced venom gland transcriptome of S. plumipes, which revealed structural complexity and innovations in the evolution of the toxins. The precursor prediction tool (SpiderP is freely available on ArachnoServer (, a web portal to a comprehensive relational database of spider toxins. All training data, test data, and scripts used are available from


    Energy Technology Data Exchange (ETDEWEB)

    Walborn, Nolan R.; Sana, Hugues; Sabbi, Elena, E-mail:, E-mail:, E-mail: [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); and others


    Extremely broad emission wings at Hβ and Hα have been found in VLT-FLAMES Tarantula Survey data for five very luminous BA supergiants in or near 30 Doradus in the Large Magellanic Cloud. The profiles of both lines are extremely asymmetrical, which we have found to be caused by very broad diffuse interstellar bands (DIBs) in the longward wing of Hβ and the shortward wing of Hα. These DIBs are well known to interstellar but not to many stellar specialists, so that the asymmetries may be mistaken for intrinsic features. The broad emission wings are generally ascribed to electron scattering, although we note difficulties for that interpretation in some objects. Such profiles are known in some Galactic hyper/supergiants and are also seen in both active and quiescent Luminous Blue Variables (LBVs). No prior or current LBV activity is known in these 30 Dor stars, although a generic relationship to LBVs is not excluded; subject to further observational and theoretical investigation, it is possible that these very luminous supergiants are approaching the LBV stage for the first time. Their locations in the HRD and presumed evolutionary tracks are consistent with that possibility. The available evidence for spectroscopic variations of these objects is reviewed, while recent photometric monitoring does not reveal variability. A search for circumstellar nebulae has been conducted, with an indeterminate result for one of them.


    Energy Technology Data Exchange (ETDEWEB)

    Sabbi, E.; Anderson, J.; Cignoni, M.; Marel, R. P. van der; Panagia, N.; Sana, H.; Aloisi, A.; Arab, H.; Gordon, K. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD, 21218 (United States); Lennon, D. J. [ESA—European Space Astronomy Center, Apdo. de Correo 78, E-28691 Associate Villanueva de la Cañada, Madrid (Spain); Zaritsky, D. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); Marchi, G. De [Space Science Department, European Space Agency, Keplerlaan 1, 2200 AG Noordwijk (Netherlands); Gouliermis, D. A. [Zentrum für Astronomie der Universität Heidelberg, Institut für Theoretische Astrophysik, Albert-Ueberle-Str. 2, D-69120 Heidelberg (Germany); Grebel, E. K. [Astronomisches Rechen-Institut, Zentrum für Astronomie der Universität Heidelberg, Mönchhofstr. 12-14, D-69120 Heidelberg (Germany); III, J. S. Gallagher [Department of Astronomy, University of Wisconsin, 475 North Charter Street, Madison, WI 53706 (United States); Smith, L. J. [ESA/STScI, 3700 San Martin Drive, Baltimore, MD, 21218 (United States); Tosi, M. [Istituto Nazionale di Astrofisica, Osservatorio Astronomico di Bologna, Via Ranzani 1, I-40127 Bologna (Italy); Evans, C. J. [UK Astronomy Technology Center, Royal Observatory Edinburgh, Blackford Hill, Edinburgh, EH9 3HJ (United Kingdom); Boyer, M. [Observational Cosmology Lab, Code 665, NASA, Goddard Space Flight Center, Greenbelt, MD, 20771 (United States); Mink, S. E. de, E-mail: [Astronomical Institute “Anton Pannekoek,”University of Amsterdam, P.O. Box 94249, NL-1090 GE Amsterdam (Netherlands); and others


    We present and describe the astro-photometric catalog of more than 800,000 sources found in the Hubble Tarantula Treasury Project (HTTP). HTTP is a Hubble Space Telescope Treasury program designed to image the entire 30 Doradus region down to the sub-solar (∼0.5 M{sub ⊙}) mass regime using the Wide Field Camera 3 and the Advanced Camera for Surveys. We observed 30 Doradus in the near-ultraviolet (F275W, F336W), optical (F555W, F658N, F775W), and near-infrared (F110W, F160W) wavelengths. The stellar photometry was measured using point-spread function fitting across all bands simultaneously. The relative astrometric accuracy of the catalog is 0.4 mas. The astro-photometric catalog, results from artificial star experiments, and the mosaics for all the filters are available for download. Color–magnitude diagrams are presented showing the spatial distributions and ages of stars within 30 Dor as well as in the surrounding fields. HTTP provides the first rich and statistically significant sample of intermediate- and low-mass pre-main sequence candidates and allows us to trace how star formation has been developing through the region. The depth and high spatial resolution of our analysis highlight the dual role of stellar feedback in quenching and triggering star formation on the giant H ii region scale. Our results are consistent with stellar sub-clustering in a partially filled gaseous nebula that is offset toward our side of the Large Magellanic Cloud.

  4. [Tarantism in Spain in the eighteen century: latrodectism and suggestion]. (United States)

    Corral-Corral, I; Corral-Corral, C


    Tarantism is the disease caused by the bite of the tarantula, in which the music tarantella triggers an involuntary dance. It is known in Italy since the sixteenth century. To analyze the tarantism reported in Spain at the end of the eighteenth century, with special attention to its neurological aspects, and to propose its medical and psychopathological explanation. An epidemic of people affected by the tarantula bite occurred in Spain in 1782. Spanish doctors described appropriately the clinical effects, identical to those produced by the bite of the spider black widow (Latrodectus tredecimguttatus), which was at that time identified as a tarantula. The cases reported by Francisco Xavier Cid cured with the involuntary dance triggered by the tarantella, as was described in Italy since the sixteenth century. Our interpretation is that this curative effect of dance in Spain was induced by suggestion. In Spanish patients there were no behavioral disturbances, periodic recurrences or collective involvement as those reported by Italian authors, which suggest an hysterical phenomenon, probably a continuation of the dancing mania of the Middle Age. Tarantism reported in Spain in the eighteenth century includes two different phenomena: the systemic symptoms produced by the tarantula bite, which is actually latrodectism, and the curative effect of the tarantella, explained by suggestion. The psychiatric disturbances, with a hysterical nature, falsely associated to the tarantula bite, observed in Italy, were not present among the Spanish cases of tarantism in the eighteenth century.

  5. The tarantula toxins ProTx-II and huwentoxin-IV differentially interact with human Nav1.7 voltage sensors to inhibit channel activation and inactivation. (United States)

    Xiao, Yucheng; Blumenthal, Kenneth; Jackson, James O; Liang, Songping; Cummins, Theodore R


    The voltage-gated sodium channel Na(v)1.7 plays a crucial role in pain, and drugs that inhibit hNa(v)1.7 may have tremendous therapeutic potential. ProTx-II and huwentoxin-IV (HWTX-IV), cystine knot peptides from tarantula venoms, preferentially block hNa(v)1.7. Understanding the interactions of these toxins with sodium channels could aid the development of novel pain therapeutics. Whereas both ProTx-II and HWTX-IV have been proposed to preferentially block hNa(v)1.7 activation by trapping the domain II voltage-sensor in the resting configuration, we show that specific residues in the voltage-sensor paddle of domain II play substantially different roles in determining the affinities of these toxins to hNa(v)1.7. The mutation E818C increases ProTx-II's and HWTX-IV's IC(50) for block of hNa(v)1.7 currents by 4- and 400-fold, respectively. In contrast, the mutation F813G decreases ProTx-II affinity by 9-fold but has no effect on HWTX-IV affinity. It is noteworthy that we also show that ProTx-II, but not HWTX-IV, preferentially interacts with hNa(v)1.7 to impede fast inactivation by trapping the domain IV voltage-sensor in the resting configuration. Mutations E1589Q and T1590K in domain IV each decreased ProTx-II's IC(50) for impairment of fast inactivation by ~6-fold. In contrast mutations D1586A and F1592A in domain-IV increased ProTx-II's IC(50) for impairment of fast inactivation by ~4-fold. Our results show that whereas ProTx-II and HWTX-IV binding determinants on domain-II may overlap, domain II plays a much more crucial role for HWTX-IV, and contrary to what has been proposed to be a guiding principle of sodium channel pharmacology, molecules do not have to exclusively target the domain IV voltage-sensor to influence sodium channel inactivation.

  6. Sexual cannibalism: high incidence in a natural population with benefits to females.

    Directory of Open Access Journals (Sweden)

    Rubén Rabaneda-Bueno

    Full Text Available Sexual cannibalism may be a form of extreme sexual conflict in which females benefit more from feeding on males than mating with them, and males avoid aggressive, cannibalistic females in order to increase net fitness. A thorough understanding of the adaptive significance of sexual cannibalism is hindered by our ignorance of its prevalence in nature. Furthermore, there are serious doubts about the food value of males, probably because most studies that attempt to document benefits of sexual cannibalism to the female have been conducted in the laboratory with non-natural alternative prey. Thus, to understand more fully the ecology and evolution of sexual cannibalism, field experiments are needed to document the prevalence of sexual cannibalism and its benefits to females.We conducted field experiments with the Mediterranean tarantula (Lycosa tarantula, a burrowing wolf spider, to address these issues. At natural rates of encounter with males, approximately a third of L. tarantula females cannibalized the male. The rate of sexual cannibalism increased with male availability, and females were more likely to kill and consume an approaching male if they had previously mated with another male. We show that females benefit from feeding on a male by breeding earlier, producing 30% more offspring per egg sac, and producing progeny of higher body condition. Offspring of sexually cannibalistic females dispersed earlier and were larger later in the season than spiderlings of non-cannibalistic females.In nature a substantial fraction of female L. tarantula kill and consume approaching males instead of mating with them. This behaviour is more likely to occur if the female has mated previously. Cannibalistic females have higher rates of reproduction, and produce higher-quality offspring, than non-cannibalistic females. Our findings further suggest that female L. tarantula are nutrient-limited in nature and that males are high-quality prey. The results of these

  7. Viewing behaviour of spider phobics and non-phobics in the presence of threat and safety stimuli. (United States)

    Lange, W G T; Tierney, K J; Reinhardt-Rutland, A H; Vivekananda-Schmidt, P


    To determine whether spider phobics and spider non-phobics differ in attending to threat and safety stimuli in close proximity, or spatially separated. A sample group of 16 spider-phobic and 16 spider-non-phobic volunteers were drawn from a student population on the basis of their scores on Watts and Sharrock's Spider Phobia Questionnaire. Attention was assessed by way of participants' viewing behaviour using an ASL 501 head-mounted eye-tracking system. In a control condition, participants viewed a neutral stimulus (a TV video) in the absence of the threat stimulus. In two experimental conditions, the threat stimulus (a live Chilean rose tarantula) was introduced (a) immediately beside the safety stimulus (the only exit of the experimental room), or (b) away from the safety stimulus. In the experimental conditions, phobics reduced their viewing of the TV and increased their viewing of the tarantula and of the exit; the biggest changes occurred when tarantula and exit were together. Phobics also made more eye motions across the experimental room. Our results are consistent with previous research employing reaction time to a neutral stimulus as dependent measure. In addition, our results suggest that phobics scan the environment as part of safety behaviour. We suggest that exposure treatments to reduce spider phobia may be facilitated by encouraging patients to stop environmental scanning. Copyright 2004 The British Psychological Society

  8. μ-Theraphotoxin-An1a

    DEFF Research Database (Denmark)

    Rates, Breno; Prates, Maura V; Verano-Braga, Thiago


    Tarantulas are included in the mygalomorph spider family Theraphosidae. Although the pharmacological diversity of theraphosid toxins (theraphotoxins) is broad, studies dedicated to the characterization of biologically active molecules from the theraphosid genus Acanthoscurria have been restricted...

