WorldWideScience

Sample records for tabizgar-e shekl-e tep

  1. El tromboembolismo pulmonar (TEP)

    OpenAIRE

    Álvarez Alonso, Elena

    2015-01-01

    El trombo-embolismo pulmonar (TEP) consiste en la obstrucción de la arteria pulmonar o de una de sus ramas, normalmente por un trombo, aunque también puede existir una obstrucción por otras sustancias que impiden la circulación. El objetivo principal de este trabajo es dar conocer los síntomas del TEP para poder prevenir posibles complicaciones, comenzar a tratarlo desde sus inicios e informar a la población de cuáles son los principales factores de riesgo que pueden causar esta enfermed...

  2. TEP process flow diagram

    Energy Technology Data Exchange (ETDEWEB)

    Wilms, R Scott [Los Alamos National Laboratory; Carlson, Bryan [Los Alamos National Laboratory; Coons, James [Los Alamos National Laboratory; Kubic, William [Los Alamos National Laboratory

    2008-01-01

    This presentation describes the development of the proposed Process Flow Diagram (PFD) for the Tokamak Exhaust Processing System (TEP) of ITER. A brief review of design efforts leading up to the PFD is followed by a description of the hydrogen-like, air-like, and waterlike processes. Two new design values are described; the mostcommon and most-demanding design values. The proposed PFD is shown to meet specifications under the most-common and mostdemanding design values.

  3. Marine bacterial transparent exopolymer particles (TEP) and TEP precursors: Characterization and RO fouling potential

    KAUST Repository

    Li, Sheng; Winters, Harvey; Jeong, Sanghyun; Emwas, Abdul-Hamid M.; Vigneswaran, Saravanamuthu; Amy, Gary L.

    2015-01-01

    This paper investigated the characteristics and membrane fouling potential of bacterial transparent exopolymer particles (TEP)/TEP precursors released from two marine bacteria, Pseudidiomarina homiensis (P. homiensis) and Pseudoalteromonas atlantica

  4. Marine bacterial transparent exopolymer particles (TEP) and TEP precursors: Characterization and RO fouling potential

    KAUST Repository

    Li, Sheng

    2015-10-31

    This paper investigated the characteristics and membrane fouling potential of bacterial transparent exopolymer particles (TEP)/TEP precursors released from two marine bacteria, Pseudidiomarina homiensis (P. homiensis) and Pseudoalteromonas atlantica (P. atlantica), isolated from the Red Sea. Results showed that both bacteria grew at the similar rate, but the production of TEP/TEP precursors from P. atlantica was higher than that from P. homiensis. During the 168. h of incubation time, production rates of TEP/TEP precursors from P. atlantica and P. homiensis were 0.30 and 0.08 xanthan gum eq. mg/L-h, respectively. Isolated bacterial TEP precursors were mainly biopolymer, and P. atlantica produced a significantly higher concentration of biopolymer than that produced by P. homiensis. TEP/TEP precursors from both marine bacteria possessed protein-like material and were very similar in composition to previously reported foulants isolated from a fouled reverse osmosis (RO) membrane. Bacterial TEP/TEP precursors mostly consisted of aliphatic hydrocarbon from amino acids and amide group carbon of proteins (around 55%). Bacterial TEP precursors caused obvious fouling on RO membranes, which may create an ideal environment for bacteria attachment and promote to biofouling.

  5. Effectiveness of seawater reverse osmosis (SWRO) pretreatment systems in removing transparent exopolymer particles (TEP) substances

    KAUST Repository

    Lee, Shang-Tse

    2015-01-01

    Transparent exopolymer particles (TEP) have been reported as one of the main factors of membrane fouling in seawater reverse osmosis (SWRO) process. Research has been focused on algal TEP so far, overlooking bacterial TEP. This thesis investigated

  6. TEP Power Partners Project [Tucson Electric Power

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2014-02-06

    The Arizona Governor’s Office of Energy Policy, in partnership with Tucson Electric Power (TEP), Tendril, and Next Phase Energy (NPE), formed the TEP Power Partners pilot project to demonstrate how residential customers could access their energy usage data and third party applications using data obtained from an Automatic Meter Reading (AMR) network. The project applied for and was awarded a Smart Grid Data Access grant through the U.S. Department of Energy. The project participants’ goal for Phase I is to actively engage 1,700 residential customers to demonstrate sustained participation, reduction in energy usage (kWh) and cost ($), and measure related aspects of customer satisfaction. This Demonstration report presents a summary of the findings, effectiveness, and customer satisfaction with the 15-month TEP Power Partners pilot project. The objective of the program is to provide residential customers with energy consumption data from AMR metering and empower these participants to better manage their electricity use. The pilot recruitment goals included migrating 700 existing customers from the completed Power Partners Demand Response Load Control Project (DRLC), and enrolling 1,000 new participants. Upon conclusion of the project on November 19, 2013; 1,390 Home Area Networks (HANs) were registered; 797 new participants installed a HAN; Survey respondents’ are satisfied with the program and found value with a variety of specific program components; Survey respondents report feeling greater control over their energy usage and report taking energy savings actions in their homes after participating in the program; On average, 43 % of the participants returned to the web portal monthly and 15% returned weekly; and An impact evaluation was completed by Opinion Dynamics and found average participant savings for the treatment period1 to be 2.3% of their household use during this period.2 In total, the program saved 163 MWh in the treatment period of 2013.

  7. Prochlorococcus as a Possible Source for Transparent Exopolymer Particles (TEP

    Directory of Open Access Journals (Sweden)

    Susana Agustí

    2017-04-01

    Full Text Available Transparent exopolymer particles (TEP, usually associated with phytoplankton blooms, promote the formation of marine aggregates. Their exportation to deep waters is considered a key component of the biological carbon pump. Here, we explored the role of solar radiation and picocyanobacteria in the formation of TEP in oligotrophic surface waters of the Atlantic and Pacific Oceans in ten on-deck incubation experiments during the Malaspina 2010 Expedition. TEP concentrations were low on the ocean’s surface although these concentrations were significantly higher on the surface of the Pacific (24.45 ± 2.3 μg XG Eq. L-1 than on the surface of the Atlantic Ocean (8.18 ± 4.56 μg XG Eq. L-1. Solar radiation induced a significant production of TEP in the on-deck experiments from the surface water of the Pacific Ocean, reaching values up to 187.3 μg XG Eq. L-1 compared with the low production observed in the dark controls. By contrast, TEP production in the Atlantic Ocean experiments was lower, and its formation was not related to the light treatments. Prochlorococcus sp. from the surface ocean was very sensitive to solar radiation and experienced a high cell decay in the Pacific Ocean experiments. TEP production in the on-deck incubation experiments was closely related to the observed cell decay rates of Prochlorococcus sp., suggesting that this picocyanobacteria genus is a potential source of TEP. The evidence to propose such potential role was derived experimentally, using natural communities including the presence of several species and a variety of processes. Laboratory experiments with cultures of a non-axenic strain of Prochlorococcus marinus were then used to test TEP production by this genus. TEP concentrations in the culture increased with increasing cell abundance during the exponential phase, reaching the highest TEP concentration at the beginning of the stationary phase. The average TEP concentration of 1474 ± 226 μg XG Eq. L-1 (mean

  8. Prochlorococcus as a Possible Source for Transparent Exopolymer Particles (TEP)

    KAUST Repository

    Agusti, Susana; Iuculano, Francesca; Mazuecos, Ignacio P.; Reche, Isabel

    2017-01-01

    Transparent exopolymer particles (TEP), usually associated with phytoplankton blooms, promote the formation of marine aggregates. Their exportation to deep waters is considered a key component of the biological carbon pump. Here, we explored the role of solar radiation and picocyanobacteria in the formation of TEP in oligotrophic surface waters of the Atlantic and Pacific Oceans in ten on-deck incubation experiments during the Malaspina 2010 Expedition. TEP concentrations were low on the ocean’s surface although these concentrations were significantly higher on the surface of the Pacific (24.45 ± 2.3 μg XG Eq. L-1) than on the surface of the Atlantic Ocean (8.18 ± 4.56 μg XG Eq. L-1). Solar radiation induced a significant production of TEP in the on-deck experiments from the surface water of the Pacific Ocean, reaching values up to 187.3 μg XG Eq. L-1 compared with the low production observed in the dark controls. By contrast, TEP production in the Atlantic Ocean experiments was lower, and its formation was not related to the light treatments. Prochlorococcus sp. from the surface ocean was very sensitive to solar radiation and experienced a high cell decay in the Pacific Ocean experiments. TEP production in the on-deck incubation experiments was closely related to the observed cell decay rates of Prochlorococcus sp., suggesting that this picocyanobacteria genus is a potential source of TEP. The evidence to propose such potential role was derived experimentally, using natural communities including the presence of several species and a variety of processes. Laboratory experiments with cultures of a non-axenic strain of Prochlorococcus marinus were then used to test TEP production by this genus. TEP concentrations in the culture increased with increasing cell abundance during the exponential phase, reaching the highest TEP concentration at the beginning of the stationary phase. The average TEP concentration of 1474 ± 226 μg XG Eq. L-1 (mean ± SE) observed at

  9. Prochlorococcus as a Possible Source for Transparent Exopolymer Particles (TEP)

    KAUST Repository

    Agusti, Susana

    2017-04-26

    Transparent exopolymer particles (TEP), usually associated with phytoplankton blooms, promote the formation of marine aggregates. Their exportation to deep waters is considered a key component of the biological carbon pump. Here, we explored the role of solar radiation and picocyanobacteria in the formation of TEP in oligotrophic surface waters of the Atlantic and Pacific Oceans in ten on-deck incubation experiments during the Malaspina 2010 Expedition. TEP concentrations were low on the ocean’s surface although these concentrations were significantly higher on the surface of the Pacific (24.45 ± 2.3 μg XG Eq. L-1) than on the surface of the Atlantic Ocean (8.18 ± 4.56 μg XG Eq. L-1). Solar radiation induced a significant production of TEP in the on-deck experiments from the surface water of the Pacific Ocean, reaching values up to 187.3 μg XG Eq. L-1 compared with the low production observed in the dark controls. By contrast, TEP production in the Atlantic Ocean experiments was lower, and its formation was not related to the light treatments. Prochlorococcus sp. from the surface ocean was very sensitive to solar radiation and experienced a high cell decay in the Pacific Ocean experiments. TEP production in the on-deck incubation experiments was closely related to the observed cell decay rates of Prochlorococcus sp., suggesting that this picocyanobacteria genus is a potential source of TEP. The evidence to propose such potential role was derived experimentally, using natural communities including the presence of several species and a variety of processes. Laboratory experiments with cultures of a non-axenic strain of Prochlorococcus marinus were then used to test TEP production by this genus. TEP concentrations in the culture increased with increasing cell abundance during the exponential phase, reaching the highest TEP concentration at the beginning of the stationary phase. The average TEP concentration of 1474 ± 226 μg XG Eq. L-1 (mean ± SE) observed at

  10. Effectiveness of seawater reverse osmosis (SWRO) pretreatment systems in removing transparent exopolymer particles (TEP) substances

    KAUST Repository

    Lee, Shang-Tse

    2015-05-01

    Transparent exopolymer particles (TEP) have been reported as one of the main factors of membrane fouling in seawater reverse osmosis (SWRO) process. Research has been focused on algal TEP so far, overlooking bacterial TEP. This thesis investigated the effects of coagulation on removal of bacterial TEP/TEP precursors in seawater and subsequent reduction on TEP fouling in ultrafiltration (UF), as a pretreatment of SWRO. Furthermore, the performance of pretreatment (coagulation + UF) has been investigated on a bench-scale SWRO system. TEP/TEP precursors were harvested from a strain of marine bacteria, Pseudoalteromonas atlantica, isolated from the Red Sea. Isolated bacterial organic matter (BOM), containing 1.5 mg xanthan gum eq./L TEP/TEP precursors, were dosed in Red Sea water to mimic a high TEP concentration event. Bacterial TEP/TEP precursors added to seawater were coagulated with ferric chloride and aluminum sulfate at different dosages and pH. Results showed that ferric chloride had a better removal efficiency on TEP/TEP precursors. Afterwards, the non-coagulated/coagulated seawater were tested on a UF system at a constant flux of 130 L/m2h, using two types of commercially available membranes, with pore sizes of 50 kDa and 100 kDa, respectively. The fouling potential of coagulated water was determined by the Modified Fouling Index (MFI-UF). Transmembrane pressure (TMP) was also continuously monitored to investigate the fouling development on UF membranes. TEP concentrations in samples were determined by the alcian blue staining assay. Liquid chromatography-organic carbon detection (LC-OCD) was used to determine the removal of TEP precursors with particular emphasis on biopolymers. Finally, SWRO tests showed that TEP/TEP precursors had a high fouling potential as indicated by MFI-UF, corresponding to the TMP measurements. Coagulation could substantially reduce TEP/TEP precursors fouling in UF when its dosage was equal or higher than 0.2 mg Fe/L. The flux decline

  11. Abundance, size distribution and bacterial colonization of transparent exopolymeric particles (TEP) during spring in the Kattegat

    DEFF Research Database (Denmark)

    Mari, X.; Kiørboe, Thomas

    1996-01-01

    of beta differed significantly from three, probably because TEP are fractal. All TEP were colonized by bacteria, and bacteria were both attached to the surface of and embedded in TEP. Yet the number of attached bacteria per TEP was related neither to the surface area nor the volume, but rather scaled.......p.m.; they were most abundant in the surface waters subsequent to the spring phytoplankton bloom. The range of TEP (encased) volume concentration was similar to that of the phytoplankton, although at times TEP volume concentration exceeded that of the phytoplankton by two orders of magnitude. The TEP size...... to be formed from colloidal organic material exuded by phytoplankton and bacteria, and may have significant implications for pelagic flux processes. During this study, the number concentration of TEP (>1 mu m) ranged from 3 x 10(3) to 6 x 10(4) ml(-1) and the volume concentration between 0.3 and 9.0 p...

  12. Transgenic Expression of the Anti-parasitic Factor TEP1 in the Malaria Mosquito Anopheles gambiae.

    Directory of Open Access Journals (Sweden)

    Gloria Volohonsky

    2017-01-01

    Full Text Available Mosquitoes genetically engineered to be resistant to Plasmodium parasites represent a promising novel approach in the fight against malaria. The insect immune system itself is a source of anti-parasitic genes potentially exploitable for transgenic designs. The Anopheles gambiae thioester containing protein 1 (TEP1 is a potent anti-parasitic protein. TEP1 is secreted and circulates in the mosquito hemolymph, where its activated cleaved form binds and eliminates malaria parasites. Here we investigated whether TEP1 can be used to create malaria resistant mosquitoes. Using a GFP reporter transgene, we determined that the fat body is the main site of TEP1 expression. We generated transgenic mosquitoes that express TEP1r, a potent refractory allele of TEP1, in the fat body and examined the activity of the transgenic protein in wild-type or TEP1 mutant genetic backgrounds. Transgenic TEP1r rescued loss-of-function mutations, but did not increase parasite resistance in the presence of a wild-type susceptible allele. Consistent with previous reports, TEP1 protein expressed from the transgene in the fat body was taken up by hemocytes upon a challenge with injected bacteria. Furthermore, although maturation of transgenic TEP1 into the cleaved form was impaired in one of the TEP1 mutant lines, it was still sufficient to reduce parasite numbers and induce parasite melanization. We also report here the first use of Transcription Activator Like Effectors (TALEs in Anopheles gambiae to stimulate expression of endogenous TEP1. We found that artificial elevation of TEP1 expression remains moderate in vivo and that enhancement of endogenous TEP1 expression did not result in increased resistance to Plasmodium. Taken together, our results reveal the difficulty of artificially influencing TEP1-mediated Plasmodium resistance, and contribute to further our understanding of the molecular mechanisms underlying mosquito resistance to Plasmodium parasites.

  13. The evolution of TEP1, an exceptionally polymorphic immunity gene in Anopheles gambiae

    Directory of Open Access Journals (Sweden)

    Yan Guiyun

    2008-10-01

    Full Text Available Abstract Background Host-parasite coevolution can result in balancing selection, which maintains genetic variation in the susceptibility of hosts to parasites. It has been suggested that variation in a thioester-containing protein called TEP1 (AGAP010815 may alter the ability of Anopheles mosquitoes to transmit Plasmodium parasites, and high divergence between alleles of this gene suggests the possible action of long-term balancing selection. We studied whether TEP1 is a case of an ancient balanced polymorphism in an animal immune system. Results We found evidence that the high divergence between TEP1 alleles is the product of genetic exchange between TEP1 and other TEP loci, i.e. gene conversion. Additionally, some TEP1 alleles showed unexpectedly low variability. Conclusion The TEP1 gene appears to be a chimera produced from at least two other TEP loci, and the divergence between TEP1 alleles is probably not caused by long-term balancing selection, but is instead due to two independent gene conversion events from one of these other genes. Nevertheless, TEP1 still shows evidence of natural selection, in particular there appears to have been recent changes in the frequency of alleles that has diminished polymorphism within each allelic class. Although the selective force driving this dynamic was not identified, given that susceptibility to Plasmodium parasites is known to be associated with allelic variation in TEP1, these changes in allele frequencies could alter the vectoring capacity of populations.

  14. BgTEP: An Antiprotease Involved in Innate Immune Sensing in Biomphalaria glabrata

    Directory of Open Access Journals (Sweden)

    Anaïs Portet

    2018-05-01

    Full Text Available Insect thioester-containing protein (iTEP is the most recently defined group among the thioester-containing protein (TEP superfamily. TEPs are key components of the immune system, and iTEPs from flies and mosquitoes were shown to be major immune weapons. Initially characterized from insects, TEP genes homologous to iTEP were further described from several other invertebrates including arthropods, cniderians, and mollusks albeit with few functional characterizations. In the freshwater snail Biomphalaria glabrata, a vector of the schistosomiasis disease, the presence of a TEP protein (BgTEP was previously described in a well-defined immune complex involving snail lectins (fibrinogen-related proteins and schistosome parasite mucins (SmPoMuc. To investigate the potential role of BgTEP in the immune response of the snail, we first characterized its genomic organization and its predicted protein structure. A phylogenetic analysis clustered BgTEP in a well-conserved subgroup of mollusk TEP. We then investigated the BgTEP expression profile in different snail tissues and followed immune challenges using different kinds of intruders during infection kinetics. Results revealed that BgTEP is particularly expressed in hemocytes, the immune-specialized cells in invertebrates, and is secreted into the hemolymph. Transcriptomic results further evidenced an intruder-dependent differential expression pattern of BgTEP, while interactome experiments showed that BgTEP is capable of binding to the surface of different microbes and parasite either in its full length form or in processed forms. An immunolocalization approach during snail infection by the Schistosoma mansoni parasite revealed that BgTEP is solely expressed by a subtype of hemocytes, the blast-like cells. This hemocyte subtype is present in the hemocytic capsule surrounding the parasite, suggesting a potential role in the parasite clearance by encapsulation. Through this work, we report the first

  15. Compositional Similarities and Differences between Transparent Exopolymer Particles (TEP) from two Marine Bacteria and two Marine Algae: Significance to Surface Biofouling

    KAUST Repository

    Li, Sheng

    2015-06-12

    Transparent-exopolymer-particles (TEP) have been recently identified as a significant contributor to surface biofouling, such as on reverse osmosis (RO) membranes. TEP research has mainly focused on algal TEP/TEP precursors while limited investigations have been conducted on those released by bacteria. In this study, TEP/TEP precursors derived from both algae and bacteria were isolated and then characterized to investigate their similarities and/or differences using various advanced analytical techniques, thus providing a better understanding of their potential effect on biofouling. Bacterial TEP/TEP precursors were isolated from two species of marine bacteria (Pseudidiomarina homiensis and Pseudoalteromonas atlantica) while algal TEP/TEP precursors were isolated from two marine algae species (Alexandrium tamarense and Chaetoceros affinis). Results indicated that both isolated bacterial and algal TEP/TEP precursors were associated with protein-like materials, and most TEP precursors were high-molecular-weight biopolymers. Furthermore all investigated algal and bacterial TEP/TEP precursors showed a lectin-like property, which can enable them to act as a chemical conditioning layer and to agglutinate bacteria. This property may enhance surface biofouling. However, both proton nuclear magnetic resonance (NMR) spectra and the nitrogen/carbon (N/C) ratios suggested that the algal TEP/TEP precursors contained much less protein content than the bacterial TEP/TEP precursors. This difference may influence their initial deposition and further development of surface biofouling.

  16. Synthesis and characterization of TEP-EDTA-regulated bioactive hydroxyapatite

    Science.gov (United States)

    Haders, Daniel Joseph, II

    Hydroxyapatite (HA), Ca10(PO4)6(OH) 2, the stoichiometric equivalent of the ceramic phase of bone, is the preferred material for hard tissue replacement due to its bioactivity. However, bioinert metals are utilized in load-bearing orthopedic applications due to the poor mechanical properties of HA. Consequently, attention has been given to HA coatings for metallic orthopedic implants to take advantage of the bioactivity of HA and the mechanical properties of metals. Commercially, the plasma spray process (PS-HA) is the method most often used to deposit HA films on metallic implants. Since its introduction in the 1980's, however, concerns have been raised about the consequences of PS-HA's low crystallinity, lack of phase purity, lack of film-substrate chemical adhesion, passivation properties, and difficulty in coating complex geometries. Thus, there is a need to develop inexpensive reproducible next-generation HA film deposition techniques, which deposit high crystallinity, phase pure, adhesive, passivating, conformal HA films on clinical metallic substrates. The aim of this dissertation was to intelligently synthesize and characterize the material and biological properties of HA films on metallic substrates synthesized by hydrothermal crystallization, using thermodynamic phase diagrams as the starting point. In three overlapping interdisciplinary studies the potential of using ethylenediamine-tetraacetic acid/triethyl phosphate (EDTA/TEP) doubly regulated hydrothermal crystallization to deposit HA films, the TEP-regulated, time-and-temperature-dependent process by which films were deposited, and the bioactivity of crystallographically engineered films were investigated. Films were crystallized in a 0.232 molal Ca(NO3)2-0.232 molal EDTA-0.187 molal TEP-1.852 molal KOH-H2O chemical system at 200°C. Thermodynamic phase diagrams demonstrated that the chosen conditions were expected to produce Ca-P phase pure HA, which was experimentally confirmed. EDTA regulation of

  17. Evaluation of potential particulate/colloidal TEP foulants on a pilot scale SWRO desalination study

    KAUST Repository

    Li, Sheng

    2016-01-21

    This pilot study investigated the variation of potential foulants and different fractions of transparent exopolymer particles (TEP), along the treatment scheme under different conditions. The objectives are to provide a comprehensive understanding on which fraction of TEP is more problematic in seawater reverse osmosis (SWRO) fouling, and which pretreatment can better reduce the concentration of TEP. Results showed that TEP deposited on the RO membranes, and the extent of RO fouling increased with the increase of TEP concentration in RO feed water. More TEP was produced in water after chlorination, probably because of the breakdown of bacterial cells and thus the release of internal exopolymers. Moreover, the cartridge filters could behave as an incubator for the regrowth of bacteria deactivated by chlorination and a spot for potential foulant (bacterial TEP) production, and thus enhance the RO membranes fouling. The presence of residual iron and addition of phosphate based antiscalant may also contribute to the higher biofouling of RO membranes. This pilot study provided an opportunity to identify the TEP related issues under different operational conditions in RO desalination of Red Sea water.

  18. Seasonal size spectra of transparent exopolymeric particles (TEP) in a coastal sea and comparison with those predicted using coagulation theory

    DEFF Research Database (Denmark)

    Mari, Xavier; Burd, A

    1998-01-01

    The abundance and size distribution of transparent exopolymeric particles (TEP) were monitored in the Kattegat (Denmark) during 1 yr. TEP number concentration ranged from 0.5 x 10(5) to 3.8 x 10(5) ml(-1) and the volume concentration between 3 and 310 ppm. TEP volume concentration peaked during...

  19. Improved method for measuring transparent exopolymer particles (TEP) and their precursors infresh and saline water

    KAUST Repository

    Villacorte, Loreen O.

    2015-03-01

    Transparent exopolymer particles (TEP) and their precursors produced by phyto-/bacterio-planktons in fresh and marine aquatic environments are increasingly considered as a major contributor to organic/particulate and biological fouling in micro-/ultra-filtration and reverse osmosis membrane (RO) systems. However, currently established methods which are based on Alcian blue (AB) staining and spectrophotometric techniques do not measure TEP-precursors and have the tendency to overestimate concentration in brackish/saline water samples due to interference of salinity on AB staining. Here we propose a new semi-quantitative method which allows measurement of both TEP and their colloidal precursors without the interference of salinity. TEP and their precursors are first retained on 10kDa membrane, rinsed with ultra-pure water, and re-suspended in ultra-pure water by sonication and stained with AB, followed by exclusion of TEP-AB precipitates by filtration and absorbance measurement of residual AB. The concentration is then determined based on the reduction of AB absorbance due to reaction with acidic polysaccharides, blank correction and calibration with Xanthan gum standard. The extraction procedure allows concentration of TEP and their pre-cursors which makes it possible to analyse samples with a wide range of concentrations (down to <0.1mg Xeq/L). This was demonstrated through application of the method for monitoring these compounds in algal cultures and a full-scale RO plant. The monitoring also revealed that concentrations of the colloidal precursors were substantially higher than the concentration of TEP themselves. In the RO plant, complete TEP removal was observed over the pre-treatment processes (coagulation-sedimentation-filtration and ultrafiltration) but the TEP precursors were not completely removed, emphasising the importance of measuring this colloidal component to better understand the role of TEP and acidic polysaccharides in RO membrane fouling.

  20. Characterisation of transparent exopolymer particles (TEP) produced during algal bloom: A membrane treatment perspective

    KAUST Repository

    Villacorte, Loreen O.; Ekowati, Yuli; Winters, Harvey; Amy, Gary L.; Schippers, Jan Cornelis; Kennedy, D.