  9. An Annotated List of Tick (Acari: Ixodida) Common Names Authored by Harry Hoogstraal (1917-1986) (United States)


    to the comparatively recent rules promulgated by the American Arachnological Society Committee on Common Names of Arachnids (2003), most of... Arachnological Society Committee on Common Names of Arachnids (2003) Common Names of Arachnids, Fifth Edition. American Tarantula Society, accessible online

  10. Visualisation of animal anatomy using MRI and CT

    DEFF Research Database (Denmark)

    Lauridsen, Henrik; Hansen, Kasper; Pedersen, Michael

    imaging (MRI) and CT. Various species (tarantula, horseshoe crab, carp, haddock, lungfish, axolotl) were subjected to multi-slice MRI and CT protocols to produce 2D images of body slices, followed by volume rendering producing 3D digital models of animal anatomy with applications for visualising specific...

  11. Proceedings of the Annual Meeting of the Association for Education in Journalism and Mass Communication (83rd, Phoenix, Arizona, August 9-12, 2000). Cultural and Critical Studies Division. (United States)

    Association for Education in Journalism and Mass Communication.

    The Cultural and Critical Studies Division section of the proceedings contains the following 11 papers: "'Grimm' News Indeed--'Madstones,' Clever Toads, and Killer Tarantulas: Fairy-Tale Briefs in Wild West Newspapers" (Paulette Kilmer); "The First Amendment and the Doctrine of Corporate Personhood: Collapsing the Press-Corporation…

  12. Change Agent Survival Guide (United States)

    Dunbar, Folwell L.


    Consulting is a rough racket. Only a tarantula hair above IRS agents, meter maids and used car sales people, the profession is a prickly burr for slings and arrows. Throw in education, focus on dysfunctional schools and call oneself a "change agent," and this bad rap all but disappears. Unfortunately, though, consulting/coaching/mentoring in…

  13. Electron microscopy and three-dimensional reconstruction of native thin filaments reveal species-specific differences in regulatory strand densities

    Energy Technology Data Exchange (ETDEWEB)

    Cammarato, Anthony, E-mail: [Department of Physiology and Biophysics, Boston University School of Medicine, 72 East Concord Street, Boston, MA 02118 (United States); Craig, Roger [Department of Cell Biology, University of Massachusetts Medical School, 55 Lake Avenue North, Worcester, MA 01655 (United States); Lehman, William [Department of Physiology and Biophysics, Boston University School of Medicine, 72 East Concord Street, Boston, MA 02118 (United States)


    Throughout the animal kingdom striated muscle contraction is regulated by the thin filament troponin-tropomyosin complex. Homologous regulatory components are shared among vertebrate and arthropod muscles; however, unique protein extensions and/or components characterize the latter. The Troponin T (TnT) isoforms of Drosophila indirect flight and tarantula femur muscle for example contain distinct C-terminal extensions and are {approx}20% larger overall than their vertebrate counterpart. Using electron microscopy and three-dimensional helical reconstruction of native Drosophila, tarantula and frog muscle thin filaments we have identified species-specific differences in tropomyosin regulatory strand densities. The strands on the arthropod thin filaments were significantly larger in diameter than those from vertebrates, although not significantly different from each other. These findings reflect differences in the regulatory troponin-tropomyosin complex, which are likely due to the larger TnT molecules aligning and extending along much of the tropomyosin strands' length. Such an arrangement potentially alters the physical properties of the regulatory strands and may help establish contractile characteristics unique to certain arthropod muscles.

  14. Gender, gender roles, and anxiety: perceived confirmability of self report, behavioral avoidance, and physiological reactivity. (United States)

    Stoyanova, Milena; Hope, Debra A


    Despite the well-documented gender effect in anxiety, less is known about contributing factors to women's greater risk for anxiety and fears. The present study examined the relationship between gender, gender role orientation (i.e., expressivity/instrumentality) and fear of harmless insects (tarantula), using a multimodal approach of self-report measures, a Behavioral Approach Test (BAT), and physiological reactivity. Participants (144 college students; 67 women, 77 men) completed a questionnaire packet and then were instructed to approach a tarantula. We were unable to replicate Pierce and Kirkpatrick's (1992) findings that men underreport anxiety. Consistent with the literature, women in the study experienced greater anxiety and avoidance compared to men. However, men and women did not differ on physiological reactivity during the first 2 min of the BAT. The concordance across avoidance, anxiety and heart rate reactivity differed by gender, suggesting that men and women have different experiences when faced with a fearful object. Furthermore, instrumentality (masculinity) was negatively related to anticipatory anxiety for women but not for men. Copyright © 2011 Elsevier Ltd. All rights reserved.

  15. Electron microscopy and three-dimensional reconstruction of native thin filaments reveal species-specific differences in regulatory strand densities

    International Nuclear Information System (INIS)

    Cammarato, Anthony; Craig, Roger; Lehman, William


    Throughout the animal kingdom striated muscle contraction is regulated by the thin filament troponin-tropomyosin complex. Homologous regulatory components are shared among vertebrate and arthropod muscles; however, unique protein extensions and/or components characterize the latter. The Troponin T (TnT) isoforms of Drosophila indirect flight and tarantula femur muscle for example contain distinct C-terminal extensions and are ∼20% larger overall than their vertebrate counterpart. Using electron microscopy and three-dimensional helical reconstruction of native Drosophila, tarantula and frog muscle thin filaments we have identified species-specific differences in tropomyosin regulatory strand densities. The strands on the arthropod thin filaments were significantly larger in diameter than those from vertebrates, although not significantly different from each other. These findings reflect differences in the regulatory troponin-tropomyosin complex, which are likely due to the larger TnT molecules aligning and extending along much of the tropomyosin strands' length. Such an arrangement potentially alters the physical properties of the regulatory strands and may help establish contractile characteristics unique to certain arthropod muscles.

  16. Report of the unannounced inspection at Our Lady’s Children’s Hospital, Crumlin

    LENUS (Irish Health Repository)

    McAnena, L


    A case of an 11-year-old boy presenting with a two-week history of a red, irritated right eye after handling a Chilean Rose Tarantula at an exotic pet exhibition. Examination revealed innumerable microscopic hairs embedded at all levels of the cornea. He was commenced on steroid drops with subjective and objective improvement at follow up.

  17. Dissecting Diffuse X-ray Emission in 30 Doradus with T-ReX (United States)

    Townsley, Leisa K.; Broos, Patrick


    30 Doradus (the Tarantula Nebula) offers us a microscope on starburst astrophysics, having endured 25 Myrs of the birth and death of the most massive stars known. Across 30 Dor's 250-pc extent, stellar winds and supernovae have carved its ISM into an amazing display of arcs, pillars, and bubbles. For over 40 years, we have also known that 30 Dor is a bright X-ray emitter, so its familiar stars and cold ISM structures suffer irradiation by multi-million-degree plasmas. The 2-Ms Chandra X-ray Visionary Project ``The Tarantula -- Revealed by X-rays'' (T-ReX) exploits Chandra's fine spatial resolution and the ACIS-I field of view to study ISM interfaces on 1--10 pc scales across the entire 30 Dor complex. Here we give preliminary results from ongoing analyses of these data, focusing on the diffuse X-ray emission. Massive star winds and cavity supernovae over the millenia have contributed to a broad mix of X-ray-emitting plasmas and absorbing columns, showing that 30 Dor's hot ISM is just as complex and confusing as that seen at colder temperatures.

  18. Radioprotective effectiveness of some zootoxins

    International Nuclear Information System (INIS)

    Vernigorova, L.A.; Lebedev, V.G.


    A study was made of the effectiveness of a new class of radioprotective agents, polypeptides, obtained from zootoxins of scorpion, tarantula, Lathrodectes tredecimguttatus, and bee under conditions of a short-term and long-term irradiation. The peptide fraction of the sorption venom, butoxin, was most radioprotective: it provided 65% survival after LD 98/30 . Butoxin exerted a stimulatory effect on the hypophysis-adrenal system and haemopoiesis of intact and irradiated animals

  19. Antihyperalgesic effects of ProTx-II, a Nav1.7 antagonist, and A803467, a Nav1.8 antagonist, in diabetic mice


    Kamei, Junzo; Tanaka,Ken-ichiro; Sekino,Shota; Ikegami,Megumi; Ikeda,Hiroko


    Ken-ichiro Tanaka,1,2, Shota Sekino,1 Megumi Ikegami,1 Hiroko Ikeda,1 Junzo Kamei11Department of Pathophysiology and Therapeutics, School of Pharmacy and Pharmaceutical Sciences, Hoshi University, Tokyo, Japan; 2Department of Endocrinology and Metabolism, Graduate School of Medicine, Yokohama City University, Yokohama, JapanAbstract: The present study investigated the effects of intrathecal administration of ProTx-II (tarantula venom peptide) and A803467 (5-[4-chloro-phenyl]-furan-2-carboxyli...

  20. The advertisement call of Ameerega pulchripecta (Silverstone, 1976)(Anura, Dendrobatidae). (United States)

    Costa-Campos, Carlos Eduardo; Lima, Albertina Pimentel; Amézquita, Adolfo


    The name Ameerega picta was once used to denote a lineage of poison frogs (Dendrobatidae) distributed throughout most of the Amazon basin (Silverstone 1976); more recently, to describe a phenetic group involving at least 18 species, Lötters et al. (2007) pointed out that some of the lineages were indeed derived from the former A. picta. Among them, the nominal species with the widest distribution is A. hahneli (Haddad & Martins 1994; Twomey & Brown 2008), also an alleged complex of poorly defined species (Grant et al. 2006; Fouquet et al. 2007; Roberts et al. 2007). The mate-recognition signal, the advertisement call, was part of the evidence used to revalidate A. hahneli as a different species from A. picta. Although the advertisement call has been described for one or few individuals of other species in the group (Haddad & Martins 1994; Costa et al. 2006; Twomey & Brown 2008; Lötters et al. 2009), namely A. flavopicta, A. braccata and A. boehmei, and A. hahneli, we still lack a formal description for A. pulchripecta, the sister taxon of A. hahneli (Twomey & Brown 2008). Its call has been qualitatively described as similar to A. hahneli's call, but "deeper-voiced" (Lötters et al. 2007).

  1. First record of Vitalius longisternalis Bertani, 2001 (Araneae, Theraphosidae) in Argentina and notes on its natural history in Misiones province


    Ferretti, Nelson Edgardo; Copperi, Maria Sofia; Schwerdt, Leonela Vanesa; Pompozzi, Gabriel Alejandro


    This is the first record for the tarantula Vitalius longisternalis Bertani, 2001 in Parana and Araucaria Forests, Misiones province, northeastern Argentina. Specimens were found at Iguazú National Park and Urugua-í Wildlife Reserve. Data on its natural history is provided. Fil: Ferretti, Nelson Edgardo. Consejo Nacional de Investigaciones Científicas y Técnicas. Centro Científico Tecnológico la Plata. Centro de Estudios Parasitológicos y de Vectores (i); Argentina. Universidad Nacional de ...