    2013-01-01

    Algal blooms are currently a major concern of the membrane industry as it generates massive concentrations of organic matter (e.g. transparent exopolymer particles [TEP]), which can adversely affect the operation of membrane filtration systems

  1. Improved method for measuring transparent exopolymer particles (TEP) and their precursors infresh and saline water

    KAUST Repository

    Villacorte, Loreen O.; Ekowati, Yuli; Calix-Ponce, Helga N.; Schippers, Jan Cornelis; Amy, Gary L.; Kennedy, Maria Dolores

    2015-01-01

    Transparent exopolymer particles (TEP) and their precursors produced by phyto-/bacterio-planktons in fresh and marine aquatic environments are increasingly considered as a major contributor to organic/particulate and biological fouling in micro

  2. Evaluation of potential particulate/colloidal TEP foulants on a pilot scale SWRO desalination study

    KAUST Repository

    Li, Sheng; Sinha, Shahnawaz; Leiknes, TorOve; Amy, Gary L.; Ghaffour, NorEddine

    2016-01-01

    This pilot study investigated the variation of potential foulants and different fractions of transparent exopolymer particles (TEP), along the treatment scheme under different conditions. The objectives are to provide a comprehensive understanding

  3. Totally extraperitoneal (TEP) bilateral hernioplasty using the Single Site® robotic da Vinci platform (DV-SS TEP): description of the technique and preliminary results.

    Science.gov (United States)

    Cestari, A; Galli, A C; Sangalli, M N; Zanoni, M; Ferrari, M; Roviaro, G

    2017-06-01

    Laparoendoscopic single site totally extraperitoneal (TEP) hernia repair showed to be a feasible alternative to conventional laparoscopic hernia repair; nevertheless single site surgery, with the loss of instruments triangulation can be a demanding procedure. To overcome those hurdles, the Single Site® (SS) platform of the da Vinci (DV) Si robotic system enables to perform surgical procedures through a 25-mm skin incision, with a stable 3D vision and restoring an adequate triangulation of the surgical instruments. We present in details the technique and the preliminary results of DV-SS TEP, to our knowledge the first cases reported in literature. In March 2016, three consecutive male patients (mean age 46.6 years-mean BMI 25.3) with bilateral symptomatic inguinal hernia were submitted to DV-SS TEP in our institutions. Feasibility, codification of the technique, operative time and perioperative outcomes were recorded. All the procedures were completed as scheduled, with no conversion to other techniques. Mean operative time was 98.6 min, ranging between 155 and 55 min, reflecting the learning curve of the operating room team on this new procedure. No intraoperative or postoperative complications were experienced and all the patients were discharged within 24 h after surgery. Patients reported satisfactory postoperative course, with no recurrence of inguinal hernia and satisfaction in cosmetic result at 6-month follow-up. DV-SS TEP inguinal hernia repair showed to be feasible and effective surgical option for bilateral groin hernia repair. Patients' outcome was uneventful, with optimal cosmetic results. Further studies comparing this innovative technique to TEP or LESS TEP should be promoted.

  4. Comparison of Alcian blue and total carbohydrate assays for quantitation of transparent exopolymer particles (TEP) in biofouling studies.

    Science.gov (United States)

    Li, Xu; Skillman, Lucy; Li, Dan; Ela, Wendell P

    2018-04-15

    Transparent exopolymer particles (TEP) and their precursors are gel-like acidic polysaccharide particles. Both TEP precursors and TEP have been identified as causal factors in fouling of desalination and water treatment systems. For comparison between studies, it is important to accurately measure the amount and fouling capacity of both components. However, the accuracy and recovery of the currently used Alcian blue based TEP measurement of different surrogates and different size fractions are not well understood. In this study, we compared Alcian blue based TEP measurements with a total carbohydrate assay method. Three surrogates; xanthan gum, pectin and alginic acid; were evaluated at different salinities. Total carbohydrate concentrations of particulates (>0.4 μm) and their precursors (10 kDa) varied depending on water salinity and method of recovery. As xanthan gum is the most frequently used surrogate in fouling studies, TEP concentration is expressed as xanthan gum equivalents (mg XG eq /L) in this study. At a salinity of 35 mg/L sea salt, total carbohydrate assays showed a much higher particulate TEP fraction for alginic acid (38%) compared to xanthan gum (9%) and pectin (12%). The concentrations of particulate TEP therefore may only represent ∼10% of the total mass; while precursor TEP represents ∼80% of the total TEP. This highlights the importance of reporting both particulate and precursor TEP for membrane biofouling studies. The calculated concentrations of TEP and their precursors in seawater samples are also highly dependent on type of surrogate and resulting calibration factor. A linear correlation between TEP recovery and calibration factor was demonstrated in this study for all three surrogates. The relative importance and accuracy of measurement method, particulate size, surrogate type, and recovery are described in detail in this study. Copyright © 2017. Published by Elsevier Ltd.

  5. Compositional Similarities and Differences between Transparent Exopolymer Particles (TEP) from two Marine Bacteria and two Marine Algae: Significance to Surface Biofouling

    KAUST Repository

    Li, Sheng; Winters, Harvey; Villacorte, L.O.; Ekowati, Y.; Emwas, Abdul-Hamid M.; Kennedy, M.D.; Amy, Gary L.

    2015-01-01

    indicated that both isolated bacterial and algal TEP/TEP precursors were associated with protein-like materials, and most TEP precursors were high-molecular-weight biopolymers. Furthermore all investigated algal and bacterial TEP/TEP precursors showed a lectin-like property, which can enable them to act as a chemical conditioning layer and to agglutinate bacteria. This property may enhance surface biofouling. However, both proton nuclear magnetic resonance (NMR) spectra and the nitrogen/carbon (N/C) ratios suggested that the algal TEP/TEP precursors contained much less protein content than the bacterial TEP/TEP precursors. This difference may influence their initial deposition and further development of surface biofouling.

  6. Carbon content and C:N ratio of transparent exopolymeric particles (TEP) produced by bubbling exudates of diatoms

    DEFF Research Database (Denmark)

    Mari, Xavier

    1999-01-01

    The carbon content of transparent exopolymeric particles (TEP) was measured in the laboratory in particles produced by bubbling exudates of the diatom Thalassiosira weissflogii, grown under nitrogen non-limited conditions (N:P = 7). The carbon content of these particles (TEP-C) appears to vary...... a coastal area (Kattegat, Denmark), TEP carbon concentration in the surface mixed layer was on the order of 230 ± 150 µg C l-1. This is high relative to other sources of particulate organic carbon (e.g. phytoplankton) and depending on TEP turnover rates, suggests that TEP is an important pathway...... for dissolved organic carbon in coastal seas. The carbon to nitrogen ratio of TEP was measured from particles formed by bubbling exudates of the diatoms T. weissflogii, Skeletonema costatum, Chaetoceros neogracile and C. affinis. Each of these diatom species was grown under various N:P ratios, from N...

  7. NOM and TEP fouling of a forward osmosis (FO) membrane: Foulant identification and cleaning

    KAUST Repository

    Valladares Linares, Rodrigo; Yangali-Quintanilla, Victor; Li, Zhenyu; Amy, Gary L.

    2012-01-01

    The study of forward osmosis (FO) membranes has increased due to the already demonstrated advantages compared to high-energy membrane processes such as reverse osmosis (RO). This research focuses on characterization of the natural organic matter (NOM) fraction causing fouling on the active layer (AL) of a FO membrane in a novel plate and frame module configuration, facing secondary wastewater effluent as a feed solution (FS) and seawater used as a draw solution (DS). In addition, transparent exopolymer particles (TEP) were observed on the support layer (SL) of the membrane in contact with the DS. The NOM fouling layer, after characterizing the water samples and membranes used, was found to be composed of biopolymers and protein-like substances, which adversely affect the flux of water through the FO membrane. However, NOM fouling showed high reversibility, up to 90% when air scouring for 15. min is used as a cleaning technique. The irreversible fouling in this work was found to be 8.2% after chemical cleaning. On the support layer of the membrane, TEP formed clusters clearly identifiable with an optical microscope and a TEP-specific dye. Chemical cleaning with 1% NaOCl for 10. min proved to be the most effective method to remove TEP. © 2012.

  8. Characterisation of transparent exopolymer particles (TEP) produced during algal bloom: A membrane treatment perspective

    KAUST Repository

    Villacorte, Loreen O.

    2013-01-01

    Algal blooms are currently a major concern of the membrane industry as it generates massive concentrations of organic matter (e.g. transparent exopolymer particles [TEP]), which can adversely affect the operation of membrane filtration systems. The goal of this study is to understand the production, composition and membrane rejection of these organic materials using different characterisation techniques. Two common species of bloom-forming freshwater and marine algae were cultivated in batch cultures for 30days and the productions of TEP and other organic matter were monitored at different growth phases. TEP production of the marine diatom, Chaetoceros affinis, produced 6-9 times more TEP than the freshwater blue-green algae, Microcystis. The organic substances produced by both algal species were dominated by biopolymeric substances such as polysaccharides (45-64%) and proteins (2-17%) while the remaining fraction comprises of low molecular weight refractory (humic-like) and/ or biogenic organic substances. MF/UF membranes mainly rejected the biopolymers but not the low molecular weight organic materials. MF membranes (0.1-0.4 lm) rejected 42-56% of biopolymers, while UF membranes (10-100 kDa) rejected 65-95% of these materials. Further analysis of rejected organic materials on the surface of the membranes revealed that polysac-charides and proteins are likely responsible for the fouling of MF/UF systems during an algal bloom situation. © 2013 Desalination Publications.

  9. NOM and TEP fouling of a forward osmosis (FO) membrane: Foulant identification and cleaning

    KAUST Repository

    Valladares Linares, Rodrigo

    2012-12-01

    The study of forward osmosis (FO) membranes has increased due to the already demonstrated advantages compared to high-energy membrane processes such as reverse osmosis (RO). This research focuses on characterization of the natural organic matter (NOM) fraction causing fouling on the active layer (AL) of a FO membrane in a novel plate and frame module configuration, facing secondary wastewater effluent as a feed solution (FS) and seawater used as a draw solution (DS). In addition, transparent exopolymer particles (TEP) were observed on the support layer (SL) of the membrane in contact with the DS. The NOM fouling layer, after characterizing the water samples and membranes used, was found to be composed of biopolymers and protein-like substances, which adversely affect the flux of water through the FO membrane. However, NOM fouling showed high reversibility, up to 90% when air scouring for 15. min is used as a cleaning technique. The irreversible fouling in this work was found to be 8.2% after chemical cleaning. On the support layer of the membrane, TEP formed clusters clearly identifiable with an optical microscope and a TEP-specific dye. Chemical cleaning with 1% NaOCl for 10. min proved to be the most effective method to remove TEP. © 2012.

  10. Ability of TEP1 in intestinal flora to modulate natural resistance of Anopheles dirus.

    Science.gov (United States)

    Wang, Yanyan; Wang, Ying; Zhang, Jingru; Xu, Wenyue; Zhang, Jian; Huang, Fu Sheng

    2013-08-01

    Blocking transmission of malaria is a reliable way to control and eliminate infection. However, in-depth knowledge of the interaction between Plasmodium and mosquito is needed. Studies suggest that innate immunity is the main mechanism inhibiting development of malaria parasites in the mosquito. Recent studies have found that use of antibiotics that inhibit the mosquito gut flora can reduce the immune response of Anopheles gambiae, thereby contributing to the development of malaria parasites. In our study, we used the non susceptible model of Anopheles dirus-Plasmodium yoelii to explore the effect of Anopheles intestinal flora on the natural resistance of A. dirus to P. yoelii. We found that in mosquitoes infected with Plasmodium, the intestinal flora can regulate expression of thioester-containing protein (TEP1) via an RNAi gene-silencing approach. Our results suggest that in the absence of TEP1, the natural microbiota cannot suppress the development of P. yoelii in A. dirus. This suggests that AdTEP1 plays an important role in the resistance of A. dirus to P. yoelii. The intestinal flora may modulate the development of P. yoelii in A. dirus by regulating TEP1 expression. Copyright © 2013 Elsevier Inc. All rights reserved.

  11. Co-existence of electricity, TEP, and TGC markets in the Baltic Sea Region

    International Nuclear Information System (INIS)

    Hindsberger, Magnus; Nybroe, Malene Hein; Ravn, Hans F.; Schmidt, Rune

    2003-01-01

    This paper analyses the application of two policy instruments, tradable emission permits (TEPs) and tradable green certificates (TGCs) to the electricity sector in an international context. The paper contains an explicit modelling at two levels of abstraction, one suitable for defining and analysing basic functionalities and one suitable for numerical analysis in relation to countries in the Baltic Sea Region. Emphasis is on estimating implications in quantitative terms for countries in the Baltic Sea Region in 2010 when the TEP market in the analysis extends to four Nordic countries (Denmark, Finland, Norway, Sweden), and the TGC market extends to North European EU countries (Denmark, Finland, Sweden, Germany). The study concludes that within the range of goals stipulated in the EU draft directive (23.6% renewable energy) and the Kyoto targets for emissions, the following prices are affected significantly: from -2 to +10 Euro/MWh for electricity spot prices, TGC prices up to 50 Euro/MWh, TEP prices up to 18 Euro/t CO 2 and up to +15 Euro/MWh on the consumer cost. It is shown that such price changes have important consequences for the production and investment patterns in the electricity sector, and the resulting patterns will be clearly different according to the specific numerical targets for the two goals. An immediate consequence is increased pressure on transmission lines. Further, the introduction of TEP and TGC markets will imply a restructuring of the electricity sector, e.g. (depending on the specific combination of targets) by a significant increase in wind power capacities. However, this will have to be counterbalanced by access to production technologies that have fast regulation properties and/or that may maintain voltage stability. However, the price signals of TGCs (and to some extent also TEPs) that will enhance wind power investments will simultaneously hamper investments in technologies that are a precondition for extensive use of wind power

  12. MiTEP's Collaborative Field Course Design Process Based on Earth Science Literacy Principles

    Science.gov (United States)

    Engelmann, C. A.; Rose, W. I.; Huntoon, J. E.; Klawiter, M. F.; Hungwe, K.

    2010-12-01

    Michigan Technological University has developed a collaborative process for designing summer field courses for teachers as part of their National Science Foundation funded Math Science Partnership program, called the Michigan Teacher Excellence Program (MiTEP). This design process was implemented and then piloted during two two-week courses: Earth Science Institute I (ESI I) and Earth Science Institute II (ESI II). Participants consisted of a small group of Michigan urban science teachers who are members of the MiTEP program. The Earth Science Literacy Principles (ESLP) served as the framework for course design in conjunction with input from participating MiTEP teachers as well as research done on common teacher and student misconceptions in Earth Science. Research on the Earth Science misconception component, aligned to the ESLP, is more fully addressed in GSA Abstracts with Programs Vol. 42, No. 5. “Recognizing Earth Science Misconceptions and Reconstructing Knowledge through Conceptual-Change-Teaching”. The ESLP were released to the public in January 2009 by the Earth Science Literacy Organizing Committee and can be found at http://www.earthscienceliteracy.org/index.html. Each day of the first nine days of both Institutes was focused on one of the nine ESLP Big Ideas; the tenth day emphasized integration of concepts across all of the ESLP Big Ideas. Throughout each day, Michigan Tech graduate student facilitators and professors from Michigan Tech and Grand Valley State University consistantly focused teaching and learning on the day's Big Idea. Many Earth Science experts from Michigan Tech and Grand Valley State University joined the MiTEP teachers in the field or on campus, giving presentations on the latest research in their area that was related to that Big Idea. Field sites were chosen for their unique geological features as well as for the “sense of place” each site provided. Preliminary research findings indicate that this collaborative design

  13. Marine aggregates and transparent exopolymeric particles (TEPs) as substrates for the stramenopilan fungi, the thraustochytrids: Roller table experimental approach.

    Digital Repository Service at National Institute of Oceanography (India)

    Damare, V.S.; Raghukumar, S.

    In order to understand the kind of organic substrates utilized by thraustochytrids in the coastal water column, their growth in the presence of Transparent Exopolymeric Substances (TEPS) and aggregates generated in roller table experiments...

  14. Transparent exopolymer particles (TEP) removal efficiency by a combination of coagulation and ultrafiltration to minimize SWRO membrane fouling

    KAUST Repository

    Li, Sheng; Lee, Shang-Tse; Sinha, Shahnawaz; Leiknes, TorOve; Amy, Gary L.; Ghaffour, NorEddine

    2016-01-01

    This study investigated the impact of coagulation on the transformation between colloidal and particulate transparent exopolymer particles (TEP) in seawater; and the effectiveness of a combined pretreatment consisting of coagulation and UF on minimizing TEP fouling of seawater reverse osmosis (SWRO) membranes. Coagulation with ferric chloride at pH 5 substantially transformed colloidal TEP (0.1–0.4) into particulate TEP (>0.4) leading to a better membrane fouling control. Both 50 and 100 kDa molecular weight cut-off (MWCO) UF membranes removed most of particulate and colloidal TEP without the assistance of coagulation, but coagulation is still necessary for better UF fouling control. The improvement of combined SWRO pretreatment with coagulation and 50 kDa UF membranes was not that much significant compared to UF pretreatment with 50 KDa alone. Therefore, the minimal coagulant dosage for seawater containing TEP should be based on the UF fouling control requirements rather than removal efficiency. © 2016 Elsevier Ltd

  15. Transparent exopolymer particles (TEP) removal efficiency by a combination of coagulation and ultrafiltration to minimize SWRO membrane fouling

    KAUST Repository

    Li, Sheng

    2016-07-02

    This study investigated the impact of coagulation on the transformation between colloidal and particulate transparent exopolymer particles (TEP) in seawater; and the effectiveness of a combined pretreatment consisting of coagulation and UF on minimizing TEP fouling of seawater reverse osmosis (SWRO) membranes. Coagulation with ferric chloride at pH 5 substantially transformed colloidal TEP (0.1–0.4) into particulate TEP (>0.4) leading to a better membrane fouling control. Both 50 and 100 kDa molecular weight cut-off (MWCO) UF membranes removed most of particulate and colloidal TEP without the assistance of coagulation, but coagulation is still necessary for better UF fouling control. The improvement of combined SWRO pretreatment with coagulation and 50 kDa UF membranes was not that much significant compared to UF pretreatment with 50 KDa alone. Therefore, the minimal coagulant dosage for seawater containing TEP should be based on the UF fouling control requirements rather than removal efficiency. © 2016 Elsevier Ltd

  16. Exploiting Earth observation data pools for urban analysis: the TEP URBAN project

    Science.gov (United States)

    Heldens, W.; Esch, T.; Asamer, H.; Boettcher, M.; Brito, F.; Hirner, A.; Marconcini, M.; Mathot, E.; Metz, A.; Permana, H.; Zeidler, J.; Balhar, J.; Soukop, T.; Stankek, F.

    2017-10-01

    Large amounts of Earth observation (EO) data have been collected to date, to increase even more rapidly with the upcoming Sentinel data. All this data contains unprecedented information, yet it is hard to retrieve, especially for nonremote sensing specialists. As we live in an urban era, with more than 50% of the world population living in cities, urban studies can especially benefit from the EO data. Information is needed for sustainable development of cities, for the understanding of urban growth patterns or for studying the threats of natural hazards or climate change. Bridging this gap between the technology-driven EO sector and the information needs of environmental science, planning, and policy is the driver behind the TEP-Urban project. Modern information technology functionalities and services are tested and implemented in the Urban Thematic Exploitation Platform (U-TEP). The platform enables interested users to easily exploit and generate thematic information on the status and development of the environment based on EO data and technologies. The beta version of the web platform contains value added basic earth observation data, global thematic data sets, and tools to derive user specific indicators and metrics. The code is open source and the architecture of the platform allows adding of new data sets and tools. These functionalities and concepts support the four basic use scenarios of the U-TEP platform: explore existing thematic content; task individual on-demand analyses; develop, deploy and offer your own content or application; and, learn more about innovative data sets and methods.

  17. Athletes with inguinal disruption benefit from endoscopic totally extraperitoneal (TEP) repair.

    Science.gov (United States)

    Roos, M M; Bakker, W J; Goedhart, E A; Verleisdonk, E J M M; Clevers, G J; Voorbrood, C E H; Sanders, F B M; Naafs, D B; Burgmans, J P J

    2018-06-01

    Inguinal disruption, a common condition in athletes, is a diagnostic and therapeutic challenge. The aim of this study was to evaluate the effect of endoscopic totally extraperitoneal (TEP) repair in athletes with inguinal disruption, selected through a multidisciplinary, systematic work-up. An observational, prospective cohort study was conducted in 32 athletes with inguinal disruption. Athletes were assessed by a sports medicine physician, radiologist and hernia surgeon and underwent subsequent endoscopic TEP repair with placement of polypropylene mesh. The primary outcome was pain reduction during exercise on the numeric rating scale (NRS) 3 months postoperatively. Secondary outcomes were sports resumption, physical functioning and long-term pain intensity. Patients were assessed preoperatively, 3 months postoperatively and after a median follow-up of 19 months. Follow-up was completed in 30 patients (94%). The median pain score decreased from 8 [interquartile range (IQR) 7-8] preoperatively to 2 (IQR 0-5) 3 months postoperatively (p disruption, selected through a multidisciplinary, systematic work-up, benefit from TEP repair.

  18. Is unilateral laparoscopic TEP inguinal hernia repair a job half done? The case for bilateral repair.

    Science.gov (United States)

    Pawanindra Lal; Philips, Prejesh; Chander, Jagdish; Ramteke, Vinod K

    2010-07-01

    Bilateral laparoscopic totally extraperitoneal (TEP) repair of unilateral hernia is conspicuous in published literature by its absence. There are no studies or data on the feasibility, advantages or disadvantages of bilateral repair in all cases or in any subset of patients with unilateral primary inguinal hernia. The objective of this study is to investigate the feasibility of bilateral laparoscopic exploration for all unilateral cases followed by laparoscopic TEP in all cases and to compare complications, recurrence rates, postoperative pain, patient satisfaction, and return to work retrospectively with a similar number of age-matched retrospective controls. One hundred fifty TEP operations were performed in 75 patients (group A) prospectively and were compared with 75 unilateral TEP operations (group B) in age-matched controls done previously by the same surgeon. All cases were performed under general anesthesia, and TEP repair was performed using three midline ports. All uncomplicated patients were discharged at 24 h, in keeping with departmental policy. Of 75 patients (group A), 25 (33.3%) were clinically diagnosed with bilateral hernia and the rest (50, 66.66%) with unilateral hernia. The distribution of the 25 bilateral cases was 11 bilateral direct and 14 bilateral indirect inguinal hernias. The distribution of the 75 age-matched controls (group B) was all unilateral hernia, of which 47 were right-sided and 28 were left-sided. There were 23 direct hernias and 52 indirect hernias among the control group. The mean operative time for all 150 cases was 76.66 +/- 15.92 min. The operative time in the control group (unilateral hernias) was 66.16 +/- 12.44 min, whereas the operative time in the test group (bilateral repair) was 87.2 +/- 11.32 min. The operative time in the bilateral group was significantly higher, by 21.04 min or 31.88% (p = 0.000). The operative time in the true unilateral group was 82.45 +/- 9.38 min, whereas the operative time in the former

  19. Immune-tolerant elastin-like polypeptides (iTEPs) and their application as CTL vaccine carriers.

    Science.gov (United States)

    Cho, S; Dong, S; Parent, K N; Chen, M

    2016-01-01

    Cytotoxic T lymphocyte (CTL) vaccine carriers are known to enhance the efficacy of vaccines, but a search for more effective carriers is warranted. Elastin-like polypeptides (ELPs) have been examined for many medical applications but not as CTL vaccine carriers. We aimed to create immune tolerant ELPs using a new polypeptide engineering practice and create CTL vaccine carriers using the ELPs. Four sets of novel ELPs, termed immune-tolerant elastin-like polypeptide (iTEP) were generated according to the principles dictating humoral immunogenicity of polypeptides and phase transition property of ELPs. The iTEPs were non-immunogenic in mice. Their phase transition feature was confirmed through a turbidity assay. An iTEP nanoparticle (NP) was assembled from an amphiphilic iTEP copolymer plus a CTL peptide vaccine, SIINFEKL. The NP facilitated the presentation of the vaccine by dendritic cells (DCs) and enhanced vaccine-induced CTL responses. A new ELP design and development practice was established. The non-canonical motif and the immune tolerant nature of the iTEPs broaden our insights about ELPs. ELPs, for the first time, were successfully used as carriers for CTL vaccines. It is feasible to concurrently engineer both immune-tolerant and functional peptide materials. ELPs are a promising type of CTL vaccine carriers.

  20. OR TEP-II: a FORTRAN Thermal-Ellipsoid Plot Program for crystal structure illustrations

    International Nuclear Information System (INIS)

    Johnson, C.K.

    1976-03-01

    A computer program is described for drawing crystal structure illustrations using a mechanical plotter. Ball-and-stick type illustrations of a quality suitable for publication are produced with either spheres or thermal-motion probability ellipsoids on the atomic sites. The program can produce stereoscopic pairs of illustrations which aid in the visualization of complex packing arrangements of atoms and thermal motion patterns. Interatomic distances, bond angles, and principal axes of thermal motion are also calculated to aid the structural study. The most recent version of the program, OR TEP-II, has a hidden-line-elimination feature to omit those portions of atoms or bonds behind other atoms or bonds

  1. OR TEP-II: a FORTRAN Thermal-Ellipsoid Plot Program for crystal structure illustrations

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, C.K.

    1976-03-01

    A computer program is described for drawing crystal structure illustrations using a mechanical plotter. Ball-and-stick type illustrations of a quality suitable for publication are produced with either spheres or thermal-motion probability ellipsoids on the atomic sites. The program can produce stereoscopic pairs of illustrations which aid in the visualization of complex packing arrangements of atoms and thermal motion patterns. Interatomic distances, bond angles, and principal axes of thermal motion are also calculated to aid the structural study. The most recent version of the program, OR TEP-II, has a hidden-line-elimination feature to omit those portions of atoms or bonds behind other atoms or bonds.

  2. Dynamics of transparent exopolymer particle (TEP) production and aggregation during viral infection of the coccolithophore, Emiliania huxleyi.

    Science.gov (United States)

    Nissimov, Jozef I; Vandzura, Rebecca; Johns, Christopher T; Natale, Frank; Haramaty, Liti; Bidle, Kay D

    2018-06-19

    Emiliania huxleyi produces calcium carbonate (CaCO 3 ) coccoliths and transparent exopolymer particles (TEP), sticky, acidic carbohydrates that facilitate aggregation. E. huxleyi's extensive oceanic blooms are often terminated by coccolithoviruses (EhVs) with the transport of cellular debris and associated particulate organic carbon (POC) to depth being facilitated by TEP-bound "marine snow" aggregates. The dynamics of TEP production and particle aggregation in response to EhV infection are poorly understood. Using flow cytometry, spectrophotometry, and FlowCam visualization of alcian blue (AB)-stained aggregates, we assessed TEP production and the size spectrum of aggregates for E. huxleyi possessing different degrees of calcification and cellular CaCO 3 :POC mass ratios, when challenged with two EhVs (EhV207 and EhV99B1). FlowCam imaging also qualitatively assessed the relative amount of AB-stainable TEP (i.e. blue:red ratio of each particle). We show significant increases in TEP during early phase EhV207-infection (∼24 hours) of calcifying strains and a shift towards large aggregates following EhV99B1-infection. We also observed the formation of large aggregates with low blue:red ratios, suggesting that other exopolymer substances contribute towards aggregation. Our findings show the potential for virus infection and the associated response of their hosts to impact carbon flux dynamics and provide incentive to explore these dynamics in natural populations. This article is protected by copyright. All rights reserved. © 2018 Society for Applied Microbiology and John Wiley & Sons Ltd.