  2. Air Gaps, Size Effect, and Corner-Turning in Ambient LX-17

    Energy Technology Data Exchange (ETDEWEB)

    Souers, P C; Hernandez, A; Cabacungan, C; Fried, L; Garza, R; Glaesemann, K; Lauderbach, L; Liao, S; Vitello, P


    Various ambient measurements are presented for LX-17. The size (diameter) effect has been measured with copper and Lucite confinement, where the failure radii are 4.0 and 6.5 mm, respectively. The air well corner-turn has been measured with an LX-07 booster, and the dead-zone results are comparable to the previous TATB-boosted work. Four double cylinders have been fired, and dead zones appear in all cases. The steel-backed samples are faster than the Lucite-backed samples by 0.6 {micro}s. Bare LX-07 and LX-17 of 12.7 mm-radius were fired with air gaps. Long acceptor regions were used to truly determine if detonation occurred or not. The LX-07 crossed at 10 mm with a slight time delay. Steady state LX-17 crossed at 3.5 mm gap but failed to cross at 4.0 mm. LX-17 with a 12.7 mm run after the booster crossed a 1.5 mm gap but failed to cross 2.5 mm. Timing delays were measured where the detonation crossed the gaps. The Tarantula model is introduced as embedded in 0 reactive flow JWL++ and Linked Cheetah V4, mostly at 4 zones/mm. Tarantula has four pressure regions: off, initiation, failure and detonation. The physical basis of the input parameters is considered.

  3. Temporal Activity Patterns of the Spider Wasp Pepsis montezuma Smith (Hymenoptera: Pompilidae) in a Disturbed Lower Montane Rainforest (Manizales, Colombia)


    Restrepo-Giraldo, Carlos; Rodriguez, Juanita; Pitts, James P.


    We studied the temporal activity pattern of the spider wasp Pepsis montezuma Smith (Hymenoptera: Pompilidae) in a disturbed lower montane rainforest, which is located in the city of Manizales, Colombia, at an altitude of 2,150 m. Females of this species are diurnal with two peaks of activity: one in the morning and the other in the afternoon. During the morning, nectar foraging occurred at Baccharis latifolia. During the afternoon, females hunted for tarantulas of the genus Pamphobeteus (Aran...

  4. Are amphitheater headed canyons indicative of a particular formative process? (United States)

    Ryan, A. J.; Whipple, K. X.; Johnson, J. P.


    Tributary canyons with amphitheater-shaped heads have previously been interpreted as evidence for groundwater seepage erosion, particularly in environments where fluvial processes are assumed to be negligible. However, some have questioned whether this canyon morphology is truly diagnostic of a particular formative process. We seek to determine the relative roles of fluvial and groundwater-related processes and the strength of stratigraphic control on the Colorado Plateau through a combination of fieldwork and GIS analysis. Amphitheater valleys may have overhanging or steep-sided headwalls with a semicircular plan-view pattern. It is reasonable to assume that this form is a result of focused erosion at the base of the headwall (i.e. sapping). Two frequently cited agents may lead to undermining: plunge-pool scour at the base of waterfalls and seepage induced weathering and erosion where the groundwater table intersects the land surface. Both processes are enhanced where weaker, less permeable layers underlie stronger cap rock. We conducted preliminary fieldwork in two locations on the Colorado Plateau, where there are many classic examples of amphitheater headed canyons. The Escalante River landscape is highly variable with a range of canyon and valley-head forms, many of which cut through the thick Navajo Sandstone into the underlying shale and sand of the Kayenta Formation. Northeast of Escalante National Monument, at the base of the Henry Mountains, is Tarantula Mesa. The canyons there are also considerably variable, with nearly all containing at least one abrupt amphitheater knickpoint at the valley head or farther downstream. Our observations are presented here with an analysis of the canyon profiles, surrounding topography, and potential structural controls. We have found that nearly all amphitheaters in both locales show signs of groundwater seepage weathering and plausibly seepage erosion. However, many also contain plunge pools and evidence of substantial

  5. Pharmacological characterisation of the highly NaV1.7 selective spider venom peptide Pn3a


    Jennifer R. Deuis; Zoltan Dekan; Joshua S. Wingerd; Jennifer J. Smith; Nehan R. Munasinghe; Rebecca F. Bhola; Wendy L. Imlach; Volker Herzig; David A. Armstrong; K. Johan Rosengren; Frank Bosmans; Stephen G. Waxman; Sulayman D. Dib-Hajj; Pierre Escoubas; Michael S. Minett


    Human genetic studies have implicated the voltage-gated sodium channel NaV1.7 as a therapeutic target for the treatment of pain. A novel peptide, ?-theraphotoxin-Pn3a, isolated from venom of the tarantula Pamphobeteus nigricolor, potently inhibits NaV1.7 (IC50 0.9?nM) with at least 40?1000-fold selectivity over all other NaV subtypes. Despite on-target activity in small-diameter dorsal root ganglia, spinal slices, and in a mouse model of pain induced by NaV1.7 activation, Pn3a alone displayed...

  6. Air Gaps, Size Effect, and Corner-Turning in Ambient LX-17

    Energy Technology Data Exchange (ETDEWEB)

    Souers, P C; Hernandez, A; Cabacungen, C; Fried, L; Garza, R; Glaesemann, K; Lauderbach, L; Liao, S; Vitello, P


    Various ambient measurements are presented for LX-17. The size (diameter) effect has been measured with copper and Lucite confinement, where the failure radii are 4.0 and 6.5 mm, respectively. The air well corner-turn has been measured with an LX-07 booster, and the dead-zone results are comparable to the previous TATB-boosted work. Four double cylinders have been fired, and dead zones appear in all cases. The steel-backed samples are faster than the Lucite-backed samples by 0.6 {micro}s. Bare LX-07 and LX-17 of 12.7 mm-radius were fired with air gaps. Long acceptor regions were used to truly determine if detonation occurred or not. The LX-07 crossed at 10 mm with a slight time delay. Steady state LX-17 crossed at 3.5 mm gap but failed to cross at 4.0 mm. LX-17 with a 12.7 mm run after the booster crossed a 1.5 mm gap but failed to cross 2.5 mm. Timing delays were measured where the detonation crossed the gaps. The Tarantula model is introduced as embedded in the Linked Cheetah V4.0 reactive flow code at 4 zones/mm. Tarantula has four pressure regions: off, initiation, failure and detonation. A report card of 25 tests run with the same settings on LX-17 is shown, possibly the most extensive simultaneous calibration yet tried with an explosive. The physical basis of some of the input parameters is considered.

  7. A Massive Star Census of the Starburst Cluster R136 (United States)

    Crowther, Paul


    We propose to carry out a comprehensive census of the most massive stars in the central parsec {4"} of the starburst cluster, R136, which powers the Tarantula Nebula in the LMC. R136 is both sufficiently massive that the upper mass function is richly populated and young enough that its most massive stars have yet to explode as supernovae. The identification of very massive stars in R136, up to 300 solar masses, raises general questions of star formation, binarity and feedback in young massive clusters. The proposed STIS spectral survey of 36 stars more massive than 50 solar masses within R136 is ground-breaking, of legacy value, and is specifically tailored to a} yield physical properties; b} detect the majority of binaries by splitting observations between Cycles 19 and 20; c} measure rotational velocities, relevant for predictions of rotational mixing; d} quantify mass-loss properties for very massive stars; e} determine surface compositions; f} measure radial velocities, relevant for runaway stars and cluster dynamics; g} quantify radiative and mechanical feedback. This census will enable the mass function of very massive stars to be measured for the first time, as a result of incomplete and inadequate spectroscopy to date. It will also perfectly complement our Tarantula Survey, a ground-based VLT Large Programme, by including the most massive stars that are inaccessible to ground-based visual spectroscopy due to severe crowding. These surveys, together with existing integrated UV and optical studies will enable 30 Doradus to serve as a bona-fide template for unresolved extragalactic starburst regions.

  8. Pharmacological characterisation of the highly NaV1.7 selective spider venom peptide Pn3a


    Deuis, J. R.; Dekan, Z.; Wingerd, J. S.; Smith, J. J.; Munasinghe, N. R.; Bhola, R. F.; Imlach, W. L.; Herzig, V.; Armstrong, D. A.; Rosengren, K. J.; Bosmans, F.; Waxman, S. G.; Dib-Hajj, S. D.; Escoubas, P.; Minett, M. S.


    Human genetic studies have implicated the voltage-gated sodium channel NaV1.7 as a therapeutic target for the treatment of pain. A novel peptide, μ-theraphotoxin-Pn3a, isolated from venom of the tarantula Pamphobeteus nigricolor, potently inhibits NaV1.7 (IC50 0.9 nM) with at least 40-1000-fold selectivity over all other NaV subtypes. Despite on-target activity in small-diameter dorsal root ganglia, spinal slices, and in a mouse model of pain induced by NaV1.7 activation, Pn3a alone displayed...

  9. Temporal Activity Patterns of the Spider Wasp Pepsis montezuma Smith (Hymenoptera: Pompilidae in a Disturbed Lower Montane Rainforest (Manizales, Colombia

    Directory of Open Access Journals (Sweden)

    Carlos Restrepo-Giraldo


    Full Text Available We studied the temporal activity pattern of the spider wasp Pepsis montezuma Smith (Hymenoptera: Pompilidae in a disturbed lower montane rainforest, which is located in the city of Manizales, Colombia, at an altitude of 2,150 m. Females of this species are diurnal with two peaks of activity: one in the morning and the other in the afternoon. During the morning, nectar foraging occurred at Baccharis latifolia. During the afternoon, females hunted for tarantulas of the genus Pamphobeteus (Araneae: Theraphosidae, which were dragged backwards to the nest by the wasp. The nest was excavated before hunting. This is the first description of the behavior of Pepsis montezuma.

  10. Properties of O dwarf stars in 30 Doradus (United States)

    Sabín-Sanjulián, Carolina; VFTS Collaboration


    We perform a quantitative spectroscopic analysis of 105 presumably single O dwarf stars in 30 Doradus, located within the Large Magellanic Cloud. We use mid-to-high resolution multi-epoch optical spectroscopic data obtained within the VLT-FLAMES Tarantula Survey. Stellar and wind parameters are derived by means of the automatic tool iacob-gbat, which is based on a large grid of fastwind models. We also benefit from the Bayesian tool bonnsai to estimate evolutionary masses. We provide a spectral calibration for the effective temperature of O dwarf stars in the LMC, deal with the mass discrepancy problem and investigate the wind properties of the sample.

  11. The dancing plague: a public health conundrum. (United States)

    Donaldson, L J; Cavanagh, J; Rankin, J


    The phenomenon of mass, frenzied dancing affected large populations in various parts of Europe from the thirteenth century and lasted, on and off, for three centuries. The exact aetiology of the Dancing Plague (or Dancing Mania) is still unclear. Retrospective historical review of this public health problem reveals claims for causative factors including demonic possession, epilepsy, the bite of a tarantula, ergot poisoning and social adversity. It seems unlikely that Dancing Mania resulted from a single cause but rather resulted from multiple factors combining with a predisposing cultural background and triggered by adverse social circumstances. Dancing Mania remains one of the unresolved mysteries of public health.

  12. Evaluation of sample preparation protocols for spider venom profiling by MALDI-TOF MS. (United States)

    Bočánek, Ondřej; Šedo, Ondrej; Pekár, Stano; Zdráhal, Zbyněk


    Spider venoms are highly complex mixtures containing biologically active substances with potential for use in biotechnology or pharmacology. Fingerprinting of venoms by Matrix-Assisted Laser Desorption-Ionization - Time of Flight Mass Spectrometry (MALDI-TOF MS) is a thriving technology, enabling the rapid detection of peptide/protein components that can provide comparative information. In this study, we evaluated the effects of sample preparation procedures on MALDI-TOF mass spectral quality to establish a protocol providing the most reliable analytical outputs. We adopted initial sample preparation conditions from studies already published in this field. Three different MALDI matrixes, three matrix solvents, two sample deposition methods, and different acid concentrations were tested. As a model sample, venom from Brachypelma albopilosa was used. The mass spectra were evaluated on the basis of absolute and relative signal intensities, and signal resolution. By conducting three series of analyses at three weekly intervals, the reproducibility of the mass spectra were assessed as a crucial factor in the selection for optimum conditions. A sample preparation protocol based on the use of an HCCA matrix dissolved in 50% acetonitrile with 2.5% TFA deposited onto the target by the dried-droplet method was found to provide the best results in terms of information yield and repeatability. We propose that this protocol should be followed as a standard procedure, enabling the comparative assessment of MALDI-TOF MS spider venom fingerprints. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. The ultraviolet extinction properties of the 30 Dor Nebula (United States)

    De Marchi, Guido; Panagia, Nino


    Recent investigation of the extinction law in 30 Dor and the Tarantula Nebula, at optical and near infrared wavelengths, has revealed a ratio of total to selective extinction RV=AV/E(B-V) of about 4.5. This indicates a larger proportion of large grains than in the Galactic diffuse interstellar medium. Possible origins include coalescence of small grains, grain growth, selective destruction of small grains, and fresh injection of large grains. From a study of the ultraviolet extinction properties of three Wolf-Rayet stars in 30 Dor (R 139, R 140, R 145), observed with the International Ultraviolet Explorer, we show that the excess of large grains does not come at the expense of small grains, which are still present. Fresh injection of large grains by supernova explosions appears to be the dominant mechanism.

  14. The Aromatic Head Group of Spider Toxin Polyamines Influences Toxicity to Cancer Cells. (United States)

    Wilson, David; Boyle, Glen M; McIntyre, Lachlan; Nolan, Matthew J; Parsons, Peter G; Smith, Jennifer J; Tribolet, Leon; Loukas, Alex; Liddell, Michael J; Rash, Lachlan D; Daly, Norelle L


    Spider venoms constitute incredibly diverse libraries of compounds, many of which are involved in prey capture and defence. Polyamines are often prevalent in the venom and target ionotropic glutamate receptors. Here we show that a novel spider polyamine, PA 366 , containing a hydroxyphenyl-based structure is present in the venom of several species of tarantula, and has selective toxicity against MCF-7 breast cancer cells. By contrast, a polyamine from an Australian funnel-web spider venom, which contains an identical polyamine tail to PA 366 but an indole-based head-group, is only cytotoxic at high concentrations. Our results suggest that the ring structure plays a role in the cytotoxicity and that modification to the polyamine head group might lead to more potent and selective compounds with potential as novel cancer treatments.

  15. The Aromatic Head Group of Spider Toxin Polyamines Influences Toxicity to Cancer Cells

    Directory of Open Access Journals (Sweden)

    David Wilson


    Full Text Available Spider venoms constitute incredibly diverse libraries of compounds, many of which are involved in prey capture and defence. Polyamines are often prevalent in the venom and target ionotropic glutamate receptors. Here we show that a novel spider polyamine, PA366, containing a hydroxyphenyl-based structure is present in the venom of several species of tarantula, and has selective toxicity against MCF-7 breast cancer cells. By contrast, a polyamine from an Australian funnel-web spider venom, which contains an identical polyamine tail to PA366 but an indole-based head-group, is only cytotoxic at high concentrations. Our results suggest that the ring structure plays a role in the cytotoxicity and that modification to the polyamine head group might lead to more potent and selective compounds with potential as novel cancer treatments.

  16. Sequential fragmentation of Pleistocene forests in an East Africa biodiversity hotspot: chameleons as a model to track forest history.

    Directory of Open Access Journals (Sweden)

    G John Measey

    Full Text Available The Eastern Arc Mountains (EAM is an example of naturally fragmented tropical forests, which contain one of the highest known concentrations of endemic plants and vertebrates. Numerous paleo-climatic studies have not provided direct evidence for ancient presence of Pleistocene forests, particularly in the regions in which savannah presently occurs. Knowledge of the last period when forests connected EAM would provide a sound basis for hypothesis testing of vicariance and dispersal models of speciation. Dated phylogenies have revealed complex patterns throughout EAM, so we investigated divergence times of forest fauna on four montane isolates in close proximity to determine whether forest break-up was most likely to have been simultaneous or sequential, using population genetics of a forest restricted arboreal chameleon, Kinyongia boehmei.We used mitochondrial and nuclear genetic sequence data and mutation rates from a fossil-calibrated phylogeny to estimate divergence times between montane isolates using a coalescent approach. We found that chameleons on all mountains are most likely to have diverged sequentially within the Pleistocene from 0.93-0.59 Ma (95% HPD 0.22-1.84 Ma. In addition, post-hoc tests on chameleons on the largest montane isolate suggest a population expansion ∼182 Ka.Sequential divergence is most likely to have occurred after the last of three wet periods within the arid Plio-Pleistocene era, but was not correlated with inter-montane distance. We speculate that forest connection persisted due to riparian corridors regardless of proximity, highlighting their importance in the region's historic dispersal events. The population expansion coincides with nearby volcanic activity, which may also explain the relative paucity of the Taita's endemic fauna. Our study shows that forest chameleons are an apposite group to track forest fragmentation, with the inference that forest extended between some EAM during the Pleistocene 1

  17. Using humor in systematic desensitization to reduce fear. (United States)

    Ventis, W L; Higbee, G; Murdock, S A


    Effectiveness of systematic desensitization for fear reduction, using humorous hierarchy scenes without relaxation, was tested. Participants were 40 students highly fearful of spiders. Using a 24-item behavioral approach test with an American tarantula, participants were matched on fear level and randomly assigned to 1 of 3 treatment groups: (a) systematic desensitization, (b) humor desensitization, and (c) untreated controls. Each participant was seen for 6 sessions, including pretest and posttest. Analyses of covariance of posttest scores revealed that the 2 treatment groups showed greater reduction in fear than the controls on 3 measures but did not differ from each other. Therefore, humor in systematic desensitization reduced fear as effectively as more traditional desensitization. This finding may have therapeutic applications; however, it may also be applicable in advertising to desensitize fear of a dangerous product, such as cigarettes.

  18. Of Tears and Tarantulas: Folk Religiosity, de Martino’s Ethnology, and the Italian South


    Falasca Zamponi, Simonetta


    This paper discusses the Italian ethnographer Ernesto de Martino’s investigation of ritual crying in Southern Italy, bringing to the fore the role ethnology was called to play as a new twentieth-century discipline that emerged from the forced encounter between powerful “advanced” nations and societies “without history.”  Ethnology sought to analyze the impact of cultural norms on a world increasingly polarized between the inevitable march towards rational modernity and the appeal of a magical...

  19. A verified spider bite and a review of the literature confirm Indian ornamental tree spiders (Poecilotheria species) as underestimated theraphosids of medical importance. (United States)

    Fuchs, Joan; von Dechend, Margot; Mordasini, Raffaella; Ceschi, Alessandro; Nentwig, Wolfgang


    Literature on bird spider or tarantula bites (Theraphosidae) is rare. This is astonishing as they are coveted pets and interaction with their keepers (feeding, cleaning the terrarium or taking them out to hold) might increase the possibility for bites. Yet, this seems to be a rare event and might be why most theraphosids are considered to be harmless, even though the urticating hairs of many American species can cause disagreeable allergic reactions. We are describing a case of a verified bite by an Indian ornamental tree spider (Poecilotheria regalis), where the patient developed severe, long lasting muscle cramps several hours after the bite. We present a comprehensive review of the literature on bites of these beautiful spiders and conclude that a delayed onset of severe muscle cramps, lasting for days, is characteristic for Poecilotheria bites. We discuss Poecilotheria species as an exception from the general assumption that theraphosid bites are harmless to humans. Copyright © 2013 Elsevier Ltd. All rights reserved.

  20. Spider genomes provide insight into composition and evolution of venom and silk (United States)

    Sanggaard, Kristian W.; Bechsgaard, Jesper S.; Fang, Xiaodong; Duan, Jinjie; Dyrlund, Thomas F.; Gupta, Vikas; Jiang, Xuanting; Cheng, Ling; Fan, Dingding; Feng, Yue; Han, Lijuan; Huang, Zhiyong; Wu, Zongze; Liao, Li; Settepani, Virginia; Thøgersen, Ida B.; Vanthournout, Bram; Wang, Tobias; Zhu, Yabing; Funch, Peter; Enghild, Jan J.; Schauser, Leif; Andersen, Stig U.; Villesen, Palle; Schierup, Mikkel H; Bilde, Trine; Wang, Jun


    Spiders are ecologically important predators with complex venom and extraordinarily tough silk that enables capture of large prey. Here we present the assembled genome of the social velvet spider and a draft assembly of the tarantula genome that represent two major taxonomic groups of spiders. The spider genomes are large with short exons and long introns, reminiscent of mammalian genomes. Phylogenetic analyses place spiders and ticks as sister groups supporting polyphyly of the Acari. Complex sets of venom and silk genes/proteins are identified. We find that venom genes evolved by sequential duplication, and that the toxic effect of venom is most likely activated by proteases present in the venom. The set of silk genes reveals a highly dynamic gene evolution, new types of silk genes and proteins, and a novel use of aciniform silk. These insights create new opportunities for pharmacological applications of venom and biomaterial applications of silk. PMID:24801114

  1. Ambitious Survey Spots Stellar Nurseries (United States)


    Astronomers scanning the skies as part of ESO's VISTA Magellanic Cloud survey have now obtained a spectacular picture of the Tarantula Nebula in our neighbouring galaxy, the Large Magellanic Cloud. This panoramic near-infrared view captures the nebula itself in great detail as well as the rich surrounding area of sky. The image was obtained at the start of a very ambitious survey of our neighbouring galaxies, the Magellanic Clouds, and their environment. The leader of the survey team, Maria-Rosa Cioni (University of Hertfordshire, UK) explains: "This view is of one of the most important regions of star formation in the local Universe - the spectacular 30 Doradus star-forming region, also called the Tarantula Nebula. At its core is a large cluster of stars called RMC 136, in which some of the most massive stars known are located." ESO's VISTA telescope [1] is a new survey telescope at the Paranal Observatory in Chile (eso0949). VISTA is equipped with a huge camera that detects light in the near-infrared part of the spectrum, revealing a wealth of detail about astronomical objects that gives us insight into the inner workings of astronomical phenomena. Near-infrared light has a longer wavelength than visible light and so we cannot see it directly for ourselves, but it can pass through much of the dust that would normally obscure our view. This makes it particularly useful for studying objects such as young stars that are still enshrouded in the gas and dust clouds from which they formed. Another powerful aspect of VISTA is the large area of the sky that its camera can capture in each shot. This image is the latest view from the VISTA Magellanic Cloud Survey (VMC). The project will scan a vast area - 184 square degrees of the sky (corresponding to almost one thousand times the apparent area of the full Moon) including our neighbouring galaxies the Large and Small Magellanic Clouds. The end result will be a detailed study of the star formation history and three

  2. Relating Line Width and Optical Depth for CO Emission in the Large Mgellanic Cloud (United States)

    Wojciechowski, Evan; Wong, Tony; Bandurski, Jeffrey; MC3 (Mapping CO in Molecular Clouds in the Magellanic Clouds) Team


    We investigate data produced from ALMA observations of giant molecular clouds (GMCs) located in the Large Magellanic Cloud (LMC), using 12CO(2–1) and 13CO(2–1) emission. The spectral line width is generally interpreted as tracing turbulent rather than thermal motions in the cloud, but could also be affected by optical depth, especially for the 12CO line (Hacar et al. 2016). We compare the spectral line widths of both lines with their optical depths, estimated from an LTE analysis, to evaluate the importance of optical depth effects. Our cloud sample includes two regions recently published by Wong et al. (2017, submitted): the Tarantula Nebula or 30 Dor, an HII region rife with turbulence, and the Planck cold cloud (PCC), located in a much calmer environment near the fringes of the LMC. We also include four additional LMC clouds, which span intermediate levels of star formation relative to these two clouds, and for which we have recently obtained ALMA data in Cycle 4.