  3. Monitoring the aging of pressure vessel steels by TEP measurements: Advantages and current limitations of the method

    International Nuclear Information System (INIS)

    Kleber, X.; Saillet, S.

    2011-01-01

    The TEP (Thermoelectric Power or Seebeck coefficient) characterizes the ability of a material to generate an electrical potential difference when the material is subjected to a heat flux. It can be defined from the Seebeck effect, which manifests itself in a circuit formed by two different metals subjected to a temperature gradient. The origin of the thermoelectric power is, as the resistivity, due to electronic phenomena occurring at the atomic scale in relation to the crystallographic structure of the material. TEP measurements are used to characterize small microstructural changes at the scale of crystal defects. The high sensitivity of TEP makes it an excellent probe able of detecting small changes in the microstructural state, including precipitation, dissolution of alloying elements, hardening and recovery after deformation. It has been shown recently that the TEP of pressure vessels steels was sensitive to irradiation, making this measurement technique a potential candidate for monitoring the aging of the pressure vessel steel. However, the first measurements on Charpy specimens of the EDF monitoring program (Pressure Vessel Surveillance Program) showed a strong negative effect of specimen geometry on the accuracy that can be achieved. In this paper we show what the origins of these inaccuracies are. From numerical simulation and finite element model, we describe the roles of the thermal contact resistance as well as the influence of the geometry of the blocks device. A model is proposed to overcome these negative effects. We also show the effect of the presence of heterogeneities in the material on the TEP measurement, and the importance of their localization. Finally, solutions are proposed to improve the device for measuring TEP on PVSP Charpy specimens. (authors)

  4. Transparent Exopolymeric Particles (TEP Selectively Increase Biogenic Silica Dissolution From Fossil Diatoms as Compared to Fresh Diatoms

    Directory of Open Access Journals (Sweden)

    Jordan Toullec

    2018-03-01

    Full Text Available Diatom production is mainly supported by the dissolution of biogenic silica (bSiO2 within the first 200 m of the water column. The upper oceanic layer is enriched in dissolved and/or colloidal organic matter, such as exopolymeric polysaccharides (EPS and transparent exopolymeric particles (TEP excreted by phytoplankton in large amounts, especially at the end of a bloom. In this study we explored for the first time the direct influence of TEP-enriched diatom excretions on bSiO2 dissolution. Twelve dissolution experiments on fresh and fossil diatom frustules were carried out on seawater containing different concentrations of TEP extracted from diatom cultures. Fresh diatom frustules were cleaned from the organic matter by low ash temperature, and fossil diatoms were made from diatomite powder. Results confirm that newly formed bSiO2 dissolved at a faster rate than fossil diatoms due to a lower aluminum (Al content. Diatom excretions have no effect on the dissolution of the newly formed bSiO2 from Chaetoceros muelleri. Reversely, the diatomite specific dissolution rate constant and solubility of the bSiO2 were positively correlated to TEP concentrations, suggesting that diatom excretion may provide an alternative source of dSi when limitations arise.

  5. Data acquisition and PV module power production in upgraded TEP/AzRISE solar test yard

    Science.gov (United States)

    Bennett, Whit E.; Fishgold, Asher D.; Lai, Teh; Potter, Barrett G.; Simmons-Potter, Kelly

    2017-08-01

    The Tucson Electric Power (TEP)/University of Arizona AzRISE (Arizona Research Institute for Solar Energy) solar test yard is continuing efforts to improve standardization and data acquisition reliability throughout the facility. Data reliability is ensured through temperature-insensitive data acquisition devices with battery backups in the upgraded test yard. Software improvements allow for real-time analysis of collected data, while uploading to a web server. Sample data illustrates high fidelity monitoring of the burn-in period of a polycrystalline silicon photovoltaic module test string with no data failures over 365 days of data collection. In addition to improved DAQ systems, precision temperature monitoring has been implemented so that PV module backside temperatures are routinely obtained. Weather station data acquired at the test yard provides local ambient temperature, humidity, wind speed, and irradiance measurements that have been utilized to enable characterization of PV module performance over an extended test period

  6. LAS TIC-TAC-TEP: un referente para la educación policial

    Directory of Open Access Journals (Sweden)

    Gloria Esperanza Ortiz Russi

    2015-11-01

    Full Text Available La lectura que las autoras esbozan, hace parte de un discurso tejido durante años en trabajo continuo de cerca a la educación policial, desde el centro de Mediaciones Pedagógicas y Tecnológicas –CEMPE-, se puede comentar que dicho discurso es aún inacabado, pero sí propone una postura clave para ser tenida en cuenta en los procesos educativos que demandan la globalidad en una socio-cultura cada vez más inmersa en las TIC-TAC-TEP,  esas siglas tienen unas nuevas acepciones muy especiales para la educación y que desde la PONAL son necesarias trabajarlas.

  7. Coastal Thematic Exploitation Platform (C-TEP): An innovative and collaborative platform to facilitate Big Data coastal research

    Science.gov (United States)

    Tuohy, Eimear; Clerc, Sebastien; Politi, Eirini; Mangin, Antoine; Datcu, Mihai; Vignudelli, Stefano; Illuzzi, Diomede; Craciunescu, Vasile; Aspetsberger, Michael

    2017-04-01

    The Coastal Thematic Exploitation Platform (C-TEP) is an on-going European Space Agency (ESA) funded project to develop a web service dedicated to the observation of the coastal environment and to support coastal management and monitoring. For over 20 years ESA satellites have provided a wealth of environmental data. The availability of an ever increasing volume of environmental data from satellite remote sensing provides a unique opportunity for exploratory science and the development of coastal applications. However, the diversity and complexity of EO data available, the need for efficient data access, information extraction, data management and high spec processing tools pose major challenges to achieving its full potential in terms of Big Data exploitation. C-TEP will provide a new means to handle the technical challenges of the observation of coastal areas and contribute to improved understanding and decision-making with respect to coastal resources and environments. C-TEP will unlock coastal knowledge and innovation as a collaborative, virtual work environment providing access to a comprehensive database of coastal Earth Observation (EO) data, in-situ data, model data and the tools and processors necessary to fully exploit these vast and heterogeneous datasets. The cloud processing capabilities provided, allow users to perform heavy processing tasks through a user-friendly Graphical User Interface (GUI). A connection to the PEPS (Plateforme pour l'Exploitation des Produits Sentinel) archive will provide data from Sentinel missions 1, 2 and 3. Automatic comparison tools will be provided to exploit the in-situ datasets in synergy with EO data. In addition, users may develop, test and share their own advanced algorithms for the extraction of coastal information. Algorithm validation will be facilitated by the capabilities to compute statistics over long time-series. Finally, C-TEP subscription services will allow users to perform automatic monitoring of some key

  8. LAPAROSCOPIC TEP VERSUS OPEN HERNIOPLASTY: A COMPARATIVE STUDY OF EXTRAPERITONEAL TENSION FREE MESH REPAIRS IN INGUINAL HERNIA

    OpenAIRE

    Rehan Sabir; Sadiq; Shadan

    2015-01-01

    Inguinal hernia repair is now one of the most commonly performed general surgical procedures in practice. 'Tension - free repair' is the procedure of choice . [ 1 ] due to its low recurrence rate, these tension - free repair procedures can be roughly categorized into two groups: laparoscopic and open anterior approach. TEP is accepted as the most ideal method because it can avoid entry into the peritoneal cavity, which can cause intraperitoneal compli...

  9. Testing of a 7-tube palladium membrane reactor for potential use in TEP

    International Nuclear Information System (INIS)

    Carlson, Bryan J.; Trujillo, Stephen; Willms, R. Scott

    2010-01-01

    A Palladium Membrane Reactor (PMR) consists of a palladium/silver membrane permeator filled with catalyst (catalyst may be inside or outside the membrane tubes). The PMR is designed to recover tritium from the methane, water, and other impurities present in fusion reactor effluent. A key feature of a PMR is that the total hydrogen isotope content of a stream is significantly reduced as (1) methane-steam reforming and/or water-gas shift reactions proceed on the catalyst bed and (2) hydrogen isotopes are removed via permeation through the membrane. With a PMR design matched to processing requirements, nearly complete hydrogen isotope removals can be achieved. A 3-tube PMR study was recently completed. From the results presented in this study, it was possible to conclude that a PMR is appropriate for TEP, perforated metal tube protectors function well, platinum on aluminum (PtA) catalyst performs the best, conditioning with air is probably required to properly condition the Pd/Ag tubes, and that CO/CO 2 ratios maybe an indicator of coking. The 3-tube PMR had a permeator membrane area of 0.0247 m 2 and a catalyst volume to membrane area ratio of 4.63 cc/cm 2 (with the catalyst on the outside of the membrane tubes and the catalyst only covering the membrane tube length). A PMR for TEP will require a larger membrane area (perhaps 0.35 m 2 ). With this in mind, an intermediate sized PMR was constructed. This PMR has 7 permeator tubes and a total membrane area of 0.0851 m 2 . The catalyst volume to membrane area ratio for the 7-tube PMR was 5.18 cc/cm 2 . The total membrane area of the 7-tube PMR (0.0851 m 2 ) is 3.45 times larger than total membrane area of the 3-tube PMR (0.0247 m 2 ). The following objectives were identified for the 7-tube PMR tests: (1) Refine test measurements, especially humidity and flow; (2) Refine maintenance procedures for Pd/Ag tube conditioning; (3) Evaluate baseline PMR operating conditions; (4) Determine PMR scaling method; (5) Evaluate PMR

  10. Experimental validation of a method for performance monitoring of the impurity processing stage in the TEP system of ITER

    International Nuclear Information System (INIS)

    Bornschein, B.; Corneli, D.; Glugla, M.; Guenther, K.; Le, T.L.; Simon, K.H.

    2007-01-01

    The Tokamak Exhaust Processing (TEP) system within the Tritium Plant of ITER needs to be designed such that tritium is recovered from all exhaust gases produced during different modes and operational conditions of the vacuum vessel. The reference process for the TEP system of ITER is called CAPER and comprises three different, consecutive steps to recover hydrogen isotopes at highest purity for direct transfer to the cryogenic Isotope Separation system. The second step ('impurity processing', IP) is carried out in a closed loop involving heterogeneously catalyzed cracking or conversion reactions to liberate tritium from tritiated hydrocarbons or tritiated water combined with permeation of hydrogen isotopes through a Pd/Ag permeator. This combination shifts chemical equilibria towards dehydrogenation and, therefore, enables detritiation factors higher than 1000 in the IP stage. Such a high decontamination factor requires the optimal performance of the permeator, which on the other hand is operated under conditions which provoke coking of the permeator membrane by hydrocarbon cracking. For this reason the permeator in the impurity processing loop needs to be repeatedly regenerated in order to sustain decontamination factors higher/in the order of 1000. At the Tritium Laboratory Karlsruhe (TLK) a method to measure the actual performance of the second stage of the CAPER process has been developed. This method has been successfully tested with the CAPER facility and appears feasible for the TEP system of ITER

  11. PET: which radionuclides can be used?; TEP: quels sont les radionucleides utilisables?

    Energy Technology Data Exchange (ETDEWEB)

    Pasqualini, R. [CEA Saclay, CIS bio international, Schering, 91 - Gif-sur-Yvette (France)

    2005-04-15

    Almost the totality of positron imaging procedures are performed with {sup 18}F, mainly after administration of {sup 18}F-FDG. The reason of this hegemonic role in TEP is not only due to the favourable nuclear properties of {sup 18}F (97% of positron yield, low energy positron, no parasitic gamma-ray) but also to the relatively simple manufacturing process (use of low energy cyclotron, high irradiation yield). Only the short value of {sup 18}F half-life and the relatively poor labelling chemistry might be considered a disadvantage to a wider use of this radionuclide. The success of {sup 18}F has stimulated the search for new positron emitters, leading to a list of a large number of potential candidates. However, it is known that the pharmaceutical development leading to the approval of a new radioactive tracer is a long and costly process. Therefore, it is necessary to adopt selecting criteria able to identify the best candidate undergoing the pharmaceutical development with potentiality of success. The selection criteria used in this presentation are based on both the impact of nuclear properties on image quality and dosimetry and on the data related to the manufacturing process (irradiation and purification yields, half-life value etc). These criteria have been applied to the most frequently cited positron emitters, namely {sup 64}Cu, {sup 68}Ga, {sup 72}As, {sup 76}Br, {sup 86}Y, and {sup 124}I. {sup 82}Rb, a radionuclide currently approved in US has also been included in this analysis. Amongst the above radionuclides, only {sup 64}Cu, {sup 68}Ga, {sup 82}Rb and, to a less extent, {sup 124}I can be considered acceptable candidates for an industrial development. (author)

  12. Earth Observation-Supported Service Platform for the Development and Provision of Thematic Information on the Built Environment - the Tep-Urban Project

    Science.gov (United States)

    Esch, T.; Asamer, H.; Boettcher, M.; Brito, F.; Hirner, A.; Marconcini, M.; Mathot, E.; Metz, A.; Permana, H.; Soukop, T.; Stanek, F.; Kuchar, S.; Zeidler, J.; Balhar, J.

    2016-06-01

    The Sentinel fleet will provide a so-far unique coverage with Earth observation data and therewith new opportunities for the implementation of methodologies to generate innovative geo-information products and services. It is here where the TEP Urban project is supposed to initiate a step change by providing an open and participatory platform based on modern ICT technologies and services that enables any interested user to easily exploit Earth observation data pools, in particular those of the Sentinel missions, and derive thematic information on the status and development of the built environment from these data. Key component of TEP Urban project is the implementation of a web-based platform employing distributed high-level computing infrastructures and providing key functionalities for i) high-performance access to satellite imagery and derived thematic data, ii) modular and generic state-of-the art pre-processing, analysis, and visualization techniques, iii) customized development and dissemination of algorithms, products and services, and iv) networking and communication. This contribution introduces the main facts about the TEP Urban project, including a description of the general objectives, the platform systems design and functionalities, and the preliminary portfolio products and services available at the TEP Urban platform.

  13. Computation code TEP 1 for automated evaluation of technical and economic parameters of operation of WWER-440 nuclear power plant units

    International Nuclear Information System (INIS)

    Zadrazil, J.; Cvan, M.; Strimelsky, V.

    1987-01-01

    The TEP 1 program is used for automated evaluation of the technical and economic parameters of nuclear power plant units with WWER-440 reactors. This is an application program developed by the Research Institute for Nuclear Power Plants in Jaslovske Bohunice for the KOMPLEX-URAN 2M information system, delivered by the USSR to the V-2 nuclear power plants in Jaslovske Bohunice and in Dukovany. The TEP 1 program is written in FORTRAN IV and its operation has two parts. First the evaluation of technical and economic parameters of operation for a calculation interval of 10 mins and second, the control of the calculation procedure, follow-up on input data, determination of technical and economic parameters for a lengthy time interval, and data printout and storage. The TEP 1 program was tested at the first unit of the V-2 power plant and no serious faults appeared in the process of the evaluation of technical and economic parameters. A modification of the TEP 1 programme for the Dukovany nuclear power plant is now being tested on the first unit of the plant. (Z.M.)

  14. Expression profiles of vault components MVP, TEP1 and vPARP and their correlation to other multidrug resistance proteins in ovarian cancer.

    Science.gov (United States)

    Szaflarski, Witold; Sujka-Kordowska, Patrycja; Pula, Bartosz; Jaszczyńska-Nowinka, Karolina; Andrzejewska, Małgorzata; Zawierucha, Piotr; Dziegiel, Piotr; Nowicki, Michał; Ivanov, Pavel; Zabel, Maciej

    2013-08-01

    Vaults are cytoplasmic ribonucleoprotein particles composed of three proteins (MVP, TEP1, vPARP) and vault‑associated RNAs (vRNAs). Although the cellular functions of vaults remain unclear, vaults are strongly linked to the development of multidrug resistance (MDR), the major obstacle to the efficient treatment of cancers. Available published data suggest that vaults and their components are frequently upregulated in broad variety of multidrug-resistant cancer cell lines and tumors of different histological origin. Here, we provide detailed analysis of vault protein expression in post-surgery ovarian cancer samples from patients that were not exposed to chemotherapy. Our analysis suggests that vault proteins are expressed in the ovaries of healthy individuals but their expression in cancer patients is changed. Specifically, MVP, TEP1 and vPARP mRNA levels are significantly decreased in cancer samples with tendency of lower expression in higher-grade tumors. The pattern of vault protein mRNA expression is strongly correlated with the expression of other MDR-associated proteins such as MDR1, MRP1 and BCRP. Surprisingly, the protein levels of MVP, TEP1 and vPARP are actually increased in the higher‑grade tumors suggesting existence of post-transcriptional regulation of vault component production.

  15. Quantitative real-time PCR analysis of Anopheles dirus TEP1 and NOS during Plasmodium berghei infection, using three reference genes

    Directory of Open Access Journals (Sweden)

    Jonathan W.K. Liew

    2017-07-01

    Full Text Available Quantitative reverse transcription PCR (qRT-PCR has been an integral part of characterizing the immunity of Anopheles mosquitoes towards Plasmodium invasion. Two anti-Plasmodium factors of Anopheles, thioester-containing protein 1 (TEP1 and nitric oxide synthase (NOS, play a role in the refractoriness of Anopheles towards Plasmodium infection and are generally expressed during infection. However, these are less studied in Anopheles dirus, a dominant malaria vector in Southeast Asia. Furthermore, most studies used a single reference gene for normalization during gene expression analysis without proper validation. This may lead to erroneous quantification of expression levels. Therefore, the present study characterized and investigated the expression profiles of TEP1 and NOS of Anopheles dirus during P. berghei infection. Prior to that, the elongation factor 1-alpha (EF1, actin 1 (Act and ribosomal protein S7 (S7 genes were validated for their suitability as a set of reference genes. TEP1 and NOS expressions in An. dirus were found to be significantly induced after P. berghei infection.

  16. The effect of ultrapro or prolene mesh on postoperative pain and well-being following endoscopic Totally Extraperitoneal (TEP hernia repair (TULP: study protocol for a randomized controlled trial

    Directory of Open Access Journals (Sweden)

    Schouten Nelleke

    2012-06-01

    Full Text Available Abstract Background The purpose of this study was to describe the rationale and design of a randomized controlled trial analyzing the effects of mesh type (Ultrapro versus Prolene mesh on postoperative pain and well-being following an endoscopic Totally Extraperitoneal (TEP repair for inguinal hernias (short: TULP trial. Methods and design The TULP trial is a prospective, two arm, double blind, randomized controlled trial to assess chronic postoperative pain and quality of life following implantation of a lightweight (Ultrapro and heavyweight (Prolene mesh in endoscopic TEP hernia repair. The setting is a high-volume single center hospital, specializing in TEP hernia repair. All patients are operated on by one of four surgeons. Adult male patients (≥18 years of age with primary, reducible, unilateral inguinal hernias and no contraindications for TEP repair are eligible for inclusion in the study. The primary outcome is substantial chronic postoperative pain, defined as moderate to severe pain persisting ≥ 3 months postoperatively (Numerical Rating Scale, NRS 4–10. Secondary endpoints are the individual development of pain until three years after the TEP procedure, the quality of life (QoL, recurrence rate, patient satisfaction and complications. Discussion Large prospective randomized controlled studies with a long follow-up evaluating the incidence of chronic postoperative pain following implantation of lightweight and heavyweight mesh in endoscopic (TEP hernia repair are limited. By studying the presence of pain and quality of life, but also complications and recurrences in a large patient population, a complete efficiency and feasibility assessment of both mesh types in TEP hernia repair will be performed. Trial registration The TULP study is registered in the Dutch Trial Register (NTR2131

  17. Community-Based Global Health Program for Maltreated Children and Adolescents in Brazil: The Equilibrium Program (TEP

    Directory of Open Access Journals (Sweden)

    Andrea Horvath Marques

    2015-07-01

    Full Text Available The maltreatment of children and adolescents is a global public health problem that affects high and low-middle income countries (LMICs. In the United States, around 1.2 million children suffer from abuse, while in LMICs such as Brazil these rates are much higher (an estimated 28 million children. Exposition to early environmental stress has been associated with suboptimal physical and brain development, persistent cognitive impairment and behavioral problems. Studies have reported that children exposed to maltreatment are at high risk of behavioral problems, learning disabilities, communication and psychiatric disorders and general clinical conditions such as obesity and systemic inflammation later in life. The aim of this paper is to describe The Equilibrium Program (TEP, a community-based global health program implemented in São Paulo, Brazil to serve traumatized and neglected children and adolescents. We will describe and discuss TEP’s implementation, highlighting its innovation aspects, research projects developed within the program as well as its population profile. Finally, we will discuss TEP’s social impact, challenges and limitations. The program’s goal is to promote the social and family reintegration of maltreated children and adolescents through an interdisciplinary intervention program that provides multi-dimensional bio-psycho-social treatment integrated with the diverse services needed to meet the unique demands of this population. The program’s cost-effectiveness is being evaluated to support the development of more effective treatments and to expand similar programs in other areas of Brazil. Policy makers should encourage early evidence-based interventions for disadvantaged children to promote healthier psychosocial environments and provide them opportunities to become healthy and productive adults. This approach has already shown itself to be a cost-effective strategy to prevent disease and promote health.

  18. The use of self-gripping (Progrip™) mesh during laparoscopic total extraperitoneal (TEP) inguinal hernia repair: a prospective feasibility and long-term outcomes study.

    Science.gov (United States)

    Bresnahan, Erin; Bates, Andrew; Wu, Andrew; Reiner, Mark; Jacob, Brian

    2015-09-01

    The use of self-gripping mesh during laparoscopic TEP inguinal hernia repairs may eliminate the need for any additional fixation, and thus reduce post-operative pain without the added concern for mesh migration. Long-term outcomes are not yet prospectively studied in a controlled fashion. Under IRB approval, from January 2011-April 2013, 91 hernias were repaired laparoscopically with self-gripping mesh without additional fixation. Patients were followed for at least 1 year. Demographics and intraoperative data (defect location, size, and mesh deployment time) are recorded. VAS is used in the recovery room (RR) to score pain, and the Carolinas Comfort Scale ™ (CCS), a validated 0-5 pain/quality of life (QoL) score where a mean score of >1.0 means symptomatic pain, is employed at 2 weeks and at 1 year. Morbidities, narcotic usage, days to full activity and return to work, and CCS scores are reported. Sixty two patients, with 91 hernias repaired with self-gripping mesh, completed follow-up at a mean time period of 14.8 months. Seventeen hernias were direct defects (average size 3.0 cm). Mesh deployment time was 193.7 s. RR pain was 1.1/10 using a VAS. Total average oxycodone/acetaminophen (5 mg/325 mg) usage = 5.0 tablets, days to full activity was 1.6, and return to work was 4.2 days. Thirteen small asymptomatic seromas were palpated without any recurrences or groin tenderness, and all seromas resolved by the 6 month visit. Transient testis discomfort was reported in five patients. Urinary retention was 3.2%. Mean CCS™ scores at the first visit for groin pain laying, bending, sitting, walking, and step-climbing were 0.2, 0.5, 0.4, 0.3, and 0.3, respectively. At the first post op visit, 4.8% had symptomatic pain (CCS > 1). At 14.8 months, no patients reported symptomatic pain with CCS scores for all 62 patients averaging 0.02, (range 0-0.43). There are no recurrences thus far. Self-gripping mesh can be safely used during laparoscopic TEP inguinal hernia repairs

  19. Dynamics of phytoplankton productivity and exopolysaccharides (EPS and TEP) pools in the Seine Estuary (France, Normandy) over tidal cycles and over two contrasting seasons.

    Science.gov (United States)

    Morelle, Jérôme; Schapira, Mathilde; Claquin, Pascal

    2017-10-01

    Exopolysaccharides (EPS) play an important role in the carbon flux and may be directly linked to phytoplankton and microphytobenthos production, most notably in estuarine systems. However the temporal and spatial dynamics of estuarine EPS are still not well understood, nor how primary productivity triggers this variability at these different scales. The aim of this study was to investigate the primary productivity of phytoplankton and EPS dynamics in the Seine estuary over a tidal cycle in three different haline zones over two contrasted seasons. The other objectives was to investigate the origin of pools of soluble carbohydrates (S-EPS) and transparent exopolymeric particles (TEP) in phytoplankton, microphytobenthos or other compartments. High frequency measurements of productivity were made in winter and summer 2015. Physical and chemical parameters, biomass and EPS were measured at hourly intervals in sub-surface waters and just above the water sediment-interface. Our results confirmed that high frequency measurements improve the accuracy of primary productivity estimations and associated carbon fluxes in estuaries. The photosynthetic parameters were shown to be strongly controlled by salinity and by the concentrations of suspended particle matter at the smallest temporal and at spatial scales. At these scales, our results showed an inverse relationship between EPS concentrations and biomass and productivity, and a positive relationship with sediment resuspension. Additionally, the distribution of EPS appears to be linked to hydrodynamics with the tide at daily scale and with the winter at seasonal scale. At spatial scale, the maximum turbidity zone played an important role in the distribution of TEP. Our results suggest that, in the Seine estuary, between 9% and 33% of the S-EPS pool in the water column can be attributed to phytoplankton excretion, while only 0.4%-1.6% (up to 6.14% in exceptional conditions) originates from the microphytobenthos compartments

  20. miR-380-5p-mediated repression of TEP1 and TSPYL5 interferes with telomerase activity and favours the emergence of an “ALT-like” phenotype in diffuse malignant peritoneal mesothelioma cells

    Directory of Open Access Journals (Sweden)

    Graziella Cimino-Reale

    2017-07-01

    Full Text Available Abstract Background Understanding the molecular/cellular underpinnings of diffuse malignant peritoneal mesothelioma (DMPM, a fatal malignancy with limited therapeutic options, is of utmost importance for the fruitful management of the disease. In this context, we previously found that telomerase activity (TA, which accounts for the limitless proliferative potential of cancer cells, is prognostic for disease relapse and cancer-related death in DMPM patients. Consequently, the identification of factors involved in telomerase activation/regulation may pave the way towards the development of novel therapeutic interventions for the disease. Here, the capability of miR-380-5p, a microRNA negligibly expressed in telomerase-positive DMPM clinical specimens, to interfere with telomerase-mediated telomere maintenance and, hence, with cancer cell growth was assessed on preclinical models of DMPM. Methods DMPM cells were transfected with a miR-380-5p synthetic precursor, and the effects of miRNA replacement were evaluated in terms of growing capability, induction of apoptosis and interference with TA. Reiterated weekly transfections were also performed in order to analyse the phenotype arising upon prolonged miR-380-5p reconstitution in DMPM cells. Results The ectopic expression of miR-380-5p elicited a remarkable inhibition of TA and resulted in DMPM cell growth impairment and apoptosis induction. In particular, we demonstrated for the first time that these effects were the result of a molecular circuitry converging on telomerase associated protein 1 (TEP1, where the miRNA was able to target the gene both directly in unconventional targeting modality and indirectly via p53 accumulation consequent to miRNA-mediated downregulation of testis-specific protein, Y-encoded-like 5 gene. Moreover, miR-380-5p did not cause telomere attrition and cell growth arrest in long-term DMPM transfectants, which in turn showed slightly elongated telomeres and molecular

  1. Savannah River Site TEP-SET tests uncertainty report

    International Nuclear Information System (INIS)

    Taylor, D.J.N.