  3. Clinical presentation and outcome of Sri-Lankan Ornamental Tarantula Poecilotheria fasciata spider bite: a case report


    NP Dinamithra; S Sivansuthan; P Johnson; JGP Nishshanka


    We report on a 19-year-old boy with visible muscle spasms admitted to the hospitals 24 hours after spider bite. He was treated effectively with intravenous calcium gluconate followed by oral calcium supplements and made a full recovery 48 hours after the incident. Although no specific treatment exists in Srilanka, it has been suggested that calcium supplements may be beneficial to relieve the muscle spasms. Our patient made a full recovery with calcium supplements suggesting the treatment wit...

  4. A new theraphosid spider toxin causes early insect cell death by necrosis when expressed in vitro during recombinant baculovirus infection.

    Directory of Open Access Journals (Sweden)

    Daniel Mendes Pereira Ardisson-Araújo

    Full Text Available Baculoviruses are the most studied insect viruses in the world and are used for biological control of agricultural and forest insect pests. They are also used as versatile vectors for expression of heterologous proteins. One of the major problems of their use as biopesticides is their slow speed to kill insects. Thus, to address this shortcoming, insect-specific neurotoxins from arachnids have been introduced into the baculovirus genome solely aiming to improve its virulence. In this work, an insecticide-like toxin gene was obtained from a cDNA derived from the venom glands of the theraphosid spider Brachypelma albiceps. The mature form of the peptide toxin (called Ba3 has a high content of basic amino acid residues, potential for three possible disulfide bonds, and a predicted three-stranded β-sheetDifferent constructions of the gene were engineered for recombinant baculovirus Autographa californica multiple nuclepolyhedrovirus (AcMNPV expression. Five different forms of Ba3 were assessed; (1 the full-length sequence, (2 the pro-peptide and mature region, (3 only the mature region, and the mature region fused to an (4 insect or a (5 virus-derived signal peptide were inserted separately into the genome of the baculovirus. All the recombinant viruses induced cell death by necrosis earlier in infection relative to a control virus lacking the toxin gene. However, the recombinant virus containing the mature portion of the toxin gene induced a faster cell death than the other recombinants. We found that the toxin construct with the signal peptide and/or pro-peptide regions delayed the necrosis phenotype. When infected cells were subjected to ultrastructural analysis, the cells showed loss of plasma membrane integrity and structural changes in mitochondria before death. Our results suggest this use of baculovirus is a potential tool to help understand or to identify the effect of insect-specific toxic peptides when produced during infection of insect

  5. Description and molecular characterization of a new species of tarantula, Pamphobeteus verdolaga , from Colombia (Araneae: Mygalomorphae: Theraphosidae

    Directory of Open Access Journals (Sweden)

    Yeimy Cifuentes

    Full Text Available ABSTRACT A new species of Pamphobeteus Pocock, 1901, is described from the Colombian Andes, Medellín, Antioquia. The biochemistry and molecular characteristics of the venom of this new species (previously identified as Pamphobeteus aff. nigricolor has been already described. A detailed taxonomic study, comparing this species with holotypes and additional material of Pamphobeteus species, allowed us to recognize it as new, and to describe it here as Pamphobeteus verdolaga sp. nov. The male of P. verdolaga sp. nov. is distinguished by the palpal bulb with broad embolus, poorly developed apical keel (A, prolateral inferior keel (PI and prolateral accessory keel (PAc present but poorly developed, and retrolateral keel (R of similar length as A. Females are distinguished by the morphology of spermatheca with a wide base and very short oval seminal receptacles, which are curved toward the center. This is the thirteenth species described in Pamphobeteus and the sixth species reported from Colombia. The species description is complemented by a molecular characterization of a partial CO1 sequence.

  6. Description and molecular characterization of a new species of tarantula, Pamphobeteus verdolaga , from Colombia (Araneae: Mygalomorphae: Theraphosidae)


    Cifuentes, Yeimy; Estrada-Gomez, Sebastián; Vargas-Muñoz, Leidy Johana; Perafán, Carlos


    ABSTRACT A new species of Pamphobeteus Pocock, 1901, is described from the Colombian Andes, Medellín, Antioquia. The biochemistry and molecular characteristics of the venom of this new species (previously identified as Pamphobeteus aff. nigricolor ) has been already described. A detailed taxonomic study, comparing this species with holotypes and additional material of Pamphobeteus species, allowed us to recognize it as new, and to describe it here as Pamphobeteus verdolaga sp. nov. The male o...

  7. Robust Trapdoor Tarantula Haploclastus validus Pocock, 1899: notes on taxonomy, distribution and natural history (Araneae: Theraphosidae: Thrigmopoeinae

    Directory of Open Access Journals (Sweden)

    Z.A. Mirza


    Full Text Available The genus Haploclastus is endemic to India and is represented by six species. One of the species H. validus Pocock, 1899 was described from Matheran and has remained poorly known in terms of its natural history and distribution. During recent surveys the species was for the first time found again since its description nearly 110 years ago. Based on the new material collected it is redescribed and data on its natural history and distribution are added. It is the first record of an Indian theraphosid spider, which closes its burrow with a trapdoor.

  8. Snake oil and venoms for medical research (United States)

    Wolpert, H. D.


    Some think that using derivatives of snake venom for medical purposes is the modern version of snake oil but they are seriously misjudging the research potentials of some of these toxins in medicines of the 2000's. Medical trials, using some of the compounds has proven their usefulness. Several venoms have shown the possibilities that could lead to anticoagulants, helpful in heart disease. The blood clotting protein from the taipan snake has been shown to rapidly stop excessive bleeding. The venom from the copperhead may hold an answer to breast cancer. The Malaysian pit viper shows promise in breaking blood clots. Cobra venom may hold keys to finding cures for Parkinson's disease and Alzheimer's. Rattlesnake proteins from certain species have produced blood pressure medicines. Besides snake venoms, venom from the South American dart frog, mollusks (i.e. Cone Shell Snail), lizards (i.e. Gila Monster & Komodo Dragon), some species of spiders and tarantulas, Cephalopods, mammals (i.e. Platypus & Shrews), fish (i.e. sting rays, stone fish, puffer fish, blue bottle fish & box jelly fish), intertidal marine animals (echinoderms)(i.e. Crown of Thorn Star Fish & Flower Urchin) and the Honeybee are being investigated for potential medical benefits.

  9. Pharmacological characterisation of the highly NaV1.7 selective spider venom peptide Pn3a. (United States)

    Deuis, Jennifer R; Dekan, Zoltan; Wingerd, Joshua S; Smith, Jennifer J; Munasinghe, Nehan R; Bhola, Rebecca F; Imlach, Wendy L; Herzig, Volker; Armstrong, David A; Rosengren, K Johan; Bosmans, Frank; Waxman, Stephen G; Dib-Hajj, Sulayman D; Escoubas, Pierre; Minett, Michael S; Christie, Macdonald J; King, Glenn F; Alewood, Paul F; Lewis, Richard J; Wood, John N; Vetter, Irina


    Human genetic studies have implicated the voltage-gated sodium channel Na V 1.7 as a therapeutic target for the treatment of pain. A novel peptide, μ-theraphotoxin-Pn3a, isolated from venom of the tarantula Pamphobeteus nigricolor, potently inhibits Na V 1.7 (IC 50 0.9 nM) with at least 40-1000-fold selectivity over all other Na V subtypes. Despite on-target activity in small-diameter dorsal root ganglia, spinal slices, and in a mouse model of pain induced by Na V 1.7 activation, Pn3a alone displayed no analgesic activity in formalin-, carrageenan- or FCA-induced pain in rodents when administered systemically. A broad lack of analgesic activity was also found for the selective Na V 1.7 inhibitors PF-04856264 and phlotoxin 1. However, when administered with subtherapeutic doses of opioids or the enkephalinase inhibitor thiorphan, these subtype-selective Na V 1.7 inhibitors produced profound analgesia. Our results suggest that in these inflammatory models, acute administration of peripherally restricted Na V 1.7 inhibitors can only produce analgesia when administered in combination with an opioid.

  10. Experimental flights using a small unmanned aircraft system for mapping emergent sandbars (United States)

    Kinzel, Paul J.; Bauer, Mark A.; Feller, Mark R.; Holmquist-Johnson, Christopher; Preston, Todd


    The US Geological Survey and Parallel Inc. conducted experimental flights with the Tarantula Hawk (T-Hawk) unmanned aircraft system (UAS ) at the Dyer and Cottonwood Ranch properties located along reaches of the Platte River near Overton, Nebraska, in July 2013. We equipped the T-Hawk UAS platform with a consumer-grade digital camera to collect imagery of emergent sandbars in the reaches and used photogrammetric software and surveyed control points to generate orthophotographs and digital elevation models (DEMS ) of the reaches. To optimize the image alignment process, we retained and/or eliminated tie points based on their relative errors and spatial resolution, whereby minimizing the total error in the project. Additionally, we collected seven transects that traversed emergent sandbars concurrently with global positioning system location data to evaluate the accuracy of the UAS survey methodology. The root mean square errors for the elevation of emergent points along each transect across the DEMS ranged from 0.04 to 0.12 m. If adequate survey control is established, a UAS combined with photogrammetry software shows promise for accurate monitoring of emergent sandbar morphology and river management activities in short (1–2 km) river reaches.

  11. Porting Initiation and Failure into Linked CHEETAH (United States)

    Souers, Clark; Vitello, Peter


    Linked CHEETAH is a thermo-chemical code coupled to a 2-D hydrocode. Initially, a quadratic-pressure dependent kinetic rate was used, which worked well in modeling prompt detonation of explosives of large size, but does not work on other aspects of explosive behavior. The variable-pressure Tarantula reactive flow rate model was developed with JWL++ in order to also describe failure and initiation, and we have moved this model into Linked CHEETAH. The model works by turning on only above a pressure threshold, where a slow turn-on creates initiation. At a higher pressure, the rate suddenly leaps to a large value over a small pressure range. A slowly failing cylinder will see a rapidly declining rate, which pushes it quickly into failure. At a high pressure, the detonation rate is constant. A sequential validation procedure is used, which includes metal-confined cylinders, rate-sticks, corner-turning, initiation and threshold, gap tests and air gaps. The size (diameter) effect is central to the calibration. This work was performed under the auspices of the U.S. Department of Energy by the University of California Lawrence Livermore National Laboratory under contract No. W-7405-Eng-48.

  12. Discovery of the Critically Endangered Tarantula Species of the Genus Poecilotheria (Araneae: Theraphosidae, Poecilotheria hanumavilasumica, From Sri Lanka

    Directory of Open Access Journals (Sweden)

    Ranil P. Nanayakkara


    Full Text Available The arboreal spiders in the genus Poecilotheria is represented by 16 species and restricted to India and Sri Lanka. Each country has eight endemic species. During a survey on mygalomorph spiders in the Northern Province of Sri Lanka, the critically endangered species of Theraphosidae Poecilotheria hanumavilasumica was discovered for the first time outside of its native habitat in India, expanding its range to northern Sri Lanka. The discovery of P. hanumavilasumica is unique, as it used to be a critically endangered and endemic species of the genus Poecilotheria found in India, and it is evident that during the land bridge connection between India and Sri Lanka, when the Pleistocene epoch biotic exchange took place between the two countries, taxa were dispersed through the land connections.

  13. At the Mercy of Gaia: Deep Ecologial Unrest and America's fall as Nature's Nation in Kingdom of the Spiders

    Directory of Open Access Journals (Sweden)

    Jacob Lillemose


    Full Text Available This paper looks as the animal horror genre as a way to discuss current notions of ecology in relation to a specific American idea of being "Nature's Nation". The central work for the discussion is the movie Kingdom of the Spiders (1977 by John Cardos, which depicts how a small Arizona town is taken over by a "swarm" of tarantulas. Without any obvious explanation the spiders slowly but steadily invade the town and start killing both other animals and humans until they have completely covered the town in their web. The paper connects the movie to a long tradition of fiction describing how nature turns on humans and reverses the power relation be-tween man and nature that is fundamental to modernity. Moreover, the paper connects the movie to Maurice Maeterlincks ideas of swarm communities as mani-fested by ants and termites to argue that these communities are ecologically superior to the the communities of man-made civilisation. Finally, the paper discusses Kingdom of the Spiders and animal horror in general in relation to recent ideas of non-human ecologies and critiques of anthropocentrism and makes the point that these works of fiction serve as both dramatic and philosophical visions of a world without humans.

  14. Effects of the antimicrobial peptide gomesin on the global gene expression profile, virulence and biofilm formation of Xylella fastidiosa. (United States)

    Fogaça, Andréa C; Zaini, Paulo A; Wulff, Nelson A; da Silva, Patrícia I P; Fázio, Marcos A; Miranda, Antônio; Daffre, Sirlei; da Silva, Aline M


    In the xylem vessels of susceptible hosts, such as citrus trees, Xylella fastidiosa forms biofilm-like colonies that can block water transport, which appears to correlate to disease symptoms. Besides aiding host colonization, bacterial biofilms play an important role in resistance against antimicrobial agents, for instance antimicrobial peptides (AMPs). Here, we show that gomesin, a potent AMP from a tarantula spider, modulates X. fastidiosa gene expression profile upon 60 min of treatment with a sublethal concentration. DNA microarray hybridizations revealed that among the upregulated coding sequences, some are related to biofilm production. In addition, we show that the biofilm formed by gomesin-treated bacteria is thicker than that formed by nontreated cells or cells exposed to streptomycin. We have also observed that the treatment of X. fastidiosa with a sublethal concentration of gomesin before inoculation in tobacco plants correlates with a reduction in foliar symptoms, an effect possibly due to the trapping of bacterial cells to fewer xylem vessels, given the enhancement in biofilm production. These results warrant further investigation of how X. fastidiosa would respond to the AMPs produced by citrus endophytes and by the insect vector, leading to a better understanding of the mechanism of action of these molecules on bacterial virulence.

  15. Evolutionary history of the genus Tarentola (Gekkota: Phyllodactylidae from the Mediterranean Basin, estimated using multilocus sequence data

    Directory of Open Access Journals (Sweden)

    Rato Catarina


    Full Text Available Abstract Background The pronounced morphological conservatism within Tarentola geckos contrasted with a high genetic variation in North Africa, has led to the hypothesis that this group could represent a cryptic species complex, a challenging system to study especially when trying to define distinct evolutionary entities and address biogeographic hypotheses. In the present work we have re-examined the phylogenetic and phylogeographic relationships between and within all Mediterranean species of Tarentola, placing the genealogies obtained into a temporal framework. In order to do this, we have investigated the sequence variation of two mitochondrial (12S rRNA and 16S rRNA, and four nuclear markers (ACM4, PDC, MC1R, and RAG2 for 384 individuals of all known Mediterranean Tarentola species, so that their evolutionary history could be assessed. Results Of all three generated genealogies (combined mtDNA, combined nDNA, and mtDNA+nDNA we prefer the phylogenetic relationships obtained when all genetic markers are combined. A total of 133 individuals, and 2,901 bp of sequence length, were used in this analysis. The phylogeny obtained for Tarentola presents deep branches, with T. annularis, T. ephippiata and T. chazaliae occupying a basal position and splitting from the remaining species around 15.38 Mya. Tarentola boehmei is sister to all other Mediterranean species, from which it split around 11.38 Mya. There are also two other major groups: 1 the T. mauritanica complex present in North Africa and Europe; and 2 the clade formed by the T. fascicularis/deserti complex, T. neglecta and T. mindiae, occurring only in North Africa. The cladogenesis between these two groups occurred around 8.69 Mya, coincident with the late Miocene. Contrary to what was initially proposed, T. neglecta and T. mindiae are sister taxa to both T. fascicularis and T. deserti. Conclusions At least in the Iberian Peninsula and Northwest Africa, the lineages obtained have some

  16. 78 FR 72622 - Endangered and Threatened Wildlife and Plants; 90-Day Finding on a Petition To List 11 Tarantula... (United States)


    ... attach multiple pieces of information, our preferred format is a spreadsheet in Microsoft Excel. By hard... addresses the petition. Evaluation of Petition The 11 species named in the petition include six species... species is endemic to the southern Western Ghats, in southern India. The species is reported from six...

  17. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest.

    Directory of Open Access Journals (Sweden)

    Yann Hénaut

    Full Text Available Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

  18. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest. (United States)

    Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain


    Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between 'Aechmea-areas' and 'control-areas' of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests.

  19. A Tank Bromeliad Favors Spider Presence in a Neotropical Inundated Forest (United States)

    Hénaut, Yann; Corbara, Bruno; Pélozuelo, Laurent; Azémar, Frédéric; Céréghino, Régis; Herault, Bruno; Dejean, Alain


    Tank bromeliads are good models for understanding how climate change may affect biotic associations. We studied the relationships between spiders, the epiphytic tank bromeliad, Aechmea bracteata, and its associated ants in an inundated forest in Quintana Roo, Mexico, during a drought period while, exceptionally, this forest was dry and then during the flooding that followed. We compared spider abundance and diversity between ‘Aechmea-areas’ and ‘control-areas’ of the same surface area. We recorded six spider families: the Dipluridae, Ctenidae, Salticidae, Araneidae, Tetragnathidae and Linyphiidae among which the funnel-web tarantula, Ischnothele caudata, the only Dipluridae noted, was the most abundant. During the drought period, the spiders were more numerous in the Aechmea-areas than in the control-areas, but they were not obligatorily associated with the Aechmea. During the subsequent flooding, the spiders were concentrated in the A. bracteata patches, particularly those sheltering an ant colony. Also, a kind of specificity existed between certain spider taxa and ant species, but varied between the drought period and subsequent flooding. We conclude that climatic events modulate the relationship between A. bracteata patches and their associated fauna. Tank bromeliads, previously considered only for their ecological importance in supplying food and water during drought, may also be considered refuges for spiders during flooding. More generally, tank bromeliads have an important role in preserving non-specialized fauna in inundated forests. PMID:25494055


    Energy Technology Data Exchange (ETDEWEB)

    Dufton, P. L.; Dunstall, P. R.; Fraser, M. [Astrophysics Research Centre, School of Mathematics and Physics, Queen' s University Belfast, Belfast BT7 1NN (United Kingdom); Evans, C. J. [UK Astronomy Technology Centre, Royal Observatory Edinburgh, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Brott, I. [University of Vienna, Department of Astronomy, Tuerkenschanzstr. 17, A-1180 Vienna (Austria); Cantiello, M.; Langer, N. [Argelander Institut fuer Astronomie der Universitaet Bonn, Auf dem Huegel 71, 53121 Bonn (Germany); De Koter, A.; Sana, H. [Astronomical Institute ' Anton Pannekoek' , University of Amsterdam, Postbus 94249, 1090 GE Amsterdam (Netherlands); De Mink, S. E. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Henault-Brunet, V.; Taylor, W. D. [Scottish Universities Physics Alliance, Institute for Astronomy, University of Edinburgh, Royal Observatory Edinburgh, Blackford Hill, Edinburgh EH9 3HJ (United Kingdom); Howarth, I. D. [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Lennon, D. J. [ESA, Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Markova, N., E-mail: [Institute of Astronomy with NAO, Bulgarian Academy of Sciences, P.O. Box 136, 4700 Smoljan (Bulgaria)


    We present a spectroscopic analysis of an extremely rapidly rotating late O-type star, VFTS102, observed during a spectroscopic survey of 30 Doradus. VFTS102 has a projected rotational velocity larger than 500 km s{sup -1} and probably as large as 600 km s{sup -1}; as such it would appear to be the most rapidly rotating massive star currently identified. Its radial velocity differs by 40 km s{sup -1} from the mean for 30 Doradus, suggesting that it is a runaway. VFTS102 lies 12 pc from the X-ray pulsar PSR J0537-6910 in the tail of its X-ray diffuse emission. We suggest that these objects originated from a binary system with the rotational and radial velocities of VFTS102 resulting from mass transfer from the progenitor of PSR J0537-691 and the supernova explosion, respectively.

  1. A method for 3D-reconstruction of a muscle thick filament using the tilt series images of a single filament electron tomogram. (United States)

    Márquez, G; Pinto, A; Alamo, L; Baumann, B; Ye, F; Winkler, H; Taylor, K; Padrón, R


    Myosin interacting-heads (MIH) motifs are visualized in 3D-reconstructions of thick filaments from striated muscle. These reconstructions are calculated by averaging methods using images from electron micrographs of grids prepared using numerous filament preparations. Here we propose an alternative method to calculate the 3D-reconstruction of a single thick filament using only a tilt series images recorded by electron tomography. Relaxed thick filaments, prepared from tarantula leg muscle homogenates, were negatively stained. Single-axis tilt series of single isolated thick filaments were obtained with the electron microscope at a low electron dose, and recorded on a CCD camera by electron tomography. An IHRSR 3D-recontruction was calculated from the tilt series images of a single thick filament. The reconstruction was enhanced by including in the search stage dual tilt image segments while only single tilt along the filament axis is usually used, as well as applying a band pass filter just before the back projection. The reconstruction from a single filament has a 40 Å resolution and clearly shows the presence of MIH motifs. In contrast, the electron tomogram 3D-reconstruction of the same thick filament - calculated without any image averaging and/or imposition of helical symmetry - only reveals MIH motifs infrequently. This is - to our knowledge - the first application of the IHRSR method to calculate a 3D reconstruction from tilt series images. This single filament IHRSR reconstruction method (SF-IHRSR) should provide a new tool to assess structural differences between well-ordered thick (or thin) filaments in a grid by recording separately their electron tomograms. Copyright © 2014 Elsevier Inc. All rights reserved.