    1993-09-01

    This document presents a measurement uncertainty analysis for the instruments used for the Phase I, II and III of the Savannah River One-Fourth Linear Scale, One-Sixth Sector, Tank/Muff/Pump (TMP) Separate Effects Tests (SET) Experiment Series. The Idaho National Engineering Laboratory conducted the tests for the Savannah River Site (SRS). The tests represented a range of hydraulic conditions and geometries that bound anticipated Large Break Loss of Coolant Accidents in the SRS reactors. Important hydraulic phenomena were identified from experiments. In addition, code calculations will be benchmarked from these experiments. The experimental system includes the following measurement groups: coolant density; absolute and differential pressures; turbine flowmeters (liquid phase); thermal flowmeters (gas phase); ultrasonic liquid level meters; temperatures; pump torque; pump speed; moderator tank liquid inventory via a load cells measurement; and relative humidity meters. This document also analyzes data acquisition system including the presampling filters as it relates to these measurements

  2. Geo-thermo-electric power: geo-TEP materials; Geo-Thermopower. Geo-TEP Materials. Jahresbericht 2006

    Energy Technology Data Exchange (ETDEWEB)

    Bocher, L.; Weidenkaff, A.

    2006-11-15

    This illustrated annual report for 2006 for the Swiss Federal Office of Energy (SFOE) summarises activities carried out at the Swiss Federal Laboratories for Materials Testing and Research EMPA in the area of materials for use in thermo-electric power generation. Work carried out using Perovskite-type oxides exhibiting promising thermo-electric properties is described. The morphology and microstructure of polycrystalline particles are discussed as are the associated Seebeck coefficients. Further work to be carried out in 2007 is briefly reviewed.

  3. Solar-TEP - Development of materials for thermo-electric power generators; SOLAR-TEP - Materialentwicklung fuer solarthermoelektrische Stromerzeuger - Schlussbericht 2008

    Energy Technology Data Exchange (ETDEWEB)

    Robert, R.; Weidenkaff, A.

    2008-06-15

    This final report for the Swiss Federal Office of Energy (SFOE) reports on the development of materials for thermo-electric power generators. Cobaltate phases are discussed as being suitable materials for thermoelectric applications at high temperatures. These potential thermoelectric materials are characterised with respect to their crystal structure, microstructure, composition, and thermal stability. The Seebeck coefficient, thermal conductivity and electrical resistivity of polycrystalline cobaltates with perovskite-type and layered-cobaltite structure are evaluated for a wide temperature range. The large Seebeck coefficient exhibited by both perovskite-type and layered cobaltite phases is analysed using the Heikes formula. The work is illustrated with results obtained for various materials in graphical form.

  4. A Classification Framework for Exploring Technology-Enabled Practice--Frame TEP

    Science.gov (United States)

    Prestridge, Sarah; de Aldama, Carlos

    2016-01-01

    This article theorizes the construction of a classification framework to explore teachers' beliefs and pedagogical practices for the use of digital technologies in the classroom. There are currently many individual schemas and models that represent both developmental and divergent concepts associated with technology-enabled practice. This article…

  5. Positron emission tomography (PET) and pancreatic tumours; Tomographie par emission de positons (TEP) et tumeurs pancreatiques

    Energy Technology Data Exchange (ETDEWEB)

    Montravers, F.; Kerrou, K.; Grahek, D.; Gutman, F.; Beco, V. de; Talbot, J.N. [Hopital Tenon, Service de Medecine, 75 - Paris (France)

    2005-07-15

    Neoplasms of the pancreas may originate front both exocrine and endocrine cells but in 90% of the cases, they correspond to ductal adenocarcinomas. For adenocarcinomas, the major indication of FDG-PET corresponds to the pre-operative staging because unexpected distant metastases can be detected by FDG-PET in about 20 to 40% of the cases, which results in avoidance of unnecessary surgical procedures. FDG PET is also useful in evaluation of the treatment effect, monitoring after the operation and detection of recurrent pancreatic cancers. For the characterisation of the pancreatic tumour, the performance of FDG-PET is sometimes limited due to poor cellularity, hyperglycemia or inflammatory processes. especially for large tumours and is indicated only in cases of doubtful results of CT or MRI. For endocrine pancreatic tumours, FDG-PET is useful only in case of poorly-differentiated and aggressive tumours. F-DOPA PET can he useful, complementary to pentetreotide scintigraphy, in well-differentiated endocrine tumours. (authors)

  6. Abundance of thraustochytridsand bacteria in the equatorial Indian Ocean, in relation totransparent exopolymeric particles (TEPs)

    Digital Repository Service at National Institute of Oceanography (India)

    Damare, V.; Raghukumar, S.

    Thraustochytrid protists are often abundant in coastal waters. However, their population dynamics and substrate preferences in the oceanic water column are poorly understood.We studied the abundance and distribution of thraustochytrids, bacteria...

  7. Detection of primary tumor by 18F-FDG-TEP in patients with cup syndrome

    International Nuclear Information System (INIS)

    Alberini, J.L.; Belhocine, T.; Daenen, F.; Hustinx, R.; Rigo, P.

    2000-01-01

    To study the performance of whole body 18 F-FDG-PET in the detection of the primary tumor in patients with unknown primary carcinoma in comparison with conventional imaging. Patients and methods: Forty-one patients, without previous history of known cancer, (18 women and 23 men; average age 64,1 years) with bone, brain, lymph node, liver, cutaneous, pleural and epidural metastases were included in a retrospective study. Results of PET (UGM Penn PET 240 H) were compared with those of techniques used in the current conventional procedure. There were 26 true positives, 2 false negatives (1 renal carcinoma and 1 myeloma) and one false positive results. Origins were lung [16], gut [6], breast [3] and head and neck [1] but stayed undetermined in 8 patients. Results of PET were superior to conventional diagnostic procedure in 12 patients and led to modify the therapy management in 11 patients. All known metastatic lesions were detected by PET. FDG-PET can be useful to determine the origin of metastasis. It allows detection of the primary tumor (26/33 patients) and allows evaluation of the spread of the disease. These results have to be confirmed and particularly in patients with highly treatable unknown primary carcinoma. (author)

  8. Romania en bankgarantie: een herlezing van de arresten Romania, Aukema en TEP

    NARCIS (Netherlands)

    Jonkers, A.L.

    2014-01-01

    In het Romania-arrest geeft de Hoge Raad in een obiter dictum aan dat in het daar voorliggende geval de garant geen regresvordering jegens de boedel geldend kan maken. Die garant was in Romania de aandeelhouder van de failliet. In deze bijdrage wordt betoogd dat de garantie van een bank - met

  9. Tradeable CO2 emission permits. A quantitative analysis of a TEP system between Annex I countries

    International Nuclear Information System (INIS)

    Koutstaal, P.R.; Kram, T.; Van Rooijen, S.N.M.

    1997-11-01

    Tradeable emission permits can be a cost-effective way to achieve emission reductions between countries or firms. In this study, the role of trading CO 2 emission permits between the Annex I countries of the FCCC is analysed. It is assumed that only countries are allowed to trade and that there is a perfect market without transaction costs and strategic behaviour. For several cases, the consequences for abatement costs, before and after trade, the volume of permits traded and emissions per capita are studied. Moreover, the gains from trade are determined. This study was undertaken before the Kyoto conference, therefore as a starting point for the different cases it was assumed that all countries should reduce their emissions with 10%. The cases studied are: a flat rate of 10% for each country; the differentiated EU distribution combined with a 10% reduction for the other OECD countries; and the so-called Triptych approach applied to all OECD countries. Two trading systems are considered, one covering only the OECD countries and one which also covers Middle and Eastern European countries (in a simplified way). Furthermore, two extreme cases are studied for the OECD trading scheme: equal costs (after trade) per unit of GNP and equal emission per capita (before trade). Tradeable emission permits will considerably reduce total costs compared with no trade by about 50%. The EU will considerably reduce total costs compared with no trade by about 50%. The EU will be a net exporter of permits in an OECD trading scheme (without Middle and Eastern Europe), mainly because the low costs possibilities for reduction of CO 2 emissions in Germany and the United Kingdom. 13 refs

  10. Sharpening the Theater Engagement Plan (TEP) Focus: The Impact of Higher Order Beliefs and Values

    National Research Council Canada - National Science Library

    Smith, S

    2002-01-01

    .... The very existence of the debate suggests, however, that differences abound, the most fundamental of which are the world views, values, and beliefs that have been molded across the generations...

  11. Usefulness of positron emission tomography (TEP) in the assessment of osteo-articular prosthesis

    International Nuclear Information System (INIS)

    Maldonado, A.; Suarez, J.P.; Dominguez, M.L.

    2004-01-01

    Joint arthroplasty is performed with increasing frequency as the population ages. Loosening or infection of the prosthesis is a relatively common event that can limit the lifetime of a prosthesis. Accuracy differentiation between aseptic and septic loosening of the prosthesis remains a challenge because of the consequences for patient management. Moreover, an early diagnosis of infected hip prosthesis is very important for optimal and cost-effective management. Various approaches have developed to visualize infection and inflammation by nuclear medicine techniques. Recently positron emission tomography (PET) with fluorine-l8 labelled 2 fluoro-2-deoxyglucose ( 18 F-FDG) has been shown to delineate infectious and inflammatory foci with high sensitivity owing to the increased glucose metabolism in inflammatory cells. In this paper we review the role of FDG-PET in this common differential diagnosis in patients with total knee and hip prostheses. Different patterns of FDG-PET interpretation have been described as wed as methodological aspects. (author)

  12. GEO-TEP. Development of thermoelectric materials for geothermal energy conversion systems. Final report 2008

    Energy Technology Data Exchange (ETDEWEB)

    Bocher, L.; Weidenkaff, A.

    2008-07-01

    Geothermal heat can be directly converted into electricity by using thermoelectric converters. Thermoelectric conversion relies on intrinsic materials properties which have to be optimised. In this work novel environmentally friendly and stable oxide ceramics were developed to fulfil this task. Thus, manganate phases were studied regarding their potential thermoelectric properties for converting geothermal heat into electricity. Perovskite-type phases were synthesized by applying different methods: the ceramic route, and innovative synthesis routes such as the 'chimie douce' method by bulk thermal decomposition of the citrate precursor or using an USC process, and also the polyol-mediated synthesis route. The crystal structures of the manganate phases are evaluated by XRPD, NPD, and ED techniques while specific microstructures such as twinned domains are highlighted by HRTEM imaging. Besides, the thermal stability of the Mn-oxide phases in air atmosphere are controlled over a wide temperature range (T < 1300 K). The thermoelectric figure of merit ZT was enhanced from 0.021 to 0.3 in a broad temperature range for the studied phases which makes these phases the best perovskitic candidates as n-type polycrystalline thermoelectric materials operating in air at high temperatures. (author)

  13. An efficient energy management in ten teps; Effizientes Energiemanagement in zehn Schritten

    Energy Technology Data Exchange (ETDEWEB)

    Vallbracht, Dirk; Klick, Mareike [DNV Business Assurance, Simmerath-Lammersdorf (Germany)

    2013-06-15

    Environmental protection, energy saving, expenses reduction: Are these the issues which play a major role in your company? Do you want to act sustainably? Do you need any orientation of how exactly you can implement this requirement? An energy management system offers opportunities which specifically reduce energy costs and protect the environment. The certification of the system allows a reliable presentation of your sustainable strategy outward.

  14. Usefulness of positron emission tomography (TEP) in the assessment of osteo-articular prosthesis; Utilite de la tomographie par emission de positons (TEP) dans l'etude des protheses osteo-articulaires

    Energy Technology Data Exchange (ETDEWEB)

    Maldonado, A.; Suarez, J.P.; Dominguez, M.L. [Centro PET Complutense, Madrid (Spain)

    2004-12-15

    Joint arthroplasty is performed with increasing frequency as the population ages. Loosening or infection of the prosthesis is a relatively common event that can limit the lifetime of a prosthesis. Accuracy differentiation between aseptic and septic loosening of the prosthesis remains a challenge because of the consequences for patient management. Moreover, an early diagnosis of infected hip prosthesis is very important for optimal and cost-effective management. Various approaches have developed to visualize infection and inflammation by nuclear medicine techniques. Recently positron emission tomography (PET) with fluorine-l8 labelled 2 fluoro-2-deoxyglucose ({sup 18}F-FDG) has been shown to delineate infectious and inflammatory foci with high sensitivity owing to the increased glucose metabolism in inflammatory cells. In this paper we review the role of FDG-PET in this common differential diagnosis in patients with total knee and hip prostheses. Different patterns of FDG-PET interpretation have been described as wed as methodological aspects. (author)

  15. Dynamics of transparent exopolymeric particles (TEP) and particle-associated carbohydrates in the Dona Paula bay, west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Bhaskar, P.V.; Bhosle, N.B.

    filters. The filters were then placed on a glass slide having a drop of fluorescence free oil, another drop of oil placed over the filter paper and covered with a cover glass. The slide was then illuminated with a UV lamp and viewed at 1000x... to their properties. For example, Sal-PCHO is loosely attached polymers produced by phytoplankton, generally more labile and hence preferred by bacteria (Decho 1990). Alternately, CPCHO are cell-bound polymers, which have higher concentrations of acidic radicals...

  16. Positron emission tomography: Which indications, which benefits?; Tomographie par emission de positons (TEP): quelles indications, quels benefices?

    Energy Technology Data Exchange (ETDEWEB)

    Chassoux, F. [Ctr Hosp St Anne, Serv Neurochirurg, F-75014 Paris (France); Chassoux, F.; Chiron, C. [CEA, I2BM, Serv Hosp Frederic Joliot, F-91 Orsay (France); Chiron, C. [Hop Necker Enfants Malad, INSERM, U663, F-75015 Paris (France); Chassoux, F.; Chiron, C. [Univ Paris 06, F-75005 Paris (France)

    2008-07-01

    Positron emission tomography (PET) is currently used in the pre-surgical workup for drug-resistant partial epilepsies in addition to MRI. Inter-ictal metabolism is studied in clinical practice using {sup 18}fluoro-desoxy-glucose ({sup 18}FDG). In medial temporal lobe epilepsy (MTLE) associated with hippocampal sclerosis, hypo-metabolism ipsilateral to the epileptogenic focus is found in 70-90% of cases. However, hypo-metabolism is larger than the structural lesion observed on MRI and includes the epileptogenic zone and ictal discharge spread areas. Hypo-metabolism is related to surgical outcome and cognitive disturbances in MTLE. Although the usefulness of PET appears less well-established in extra-temporal lobe epilepsy and in children, its sensitivity may be improved by co-registration and superimposition of PET on MRI at any age. Focal hypo-metabolism can be easily detected by visual analysis, allowing detection of minor gyral abnormalities that may correspond to focal cortical dysplasias. Moreover, in cases of negative MRI, focal hypo-metabolism findings may help invasive monitoring planning and deep electrode placement for SEEG, and finally improve surgical outcome. (authors)

  17. Seagrass as major source of transparent exopolymer particles in the oligotrophic Mediterranean coast

    KAUST Repository

    Iuculano, Francesca; Duarte, Carlos M.; Marbà , Nú ria; Agusti, Susana

    2017-01-01

    rates of TEP production by P. oceanica litter, allowing calculations of the associated TEP yield. We demonstrated that P. oceanica is an important source of TEP to the Mediterranean Sea, contributing an estimated 0.10 Tg C as TEP annually. TEP release

  18. p53 and PTEN/MMAC1/TEP1 gene therapy of human prostate PC-3 carcinoma xenograft, using transferrin-facilitated lipofection gene delivery strategy.

    Science.gov (United States)

    Seki, Masafumi; Iwakawa, Jun; Cheng, Helen; Cheng, Pi-Wan

    2002-04-10

    We previously reported that supplementation of a cationic liposome with transferrin (Tf) greatly enhanced lipofection efficiency (P.-W. Cheng, Hum. Gene Ther. 1996;7:275-282). In this study, we examined the efficacy of p53 and PTEN tumor suppressor gene therapy in a mouse xenograft model of human prostate PC-3 carcinoma cells, using a vector consisting of dimyristoyloxypropyl-3-dimethylhydroxyethyl ammonium bromide (DMRIE)-cholesterol (DC) and Tf. When the volume of the tumors grown subcutaneously in athymic nude mice reached 50-60 mm(3), three intratumoral injections of the following four formulations were performed during week 1 and then during week 3: (1) saline, (2) DC + Tf + pCMVlacZ, (3) DC + Tf + pCMVPTEN, and (4) DC + Tf + pCMVp53 (standard formulation). There was no significant difference in tumor volume and survival between group 1 and group 2 animals. As compared with group 1 controls, group 3 animals had slower tumor growth during the first 3 weeks but thereafter their tumor growth rate was similar to that of the controls. By day 2 posttreatment, group 4 animals had significantly lower tumor volume relative to initial tumor volume as well as controls at the comparable time point. Also, animals treated with p53 survived longer. Treatment with DC, Tf, pCMVp53, DC + pCMVp53, or Tf + pCMVp53 had no effect on tumor volume or survival. Expression of p53 protein and apoptosis were detected in tumors treated with the standard formulation, thus associating p53 protein expression and apoptosis with efficacy. However, p53 protein was expressed in only a fraction of the tumor cells, suggesting a role for bystander effects in the efficacy of p53 gene therapy. We conclude that intratumoral gene delivery by a nonviral vector consisting of a cationic liposome and Tf can achieve efficacious p53 gene therapy of prostate cancer.

  19. Interest of PET with F.D.G. in the follicular lymphomas; Interet de la TEP au FDG dans les lymphomes folliculaires

    Energy Technology Data Exchange (ETDEWEB)

    Albarghach, N.; Cornec, D.; Querellou, S.; Berthou, C.; Renaudineau, Y.; Pradier, O.; Cheze-Lerest, C. [CHU Morvan, 29 - Brest (France); Hatt, M.; Visvikis, D. [Inserm U650, 29 - Brest (France)

    2009-10-15

    For the follicular lymphomas, the PET is not in the systematic medical evaluation when it cannot be ignored in the evaluation of high grade non hodgkin lymphomas because it allows to make a complete extension evaluation and especially to help to define the target volume when the radiotherapy is indicated. The fixation of F.D.G. in follicular lymphomas was studied. We showed that the follicular lymphomas present in PET under the form of hypermetabolic injuries. It seems possible to consider the use of PET to help at the definition of target volumes when the radiotherapy is indicated. The intensity of fixation seems to have a predictive value for the therapy response in case of immunotherapy. The measurement of the active tumoral volume seems to have a predictive value for the response to the treatment that is worth being specified on a more important population. (N.C.)

  20. Cerebral blood flow and metabolism analysis in parkinsonian disorders; Pathologie extrapyramidale. Apport de l'imagerie de perfusion et du metabolisme (TEP, TEM)

    Energy Technology Data Exchange (ETDEWEB)

    Defebvre, L. [Hopital Roger Salengro, Service de Neurologie, 59 - Lille (France)

    1999-12-01

    Main metabolic and hemodynamic abnormalities detected by single photon emission computerized tomography and positron emission tomography in extra-pyramidal disorders are reported. In the first stage of Parkinson's disease, cortical metabolism and perfusion can be in normal range or moderately and uniformly reduced. A significant decrease may appear with the disease evolution. Marked abnormalities are observed in parkinsonian patients with dementia (subcortical dementia), involving especially the frontal cortex. A marked diffuse cortical hypo-metabolism (temporal, parietal, occipital and frontal cortex) may suggest the diagnosis of dementia with Lewy bodies, especially in case of fluctuating cognitive decline with recurrent visual hallucinations. In progressive supra-nuclear palsy, a frontal cortex hypo-metabolism is reported precociously, preceding sometimes the cognitive impairment. Metabolic pattern find in multiple system atrophy reflects dysfunction of both nigrostriatal pathways and striatum, with a decrease glucose uptake in putamen and caudate nucleus which also involves cerebellum for the patients with cerebellar syndrome. In cortico-basal degeneration, asymmetric fronto-parietal and striatal hypo-metabolism observed in the controlateral hemisphere to the clinically most affected side, constitute the main characteristic well correlated with apraxia. (author)

  1. Interest of FDG-PET for lung cancer radiotherapy; Interet de la TEP au FDG pour la radiotherapie des cancers bronchiques

    Energy Technology Data Exchange (ETDEWEB)

    Thureau, S.; Mezzani-Saillard, S.; Dubray, B. [Departement de radiotherapie et de physique medicale et QuantIF - Litis, EA 4108, CRLCC Henri-Becquerel, 1, rue d' Amiens, 76038 Rouen (France); Modzelewski, R.; Edet-Sanson, A.; Vera, P. [Departement de medecine nucleaire et QuantIF - Litis, EA 4108, CRLCC Henri-Becquerel, 1, rue d' Amiens, 76038 Rouen (France)

    2011-10-15

    The recent advances in medical imaging have profoundly altered the radiotherapy of non-small cell lung cancers (NSCLC). A meta-analysis has confirmed the superiority of FDG PET-CT over CT for initial staging. FDG PET-CT improves the reproducibility of target volume delineation, especially close to the mediastinum or in the presence of atelectasis. Although not formally validated by a randomized trial, the reduction of the mediastinal target volume, by restricting the irradiation to FDG-avid nodes, is widely accepted. The optimal method of delineation still remains to be defined. The role of FDGPET-CT in monitoring tumor response during radiotherapy is under investigation, potentially opening the way to adapting the treatment modalities to tumor radiation sensitivity. Other tracers, such as F-miso (hypoxia), are also under clinical investigation. To avoid excessive delays, the integration of PET-CT in routine practice requires quick access to the imaging equipment, technical support (fusion and image processing) and multidisciplinary delineation of target volumes. (authors)

  2. Usefulness of {sup 18}FDG-PET in epilepsy. Methods and indications; Utilite de la TEP au {sup 18}FDG dans l'epilepsie. Methodes et indications

    Energy Technology Data Exchange (ETDEWEB)

    Chassoux, F. [Centre hospitalier Sainte-Anne, 1, rue Cabanis, 75014 Paris, (France); Service hospitalier Frederic-Joliot, I2BM-CEA, 4, place du General Leclerc, 91401 Orsay cedex, (France)

    2009-05-15

    Positron emission tomography (PET) using 18-fluorodeoxyglucose ({sup 18}FDG) is currently used in pre surgical work-up for drug-resistant partial epilepsies in children as in adults, in addition to MRI. Recent cameras with less than 5 mm spatial resolution allow to obtain thin slices (about 2 mm thickness) in 3D planes. {sup 18}FDG is intravenously injected at the mean dose of 3 MBq/kg of body weight in inter-ictal and resting state, in a quiet, dimly lit environment and careful monitoring for head movements and ictal events. In children, sedation may be necessary. Image acquisition starts 30 min after injection and ended 15 to 20 min later. Semiquantitative analysis is visually assessed in clinical practice using colour scales. PET sensibility is improved by superimposition of metabolic imaging on MRI. Statistical analysis with S.P.M. may be useful but comparison with health subjects database is required. In medial temporal lobe epilepsy associated with hippocampal sclerosis, hypo metabolism ipsilateral to the epileptogenic focus is found in 70 to 90% of the cases and is predictive of surgical outcome. In other types of temporal and extra temporal epilepsy with negative MRI, focal hypo metabolism can be detected, allowing identification of minor gyral abnormalities corresponding to focal cortical dysplasia. In such MRI negative cases, PET findings may improve surgical outcome. (author)

  3. Assessment of suspected infection of hip or knee endoprosthesis by nuclear medicine techniques; Nuklearmedizinische Abklaerung bei vermuteter Infektion einer Hueft- oder Knie-TEP

    Energy Technology Data Exchange (ETDEWEB)

    Schmidt, M.; Dietlein, M.; Schicha, H. [Koeln Univ. (Germany). Klinik und Poliklinik fuer Nuklearmedizin; Delank, K.S. [Koeln Univ. (Germany). Klinik und Poliklinik fuer Orthopaedie

    2007-06-15

    Complications after hip endoprosthesis operation occur with a frequency of 1-2 % after primary operation and with 3-5 % after revision arthroplasty and are even more frequent after knee arthroplasty. The differentiation between aseptic loosening and bacterial infection is very important. In aseptic loosening a one-step revision is usually possible. In case of bacterial infection, all foreign material has to be removed first to allow cure from the infection. After healing and absence of bacteria a follow-up operation is possible with insertion of a new prosthesis. Diagnosis and therapy of a painful hip or knee endoprosthesis are difficult, because patient history, clinical examination, laboratory results including microbiological investigation of puncture material and results of radiological examinations may all be inconclusive. Quite a number of nuclear medicine procedures have been published in the past to help in the differentiation between aseptic loosening and bacterial infection of a painful hip or knee endoprosthesis. No single method can be regarded as excellent and without disadvantages. In the international literature the combined leucocyte-marrow imaging has been propageted as superior technique. In Germany, combined leucocyte-marrow imaging is not available in the published form. Moreover, this technique is time consuming, cost intensive and requires direct work with blood. Therefore, infection imaging with labelled antibodies or labelled fragments of antibodies may be regarded as the method of choice for most nuclear medicine physicians. With semiquantitative evaluation a comparative diagnostic accuracy may be achieved. {sup 18}F-FDG-PET is not able to differentiate reliably between abacterial polyethylene abrasion and septic inflammation. However, with pattern recognition of the distribution of {sup 18}F-FDG around a hip prosthesis an approach with clinically acceptable results has been published. A normal {sup 18}F-FDG-PET can reliably exclude an infection. Concerning knee prostheses such a differentiation with the help of {sup 18}F-FDG pattern recognition has not been successful so far. Therefore, in knee endoprosthesis labelled antibodies or labelled fragments of antibodies may be regarded as the method of choice for most nuclear medicine physicians. It may be regarded as somehow disappointing that a basically attractive approach with {sup 99m}Tc-ciprofloxacine has not fulfilled the expectations of excellent discrimination between prosthetic loosening and septic inflammation. No single diagnostic procedure in nuclear medicine is able to detect bacterial infection in a direct manner. Therefore, it is important to know the limitations of the diagnostic methods in nuclear medicine. (orig.)