  2. Inferring species trees from gene trees in a radiation of California trapdoor spiders (Araneae, Antrodiaetidae, Aliatypus.

    Directory of Open Access Journals (Sweden)

    Jordan D Satler

    Full Text Available The California Floristic Province is a biodiversity hotspot, reflecting a complex geologic history, strong selective gradients, and a heterogeneous landscape. These factors have led to high endemic diversity across many lifeforms within this region, including the richest diversity of mygalomorph spiders (tarantulas, trapdoor spiders, and kin in North America. The trapdoor spider genus Aliatypus encompasses twelve described species, eleven of which are endemic to California. Several Aliatypus species show disjunct distributional patterns in California (some are found on both sides of the vast Central Valley, and the genus as a whole occupies an impressive variety of habitats.We collected specimens from 89 populations representing all described species. DNA sequence data were collected from seven gene regions, including two newly developed for spider systematics. Bayesian inference (in individual gene tree and species tree approaches recovered a general "3 clade" structure for the genus (A. gulosus, californicus group, erebus group, with three other phylogenetically isolated species differing slightly in position across different phylogenetic analyses. Because of extremely high intraspecific divergences in mitochondrial COI sequences, the relatively slowly evolving 28S rRNA gene was found to be more useful than mitochondrial data for identification of morphologically indistinguishable immatures. For multiple species spanning the Central Valley, explicit hypothesis testing suggests a lack of monophyly for regional populations (e.g., western Coast Range populations. Phylogenetic evidence clearly shows that syntopy is restricted to distant phylogenetic relatives, consistent with ecological niche conservatism.This study provides fundamental insight into a radiation of trapdoor spiders found in the biodiversity hotspot of California. Species relationships are clarified and undescribed lineages are discovered, with more geographic sampling likely to

  3. Arachnids secrete a fluid over their adhesive pads.

    Directory of Open Access Journals (Sweden)

    Anne M Peattie

    Full Text Available BACKGROUND: Many arachnids possess adhesive pads on their feet that help them climb smooth surfaces and capture prey. Spider and gecko adhesives have converged on a branched, hairy structure, which theoretically allows them to adhere solely by dry (solid-solid intermolecular interactions. Indeed, the consensus in the literature is that spiders and their smooth-padded relatives, the solifugids, adhere without the aid of a secretion. METHODOLOGY AND PRINCIPAL FINDINGS: We investigated the adhesive contact zone of living spiders, solifugids and mites using interference reflection microscopy, which allows the detection of thin liquid films. Like insects, all the arachnids we studied left behind hydrophobic fluid footprints on glass (mean refractive index: 1.48-1.50; contact angle: 3.7-11.2°. Fluid was not always secreted continuously, suggesting that pads can function in both wet and dry modes. We measured the attachment forces of single adhesive setae from tarantulas (Grammostola rosea by attaching them to a bending beam with a known spring constant and filming the resulting deflection. Individual spider setae showed a lower static friction at rest (26%±2.8 SE of the peak friction than single gecko setae (Thecadactylus rapicauda; 96%±1.7 SE. This may be explained by the fact that spider setae continued to release fluid after isolation from the animal, lubricating the contact zone. SIGNIFICANCE: This finding implies that tarsal secretions occur within all major groups of terrestrial arthropods with adhesive pads. The presence of liquid in an adhesive contact zone has important consequences for attachment performance, improving adhesion to rough surfaces and introducing rate-dependent effects. Our results leave geckos and anoles as the only known representatives of truly dry adhesive pads in nature. Engineers seeking biological inspiration for synthetic adhesives should consider whether model species with fluid secretions are appropriate to their

  4. Is virtual reality effective to motivate and raise interest in phobic children toward therapy? A clinical trial study of in vivo with in virtuo versus in vivo only treatment exposure. (United States)

    St-Jacques, Julie; Bouchard, Stéphane; Bélanger, Claude


    The first objective of this study was to assess if a combined treatment with mostly virtual reality-based (in virtuo) exposure increases phobic children's motivation toward therapy compared to children who only receive in vivo exposure. Another objective was the assessment of motivation as a predictor of treatment outcome. Thirty-one DSM-IV-diagnosed arachnophobic participants aged from 8 to 15 years were randomly assigned to 1 of 2 treatment conditions: in vivo exposure alone or in virtuo plus in vivo exposure. Measures of motivation were taken at pretest and at the end of each part of the treatment; some other measures were taken at each session. The "Why Are You in Therapy?" questionnaire for children was the target measure of motivation and the main variable in the study. Outcome measures were taken at pretest, at the end of each part of the treatment, and at the 6-month follow-up. This study was conducted between September 2006 and March 2007. The results showed that children who received in virtuo exposure did not show a higher level of motivation toward their treatment than those who received in vivo exposure, but statistically significant interactions were found for both parts of the treatment. Multiple regression analysis confirmed that motivation was a significant predictor of outcome (P virtual reality did not increase motivation toward psychotherapy. At the end of the second part of therapy, all participants were comparably efficient in facing a live tarantula. These results bear important clinical implications concerning how to use virtual reality with children and concerning motivation of children toward therapy in general. They are discussed in the light of how to present in virtuo therapy to children. (c) Copyright 2010 Physicians Postgraduate Press, Inc.

  5. Early events in the evolution of spider silk genes.

    Directory of Open Access Journals (Sweden)

    James Starrett

    Full Text Available Silk spinning is essential to spider ecology and has had a key role in the expansive diversification of spiders. Silk is composed primarily of proteins called spidroins, which are encoded by a multi-gene family. Spidroins have been studied extensively in the derived clade, Orbiculariae (orb-weavers, from the suborder Araneomorphae ('true spiders'. Orbicularians produce a suite of different silks, and underlying this repertoire is a history of duplication and spidroin gene divergence. A second class of silk proteins, Egg Case Proteins (ECPs, is known only from the orbicularian species, Lactrodectus hesperus (Western black widow. In L. hesperus, ECPs bond with tubuliform spidroins to form egg case silk fibers. Because most of the phylogenetic diversity of spiders has not been sampled for their silk genes, there is limited understanding of spidroin gene family history and the prevalence of ECPs. Silk genes have not been reported from the suborder Mesothelae (segmented spiders, which diverged from all other spiders >380 million years ago, and sampling from Mygalomorphae (tarantulas, trapdoor spiders and basal araneomorph lineages is sparse. In comparison to orbicularians, mesotheles and mygalomorphs have a simpler silk biology and thus are hypothesized to have less diversity of silk genes. Here, we present cDNAs synthesized from the silk glands of six mygalomorph species, a mesothele, and a non-orbicularian araneomorph, and uncover a surprisingly rich silk gene diversity. In particular, we find ECP homologs in the mesothele, suggesting that ECPs were present in the common ancestor of extant spiders, and originally were not specialized to complex with tubuliform spidroins. Furthermore, gene-tree/species-tree reconciliation analysis reveals that numerous spidroin gene duplications occurred after the split between Mesothelae and Opisthothelae (Mygalomorphae plus Araneomorphae. We use the spidroin gene tree to reconstruct the evolution of amino acid

  6. The Dancing Manias: Psychogenic Illness as a Social Phenomenon. (United States)

    Lanska, Douglas J


    The dancing mania erupted in the 14th century in the wake of the Black Death, and recurred for centuries in central Europe - particularly Germany, the Netherlands, and Belgium - finally abating in the early 17th century. The term "dancing mania" was derived from "choreomania," a concatenation of choros (dance) and mania (madness). A variant, tarantism, was prevalent in southern Italy from the 15th to the 17th centuries, and was attributed at the time to bites from the tarantula spider. Affected individuals participated in continuous, prolonged, erratic, often frenzied and sometimes erotic, dancing. In the 14th century, the dancing mania was linked to a corruption of the festival of St. John's Day by ancient pagan customs, but by the 16th century it was commonly considered an ordeal sent by a saint, or a punishment from God for people's sins. Consequently, during outbreaks in the 14th and 15th centuries, the dancing mania was considered an issue for magistrates and priests, not physicians, even though the disorder proved intractable to decrees and exorcisms. However, in the 16th century Paracelsus discounted the idea that the saints caused or interceded in the cure of the dancing mania; he instead suggested a psychogenic or malingered etiology, and this reformulation brought the dancing mania within the purview of physicians. Paracelsus advocated various mystical, psychological, and pharmacological approaches, depending on the presumptive etiologic factors with individual patients. Only music provided any relief for tarantism. Later authors suggested that the dancing mania was a mass stress-induced psychosis, a mass psychogenic illness, a culturally determined form of ritualized behavior, a manifestation of religious ecstasy, or even the result of food poisoning caused by the toxic and psychoactive chemical products of ergot fungi. In reality, dancing manias did not have a single cause, but component causes likely included psychogenic illness, malingering, and

  7. Massive stars and miniature robots: today's research and tomorrow's technologies (United States)

    Taylor, William David


    This thesis documents the reduction of the VLT-FLAMES Tarantula Survey (VFTS) data set, whilst also describing the analysis for one of the serendipitous discoveries: the massive binary R139. This high-mass binary will provide an excellent future calibration point for stellar models, in part as it seems to defy certain expectations about its evolution. Out with the VFTS, a search for binary companions around a trio of B-type supergiants is presented. These stars are surrounded by nebulae that closely resemble the triple-ring structure associated with the poorly-understood SN1987A. Do these stars share a similar evolutionary fate? While strong evidence is found for periodic pulsations in one of the stars, there appears to be no indication of a short-period binary companion suggested in the literature. Gathering observations from a wide range of environments builds a fuller picture of massive stars, but the samples remain somewhat limited. The coming generation of extremely large telescopes will open new regions for studies like the VFTS. Fully utilising these remarkable telescopes will require many new technologies, and this thesis presents one such development project. For adaptive-optics corrected, multi-object instruments it will be necessary to position small pick-off mirrors in the telescope¿s focal plane to select the sub-fields on the sky. This could be most efficiently achieved if the mirrors were self-propelled, which has led to a miniature robot project called MAPS - the Micro Autonomous Positioning System. A number of robots have been built with a footprint of only 30 x 30mm. These wirelessly-controlled robots draw their power from the floor on which they operate and have shown the potential to be positioned to an accuracy of tens of microns. This thesis details much of the early design work and testing of the robots, and also the development of the camera imaging system used to determine the position of the robots. The MAPS project is ongoing and a

  8. Use of high-resolution imagery acquired from an unmanned aircraft system for fluvial mapping and estimating water-surface velocity in rivers (United States)

    Kinzel, P. J.; Bauer, M.; Feller, M.; Holmquist-Johnson, C.; Preston, T.