  4. Workstation studies and radiological zoning in a temporary PET/CT installation; Etudes de poste et zonage radiologique dans une installation provisoire TEP/TDM

    Energy Technology Data Exchange (ETDEWEB)

    Vrigneaud, J.M.; Lombardo, J.; Hassoun, S.; Riu, J.L.; Leguludec, D. [Service de Medecine Nucleaire, groupe hospitalier Bichat-Claude Bernard, AP-HP, 46, rue Henri Huchard, 75877 Paris Cedex 18 (France); Hassoun, S. [Service de Pharmacie, unite de Radiopharmacie, groupe hospitalier Bichat-Claude (France)

    2008-07-01

    Within the frame of a complete restructuring of the 'Hopital Bichat' nuclear medicine department, a temporary building will host the high energy activity (PET/CT, Positron emission tomography - computed tomography) during these restructuring works. The authors summarize the study performed in terms of radioprotection, dose rate and dose. A radiological zoning has been defined and the different circulations (personnel, patients, wastes, medicines, supplies, and so on) have been optimized. A risk predictive analysis has also been performed

  5. Question: in a service including a radio pharmacy, a TEP scan unit and five classical examination rooms, what is the most irradiating post?

    International Nuclear Information System (INIS)

    Costes, M.; Madrid, A.; Rasp, N.

    2007-01-01

    The first results give the radio pharmacy as the most irradiating post with a non negligible dosimetry at extremities and not the PET one as it was first supposed. These dosimetry studies allow to optimize the daily practices and lead to a more rigorous follow up of the personnel dosimetry. (N.C.)

  6. A New Proposal for Learning Curve of TEP Inguinal Hernia Repair: Ability to Complete Operation Endoscopically as a First Phase of Learning Curve

    Directory of Open Access Journals (Sweden)

    Mustafa Hasbahceci

    2014-01-01

    Full Text Available Background. The exact nature of learning curve of totally extraperitoneal inguinal hernia and the number required to master this technique remain controversial. Patients and Methods. We present a retrospective review of a single surgeon experience on patients who underwent totally extraperitoneal inguinal hernia repair. Results. There were 42 hernias (22 left- and 20 right-sided in 39 patients with a mean age of 48.8±15.1 years. Indirect, direct, and combined hernias were present in 18, 12, and 12 cases, respectively. The mean operative time was 55.1±22.8 minutes. Peritoneal injury occurred in 9 cases (21.4%. Conversion to open surgery was necessitated in 7 cases (16.7%. After grouping of all patients into two groups as cases between 1–21 and 22–42, it was seen that the majority of peritoneal injuries (7 out of 9, 77.8%, P=0.130 and all conversions (P=0.001 occurred in the first 21 cases. Conclusions. Learning curve of totally extraperitoneal inguinal hernia repair can be divided into two consequent steps: immediate and late. At least 20 operations are required for gaining anatomical knowledge and surgical pitfalls based on the ability to perform this operation without conversion during immediate phase.

  7. PET in malformations of cortical development; La tomographie d'emission de positons (TEP) dans les malformations corticales de developpement

    Energy Technology Data Exchange (ETDEWEB)

    Bouilleret, V.; O' Brien, T.J. [Department of medicine, the Royal Melbourne Hospital, Royal Parade, Parkville, 3005 Victoria (Australia); Bouilleret, V. [Unite de neurophysiologie clinique et d' epileptologie, AP-HP, CHU Bicetre, 94275 Paris (France); Bouilleret, V.; Chiron, C. [Service hospitalier Frederic-Joliot, DRM, CEA, 4, place du General-Leclerc, 91401 Orsay cedex (France); Chiron, C. [Inserm U663, AP-HP, hopital Necker, 75015 Paris (France); University Paris-Descartes, 11, rue Pierre-et-Marie-Curie, 75005 Paris (France)

    2009-01-15

    Within the group of malformations of cortical development, focal cortical dysplasia (FCD) are an increasingly recognized cause of intractable epilepsy that can be cured by surgery. The success of cortical resection for intractable epilepsy is highly dependent on the accurate pre-surgical delineation of the regions responsible for generating seizures. [{sup 18}F]-FDG PET, which images cerebral metabolism studying brain glucose uptake, is the most established functional imaging modality in the evaluation of patients with epilepsy. The aim of this article is to review [{sup 18}F]-FDG PET usefulness as a pre-surgical tool in the evaluation of medically refractory partial epilepsy. It has an established place in assisting in the localisation and definition of FCD in patients with no lesion, or only a subtle abnormality, on MRI. The role of FDG-PET in defining the extent of the surgical resection is still uncertain and needs to be the focus of future research. (authors)

  8. F.D.G.-PET scanning in managing patients with lymphoma; La place de la TEP au FDG dans l'evaluation des lymphomes

    Energy Technology Data Exchange (ETDEWEB)

    Bodet-Milin, C.; Kraeber-Bodere, F. [CHU de Nantes, Service de Medecine Nucleaire, Hotel-Dieu, 44 - Nantes (France); Salaun, P.Y. [CHU de Brest, Service de Medecine Nucleaire, 29 - Brest (France); Crespin, C.; Vuillez, J.P. [CHU de Grenoble, Service de Medecine Nucleaire, 38 - Grenoble (France); Kraeber-Bodere, F. [Centre Rene-Gauducheau, Service de Medecine Nucleaire, 44 - Saint-Herblain (France); CRCNA, Inserm UMR 892, 44 - Nantes (France)

    2009-08-15

    The place of positron emission tomography (PET) in the evaluation of diffuse at big cells B lymphomas and hodgkin lymphomas is validated. The clinical impact of the PET registered in end of therapy development is indisputable. recommendations must be followed for images interpretation. The PET is strongly recommended during the first evaluation of the disease because it is a reference examination that makes easy the interpretation at the end of the therapy and allows to evaluate the extension of the disease with a sensitivity and a specificity superior to the computerized tomography. the prognosis value of intermediate evaluations appears certain in the diffuse at big cells B lymphomas and the hodgkin lymphomas but the impact of an early therapy change induced by PET is still to determine. The criteria of interpretation of early evaluations are to standardize. for the other types of lymphomas, the PET can have an interest to confirm the the localized stages, especially for the follicular lymphomas and direct the biopsy for a patient ill of a low range lymphoma suspect of aggressive change. (N.C.)

  9. Hybrid imaging (SPECT/CT, PET/CT) in differentiated thyroid cancer; Imagerie hybride (TEMP/TDM, TEP/TDM) et cancer differencie de la thyroide

    Energy Technology Data Exchange (ETDEWEB)

    Bardet, S.; Ciappuccini, R.; Aide, N. [Unite de concertation pluridisciplinaire thyroide, service de medecine nucleaire, centre Francois-Baclesse, 14 - Caen (France); Barraux, V. [Unite de radiophysique, centre Francois-Baclesse, 14 - Caen (France); Rame, J.P. [Chirurgie ORL, centre Francois-Baclesse, 14 - Caen (France)

    2010-08-15

    Differentiated thyroid cancer (DTC) is generally associated with a good prognosis. Local recurrences, mainly lymph-node involvement, account for 15-20% of cases and are surgically treated. Distant metastases, mostly in lungs and more rarely in bones, are present in 5% of patients. When iodine uptake is sufficient (in approximately 60% of patients), distant metastases can be destroyed by iterative activities of iodine 131. Serum thyroglobulin (Tg), which can be assessed either on hormonal treatment or on TSH stimulation is considered as the tumour marker in DTC. Functional (iodine 131 scintigraphy, FDG PET, bone scintigraphy) or anatomical (neck ultrasound, thoracic CT, bone MRI) imaging methods can be performed when Tg increases in order to show residual/recurrent disease. In recent years, new hybrid equipments integrating both a gamma camera and CT scan (SPECT/CT) have been commercialized while positron emission tomography cameras associated with CT (PET/CT) have been installed on the whole French territory. These equipments, which allow us to directly correlate functional and anatomical images, greatly improve the interpretation of planar scintigraphy or that of PET alone. Hybrid imaging enables us to precisely localize scintigraphic foci and most often, to immediately verify whether they correspond to tumour lesions. The aim of this article is to review the role of SPECT/CT and PET/CT in the management of patients with DTC in 2010. (authors)

  10. Use of lasilix to explore pelvis pathologies in F.D.G. PET; Utilisation du lasilix pour l'exploration des pathologies pelviennes en TEP au FDG

    Energy Technology Data Exchange (ETDEWEB)

    Bruna-Muraille, C.; Papathanassiou, D.; Cuif-Job, A.; Moussa-Bouharati, K.; Guedec-Ghelfi, R.; Liehn, J.C. [Institut Jean-Godinot, 51 - Reims (France)

    2010-07-01

    Purpose: F.D.G. accumulations in ureters and bladder can be annoying to interpret PET examinations in case of pelvis pathology, especially for uterine cervix tumors and for some ganglions localizations. The aim of this study was to confirm that the injection of furosemide before F.D.G. scintigraphy leads to a noticed concentration reduction of the tracer in urine, what can allow a better analysis of pelvis pathology and to evaluate the possibility of using this technique in practice. Conclusions: the Lasilix injection before a PET with F.D.G. in patients suffering of a pelvis pathology allows a noticed reduction of urine intensity, making easier the interpretation for a number of pelvic disorders. however, on 26 studied patients, 3 presented urged incontinence during examination, that poses a limitation of the technique and requires the selection, when a prior medical examination, of patients susceptible to receive this protocol. (N.C.)

  11. Non-oncological positron emission tomography (PET): brain imaging; La tomographie par emission de positons (TEP) hors oncologie: l'exploration du cerveau

    Energy Technology Data Exchange (ETDEWEB)

    Lomena, F. [Centro de Diagnostico por la imagen (CDIC), Hospital Clinic, Servicio de medicina nuclear, Barcelona (Spain)

    2008-10-15

    Positron emission tomography (PET) allows evaluation of the central nervous system function. Imaging of regional cerebral blood flow and metabolism, and of several neurotransmission systems may be obtained using PET. PET quantification is accurate and has good test-retest reliability. For research purposes, PET has been used to study brain physiology, to explore neurological and psychiatric diseases pathophysiology and for the new drugs research and development. F.D.G. is the only PET radioligand with clinical application. Following criteria of evidence-based medicine, the clinical indications of F.D.G.-PET are: evaluation of treated gliomas, pre surgical study of partial refractory epilepsy and diagnosis of Alzheimer's disease when it is impossible to differentiate clinically from fronto-temporal dementia.

  12. The deep cerebral stimulation of the under thalamic nucleus modifies the cerebral metabolism in {sup 18}FDG-Tep of obsessive compulsive patients; La stimulation cerebrale profonde du noyau sous thalamique modifie le metabolisme cerebral en 18FDG-TEP des patients obsessionnels compulsifs

    Energy Technology Data Exchange (ETDEWEB)

    Le Jeune, F.; Garin, E. [Service de medecine nucleaire, centre Eugene-Marquis, Rennes, (France); Verin, M.; Peron, J. [service de neurologie, CHU Pontchaillou, Rennes, (France); Mallet, L.; Yelnik, J. [Inserm, Avenir Team, Behavior, Emotion and Basal Ganglia, IFR 70, Pitie-Salpetriere, Paris, (France); Kreps, M.O. [Inserm U796, service de psychiatrie, hopital Sainte-Anne, Paris, (France); Drapier, D.; Millet, B. [service de psychiatrie adulte, centre hospitalier Guillaume-Regnier, Rennes, (France)

    2009-05-15

    The aim of this work was to find again this orbito-frontal hyper metabolism among the resistant obsessive compulsive disorder patients that are going to benefit of a deep cerebral stimulation of the under thalamus nucleus and to demonstrate that this new therapy approach leads a reduction of the metabolism in this area in correlation with the clinical improvement. It is about the first study realized in isotopic functional imaging on ten resistant compulsive disorder patients treated by bilateral deep cerebral stimulation of the under thalamus nucleus. It shows that the treatment efficiency is in relation with a reduction of the glucide metabolism in the right orbito-frontal cortex. It suggests equally that the under thalamus nucleus would be functionally linked to the orbito-frontal cortex. (N.C.)

  13. Variable production of transparent exopolymeric particles by haploid and diploid life stages of coccolithophores grown under different CO2 concentrations

    NARCIS (Netherlands)

    Pedrotti, M.L.; Fiorini, S.; Kerros, M.E.; Middelburg, J.J.; Gattuso, J.P.

    2012-01-01

    The production of transparent exopolymeric particles (TEP) by the coccolithophores, Emiliania huxleyi, Calcidiscus leptoporus and Syracosphaera pulchra was investigated in batch cultures. The abundance, size spectra and carbon content of TEP were examined during the exponential growth phase of both

  14. Optimization of Nano-TiO Photocatalytic Reactor for Organophosphorus Degradation

    Directory of Open Access Journals (Sweden)

    Ilin Sadeghi

    2012-01-01

    Full Text Available The photocatalytic decontamination of triethyl phosphate (TEP is studied by the UV/nano-TiO2 process. The nano-TiO2 concentration and pH value for the complete oxidation of TEP were investigated in different concentrations of TEP. The kinetic reaction was calculated for TEP as a function of initial concentration of TEP. Results of adsorptions showed that TEP was adsorbed better in alkalinity pH, and the natural pH had the highest reaction rate for complete degradation. Also, the zero-kinetic order with the lag time as a function of initial concentration of TEP and TiO2 was suggested for oxidation of TEP. The optimized concentration of nano-TiO2 was 400 mg/lit which had the best conversion and the lowest lag time in the reaction.

  15. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TGVTC Sbjct: 1 ... PNDLIRQAVAAEQAGFDFVEISDHFHPWLDNQGHSPFAWSVLGAIAARTERIGLATGVTC 60 ... Query: 134 IIRLLWQGGYRSYEGKYLQLSDARIFD...LPETPPVIXXXXXXXXXXXXXXXXXXXXXXTEP 193 ... IIRLLWQGGYRSYEGKYLQLSDARIFDLPETPPVI ... ... ... TEP Sbjct: 121 IIRLLWQGGYRSYEGKYLQLSDARIFDLPETPPVIAVAAGGPAAARLAADLGDGLF

  16. Thermoelectric power measurements in liquid quenched amorphous alloys for FeZr and (FeCo)B

    International Nuclear Information System (INIS)

    Raza, S.M.; Naqvi, S.M.M.R.; Rizvi, S.; Hussain, A.; Rahman, F.

    1999-01-01

    Thermoelectric power (TEP) measurements have been carried out on six samples of LQA alloys from two different series, namely FeZr and Fe(Co)B, at relatively low temperatures. Thermoelectric power shows an overall Gaussian trend. The scattering centers are the major contributors to the residual TEP. Ziman theoretical model was used to estimate TEP. It was found that Ziman theory fails to account for quantitative TEP measurements at relatively low temperatures (77K< T<300K). (author)

  17. 40 CFR 158.660 - Nontarget plant protection data requirements table.

    Science.gov (United States)

    2010-07-01

    ... vigor R R R TEP 1, 2, 3, 7 850.4400850.5400 Aquatic plant growth (algal and aquatic vascular plant... CR CR TEP 1, 4, 5, 7 850.4150 Vegetative vigor CR CR CR TEP 1, 3, 4, 5, 7 850.4400850.5400 Aquatic... methods used to generate data must include the results of a successful confirmatory method trial by an...

  18. Vasculitis assessment with [{sup 18}F]F.D.G. positron emission tomography; Place de la tomographie par emission de positons (TEP) au [{sup 18}F]FDG dans l'exploration des vascularites

    Energy Technology Data Exchange (ETDEWEB)

    Liozon, E. [CHU Dupuytren, Services de Medecine Interne A, 87 - Limoges (France); Monteil, J. [CHU Dupuytren, Services de Medecine Nucleaire, 87 - Limoges (France)

    2008-10-15

    [{sup 18}F]fluorodeoxyglucose ({sup 18}F.D.G.) positron emission tomography (PET) is a noninvasive metabolic imaging modality that is well suited to the assessment of activity and extent of large vessel vasculitis, such as giant cell arteritis and Takayasu arteritis. PET could be more effective than magnetic resonance imaging in detecting the earliest stages of vascular wall inflammation. The visual grading of vascular [{sup 18}F]F.D.G. uptake makes it possible to discriminate arteritis from atherosclerosis, providing therefore high specificity. High sensitivity can be achieved provided scanning is performed during active inflammatory phase, preferably before starting corticosteroid treatment. Large scale prospective studies are needed to determine the exact value of PET imaging in assessing the large vessel vasculitis outcome and response to immunosuppressive treatment.

  19. Neurolymphomatosis of the sciatic nerve and F.D.G. PET: case report and review; Neurolymphomatose du nerf sciatique en TEP au FDG: a propos d'un cas et revue de la litterature

    Energy Technology Data Exchange (ETDEWEB)

    Bruna-Muraille, C.; Papathanassiou, D.; Cuif-Job, A.; Liehn, J.C. [Institut Jean-Godinot, Service de Medecine Nucleaire, 51 - Reims (France); Job, L. [CHU Robert-Debre, Service de Radiologie, 51 - Reims (France); Kolb, B.; Himberlin, C.; Delmer, A. [CHU Robert-Debre, Service d' Hematologie Clinique, 51 - Reims (France)

    2009-12-15

    We are reporting the case of a woman who has been suffering from sciatica for several months. A neurolymphomatosis of the sciatic nerve was found. In this report, we present the characteristics of this lesion in conventional imaging and in F.D.G. PET. (authors)

  20. Exploration of the S.A.P.H.O. syndrome: PET/CT with {sup 18}FNa vs planar osseous scintigraphy; Exploration du syndrome SAPHO: TEP/TDM au {sup 18}FNa vs scintigraphie osseuse planaire

    Energy Technology Data Exchange (ETDEWEB)

    Ben Ali, K.; Poisson, T.; Hayem, G.; Lebtahi, R.; Sarda-Mantel, L.; Burg, S.; Meyer, O.; Le Guludec, D. [Groupe hospitalier Bichat-Claude-Bernard, 75 - Paris (France)

    2010-07-01

    Our purpose was to study the interest of the PET/CT with {sup 18}FNa (F Na-PET/CT) in the assessment of the lesions synovitis acne pustulosis hyperostosis osteitis (S.A.P.H.O.) syndrome compared to bone planar scintigraphy with hydroxy-methylene diphosphonate (H.M.D.P.) labelled with {sup 99m}Tc. The preliminary results suggest an increase of sensitivity of the F Na-PET/CT compared to bone scintigraphy in the S.A.P.H.O. syndrome exploration ( particularly for the rachis injuries, tips and enthesopathies), without loss of specificity. (N.C.)

  1. Difficulties and aspects to take into account in the production, use and distribution of new radiopharmaceuticals PET; Difficultes et aspects a prendre en compte dans la production, l'utilisation et la distribution des nouveaux radiopharmaceutiques TEP

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez, R.; Rayo, J.I.; Serrano, J.; Infante, J.; Luz Dominguez, M.; Garcia, L.; Duran, C. [Hospital Infanta Cristina, Servicio de Medicina Nuclear, Badajoz (Spain)

    2008-10-15

    This article seeks to describe the requirements, legal and technical, for the production, distribution and use of new radiopharmaceuticals PET (other than the {sup 18}F.D.G.), describing the legislative framework in which we find ourselves, the characteristics of a production and types of synthesis and existing modules. A list of susceptible radiopharmaceuticals is presented that are being currently used in nuclear medicine by specifying the real possibilities of their production and use and which are the difficulties we face.

  2. Para neoplastic cataplexy: evolution of PET with [{sup 18}F] -F.D.G. imaging; Cataplexie paraneoplasique: evolution de l'imagerie TEP au [18F]-FDG

    Energy Technology Data Exchange (ETDEWEB)

    Farida, K.; Fernandez, P.; Guyot, M.; Jeandot, R.; Allard, M. [Service de medecine nucleaire, CHU de Bordeaux, (France); Sibon, I. [service de neurologie, CHU de Bordeaux, (France)

    2009-05-15

    Cataplexy is sudden and transient episode of loss of muscle tone, often triggered by emotions. We find it in the Gelineau disease but it can be constitutes an exceptional clinical expression of para-neoplasic syndromes. We report the evolution of the PET imaging for a patient during a para-neoplasic syndrome secondary to a testes teratoma associated to the presence of antibodies anti-Ma2. Different aspects of the {sup 18}F-F.D.G. fixation can be observed during the para-neoplasic syndromes affecting the central nervous system. Their values in term of prognosis and help to the therapy decision are still to define. (N.C.)

  3. Clinical signification of diffuse thyroid uptake on {sup 18}F-FDG PET-CT; Signification clinique des hyperfixations thyroidiennes diffuses du 18F-fluorodeoxyglucose en Morpho-TEP: a propos de 28 cas

    Energy Technology Data Exchange (ETDEWEB)

    Bruna, C.; Journo, A.; Netter, F.; Muller, M.A.; Olivier, P.; Karcher, G. [Centre Hospitalier Universitaire Nancy-Brabois, Service de Medecine Nucleaire, 54 - Vandoeuvre-les-Nancy (France)

    2007-03-15

    Aim and methods: This retrospective study, performed on 28 patients. gave us the opportunity to evaluate the interest of the description of diffuse thyroid uptake on {sup 18}F-FDG PET/CT. Indeed. this topic is rarely treated in the literature. The first aim of our study was to search for the previous history of thyroid disease of the patients for whom a diffuse uptake was reported. We also evaluated the ability of the procedure to help the diagnosis of unknown thyroid pathologies. Results: Eighteen patients out of 28 had previous history of thyroid disease: most of them were already treated. For the other 10 patients. the FDG PET/CT allowed the detection of two chronic thyroiditis without biological abnormalities. one hypothyroidism and one hyperthyroidism. Five patients had normal thyroid biology and for an additional one, the diffuse uptake was probably in relation with a known lymphoma. Conclusion: This study confirms that the majority of patients with diffuse thyroid uptake of {sup 18}F-FDG are related to previously known chronic thyroiditis, Basedow disease or goiter. Only one case was in relation with a neoplastic pathology (lymphoma). When patients have no previous thyroid disease, biology should be performed to detect a hypo- or hyperthyroidism, which could require a treatment. These results should be confirmed in a prospective way. (authors)

  4. Brain imaging and memory systems in humans: the contribution of PET methods; Imagerie cerebrale et systeme de memoire chez l'homme: contribution de l'analyse par TEP

    Energy Technology Data Exchange (ETDEWEB)

    Perani, D. [Institute of Neuroscience and Bioimaging CNR, Milan (Italy)

    1998-03-01

    The development of neuroimaging methods such as PET, has provided a new impulse to the study of the neural basis of cognitive functions, and has extended the field of inquiry from the analysis of the consequences of brain lesions to the functional investigations of brain activity, either in patients with selective neuropsychological deficits or in normal subjects engaged in cognitive tasks. Specific patterns of hypo-metabolism in neurological patients are associated with different profiles of memory deficits.[{sup 18}F]FDG PET studies have confirmed the association of episodic memory with the structures of Papez's circuit and have shown correlations between short-term and semantic memory and the language areas. The identification of anatomical-functional networks involved in specific components of memory function in normal subjects is the aim of several PET activation studies. The results are in agreement with 'neural network' models of the neural basis of memory, as complex functions subserved by multiple interconnected cortical and subcortical structures. (author)

  5. Distribuce otěrových částic UHMWPE v periprotetických tkáních u TEP kyčelního kloubu

    Czech Academy of Sciences Publication Activity Database

    Pokorný, D.; Šlouf, Miroslav; Veselý, F.; Fulín, P.; Jahoda, D.; Sosna, A.; Běláček, J.; Landor, I.; Zolotarevova, E.; Popelka, S.

    2010-01-01

    Roč. 77, č. 2 (2010), s. 87-92 ISSN 0001-5415 R&D Projects: GA MŠk 2B06096 Institutional research plan: CEZ:AV0Z40500505 Keywords : total hip replacement * polyethylene wear * aseptic loosening Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.628, year: 2009 http://www.achot.cz/detail.php?stat=346

  6. Evaluation of the PET/CT with F.D.G. in the masculine fertility evaluation; Evaluation de la TEP/TDM au FDG dans l'evaluation de la fertilite masculine

    Energy Technology Data Exchange (ETDEWEB)

    Dierickx, L.O.; Zerdoud, S.; Brillouet, S.; Filleron, T.; Caselles, O. [Institut Claudius-Regaud, 31 - Toulouse (France); Huyghe, E.; Courbon, F. [Centre hospitalier universitaire de Rangeuil, 31 - Toulouse (France); Plante, P. [Centre hospitalier universitaire Paule de Viguier, 31 - Toulouse (France); Bujan, L.

    2010-07-01

    Purpose: the contribution of a functional imaging examination is expected by the andrology and urology community in the situations of masculine infertility (especially after chemotherapy). The spermatogonia, responsible of cells populations renewal, catch the F.D.G. tracer through GLUT3 receptors. To date, PET/CT with F.D.G. has never been used for functional study of testes with andrology aim. The objective is to search an eventual correlation between the F.D.G. testes uptake and spermatology examination. Conclusions: This preliminary study shows that among men without any known testes pathology, there is a significant correlation between the F.D.G. testes uptake and the principal parameters of masculine fertility. If these results are confirmed, clinical applications could appear in the diagnosis and prognosis exploration of hypo fertility. (N.C.)

  7. PET with {sup 18}F-F.D.G. in the diagnosis and the evolutionary follow up of solitary plasmocytomas; La TEP au {sup 18}F-FDG dans le diagnostic et le suivi evolutif des plasmocytomes solitaires

    Energy Technology Data Exchange (ETDEWEB)

    Adib, S.; Huglo, D.; Steinling, M. [Hopital Huriez, CHU de Lille, Service de medecine nucleaire, 59 (France); Leleu, X.; Robu, D. [Hopital Huriez, CHU de Lille, service des maladies du sang, 59 (France)

    2010-07-01

    Purpose: evaluate the contribution of PET with {sup 18}F-F.D.G. in the diagnostic assessment, post therapy evaluation and evolutionary follow-up of solitary plasmocytomas. Conclusions: the PET with {sup 18}F-F.D.G. seems to be an efficient diagnostic tool in the staging of solitary plasmocytomas and allows also to detect infra clinical injuries unknown by other imaging techniques. (N.C.)

  8. {sup 18}F-F.D.G. PET for staging and monitoring of solitary plasmocytomas;La TEP au {sup 18}F-FDG dans le diagnostic et le suivi evolutif des plasmocytomes solitaires

    Energy Technology Data Exchange (ETDEWEB)

    Adib, S.; Robua, D.; Huglo, D.; Steinling, M. [CHU de Lille, rue Michel-Polonovski, Service de medecine nucleaire, hopital Claude-Huriez, 59 - Lille (France); Robua, D.; Leleu, X. [CHU de Lille, rue Michel-Polonovski, Service des maladies du sang, hopital Claude-Huriez, 59 - Lille (France)

    2010-02-15

    Aim: To assess the role of [{sup 18}F]F.D.G.-PET in solitary plasmocytomas with regards to staging, therapeutic follow-up and monitoring. Patients and methods. Twenty consecutive patients were included in the present study when following conditions were met: (1) solitary plasmocytomas histologically confirmed (bone, n = 16; extramedullary, n = 4); (2) [{sup 18}F]F.D.G.-PET scan from July 2004 to April 2009. The clinical follow-up was over than 2 years for 13 patients. Ten patients underwent a post-therapy PET scan. PET scans were visually analysed. Results. PET scan enabled confirmation of all main lesions (sensitivity: 100%) and also detected infra-clinical lesions in eight cases. Follow-up for more than 2 years showed a progression disease into myeloma in five from six cases (83%) with infra clinical lesions at the baseline PET scan. Among 10 patients who underwent post-therapeutic PET scan, six experienced a complete response at the main lesion site and four experienced a partial response. Conclusion: F.D.G.-PET may play an important role in plasmocytomas staging and enables detection of smaller lesions (otherwise undetected). (authors)

  9. 2D and 3D multimodality cardiac imagery: application for the coronarography/SPECT/PET-CT; Imagerie cardiaque multimodalites 2D et 3D: application a la coronarographie/tomoscintigraphie/TEP-CT

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Hernandez, J.M

    2006-06-15

    Coronarography and tomo-scintigraphy (SPECT, Single Photon Emission Tomography) are two imaging techniques used broadly for the diagnosis of cardiovascular diseases. The first modality consists of X-ray image sequences visualizing each, in a same plane, the coronary arteries located on the front and the back side of the heart. The X-ray images give anatomical information relating to the arterial tree and highlight eventual artery narrowing (stenoses). The SPECT modality (nuclear imaging) provide a 3-dimensional (3D) representation of the myocardial volume perfusion. This functional information authorizes the visualization of myocardial regions suffering from irrigation defaults. The aim of the presented work is to superimpose (in the 3D space) the functional and anatomical information in order to establish the visual link between arterial lesions and their consequence in terms of irrigation defaults. In the 3D representation chosen to facilitate the diagnosis, the structure of a schematic arterial tree and the stenoses are placed onto the perfusion volume. The initial data consist of a list of points representative for the arterial tree (start and end points of arterial segments, bifurcations, stenoses, etc) and marked by coronary-graphs on the X-ray images of the different incidences. The perfusion volume is then projected under the incidences of the coronary-graphic images. A registration algorithm superimposing the X-ray images and the corresponding SPECT projections provides the parameters of the geometrical transformations bringing the points marked in the X rays images in equivalent positions in the 2-dimensional SPECT images. A 3D reconstruction algorithm is then used to place the arterial points and the stenoses on the perfusion volume and build a schematic tree acting as landmark for the clinician. A 28 patient database was used to realize 40 3D superimposition of anatomical-functional data. These reconstructions have shown that the 3D representation is precise enough for the establishment of the visual relationship between stenoses and perfusion defaults. (author)

  10. Interests of the PET with 18-F.D.G. in infectious pathology: about a case of systemic candidiasis; Interets de la TEP au 18-FDG en pathologie infectieuse: a propos d'un cas de candidose systemique

    Energy Technology Data Exchange (ETDEWEB)

    Avet, J.; Granjon, D.; Prevot, N.; Isnardi, V.; Dubois, F. [Service de medecine nucleaire, CHU de Saint-etienne, (France); Stephan, J.L.; Berger, C. [service de pediatrie, CHU de Saint-etienne, (France)

    2009-05-15

    We report the interest of the PET with {sup 18}F-F.D.G. in the extension evaluation of injuries and in the therapy decision for a patient suffering of a systemic candida. Conclusions: In spite of a lack of recommendations, because of its great sensitivity for the deep infectious centres detection, the PET with {sup 18}F-F.D.G. can bring useful information to the management and follow up of the systemic infections. (N.C.)

  11. {sup 18}F-F.D.G. PET imaging of infection and inflammation: intestinal, prosthesis replacements, fibrosis, sarcoidosis, tuberculosis..; La TEP au {sup 18}F-FDG dans la pathologie inflammatoire et infectieuse: intestinale, prothetique, fibrose, sarcoidose, tuberculose..

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez, A.; Cortes, M.; Caresia, A.P.; Juan, R. de; Vidaller, A.; Mana, J.; Martinez-Yelamos, S.; Gamez, C. [Hospital Universitari de Bellvitge, Service TEP-Centre IDI, Services de Medecine Interne, Barcelone (Spain)

    2008-10-15

    Nuclear medicine plays an important role in the evaluation of infection and inflammation. A variety of diagnostic methods are available for imaging this inflammation and infection, most notably computed tomography, {sup 68}Ga scintigraphy or radionuclide labeled leucocytes. Fluorine 18 fluorodeoxyglucose ({sup 18}F-F.D.G.) is a readily available radiotracer that offers rapid, exquisitely sensitive high-resolution images by positron emission tomography (PET). Inflammation can be acute or chronic, the former showing predominantly neutrophilic granulocyte infiltrates, whereas in the latter, macrophages predominate. F.D.G. uptake in infection is based on the fact that mononuclear cells and granulocytes use large quantities of glucose by way of the hexose monophosphate shunts. {sup 18}F-F.D.G. PET accurately helps diagnose spinal osteomyelitis, diabetic foot and in inflammatory conditions such as sarcoidosis and tuberculosis.(it appears to be useful for defining the extent of disease and monitoring response to treatment). {sup 18}F-F.D.G. PET can also help localize the source of fever of undetermined origin, thereby guiding additional testing. {sup 18}F-F.D.G. PET may be of limited usefulness in postoperative patients and in patients with a failed joint prosthesis or bowel inflammatory disease. In this review, we will focus on the role of {sup 18}F-F.D.G. PET in the management of patients with inflammation or suspected or confirmed infection.

  12. Host plants of Carambola fruit fly, Bactrocera carambolae Drew & Hancock(Diptera:Tephritidae);and provisional list of suitable host plants of Carambola fruit fly,(Bactrocera(Bactrocera) carambolae Drew & Hancock(Diptera:Tep

    Science.gov (United States)

    Bactrocera carambolae Drew & Hancock (Diptera: Tephritidae), commonly known as the carambola fruit fly, is native to Southeast Asia, but has extended its geographic range to several countries in South America. As with other tephritid fruit fly species, establishment of B.carambolae in areas where it...

  13. Synchronization modulation increases transepithelial potentials in MDCK monolayers through Na/K pumps.

    Directory of Open Access Journals (Sweden)

    Vu Tran

    Full Text Available Transepithelial potential (TEP is the voltage across a polarized epithelium. In epithelia that have active transport functions, the force for transmembrane flux of an ion is dictated by the electrochemical gradient in which TEP plays an essential role. In epithelial injury, disruption of the epithelial barrier collapses the TEP at the wound edge, resulting in the establishment of an endogenous wound electric field (∼100 mV/mm that is directed towards the center of the wound. This endogenous electric field is implicated to enhance wound healing by guiding cell migration. We thus seek techniques to enhance the TEP, which may increase the wound electric fields and enhance wound healing. We report a novel technique, termed synchronization modulation (SM using a train of electric pulses to synchronize the Na/K pump activity, and then modulating the pumping cycles to increase the efficiency of the Na/K pumps. Kidney epithelial monolayers (MDCK cells maintain a stable TEP and transepithelial resistance (TER. SM significantly increased TEP over four fold. Either ouabain or digoxin, which block Na/K pump, abolished SM-induced TEP increases. In addition to the pump activity, basolateral distribution of Na/K pumps is essential for an increase in TEP. Our study for the first time developed an electrical approach to significantly increase the TEP. This technique targeting the Na/K pump may be used to modulate TEP, and may have implication in wound healing and in diseases where TEP needs to be modulated.

  14. Seagrass as major source of transparent exopolymer particles in the oligotrophic Mediterranean coast

    KAUST Repository

    Iuculano, Francesca

    2017-01-09

    The role of seagrass, Posidonia oceanica, meadows as a source of transparent exopolymer particles (TEP) to Mediterranean coastal waters was tested by comparing the TEP dynamics in two adjacent coastal waters in the oligotrophic NW Mediterranean Sea, one characterized by oligotrophic open-sea waters and the other accumulating seagrass leaf litter, together with an experimental examination of TEP release by seagrass litter. TEP concentrations ranged from 4.6 µg XG Eq L−1 to 90.6 µg XG Eq L−1, with mean (±SE) values of 38.7 (±2.02) µg XG Eq L−1 in the site devoid of seagrass litter, whereas the coastal beach site accumulating leaf litter had > 10-fold mean TEP concentrations of 487.02 (±72.8) µg XG Eq L−1 . Experimental evaluation confirmed high rates of TEP production by P. oceanica litter, allowing calculations of the associated TEP yield. We demonstrated that P. oceanica is an important source of TEP to the Mediterranean Sea, contributing an estimated 0.10 Tg C as TEP annually. TEP release by P. oceanica seagrass explains the elevated TEP concentration relative to the low chlorophyll a concentration in the Mediterranean Sea.

  15. Analysis of Thioester-Containing Proteins during the Innate Immune Response of Drosophila melanogaster

    Science.gov (United States)

    Bou Aoun, Richard; Hetru, Charles; Troxler, Laurent; Doucet, Daniel; Ferrandon, Dominique; Matt, Nicolas

    2010-01-01

    Thioester-containing proteins (TEPs) are conserved proteins among insects that are thought to be involved in innate immunity. In Drosophila, the Tep family is composed of 6 genes named Tep1–Tep6. In this study, we investigated the phylogeny, expression pattern and roles of these genes in the host defense of Drosophila. Protostomian Tep genes are clustered in 3 distinct branches, 1 of which is specific to mosquitoes. Most D. melanogaster Tep genes are expressed in hemocytes, can be induced in the fat body, and are expressed in specific regions of the hypodermis. This expression pattern is consistent with a role in innate immunity. However, we find that TEP1, TEP2, and TEP4 are not strictly required in the body cavity to fight several bacterial and fungal infections. One possibility is that Drosophila TEPs act redundantly or that their absence can be compensated by other components of the immune response. TEPs may thus provide a subtle selective advantage during evolution. Alternatively, they may be required in host defense against specific as yet unidentified natural pathogens of Drosophila. PMID:21063077

  16. Software for automated evaluation of technical and economic performance factors of nuclear power plant units

    International Nuclear Information System (INIS)

    Cvan, M.; Zadrazil, J.; Barnak, M.

    1989-01-01

    Computer codes TEP V2, TEP EDU and TEP V1 are used especially in real-time evaluation of technical and economic performance factors of the power unit. Their basic functions include filtration of credibility of input data obtained by measurement, simultaneous calculation of flows of various types of energy, calculation of technical and economic factors, listings and filing of the results. Code ZMEK is designed for executing changes in the calculation constants file for codes TEP V2 and TEP EDU. Code TEP DEN is used in processing the complete daily report on the technical and economic performance factors of the unit. Briefly described are the basic algorithms of credibility filtration for the measured quantities, the methodology of fundamental balances and the method of guaranteeing the continuity of measurement. Experiences are given with the use of the codes, and the trends are outlined of their future development. (J.B.). 5 refs

  17. Geometric phase and quantum interference in photosynthetic reaction center: Regulation of electron transfer

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Yuming, E-mail: ymsun@ytu.edu.cn; Su, Yuehua; Dai, Zhenhong; Wang, WeiTian

    2016-10-20

    Photosynthesis is driven by electron transfer in reaction centers in which the functional unit is composed of several simple molecules C{sub 2}-symmetrically arranged into two branches. In view of quantum mechanism, both branches are possible pathways traversed by the transferred electron. Due to different evolution of spin state along two pathways in transmembrane electric potential (TEP), quantum state of the transferred electron at the bridged site acquires a geometric phase difference dependent on TEP, the most efficient electron transport takes place in a specific range of TEP beyond which electron transfer is dramatically suppressed. What’s more, reaction center acts like elaborately designed quantum device preparing polarized spin dependent on TEP for the transferred electron to regulate the reduction potential at bridged site. In brief, electron transfer generates the TEP, reversely, TEP modulates the efficiency of electron transfer. This may be an important approach to maintaining an appreciable pH environment in photosynthesis.

  18. Regulatory challenges for autologous tissue engineered products on their way from bench to bedside in Europe.

    Science.gov (United States)

    Ram-Liebig, Gouya; Bednarz, Juergen; Stuerzebecher, Burkard; Fahlenkamp, Dirk; Barbagli, Guido; Romano, Giuseppe; Balsmeyer, Ulf; Spiegeler, Maria-Elsa; Liebig, Soeren; Knispel, Helmut

    2015-03-01

    Since the late eighties of last century the high potential of tissue engineered products (TEP)s has been shown for the treatment of various diseases and many scientific publications appeared in this field. However, only few products reached the market since. Development of TEPs is a promising but owing to its novelty a very challenging task that requires experts in this still developing field as well as ample financial resources. This paper summarises relevant regulatory challenges during quality, preclinical and clinical development of autologous TEPs in Europe. Selected strategies on how to manage major issues are presented, together with some examples from the development of an autologous TEP for urethroplasty. Considering these aspects may help other investigators with potential strategies during the development of novel TEPs. Copyright © 2014 Elsevier B.V. All rights reserved.

  19. Preperitoneal Surgery Using a Self-Adhesive Mesh for Inguinal Hernia Repair

    OpenAIRE

    Mangram, Alicia; Oguntodu, Olakunle F.; Rodriguez, Francisco; Rassadi, Roozbeh; Haley, Michael; Shively, Cynthia J.; Dzandu, James K.

    2014-01-01

    Background and Objectives: Laparoscopic preperitoneal hernia repair with mesh has been reported to result in improved patient outcomes. However, there are few published data on the use of a totally extraperitoneal (TEP) approach. The purpose of this study was to present our experience and evaluate early outcomes of TEP inguinal hernia repair with self-adhesive mesh. Methods: This cohort study was a retrospective review of patients who underwent laparoscopic TEP inguinal hernial repair from Ap...

  20. Reviewer Volume 27, Tahun 2007

    OpenAIRE

    Volume 27, Tahun 2007, Reviewer

    2007-01-01

    1. Abdul Rozaq, Dr., Ir., DAA Jurusan Teknik Pertanian (TEP), Fakultas Teknologi Pertanian (FTP), Universitas Gadjah Mada (UGM), Yogyakarta2. Bambang Purwantana, Ir., Dr., M.Agr. Jurusan TEP, FTP-UGM3. Chusnul Hidayat, Ir., Dr. Jurusan Teknologi Pangan dan Hasil Pertanian (TPHP), Fakultas Teknologi Pertanian (FTP), Universitas Gadjah Mada (UGM), Yogyakarta4. Haryadi, Ir., Dr., Prof., M. App. Sc. Jurusan TPHP, FTP-UGM5. Lilik Sutiarso, Ir., Dr., M. Eng. Jurusan TEP, FTP-UGM6. Pudji Hastuti, Ir...

  1. Spinal anesthesia is safe in laparoscopic total extraperitoneal inguinal hernia repair. A retrospective clinical trial.

    Science.gov (United States)

    Yildirim, Dogan; Hut, Adnan; Uzman, Sinan; Kocakusak, Ahmet; Demiryas, Suleyman; Cakir, Mikail; Tatar, Cihad

    2017-12-01

    Laparoscopic total extraperitoneal (TEP) inguinal hernia repair is an effective and safe method for the treatment of inguinal hernia. There are very few studies on regional anesthesia methods in TEP surgery. To compare TEP inguinal hernia repair performed when the patient was treated under spinal anesthesia (SA) with that performed under general anesthesia (GA). All total of 80 patients were studied between December 2015 and March 2017. Hyperbaric bupivacaine and fentanyl were used for SA, to achieve a sensorial level of T3. Propofol, sevoflurane, rocuronium, fentanyl, and tracheal intubation were used for GA. Intraoperative events related to SA, surgical times, intra- and postoperative complications, and pain scores were recorded. The mean operative time in the SA TEP group was 70.2 ±6.7 min, which was significantly longer than the mean operative time in the GA TEP group of 67.2 ±6.2 min (p < 0.038). The mean pain scores in the SA TEP group were 0.23 ±0.42 at the first hour, 1.83 ±0.64 at 6 h and 1.28 ±0.45 at 24 h. These scores were significantly lower than the corresponding scores of 5.18 ±0.84 (p < 0.001), 2.50 ±0.55 (p < 0.001) and 1.58 ±0.55 in the GA TEP group. Generally, patients were more satisfied with SA than GA (p < 0.004). Spinal anesthesia TEP is significantly less painful in the early postoperative period, leading to earlier ambulation than GA TEP. Additionally, SA TEP results in significantly less need for analgesics and better patient satisfaction results. SA TEP seems to be a better alternative than the existing GA TEP.

  2. 78 FR 74825 - Medicare and Medicaid Programs: Hospital Outpatient Prospective Payment and Ambulatory Surgical...

    Science.gov (United States)

    2013-12-10

    ... site to view public comments. Comments received timely will also be available for public inspection... Radiosurgery TEP Technical Expert Panel TMS Transcranial Magnetic Stimulation Therapy TOPs Transitional...

  3. Phytoplankton aggregate formation: observations of patterns and mechanisms of cell sticking and the significance of exopolymeric material

    DEFF Research Database (Denmark)

    Kiørboe, Thomas; Hansen, Jorgen L. S.

    1993-01-01

    are sticky in themselves, and coagulation depends on cell-cell sticking and does not involve mucus. Aggregates are composed solely of cells. Cells of the diatom Chaetoceros affinis, on the other hand, are not in themselves sticky. Transparent exopolymeric particles (TEP), produced by the diatom, cause...... the cells to aggregate and coagulation depends on TEP-cell rather than cell-cell sticking. Aggregates are formed of a mixture of mucus and cells. We found several species of diatoms and one flagellate species to produce copious amounts of TEP. TEP from some species (e.g. Coscinodiscus sp.) is sticky and may...

  4. Minilaparoscopic technique for inguinal hernia repair combining transabdominal pre-peritoneal and totally extraperitoneal approaches.

    Science.gov (United States)

    Carvalho, Gustavo L; Loureiro, Marcelo P; Bonin, Eduardo A; Claus, Christiano P; Silva, Frederico W; Cury, Antonio M; Fernandes, Flavio A M

    2012-01-01

    Endoscopic surgical repair of inguinal hernia is currently conducted using 2 techniques: the totally extraperitoneal (TEP) and the transabdominal (TAPP) hernia repair. The TEP procedure is technically advantageous, because of the use of no mesh fixation and the elimination of the peritoneal flap, leading to less postoperative pain and faster recovery. The drawback is that TEP is not performed as frequently, because of its complexity and longer learning curve. In this study, we propose a hybrid technique that could potentially become the gold standard of minimally invasive inguinal hernia surgery. This will be achieved by combining established advantages of TEP and TAPP associated with the precision and cosmetics of minilaparoscopy (MINI). Between January and July 2011, 22 patients were admitted for endoscopic inguinal hernia repair. The combined technique was initiated with TAPP inspection and direct visualization of a minilaparoscopic trocar dissection of the preperitoneum space. A10-mm trocar was then placed inside the previously dissected preperitoneal space, using the same umbilical TAPP skin incision. Minilaparoscopic retroperitoneal dissection was completed by TEP, and the surgical procedure was finalized with intraperitoneal review and correction of the preperitoneal work. The minilaparoscopic TEP-TAPP combined approach for inguinal hernia is feasible, safe, and allows a simple endoscopic repair. This is achieved by combining features and advantages of both TAPP and TEP techniques using precise and sophisticated MINI instruments. Minilaparoscopic preperitoneal dissection allows a faster and easier creation of the preperitoneal space for the TEP component of the procedure.

  5. Describing Physics Student Teachers' Orientations through Lesson Planning

    Science.gov (United States)

    Karal, Isik Saliha

    2017-01-01

    Recent educational reforms realized in teacher education programs (TEPs) and secondary physics syllabus were aimed at placing the learning and teaching approaches in a constructivist framework. For this reason, student teachers in pre-service TEPs are expected to develop orientations adopting student-centred teaching approaches. The purpose of…

  6. RNA-Seq of Tumor-Educated Platelets Enables Blood-Based Pan-Cancer, Multiclass, and Molecular Pathway Cancer Diagnostics

    NARCIS (Netherlands)

    Best, Myron G.; Sol, Nik; Kooi, Irsan; Tannous, Jihane; Westerman, Bart A.; Rustenburg, François; Schellen, Pepijn; Verschueren, Heleen; Post, Edward; Koster, Jan; Ylstra, Bauke; Ameziane, Najim; Dorsman, Josephine; Smit, Egbert F.; Verheul, Henk M.; Noske, David P.; Reijneveld, Jaap C.; Nilsson, R. Jonas A.; Tannous, Bakhos A.; Wesseling, Pieter; Wurdinger, Thomas

    2015-01-01

    Tumor-educated blood platelets (TEPs) are implicated as central players in the systemic and local responses to tumor growth, thereby altering their RNA profile. We determined the diagnostic potential of TEPs by mRNA sequencing of 283 platelet samples. We distinguished 228 patients with localized and

  7. Evaluating Teacher Preparation Using Graduates' Observational Ratings

    Science.gov (United States)

    Ronfeldt, Matthew; Campbell, Shanyce L.

    2016-01-01

    Despite growing calls for more accountability of teacher education programs (TEPs), there is little consensus about how to evaluate them. This study investigates the potential for using observational ratings of program completers to evaluate TEPs. Drawing on statewide data on almost 9,500 program completers, representing 44 providers (183…

  8. Evaluation of immunocompatibility of tissue-engineered periosteum

    Energy Technology Data Exchange (ETDEWEB)

    Zhao Lin; Wang Shuanke; Xia Yayi; Liu Jia; He Jing; Wang Xin [Orthopaedic Institute of the 2nd Hospital of Lanzhou University, 80 CuiYingMen, ChengGuan District, Lanzhou City, 730030 (China); Zhao Junli, E-mail: bonezl@qq.com [Department of Nephrology, the 2nd Hospital of Lanzhou University, 80 CuiYingMen, ChengGuan District, Lanzhou City, 730030 (China)

    2011-02-15

    Tissue-engineered periosteum (TEP) and 'intramembranous ossification' may be an alternative approach to bone tissue engineering. In the previous study we attained successful bone defect reparation with homemade TEP in an allogenic rabbit model. But its allogenic immunocompatibility remained unknown. In this study TEP was constructed by seeding osteogenically induced mesenchymal stem cells of rabbit onto porcine small intestinal submucosa (SIS). A mixed lymphocyte reaction (MLR) was applied to evaluate the in vitro immunogenicity. The ratio of CD4{sup +}/CD8{sup +} T-lymphocytes was tested kinetically to evaluate the systematic reaction of the TEP allograft, and a histological examination was performed to investigate local inflammation and ectopic osteogenesis. MLR indicated that TEP had a higher in vitro immunostimulation than SIS (p < 0.05). The ratios of CD4{sup +}/CD8{sup +} lymphocytes increased in both TEP and SIS implanted groups in 2 weeks, followed by a decrease to a normal level from 2 to 4 weeks. Histological examination revealed modest lymphocyte infiltration for no more than 2 weeks. Moreover, subcutaneous ectopic ossification was observed in TEP allograft animals (8/12). Our findings imply that TEP has a certain immune reaction for the allograft, but it is not severe enough to impact osteogenesis in the allogenic rabbit model.

  9. Optimum transmission system expansion offshore considering renewable energy sources

    NARCIS (Netherlands)

    Torbaghan, Shahab S.; Gibescu, Madeleine

    2017-01-01

    This chapter provides an overview of transmission expansion planning (TEP) methods and their practical application. First, it discusses the strategic importance of the transmission system. Next, it describes the reasons why TEP remains a challenge for systems with a large share of renewable energy.

  10. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Bacterial abundance and production, numbers, sizes and concentrations of transparent exopolymer particles (TEP) and total organic carbon (TOC) were measured during the 1996 summer monsoon to understand the relationship between TEP, the most labile particulate organic carbon, and bacteria. While high regional ...

  11. Measurement of thermoelectric power of Fe-Cu binary alloys

    International Nuclear Information System (INIS)

    Joubouji, Katsuo

    2007-01-01

    In INSS, non-destructive evaluation (NDE) of irradiation embrittlement of low alloy steel using thermoelectric power (TEP) measurement has been considered, as well as NDE of thermal aging of cast duplex stainless steel which has been studied in recent years. Material degradation is evaluated based on a relation between progress of the degradation and change in TEP due to change in material structure caused by the degradation event. So it is necessary for NDE of irradiation embrittlement to measure the change in TEP due to precipitation of Cu contained as an impurity, which is known as one of the reasons for the embrittlement. In this study, TEP of Fe-Cu binary alloys with different Cu content was measured for investigation of the relationship between TEP of the alloys and Cu content. In addition, appropriateness of measuring TEP of Fe-Cu binary alloy in the same way to measure TEP of duplex stainless steel was examined. It was found that increment of Cu contained in the alloys changed TEP in a negative direction and the rate was evaluated as -6.6μV/K/wt%Cu. There were the cases that it took 20 minutes for measurement values to become stable in measurement of Fe-Cu binary alloys. It was much longer than the time taken in measurement of duplex stainless steel. So the measurement time per a point was extended to 60 minutes in case of Fe-Cu binary alloys. (author)

  12. Paradox-Proof Utility Functions for Heavy-Tailed Payoffs: Two Instructive Two-Envelope Problems

    Directory of Open Access Journals (Sweden)

    Michael R. Powers

    2015-01-01

    Full Text Available We identify restrictions on a decision maker’s utility function that are both necessary and sufficient to preserve dominance reasoning in each of two versions of the Two-Envelope Paradox (TEP. For the classical TEP, the utility function must satisfy a certain recurrence inequality. For the St. Petersburg TEP, the utility function must be bounded above asymptotically by a power function, which can be tightened to a constant. By determining the weakest conditions for dominance reasoning to hold, the article settles an open question in the research literature. Remarkably, neither constant-bounded utility nor finite expected utility is necessary for resolving the classical TEP; instead, finite expected utility is both necessary and sufficient for resolving the St. Petersburg TEP.