    The use of unmanned aircraft systems (UAS) for environmental monitoring in the United States is anticipated to increase in the coming years as the Federal Aviation Administration (FAA) further develops guidelines to permit their integration into the National Airspace System. The U.S. Geological Survey's (USGS) National Unmanned Aircraft Systems Project Office routinely obtains Certificates of Authorization from the FAA for utilizing UAS technology for a variety of natural resource applications for the U.S. Department of the Interior (DOI). We evaluated the use of a small UAS along two reaches of the Platte River near Overton Nebraska, USA, to determine the accuracy of the system for mapping the extent and elevation of emergent sandbars and to test the ability of a hovering UAS to identify and track tracers to estimate water-surface velocity. The UAS used in our study is the Honeywell Tarantula Hawk RQ16 (T-Hawk), developed for the U.S. Army as a reconnaissance and surveillance platform. The T-Hawk has been recently modified by USGS, and certified for airworthiness by the DOI - Office of Aviation Services, to accommodate a higher-resolution imaging payload than was originally deployed with the system. The T-Hawk is currently outfitted with a Canon PowerShot SX230 HS with a 12.1 megapixel resolution and intervalometer to record images at a user defined time step. To increase the accuracy of photogrammetric products, orthoimagery and DEMs using structure-from-motion (SFM) software, we utilized ground control points in the study reaches and acquired imagery using flight lines at various altitudes (200-400 feet above ground level) and oriented both parallel and perpendicular to the river. Our results show that the mean error in the elevations derived from SFM in the upstream reach was 17 centimeters and horizontal accuracy was 6 centimeters when compared to 4 randomly distributed targets surveyed on emergent sandbars. In addition to the targets, multiple transects were

  9. Two Galaxies for a Unique Event (United States)


    To celebrate the 100 Hours of Astronomy, ESO is sharing two stunning images of unusual galaxies, both belonging to the Sculptor group of galaxies. The images, obtained at two of ESO's observatories at La Silla and Paranal in Chile, illustrate the beauty of astronomy. ESO PR Photo 14a/09 Irregular Galaxy NGC 55 ESO PR Photo 14b/09 Spiral Galaxy NGC 7793 As part of the International Year of Astronomy 2009 Cornerstone project, 100 Hours of Astronomy, the ambitious "Around the World in 80 Telescopes" event is a unique live webcast over 24 hours, following night and day around the globe to some of the most advanced observatories on and off the planet. To provide a long-lasting memory of this amazing world tour, observatories worldwide are revealing wonderful, and previously unseen, astronomical images. For its part, ESO is releasing outstanding pictures of two galaxies, observed with telescopes at the La Silla and Paranal observatories. The first of these depicts the irregular galaxy NGC 55, a member of the prominent Sculptor group of galaxies in the southern constellation of Sculptor. The galaxy is about 70 000 light-years across, that is, a little bit smaller than our own Milky Way. NGC 55 actually resembles more our galactic neighbour, the Large Magellanic Cloud (LMC), although the LMC is seen face-on, whilst NGC 55 is edge-on. By studying about 20 planetary nebulae in this image, a team of astronomers found that NGC 55 is located about 7.5 million light-years away. They also found that the galaxy might be forming a bound pair with the gorgeous spiral galaxy NGC 300 . Planetary nebulae are the final blooming of Sun-like stars before their retirement as white dwarfs. This striking image of NGC 55, obtained with the Wide Field Imager on the 2.2-metre MPG/ESO telescope at La Silla, is dusted with a flurry of reddish nebulae, created by young, hot massive stars. Some of the more extended ones are not unlike those seen in the LMC, such as the Tarantula Nebula. The quality

  10. Lots of Small Stars Born in Starburst Region (United States)


    will quickly affect their environment, but how much? At this moment, nobody knows for sure what determines the actual masses of individual stars that are formed in a very massive and turbulent gas cloud, although some ideas can now be tested with these new observations. The NGC 3603 region The new VLT observations are the key part of a larger research programme that also includes observations of the stellar cluster in the famous Tarantula Nebula in the Large Magellanic Cloud (LMC) with the NICMOS instrument on the Hubble Space Telescope (HST), as well as adaptive optics observations with ground-based telescopes of more quiescent, star-forming regions in the Galaxy. However, the team considered the starburst region NGC 3603 as the best target for this kind of investigation. It is situated in the far southern constellation Carina (The Keel) and can only be observed from the South. Moreover, such a study has to focus on the densest part of the cluster that can only be resolved with a very sensitive infrared (IR) instrument under the best seeing conditions. The VLT ANTU telescope and the multi-mode ISAAC facility are ideally suited for this purpose. NGC 3603 is located in the Carina spiral arm in the Milky Way galaxy at a distance of about 20,000 light-years (6 - 7 kpc). It is the only massive, galactic "HII-region" (so denoted by astronomers because part of its hydrogen is ionized) in which a central cluster of strongly UV-radiating stars of types "O" and "B" that ionize the nebula can be studied at visual and near-infrared wavelengths. This is because the line-of-sight is reasonably free of dust in this direction; the dimming in near-infrared radiation due to intervening matter between the nebula and us is only about a factor of 2 (contrary to 80 in visible light). The total mass of the hot O- and B-stars in NGC 3603 is over 2000 solar masses. Together, the more than fifty heavy and bright O-stars in NGC 3603 have about 100 times the ionizing power of the well

  11. ESO PR Highlights in 2006 (United States)


    more energetic gamma-ray bursts. But not all the explosions are associated with supernovae, and a new kind of explosion is indeed suggested by the observation of a new mysterious category of gamma-ray bursts (PR 49/06). The Atacama Pathfinder Experiment (APEX) 12-m sub-millimetre telescope lived up to the ambitions of the scientists by providing access to the 'Cold Universe' with unprecedented sensitivity and image quality. As a demonstration, no less than 26 articles based on early science with APEX were published in a special issue of the research journal Astronomy & Astrophysics (PR 24/06). This year ESO and Chile celebrated ten years of collaboration: a cooperation that led not only to breakthrough discoveries, but also to a growth of astronomy and related sciences in the South American country (PR 21/06). ESO published many images last year as well, including two huge ones, made with the Wide Field Imager: one, made of about 300 million pixels, shows an 'empty field' (PR 14/06), while the other, a 256 million pixel mosaic, depicts in amazing detail the Tarantula Nebula (PR 50/06). These and other images can be accessed through the clickable map, including amazing images of galaxies and of a finally identified flying object (PR 48/06).

  12. Stars Just Got Bigger - A 300 Solar Mass Star Uncovered (United States)


    Using a combination of instruments on ESO's Very Large Telescope, astronomers have discovered the most massive stars to date, one weighing at birth more than 300 times the mass of the Sun, or twice as much as the currently accepted limit of 150 solar masses. The existence of these monsters - millions of times more luminous than the Sun, losing weight through very powerful winds - may provide an answer to the question "how massive can stars be?" A team of astronomers led by Paul Crowther, Professor of Astrophysics at the University of Sheffield, has used ESO's Very Large Telescope (VLT), as well as archival data from the NASA/ESA Hubble Space Telescope, to study two young clusters of stars, NGC 3603 and RMC 136a in detail. NGC 3603 is a cosmic factory where stars form frantically from the nebula's extended clouds of gas and dust, located 22 000 light-years away from the Sun (eso1005). RMC 136a (more often known as R136) is another cluster of young, massive and hot stars, which is located inside the Tarantula Nebula, in one of our neighbouring galaxies, the Large Magellanic Cloud, 165 000 light-years away (eso0613). The team found several stars with surface temperatures over 40 000 degrees, more than seven times hotter than our Sun, and a few tens of times larger and several million times brighter. Comparisons with models imply that several of these stars were born with masses in excess of 150 solar masses. The star R136a1, found in the R136 cluster, is the most massive star ever found, with a current mass of about 265 solar masses and with a birthweight of as much as 320 times that of the Sun. In NGC 3603, the astronomers could also directly measure the masses of two stars that belong to a double star system [1], as a validation of the models used. The stars A1, B and C in this cluster have estimated masses at birth above or close to 150 solar masses. Very massive stars produce very powerful outflows. "Unlike humans, these stars are born heavy and lose weight as

  13. Eye-openers from XMM-Newton (United States)


    The images were obtained between 19-25 January at the very start of the science payload commissioning process. The spacecraft viewed three regions of the sky: part of the Large Magellanic Cloud (LMC), the Hickson Cluster Group 16 (HCG-16), and the star HR 1099. These targets were chosen because they all present a variety of X-ray extended and point sources and are very interesting regions. The expanding cauldon in the Large Magellanic Cloud The Large Magellanic Cloud also known as the Nebula Major is about 20 thousand light years in diameter. Situated 160 thousand light years from Earth, it is one of two irregularly shaped galaxies that are easily seen with the naked eye in the southern hemisphere. These galaxies are satellites of the Milky Way and appear to be slowly spiralling into our own Galaxy. The first image obtained by the EPIC-PN X-ray cameras viewed the 30 Doradus region of the Large Magellanic Cloud. Also called the Tarantula Nebula, 30 Doradus is a cauldron of creation where exploding stars are releasing vast amounts of matter and where new stars are being born. The image presents the million degree temperatures of the emitting medium, with blue indicating the hottest regions; green intermediate temperatures and red the coldest regions. The white and blue arc-like formation just off the centre is a new object, only part of which was known in the past. It has the appearance of a supernova remnant with its expanding glowing-hot gas producing X-ray emission as it collides with the interstellar medium. On the lower right of the picture is the remains of a star that exploded as Supernova 1987A on 24 February 1987. It was the first supernova to reach naked-eye brightness since 1604 (Kepler's star) and remained visible to the naked eye for nearly nine months. The brightest source in the view, upper left, is another supernova remnant (N157D). Martin Turner, Principal Investigator for the EPIC cameras... "These first pictures are tremendously exciting after so

  14. A Portrait of One Hundred Thousand and One Galaxies (United States)


    about 2000 light-years in diameter, thus dwarfing even the enormous Tarantula Nebula in the LMC, also photographed with the WFI (cf. ESO PR Photos 14a-g/02 ). The largest versions ("normal" or "full-res") of this and the following photos are shown with their original pixel size, demonstrating the incredible amount of detail visible on one WFI image. Technical information about this photo is available below. In 1999, Wolfgang Gieren (Universidad de Concepcion, Chile) and his colleagues started a search for Cepheid-type variable stars in NGC 300. These stars constitute a key element in the measurement of distances in the Universe. It has been known since many years that the pulsation period of a Cepheid-type star depends on its intrinsic brightness (its "luminosity"). Thus, once its period has been measured, the astronomers can calculate its luminosity. By comparing this to the star's apparent brightness in the sky, and applying the well-known diminution of light with the second power of the distance, they can obtain the distance to the star. This fundamental method has allowed some of the most reliable measurements of distances in the Universe and has been essential for all kinds of astrophysics, from the closest stars to the remotest galaxies. Previous to Gieren's new project, only about a dozen Cepheids were known in NGC 300. However, by regularly obtaining wide-field WFI exposures of NGC 300 from July 1999 through January 2000 and carefully monitoring the apparent brightness of its brighter stars during that period, the astronomers detected more than 100 additional Cepheids . The brightness variations (in astronomical terminology: "light curves") could be determined with excellent precision from the WFI data. They showed that the pulsation periods of these Cepheids range from about 5 to 115 days. Some of these Cepheids are identified on PR Photo 18b/02 , in the middle of a very crowded field in NGC 300. When fully studied, these unique observational data will yield a