  13. Thermoelectric power of Bi and Bi{sub 1{minus}x}Sb{sub x} alloy thin films and superlattices grown by MBE

    Energy Technology Data Exchange (ETDEWEB)

    Cho, S; DiVenere, A; Wong, G K; Ketterson, J B; Meyer, J R; Hoffman, C A

    1997-07-01

    The authors have measured the thermoelectric power (TEP) of MBE-grown epitaxial Bi and Bi{sub 1{minus}x} alloy thin films and superlattices as a function of temperature in the range 20--300 K. They have observed that the TEP of a Bi thin film of 1 {micro}m thickness is in good agreement with the bulk single crystal value and that the TEPs for superlattices with 400 {angstrom} and 800 {angstrom} Bi well thicknesses are enhanced over the bulk values. For x = 0.072 and 0.088 in Bi{sub 1{minus}x}Sb{sub x} thin films showing semiconducting behavior, TEP enhancement was observed by a factor of two. However as Bi or Bi{sub 1{minus}x}Sb{sub x} well thickness decreases in superlattice geometry, the TEP decreases, which may be due to unintentional p-type doping.

  14. Contribution of the PET/CT with F.D.G. to evaluate the tri therapy and the lymphocyte reconstitution in patients infected by HIV; Apport de la TEP/TDM au FDG pour l'evaluation de la tritherapie et de la reconstitution lymphocytaire chez les patients infectes par le VIH

    Energy Technology Data Exchange (ETDEWEB)

    Hamza, F.; Yeddes, I.; El Bez, I.; Evangelista, E.; Meignan, M.; Itti, E. [CHU Henri-Mondor, Service de medecine nucleaire, 94 - Creteil (France); Lelievre, J.D.; Levy, Y. [CHU Henri-Mondor, service immunologie clinique, 94 - Creteil (France); Cheynier, R. [Institut Pasteur, service de virologie, 75 - Paris (France)

    2010-07-01

    Purpose: HIV infection is accompanied by impairment of lymphoid organs that can be detected by PET / CT with F.D.G.. The purpose of this study was to correlate lymphocyte reconstitution with the metabolic activity of lymphoid organs. Conclusions: PET / CT with F.D.G. is an appropriate assessment tool to evaluate the effect of antiviral treatment in lymphoid organs. In addition, she is helping to understand the mechanisms of lymphocyte reconstitution under triple therapy. (N.C.)

  15. The accurate definition of metabolic volumes on {sup 18}F-FDG-PET before treatment allows the response to chemoradiotherapy to be predicted in the case of oesophagus cancers; La definition precise des volumes metaboliques sur TEP au 18F-FDG avant traitement permet la prediction de la reponse a la chimioradiotherapie dans les cancers de l'oesophage

    Energy Technology Data Exchange (ETDEWEB)

    Hatt, M.; Cheze-Le Rest, C.; Visvikis, D. [Inserm U650, Brest (France); Pradier, O. [Radiotherapie, CHRU Morvan, Brest (France)

    2011-10-15

    This study aims at assessing the possibility of prediction of the response of locally advanced oesophagus cancers, even before the beginning of treatment, by using metabolic volume measurements performed on {sup 18}F-FDG PET images made before the treatment. Medical files of 50 patients have been analyzed. According to the observed responses, and to metabolic volume and Total Lesion Glycosis (TLG) values, it appears that the images allow the extraction of parameters, such as the TLG, which are criteria for the prediction of the therapeutic response. Short communication

  16. Unilateral brown fat on [{sup 18}F]-F.D.G. PET/CT in the follow-up of a pleural mesothelioma; Detection unilaterale de graisse brune en [{sup 18}F]-FDG TEP/TDM dans le suivi d'un mesotheliome pleural

    Energy Technology Data Exchange (ETDEWEB)

    Waele, A. de; Deroose, C.M. [Katholieke Universiteit Leuven, Hopitaux Universitaires de Leuven, UZ Leuven, Dept. de Medecine Nucleaire, Leuven (Belgium); Nafteux, P. [Katholieke Universiteit Leuven, Hopitaux Universitaires de Leuven, Dept. de Chirurgie Thoracique, Leuven (Belgium); Nackaerts, K. [Katholieke Universiteit Leuven, Hopitaux Universitaires de Leuven, Dept. de Pneumologie, Leuven (Belgium)

    2009-10-15

    The fixation of the fluorodeoxyglucose (F.D.G.) in the brown fat is generally characterized by a strongly symmetric setting in some areas of predilection.Is reported here the case of a patient that after having undergone a multi modal treatment for a pleural mesothelioma presents a unilateral F.D.G. fixation in the brown fat, this fixation can be inhibited by the administering of a beta adrenergic blocking agent. (N.C.)

  17. Interest of PET/CT with {sup 18}F-F.D.G. in the diagnosis of endocarditis on pacemaker or defibrillator to be implanted; Interet de la TEP-TDM au 18FDG dans le diagnostic d'endocardite sur pacemaker ou defibrillateur implantable

    Energy Technology Data Exchange (ETDEWEB)

    Bensimhon, L.; Hugonnet, F.; Maunoury, C.; Faraggi, M. [Hopital europeen Georges-Pompidou, Service de medecine nucleaire, 75 - Paris (France); Lavergne, T.; Leheuzey, J.Y. [Hopital europeen Georges-Pompidou, Service de cardiologie, 75 - Paris (France); Mainardi, J.L. [Hopital europeen Georges-Pompidou, Service de microbiologie, 75 - Paris (France); Latremouille, C. [Hopital europeen Georges-Pompidou, Service de chirurgie cardiovasculaire, 75 - Paris (France)

    2010-07-01

    Purpose: Infection of pacemaker device or implantable defibrillators are rare (<5%) but serious and sometimes difficult, we evaluated the interest of PET / CT with {sup 18}F-F.D.G. in the diagnosis. conclusion: PET can be useful to diagnose infection on pacemaker and implantable defibrillators. A prolonged antibiotic therapy may cause false negatives. In our series, the management could have been altered by the examination in 6 out of 21. (N.C.)

  18. 綜合高中分流政策對學生學習成就的影響:以TEPS 資料分析為例 Effects of Comprehensive High School Policy on Students’ Achievement: Evidence from Taiwan Education Panel Survey

    Directory of Open Access Journals (Sweden)

    李敦義 Duen-Yi Lee

    2011-06-01

    Full Text Available 我國自1996 年開始試辦綜合高中,該政策的目的在於促使我國後期中等教育能在高中、高職之外,提供另一條不同的選擇進路,俾使學生得以適性發展,學得多方面知識,達到適性教育的目標。綜合高中分流政策立意甚佳,然而就歷年來綜合高中學生數變化來看,顯然綜合高中在我國後期中等教育仍不是主流,何以綜合高中沒有成為我國後期中等教育的主流?是否與國內相關研究發現綜合高中分流政策在執行上遭遇瓶頸有關,且進一步影響到國中畢業生在選擇就讀綜合高中的考量?此外,過去國內關於綜合高中分流政策的研究,大都集中在探討綜合高中的辦學績效和實施困難,而非該政策對學生學習成就的影響之探討。有鑑於此,本研究進一步探討綜合高中分流政策對綜合高中學生學習成就的影響?原始資料取自臺灣教育長期追蹤資料庫(Taiwan Education Panel Survey)公共使用版中的第一波到第四波國中追蹤樣本資料,並使用傾向分數配對法(propensity score matching)進行資料分析。研究結果發現:在學生學習成就表現上,就整體平均效果來看,就讀綜合高中的學生並不比就讀普通高中或高職的學生來得好。最後,說明本研究結果對綜合高中分流政策的意涵,及提出研究建議供相關人員與後續研究之用。 Since 1996, the Taiwanese government has launched the policy of comprehensive high school (CHS to relax the traditional system of curriculum tracking at the level of senior secondary education. The aim of CHS is to offer junior high graduates delaying their choice between senior high and vocational curricula, an opportunity to increase their common knowledge and achieve a goal of personally tailored development. However, in contrast with students in both senior high and vocational schools, the percentage of those in the comprehensive high schools has been rather small since the 1998 school year. Furthermore, a number of studies and on-site evaluation reports on CHS have been conducted. Thus far, these studies and reports have focused on exploring the performance of comprehensive high schools and difficulties in implementing the policy. No evaluation of the impacts of the CHS policy on student achievement has yet been performed. Hence, the main purpose of this study is to investigate the causal effects of CHS policy on students’ achievement in comprehensive high schools in Taiwan. Using the data from the public released core panel data of the Taiwan Education Panel Survey in 2001, 2003, 2005, and 2007, this study employs the method of propensity score matching to estimate the average treatment effect of CHS policy on students’ achievement in comprehensive high schools. The results show virtually no gain in students’ achievement from the CHS policy for those enrolled in comprehensive high schools in Taiwan. Finally, the present study discusses the implications of the CHS policy and suggests directions for stakeholders and future research.

  19. Performances evaluation of the PET/CT with {sup 18}F-F.D.G. in the diagnosis of peritoneal carcinosis with a colorectal origin; Evaluation des performances de la TEP-TDM au {sup 18}F-FDG dans le diagnostic de la carcinose peritoneale d'origine colorectale

    Energy Technology Data Exchange (ETDEWEB)

    Bullier, E. [CHU de Bordeaux, Service de medecine nucleaire, hopital de Haut-Leveque, 33 (France); Bonichon, F.; Cazeau, A.L. [Institut Bergonie CRLCC d' Aquitaine, service de medecine nucleaire, 33 - Bordeaux (France); Descat, E. [Institut Bergonie CRLCC d' Aquitaine, service de radiologie, 33 - Bordeaux (France); Evrard, S. [Institut Bergonie CRLCC d' Aquitaine, Dept. de Chirurgie, 33 - Bordeaux (France); Picat, Q. [Bergonie CRLCC d' Aquitaine, Dept. de biostatistique, 33 - Bordeaux (France)

    2010-07-01

    Purpose: the purpose of this study is to evaluate the performances and the inter-observers concordances of the PET-CT with {sup 18}F-F.D.G. in the detection of the peritoneal carcinosis in colorectal cancers, with evaluation of peritoneal extension, description of semiotics signs allowing to raise the diagnosis and confrontation of this performance to that of CT. Conclusions: The PET-CT with {sup 18}F-F.D.G. seems to be a powerful and reproducible examination for the peritoneal carcinosis diagnosis, with a methodology of research oriented proofreading of peritoneal carcinosis. Studies are to make to evaluate prospectively the extension of peritoneal carcinosis. (N.C.)

  20. About one case of mental anorexia associated with a right frontal partial epilepsy diagnosed in crisis by a PET with {sup 18}F.D.G; A propos d'un cas d'anorexie mentale associee a une epilepsie partielle frontale droite diagnostiquee en crise par une TEP au 18-FDG

    Energy Technology Data Exchange (ETDEWEB)

    Avet, J.; Decousus, M.; Dubois, F. [Service de medecine nucleaire, CHU de Saint-etienne, (France); Galusca, B. [service d' endocrinologie, CHU de Saint-etienne, (France); Convers, P. [service de neurologie, CHU de Saint-etienne, (France); Barral, F.G. [service de radiologie, CHU de Saint-etienne, (France)

    2009-05-15

    The physiology of mental anorexia is very controversial. In some cases, it was described an association with injuries close to the right frontal and temporal lobes. We report the case of an anorexia associated to a partial right frontal epilepsy, fortuitously diagnosed in crisis by a PET with {sup 18}F.D.G.. Conclusions: Because of its closely relationship with the limbic system, the abnormalities touching the right frontal area could contribute to the development of dietary behaviour troubles. This case illustrates this relationship and reports in addition a per-critic PET image of partial epilepsy, that is exceptional because of the tracer kinetics. (N.C.)

  1. Quantitative analysis of fluorodeoxyglucose-, fluoro-misonidazole- and fluoro-thymidine-PET images on five patients irradiated for a non-small-cell bronchial cancer; Analyse quantitative d'images de TEP au fluorodesoxyglucose, au fluoromisonidazole et a la fluorothymidine chez cinq patients irradies pour un cancer bronchique non a petites cellules

    Energy Technology Data Exchange (ETDEWEB)

    Thureau, S.; Dubray, B. [Departement de radiotherapie et physique medicale, centre Henri-Becquerel, Rouen (France); Litis EA 4108, QuantiF, universite de Rouen, Rouen (France); Modzelewski, R.; Lelandais, B.; Edet Sanson, A.; Gardin, I.; Vera, P. [Litis EA 4108, QuantiF, universite de Rouen, Rouen (France); Departement de medecine nucleaire, centre Henri-Becquerel, Rouen (France)

    2011-10-15

    As fluorodeoxyglucose-PET (positron emission tomography) is used for the planning of non-small-cell bronchial carcinoma radiotherapy in order to help to define the gross tumour volume (GTV), and as new tracers have been developed to define a biological target volume, the authors report the comparison of several thresholding methods by using fluorodeoxyglucose-, fluoro-misonidazole- and fluoro-thymidine-PET images. They notice important differences between the delineated volumes. Short communication

  2. Myositis ossificans: a false positive of malignancy in PET - CT F.D.G. and in osseous scintigraphy with HMDP {sup 99}Tc;La myosite ossifiante: un faux positif de malignite en TEP-TDM FDG et en scintigraphie osseuse au HMDP Tc99

    Energy Technology Data Exchange (ETDEWEB)

    Hassler, S.; Bourahla, K. [CLCC Paul-Strauss, Service de medecine nucleaire, 67 - Strasbourg (France)

    2010-05-15

    Myositis ossificans is a difficult differential diagnosis and a false positive for malignancy in both {sup 99m}Tc H.M.D.P. (hydroxy-methylene diphosphonate) scintigraphy and in exploration PET-F.D.G. This hypothesis should be mentioned in case of young patients, despite the unusual scintigraphic appearance in a benign process. (N.C.)

  3. Interest of the supplementary analysis of inter hemisphere asymmetry in the study with S.P.M. of cerebral PET-F.D.G. of patients suffering of temporal epilepsy; Interet de l'analyse supplementaire d'asymetrie interhemispherique dans l'etude avec SPM des TEP-FDG cerebrales de patients avec epilepsie temporale

    Energy Technology Data Exchange (ETDEWEB)

    Person, C.; Wolf, D. [CRAN-INPL, universite de Nancy, 54 (France); Gillet, N.; Marie, P.Y.; Laurens, M.H.; Djaballah, W.; Karcher, G. [CHU de Nancy, service de medecine nucleaire, 54 (France); Maillard, L.; Vespignani, H. [CHU de Nancy, service de neurologie, 54 (France); Guedj, E. [Hopital de la Timone, service de medecine nucleaire, AP-HM13 - Marseille (France)

    2010-07-01

    The aim of this study was to evaluate the supplementary information provided by the asymmetry analysis in the study by S.P.M. (statistical parametric mapping) of cerebral PET-F.D.G. images got for patients suffering of a drug resistant temporal epilepsy. It appears that the supplementary analysis of inter hemisphere asymmetry allow to improve the detection rate of the involved temporal lobe and bring complementary information concerning the delimitation of the hypo metabolic temporal area. (N.C.)

  4. Study, development and validation of a dead-timeless electronic architecture concept for highly sensitive PET (Positron Emission Tomograph); Etude, developpement et validation d'un concept d'architecture electronique sans temps mort pour TEP de haute sensibilite

    Energy Technology Data Exchange (ETDEWEB)

    Vert, P.E

    2007-03-15

    Positron emission tomographs (PET) are fitted with highly capable reading electronics, which owns qualities and drawbacks. Highly accused at first as an explanation of the poor sensitivity of these imagers, the present study points out that the dead-times shared along the chains contribute to only 16 % in the data losses at a typical activity of 10 {mu}Ci/ml. The gross acquisition rates could thus be raised by 20 % through a suppression of these saturations. Looking in details at the philosophy of the acquisition procedure, a property appears to circumscribe the sensitivity even more: the timing resolution. The latter conditions, to the first order, the rejection capabilities of random events, part of the scattered ones and hence noise which is finally rated to the true coincidences the signal is made up of. Minimizing the resolving time goes through the suppression of the unneeded actors along with the adoption of a well adapted time-stamping method (optimal filtering). In doing so, the intrinsic channel resolution appears to be possibly lowered by a factor 7, reducing to 350 ps. The bottom value of the coincidence window may be narrowed as a consequence, leading to an increase of the NECR (noise equivalent count rate) by 50 per cent. At this stage, a time of flight (TOF) algorithms can be implemented. As an opportunist, it promises a reduction of the noise variance by 430 %, a gain that echoes on the NECR figure. Finally merging all these ideas allows to expect an improvement close to an order of magnitude on the NECR, with the hope of routine exams shortened by the same amount. In this context, it appeared logical to imagine a new electronics acquisition synoptic dedicated to fully pixelized PET. The number of channels blows up by the way when compared to the existing, this statement being partially balanced by the decision to fully integrate the electronics. The measures of the energy and time are planned to be performed with a single channel, with a continuous and dead-timeless reading of the events. The development of the microelectronics circuits is under way, the three first blocks being described in this dissertation. (author)

  5. Comparison of target volumes in radiotherapy defined on scanner and on PET-T.D.M. with {sup 18}F-F.D.G. in the frame of head and neck cancers; Comparaison des volumes cibles en radiotherapie definis sur scanner et sur TEP-TDM au 18F FDG dans le cadre des cancers de la tete et du cou

    Energy Technology Data Exchange (ETDEWEB)

    Henriques De Figueiredo, B.; Barret, O.; Allard, M.; Fernandez, P. [Service de medecine nucleaire, CHU de Pellegrin, Bordeaux, (France); Demeaux, H.; Maire, J.P.; Lagarde, P. [service de radiotherapie, hopital Saint-Andre, Bordeaux, (France); Kantor, G.; Richau, P. [departement de radiotherapie, institut Bergonie, Bordeaux, (France); De Mones Del Pujol, E. [service d' ORL, hopital Pellegrin, Bordeaux, (France)

    2009-05-15

    The objective is to study in a prospective way, in the frame of head and neck cancers, the impact of the positron computed tomography with {sup 18}F fluorodeoxyglucose (PET-F.D.G.) on the limitation of target volumes in radiotherapy. In conclusions, the gross tumor volume (G.T.V.) defined on PET is smaller than this one defined on scanner, that could be interesting in radiotherapy, in the perspective of a dose escalation. In addition, areas of discordance exist between the clinical target volumes (C.T.V.70 and C.T.V.50) defined on PET and on scanner. These discordances, synonyms of under or over estimation of target volumes, could have important clinical consequences in term of local control and toxicity. (N.C.)

  6. Interest of delayed images in the detection of small size lesions in positron emission tomography (PET): about a case of peritoneal carcinosis evaluation; Interet des images tardives dans la detection de lesion de petite taille en tomographie par emission de positons (TEP): a propos d'un cas de bilan de carcinose peritoneale

    Energy Technology Data Exchange (ETDEWEB)

    Rakotonirina, H.; Berthelot, C.; Vervueren, L.; Agius, C.; Jeanguillaume, C.; Couturier, O. [Service de medecine nucleaire, CHU d' Angers, (France)

    2009-05-15

    Because of the effect of partial volume, the small injuries (under 1 cm) are not the most often seen in F.D.G.-PET. however, if the gradient tumor/background noise is important, it is sometimes possible to visualize them. To increase this gradient, we can increase the tumor captation of F.D.G. by increasing the time of captation, or reduce the vascular background noise by making easy the urinary excretion. through a clinical case, we remind the interest of delayed images ( 2 hours after injection) associated to the injection of furosemide in the detection of small injuries of peritoneal carcinosis. (N.C.)

  7. The co registration of initial PET on the CT-radiotherapy reduces significantly the variabilities of anatomo-clinical target volume in the child hodgkin disease; La coregistration de la TEP initiale sur la scanographie de radiotherapie diminue significativement les variabilites de volume cible anatomoclinique dans la maladie de Hodgkin de l'enfant

    Energy Technology Data Exchange (ETDEWEB)

    Metwally, H.; Blouet, A.; David, I.; Rives, M.; Izar, F.; Courbon, F.; Filleron, T.; Laprie, A. [Institut Claudius-Regaud, 31 - Toulouse (France); Plat, G.; Vial, J. [CHU-hopital des Enfants, 31 - Toulouse (France)

    2009-10-15

    It exists a great interobserver variability for the anatomo-clinical target volume (C.T.V.) definition in children suffering of Hodgkin disease. In this study, the co-registration of the PET with F.D.G. on the planning computed tomography has significantly lead to a greater coherence in the clinical target volume definition. (N.C.)

  8. Contribution of the PET-CT with {sup 18}F.D.G. in the non metastatic thyroid cancers with suspicion of residual or recurrent disease; Apport de la TEP-TDM au {sup 18}FDG dans les cancers de la thyroide non metastatiques avec suspicion de maladie residuelle ou recidivante

    Energy Technology Data Exchange (ETDEWEB)

    Ghander, C.; Taieb, D.; Tessonnier, L.; Mundler, O. [CHU Timone, Service central de biophysique et de medecine nucleaire, 13 - Marseille (France); Sebag, F.; Henry, J.F. [CHU Timone, service central de chirurgie generale et endocrinienne, 13 - Marseille (France); De Micco, C. [Inserm U555, service d' anatomopathologie, 13 - Marseille (France)

    2010-07-01

    Purpose: Recurrent thyroid carcinomas usually involve the cervical lymph nodes. The objective of this study was to evaluate the contribution of {sup 18}F-F.D.G. PET in the investigation of thyroid cancer compared with non-metastatic cervical echography. Conclusions: Due to the low overall sensitivity of PET / CT in thyroid carcinoma, its use should be reserved for cases of aggressive carcinoma and when the residual thyroglobulin under stimulation is high. In these cases it is a complementary information with neck echography. (N.C.)

  9. The deep stimulation of the sub-thalamus nucleus affects the limbic and associative circuits: a study in {sup 18}F-F.D.G. -PET in the Parkinson disease;La stimulation profonde du noyau sous thalamique affecte les circuits limbique et associatif: une etude en 18FDG-TEP dans la maladie de Parkinson

    Energy Technology Data Exchange (ETDEWEB)

    Le Jeune, F.; Garin, E. [Centre Eugene-Marquis, Servive de medecine nucleaire, 35 - Rennes (France); Le Jeune, F.; Peron, J.; Grandjean, D.; Drapier, S.; Haegelen, C.; Garin, E.; Millet, B.; Verin, M. [Universite de Rennes-1, URU comportement et noyaux gris centraux, 35 - Rennes (France); Peron, J.; Drapier, S.; Haegelen, C.; Verin, M. [CHU Pontchaillou, service de neurologie, 35 - Rennes (France); Grandjean, D. [University of Genova, Swiss Center for Affective Sciences, Geneve (Switzerland); Millet, B. [Centre hospitalier Guillaume-Regnier, service de psychiatrie adulte, 35 - Rennes (France)

    2010-05-15

    The purpose of this study is to highlight the changes in brain metabolism in {sup 18}F.D.G.-PET to improve understanding of the non-motor functional role .This study confirms the non-motor functional role of the sub thalamic nucleus (S.T.N.) in limbic and associative circuits in humans.These results provide working hypotheses to study the correlations between neuropsychological alterations clinically diagnosed and cerebral metabolism in order to identify the neural circuits involved. (N.C.)

  10. Diagnosis and evaluation of the treatment by PET-T.D.M. with 18 F.D.G. of the digestive origin of an infectious endocarditis complicated with stroke (C.V.A.); Diagnostic et evaluation du traitement, par la TEP-TDM au 18 FDG, de l'origine digestive d'une endocardite infectieuse compliquee d'AVC

    Energy Technology Data Exchange (ETDEWEB)

    Tessonnier, L.; Guedj, E.; Mundler, O. [Service central de medecine nucleaire, CHU de La-Timone, Marseille, (France); Maurel, B. [c service deneuroradiologie, CHU de La-Timone, Marseille, (France); Habib, G. [service de cardiologie, CHU de La-Timone, Marseille, (France); Nicoli, F. [service de neurologie, CHU de La-Timone, Marseille, (France)

    2009-05-15

    (We report the case of a seventeen years old patient sent for an etiological evaluation of an endocarditis, complicated with a cerebral vascular accident, for who the results of conventional imaging examinations were negative. The PET T.D.M. with {sup 18}F.D.G. was realized for the detection of a front door. Effectively, this examination allowed to find a digestive front door in the frame of an infectious endocarditis and direct the complementary adequate explorations. The following of studies will allow to give correctly the contribution of the PET-T.D.M. in infectious and inflammatory pathologies, whether it is in terms of diagnosis, of extension assessment or therapeutic evaluation. (N.C.)

  11. Comparison of six methods of segmentation of tumor volume on the {sup 18}F-F.D.G. PET scan with reference histological volume in non small cell bronchopulmonary cancers; Comparaison de six methodes de segmentation du volume tumoral sur la {sup 18}F-FDG TEP-TDM avec le volume de reference anatomopathologique dans les cancers bronchopulmonaires non a petites cellules

    Energy Technology Data Exchange (ETDEWEB)

    Venel, Y.; Garhi, H.; Baulieu, J.L.; Prunier-Aesch, C. [CHRU de Tours-Bretonneau, Service de Medecine Nucleaire, 37 - Tours (France); Muret, A. de [CHRU de Tours-Bretonneau, Service de Radiotherapie, 37 - Tours (France); Barillot, I. [CHRU de Tours-Bretonneau, Service d' Anatomopathologie, 37 - Tours (France)

    2008-06-15

    The {sup 18}F-F.D.G. PET has demonstrated its importance in oncology, for initial extension and efficacy of anti tumoral therapeutics. Several studies have attempted to prove its utility to define tumoral volumes for conformational radiotherapy in non small cell lung cancers. Some authors have suggested the use of threshold of tumor intensity uptake with 40 or 50% of maximal intensity. Black et al. have determined contouring with linear regression formula of mean semi-quantitative index of tumor uptake (standard uptake value): SUV{sub threshold} = 0.307 Sub{sub average} + 0.588. Nestle et al. have taken into account the background noise intensity and mean intensity of the tumor: I{sub threshold} = {beta} I{sub average} +I{sub noise} with {beta} 0.15. Our study was done in collaboration with Inserm U618 team and has compared volumes defined on PET scan defined according to different methods based on intensity or S.U.V. to the tumour volume determined on CT scan by radio physicist. We have compared those volumes with histological volume that we considered for reference. Four patients have been included. They had {sup 18}F-F.D.G. PET scan followed by complete tumoral removal surgery. Specific histological procedure allowed to define complete size of the tumor in re expanded lung. Comparatively to pathology, the volumes obtained using I{sub max} 40 and I{sub max} 50 are all underestimated. The volumes defined by Black's et al. method are under evaluated for the two largest tumours (15.8% to 22%) and overestimated for the two smallest ones (17.9 to 82.9%). Nestle's et al. method, using {beta} = 0.15, correctly estimates two tumor volumes over 2 cm, but overestimates the two small tumors (79.6 to 124%). Finally, the corrected Nestle's et al. formula (using {beta} = 0.264) overestimates three tumours. Volumes defined on CT scan by radio physicist are correct for one lesion, underestimated for one and overestimated for two other ones (44 and 179.5%). Nestle's et al. method seems to be the most accurate for tumours over 2 cm of diameter. Today no method can correctly estimate the volume of smaller tumours. To improve those segmentation approaches, partial volume effect correction needs to be implemented for small tumours or tumours close to mediastinal local extension. The main indication of segmentation based on F.D.G. PET is tumour greater than 2 cm for which treatment will be radiotherapy alone or radiotherapy associated with chemotherapy. Our study is important because it compares the different methods described in the literature with the reference histological volume of the tumor, which is the only way to validate tumor segmentation method. (authors)

  12. Evaluation of uterine cervix cancer hypoxia by PET with {sup 18}F-F.E.T.N.I.M.. Relation with squamous cell carcinoma (S.C.C.) and osteopontin tumoral markers; Evaluation de l'hypoxie du cancer du col uterin par la TEP au {sup 18}F-FETNIM. Relation avec les marqueurs tumoraux SCC et osteopontine

    Energy Technology Data Exchange (ETDEWEB)

    Barre, E.; Schlageter, M.H.; Groheux, D.; Vercellino, L.; Lussato, D.; Thoury, A.; Hennequin, V.; Hindie, E.; Barranger, E.; Moretti, J.L. [CHU Saint-Louis-Lariboisiere, universite Paris-7, IMDCT, 75 - Paris (France)

    2010-07-01

    Purpose: to evaluate the imaging feasibility of hypoxia of cervical squamous cell carcinoma by PET with {sup 18}F-F.E.T.N.I.M. (Iason). to compare the {sup 18}F-F.E.T.N.I.M. uptake to the metabolic uptake in {sup 18}F-F.D.G. and to study their relationship with the squamous cell carcinoma, tumoral marker and osteoponin, circulating tracer of hypoxia. Conclusions: the F.E.T.N.I.M. uptake by the tumor is always of lower level than the {sup 18}F-F.D.G. uptake. By using the ratio Tumor/Muscle, these preliminary results do not enlighten any correlation between the circulating hypoxia tracer and the tumor uptake of {sup 18}F-F.E.T.N.I.M.. (N.C.)

  13. Comparison of prognosis values of pre therapy PET-T.D.M. with {sup 18}F-F.D.G. and MRI in the uterus cervix cancer; Comparaison des valeurs pronostiques des TEP-TDM au 18F-FDG et IRM pretherapeutiques dans le cancer du col de l'uterus

    Energy Technology Data Exchange (ETDEWEB)

    Chastan, M.; Baron, M.; Diologent, B.; Edet Sanson, A.; Guernou, M.; Vera, P.; Hitzel, A. [Centre Henri-Becquerel, Rouen, (France); Manrique, A. [GIP Cyceron, Caen, (France)

    2009-05-15

    The objective is to compare the prognosis value of the pre-therapy pelvis PET--T.D.M. with {sup 18}F-F.D.G. and MRI in the uterine cervix carcinoma. The conclusions: in the uterine cervix carcinomas, the existence of a pelvis ganglion injury on the pre-therapy PET-T.D.M. with {sup 18}F-F.D.G. is a prognosis factor independent of recurrence and death at one year. The MRI does not bring any additional information relative to the prognosis of the disease. (N.C.)

  14. Interest of the PET with F DOPA in the exploration of endocrine para neoplastic syndromes (E.P.S.): about four cases; Interet de la TEP a la FDOPA dans l'exploration des syndromes paraneoplasiques endocriniens (SPE): a propos de 4 cas

    Energy Technology Data Exchange (ETDEWEB)

    Moreau Triby, C.; Pina, G.; Bournaud, C. [Centre de medecine nucleaire, groupement hospitalier Est, Lyon, (France); Billotey, C. [CERMEP, Lyon, (France); Raverot, G.; Borson Chazot, F. [service d' endocrinologie, groupement hospitalier Est, Lyon, (France)

    2009-05-15

    In front an ectopic secretion of adrenocorticotropic hormone (ACTH or corticotropin) or growth hormone (GH) the existence of an endocrine tumor must be evoked. The topographical diagnosis of these tumors is often difficult. The positron computed tomography with 6-fluoro-({sup 18}F)-L-dihydroxy-phenylalanine (PET-FDOPA) showed recently a good sensitivity in the detection of well differentiated endocrine tumors. We report our experience of the PET-FDOPA in the explorations of para-neoplasic endocrine syndromes. Our experience was relatively disappointing, this examination being a little contributive for our patients. The scintigraphy of receptors with somatostatin with octreoscan keeps all this place in this indication. (N.C.)

  15. The PET/T.D.M. with F.D.G. -({sup 18}F) appears more noticeable than the osseous scintigraphy in the Ewing sarcoma with osteo-medullar localizations; La TEP/TDM au FDG-(18F) apparait plus sensible que la scintigraphie osseuse dans le sarcome d'Ewing a localisations osteomedullaires

    Energy Technology Data Exchange (ETDEWEB)

    Girma, A.; Razzouk, M.; Carrier, P.; Darcourt, J. [Unite de medecine nucleaire, CHU l' Archet, Nice, (France); Paycha, F. [unite de medecine nucleaire, CHU Louis-Mourier, Colombes, (France); Deville, A. [unite de pediatrie, CHU l' Archet, Nice, (France); Boyer, C. [unite de radiologie, CHU l' Archet, Nice, (France); Piche, M. [unite d' anatomopathologie, CHU l' Archet, Nice, (France)

    2009-05-15

    The clinical case reported here illustrates the superiority of the PET/T.D.M. with F.D.G.({sup 18}F) on the osseous scintigraphy in the Ewing sarcoma. This difference comes from probably a major inter trabecular medullary injury that arouses only a limited cortical osteoblastic reaction, what explains its appellation of pass-wall tumor by the anatomical pathologists. (N.C.)

  16. About a case of pathological muscular hyper fixations in PET-F.D.G.. Diagnosis discussions and reminder of the main differential diagnosis; A propos d'un cas d'hyperfixations musculaires pathologiques en TEP-FDG. Discussion diagnostique et rappel des principaux diagnostics differentiels

    Energy Technology Data Exchange (ETDEWEB)

    Colavolpe, C.; Puech, J.B.; Mundler, O. [CHU Timone, Service de medecine nucleaire, 13 - Marseille (France); Belenotti, P.; Sevy, A.; Ene, N.; Serratrice, J. [CHU Timone, Service de medecine interne, 13 - Marseille (France); Verschueren, A.; Attarian, S. [CHU Timone, Service de neurologie maladies neuromusculaires, 13 - Marseille (France); Azulay, J.P. [CHU Timone, Service de neurologie pathologies du mouvement, 13 - Marseille (France)

    2010-07-01

    The muscle hyper fixing are common in PET-F.D.G.. Their interpretation requires a good knowledge of the main artifactual and pathological causes and the correlation with other clinical and para clinical data. (N.C.)

  17. Kinetic of the gas-phase reactions of OH radicals and Cl atoms with Diethyl Ethylphosphonate and Triethyl Phosphate

    KAUST Repository

    Laversin, H.

    2015-11-30

    In this paper, the relative-rate technique has been used to obtain rate coefficients for the reaction of two organophosphorus compounds: Triethyl phosphate (TEP) and Diethyl ethylphosphonate (DEEP) with OH radicals and Cl atoms at atmospheric pressure and at different temperatures. The calculated rate constants were fitted to the Arrhenius expression over the temperature range 298 – 352 K. The following expressions (in cm3molecule-1s-1) were obtained for the reactions of OH and CL with DEEP and TEP: kOH+DEEP= (7.84±0.65)x10-14exp((1866±824)/T), kOH+TEP = (6.54±0.42)x10-14exp((1897±626)/T), kCl+DEEP = (5.27± 0.80)x10−11exp(765±140/T) and kCl+TEP = (5.23± 0.80)x10−11exp(736± 110/T). These results show that the reaction of the studied compounds with Cl atoms proceeds more rapidly than that with OH radicals. The related tropospheric lifetimes suggest that once emitted into the atmosphere, TEP and DEEP can be removed within a few hours in areas close to their emission sources. TEP and DEEP are principally removed by OH radicals. However, in coastal areas where the Cl atoms’ concentration is higher, TEP and DEEP removal by reaction with Cl atoms could be a competitive process.

  18. Tris(2-butoxyethyl)phosphate and triethyl phosphate alter embryonic development, hepatic mRNA expression, thyroid hormone levels, and circulating bile acid concentrations in chicken embryos

    Energy Technology Data Exchange (ETDEWEB)

    Egloff, Caroline [National Wildlife Research Centre, Environment Canada, Ottawa, ON K1A 0H3 (Canada); Crump, Doug, E-mail: doug.crump@ec.gc.ca [National Wildlife Research Centre, Environment Canada, Ottawa, ON K1A 0H3 (Canada); Porter, Emily; Williams, Kim L.; Letcher, Robert J.; Gauthier, Lewis T. [National Wildlife Research Centre, Environment Canada, Ottawa, ON K1A 0H3 (Canada); Kennedy, Sean W. [National Wildlife Research Centre, Environment Canada, Ottawa, ON K1A 0H3 (Canada); Department of Biology, University of Ottawa, Ottawa, ON K1N 6N5 (Canada)

    2014-09-15

    The organophosphate flame retardants tris(2-butoxyethyl) phosphate (TBOEP) and triethyl phosphate (TEP) are used in a wide range of applications to suppress or delay the ignition and spread of fire. Both compounds have been detected in the environment and TBOEP was recently measured in free-living avian species. In this study, TBOEP and TEP were injected into the air cell of chicken embryos at concentrations ranging from 0 to 45,400 ng/g and 0 to 241,500 ng/g egg, respectively. Pipping success, development, hepatic mRNA expression of 9 target genes, thyroid hormone levels, and circulating bile acid concentrations were determined. Exposure to the highest doses of TBOEP and TEP resulted in negligible detection of the parent compounds in embryonic contents at pipping indicating their complete metabolic degradation. TBOEP exposure had limited effects on chicken embryos, with the exception of hepatic CYP3A37 mRNA induction. TEP exposure decreased pipping success to 68%, altered growth, increased liver somatic index (LSI) and plasma bile acids, and modulated genes associated with xenobiotic and lipid metabolism and the thyroid hormone pathway. Plasma thyroxine levels were decreased at all TEP doses, including an environmentally-relevant concentration (8 ng/g), and gallbladder hypotrophy was evident at ≥ 43,200 ng/g. Tarsus length and circulating thyroxine concentration emerged as potential phenotypic anchors for the modulation of transthyretin mRNA. The increase in plasma bile acids and LSI, gallbladder hypotrophy, and discoloration of liver tissue represented potential phenotypic outcomes associated with modulation of hepatic genes involved with xenobiotic and lipid metabolism. - Highlights: • TBOEP is not embryolethal to chicken embryos. • TEP affected embryonic viability, morphometric endpoints, and thyroid hormone levels. • TEP altered mRNA levels of xenobiotic and lipid metabolism genes. • TEP increased plasma bile acids and caused gallbladder hypotrophy

  19. Influence of triethyl phosphate on phosphatase activity in shooting range soil: Isolation of a zinc-resistant bacterium with an acid phosphatase.

    Science.gov (United States)

    Story, Sandra; Brigmon, Robin L

    2017-03-01

    Phosphatase-mediated hydrolysis of organic phosphate may be a viable means of stabilizing heavy metals via precipitation as a metal phosphate in bioremediation applications. We investigated the effect of triethyl phosphate (TEP) on soil microbial-phosphatase activity in a heavy-metal contaminated soil. Gaseous TEP has been used at subsurface sites for bioremediation of organic contaminants but not applied in heavy-metal contaminated areas. Little is known about how TEP affects microbial activity in soils and it is postulated that TEP can serve as a phosphate source in nutrient-poor groundwater and soil/sediments. Over a 3-week period, TEP amendment to microcosms containing heavy-metal contaminated soil resulted in increased activity of soil acid-phosphatase and repression of alkaline phosphatase, indicating a stimulatory effect on the microbial population. A soil-free enrichment of microorganisms adapted to heavy-metal and acidic conditions was derived from the TEP-amended soil microcosms using TEP as the sole phosphate source and the selected microbial consortium maintained a high acid-phosphatase activity with repression of alkaline phosphatase. Addition of 5mM zinc to soil-free microcosms had little effect on acid phosphatase but inhibited alkaline phosphatase. One bacterial member from the consortium, identified as Burkholderia cepacia sp., expressed an acid-phosphatase activity uninhibited by high concentrations of zinc and produced a soluble, indigo pigment under phosphate limitation. The pigment was produced in a phosphate-free medium and was not produced in the presence of TEP or phosphate ion, indicative of purple acid-phosphatase types that are pressed by bioavailable phosphate. These results demonstrate that TEP amendment was bioavailable and increased overall phosphatase activity in both soil and soil-free microcosms supporting the possibility of positive outcomes in bioremediation applications. Copyright © 2016. Published by Elsevier Inc.

  20. Influence of heat treatments on thermoelectric power of pressure vessel steels: effect of microstructural evolutions of strongly segregated areas

    International Nuclear Information System (INIS)

    Houze, M.

    2002-12-01

    Thermoelectric power measurement (TEP) is a very potential non destructive evaluation method considered to follow ageing under neutron irradiation of pressure vessel steel of nuclear reactor. Prior to these problems, the aim of this study is to establish correlations between TEP variations and microstructural evolutions of pressure vessel steels during heat treatments. Different steels, permitting to simulate heterogeneities of pressure vessel steels and to deconvoluate main metallurgical phenomenons effects were studied. This work allowed to emphasize effect on TEP of: austenitizing and cooling conditions and therefore of microstructure, metallurgical transformations during tempering (recovery, precipitation of alloying elements), and particularly molybdenum precipitation associated to secondary hardening, residual austenite amount or partial austenitizing. (author)

  1. Changes of Dielectric Properties induced by Fast neutrons in Tissue Equivalent Plastic A-150

    International Nuclear Information System (INIS)

    Abdou, M.S.

    2000-01-01

    Tissue equivalent plastic A-150 (TEP A-150) samples are exposed to fast neutrons. Dielectric studies for TEP A-150 are carried out in the frequency range from 40 Hz to 4 MHz in the temperature range 295-343 K. The obtained data revealed that, both the dielectric properties and conductivity sigma ac (omega) of TEP A-150 are altered when irradiated by a relatively high fast neutron dose (15 Sv). The values of dielectric constant and conductivity are increased for the irradiated samples to about 24% than the blank samples

  2. Thermoelectric power and topological transitions in quasi-two-dimensional electronic systems

    International Nuclear Information System (INIS)

    Blanter, Ya.M.; Pantsulaya, A.V.; Varlamov, A.A.

    1991-05-01

    Electron-impurity relaxation time and the thermoelectric power (TEP) of quasi-two-dimensional electron gas are calculated. Two cases are discussed: the isotropic spectrum and the electronic topological transition (ETT) of the ''neck-breaking'' type. Methods of thermal diagramatic technique are used for the calculation. It is found that the TEP in the vicinity of the ETT greatly exceeds its background value. The results of experimental investigations of the TEP in the metal-oxide-semiconductor structures are compared with the predictions of the proposed theory. (author). 17 refs, 5 figs

  3. Mini MAX - Medicaid Sample

    Data.gov (United States)

    U.S. Department of Health & Human Services — To facilitate wider use of MAX, CMS contracted with Mathematica to convene a technical expert panel (TEP) and determine the feasibility of creating a sample file for...

  4. Organic carbon movement through two SWRO facilities from source water to pretreatment to product with relevance to membrane biofouling

    KAUST Repository

    Alshahri, Abdullah; Dehwah, Abdullah; Leiknes, TorOve; Missimer, Thomas M.

    2016-01-01

    reductions. The mixed media filtration process was marginally useful in removing some TOC and NOM, but had little effect on TEP removal. Some bacterial regrowth may be occurring in the cartridge filters, but the evidence is inconsistent. Significant

  5. Organic Carbon Reduction in Seawater Reverse Osmosis (SWRO) Plants, Jeddah, Saudi Arabia

    KAUST Repository

    Alshahri, Abdullah

    2015-01-01

    intake systems and pre-treatment stages in minimizing the concentrations of algae, bacteria, natural organic matter (NOM) and transparent exopolymer particles (TEP), in the feed water prior to pre-treatment, through the pre-treatment stages

  6. Bilateral inguinal hernia repair: laparoscopic or open approach?

    Science.gov (United States)

    Feliu, X; Clavería, R; Besora, P; Camps, J; Fernández-Sallent, E; Viñas, X; Abad, J M

    2011-02-01

    The aim of this study was to investigate outcomes in the treatment of bilateral inguinal hernia, comparing the laparoscopic totally extraperitoneal (TEP) and open tension-free mesh repair (LICHT) approaches. We performed a prospective controlled non randomized clinical study in 128 patients with bilateral inguinal hernia over a period of 3 years. LICHT was used in 106 cases (53 patients) while TEP was employed in 150 cases (75 patients). The main outcome measurements were: recurrence rate, operating time, hospital stay and postoperative complications. There were three recurrences (2.3%): two in the LICHT group (3.8%) and one (1.3%) in the TEP group P = NS. The TEP procedure was faster than LICHT repair (48.8 ± 10.8 vs. 70.4 ± 11.2 min) P approach is an effective option for the treatment of bilateral inguinal hernia when performed by experienced surgeons.

  7. Evolution and Function of Thioester-Containing Proteins and the Complement System in the Innate Immune Response

    Directory of Open Access Journals (Sweden)

    Upasana Shokal

    2017-06-01

    Full Text Available The innate immune response is evolutionary conserved among organisms. The complement system forms an important and efficient immune defense mechanism. It consists of plasma proteins that participate in microbial detection, which ultimately results in the production of various molecules with antimicrobial activity. Thioester-containing proteins (TEPs are a superfamily of secreted effector proteins. In vertebrates, certain TEPs act in the innate immune response by promoting recruitment of immune cells, phagocytosis, and direct lysis of microbial invaders. Insects are excellent models for dissecting the molecular basis of innate immune recognition and response to a wide range of microbial infections. Impressive progress in recent years has generated crucial information on the role of TEPs in the antibacterial and antiparasite response of the tractable model insect Drosophila melanogaster and the mosquito malaria vector Anopheles gambiae. This knowledge is critical for better understanding the evolution of TEPs and their involvement in the regulation of the host innate immune system.

  8. Click It or Ticket Evaluation, 2010

    Science.gov (United States)

    2013-05-01

    The 201 Click It or Ticket (CIOT) mobilization followed a typical elective traffic enforcement program TEP) sequence, involving paid media, earned media, and enforcement. A nationally representative telephone survey indicated that the mobilization wa...

  9. Sequelae of Endoscopic Inguinal Hernia Repair : Incidence, evaluation and management

    NARCIS (Netherlands)

    Burgmans, J.P.J.

    2015-01-01

    The endoscopic preperitoneal technique (TEP) is an appealing inguinal hernia repair technique, theoretically superior to other approaches. In practice some problems remain unsolved. Real incidences of chronic postoperative inguinal pain (CPIP) and other important sequelae of endoscopic hernia repair

  10. Quantitative Method for the Detection of Triethyl Phosphate in Aqueous Solutions

    National Research Council Canada - National Science Library

    Bagalawis, Rosa

    2003-01-01

    ...) at the parts per million level in aqueous solution. TEP was used as a chemical agent simulant to evaluate the penetration characteristics of clothing, gloves, boots and items of personal equipment...

  11. Transmission expansion in an oligopoly considering generation investment equilibrium

    DEFF Research Database (Denmark)

    Taheri, S. Saeid; Kazempour, Jalal; Seyedshenava, Seyedjalal

    2017-01-01

    the future generation investment actions. However, in such an oligopolistic market, each producer makes its own strategic generation investment decisions. This motivates the transmission system planner to consider the generation investment decision-making problem of all producers within its TEP model......Transmission expansion planning (TEP) is a sophisticated decision-making problem, especially in an oligopolistic electricity market in which a number of strategic (price-maker) producers compete together. A transmission system planner, who is in charge of making TEP decisions, requires considering....... This paper proposes a tri-level TEP decision-making model to be solved by the transmission system planner, whose objective is to maximize the social welfare of the market minus the expansion costs, and whose constraints are the transmission expansion limits as well as the generation investment equilibrium...

  12. Market-based transmission expansion planning by improved differential evolution

    International Nuclear Information System (INIS)

    Georgilakis, Pavlos S.

    2010-01-01

    The restructuring and deregulation has exposed the transmission planner to new objectives and uncertainties. As a result, new criteria and approaches are needed for transmission expansion planning (TEP) in deregulated electricity markets. This paper proposes a new market-based approach for TEP. An improved differential evolution (IDE) model is proposed for the solution of this new market-based TEP problem. The modifications of IDE in comparison to the simple differential evolution method are: (1) the scaling factor F is varied randomly within some range, (2) an auxiliary set is employed to enhance the diversity of the population, (3) the newly generated trial vector is compared with the nearest parent, and (4) the simple feasibility rule is used to treat the constraints. Results from the application of the proposed method on the IEEE 30-bus test system demonstrate the feasibility and practicality of the proposed IDE for the solution of TEP problem. (author)

  13. 40 CFR 161.590 - Nontarget insect data requirements.

    Science.gov (United States)

    2010-07-01

    ... pollinators (4) CR CR CR CR CR CR TEP TEP 141-5 Nontarget insect testing—aquatic insects Acute toxicity to aquatic insects (5) 142-1 Aquatic insect life-cycle study (5) 142-1 Simulated or actual field testing for aquatic insects (5) 142-3 Nontarget insect testing—predators and parasites (5) 143-1thru 143-3 Key: CR...

  14. Investigation of cytogenetic activity of radioprotectors in human lymphocyte culture

    International Nuclear Information System (INIS)

    Egiazaryan, S.V.; Arutyunyan, R.M.

    1977-01-01

    Studied are the effects of the F-11 and F-37 indene preparations on chromosome aberrations induced in lymphocyte culture of peripheral human blood by thioTEP. Investigation into the action of the substance in euqimolar concentrations has not shown their protective effect. Indene preparations did not change the spectrum of chromosome aberrations induced by thioTEP as well as did not increase the level of chromosome aberrations in lumphocyte culture of human peripheral human blood

  15. Short-interval and long-interval intracortical inhibition of TMS-evoked EEG potentials.

    Science.gov (United States)

    Premoli, Isabella; Király, Julia; Müller-Dahlhaus, Florian; Zipser, Carl M; Rossini, Pierre; Zrenner, Christoph; Ziemann, Ulf; Belardinelli, Paolo

    2018-03-15

    Inhibition in the human motor cortex can be probed by means of paired-pulse transcranial magnetic stimulation (ppTMS) at interstimulus intervals of 2-3 ms (short-interval intracortical inhibition, SICI) or ∼100 ms (long-interval intracortical inhibition, LICI). Conventionally, SICI and LICI are recorded as motor evoked potential (MEP) inhibition in the hand muscle. Pharmacological experiments indicate that they are mediated by GABAA and GABAB receptors, respectively. SICI and LICI of TMS-evoked EEG potentials (TEPs) and their pharmacological properties have not been systematically studied. Here, we sought to examine SICI by ppTMS-evoked compared to single-pulse TMS-evoked TEPs, to investigate its pharmacological manipulation and to compare SICI with our previous results on LICI. PpTMS-EEG was applied to the left motor cortex in 16 healthy subjects in a randomized, double-blind placebo-controlled crossover design, testing the effects of a single oral dose 20 mg of diazepam, a positive modulator at the GABAA receptor, vs. 50 mg of the GABAB receptor agonist baclofen on SICI of TEPs. We found significant SICI of the N100 and P180 TEPs prior to drug intake. Diazepam reduced SICI of the N100 TEP, while baclofen enhanced it. Compared to our previous ppTMS-EEG results on LICI, the SICI effects on TEPs, including their drug modulation, were largely analogous. Findings suggest a similar interaction of paired-pulse effects on TEPs irrespective of the interstimulus interval. Therefore, SICI and LICI as measured with TEPs cannot be directly derived from SICI and LICI measured with MEPs, but may offer novel insight into paired-pulse responses recorded directly from the brain rather than muscle. Copyright © 2018 Elsevier Inc. All rights reserved.

  16. Application of thermoelectricity to NDE of thermally aged cast duplex stainless steels and neutron irradiated ferritic steels

    International Nuclear Information System (INIS)

    Coste, J.F.; Leborgne, J.M.; Massoud, J.P.; Grisot, O.; Miloudi, S.

    1997-10-01

    The thermoelectric power (TEP) of an alloy depends mainly on its temperature, its chemical composition and its atomic arrangement. The TEP measurement technique is used in order to study and follow two degradation phenomena affecting some components of the primary loop of Pressurized Water Reactors (PWR). The first degradation phenomenon is the thermal aging of cast duplex stainless steel components. The de-mixing of the ferritic Fe-Cr-Ni slid solution is responsible for the decreasing of the mechanical characteristics. Laboratory studies have shown the sensitivity of TEP to the de-mixing phenomenon. TEP increases linearly with the ferrite content and with and Arrhenius-type aging parameter depending on time, temperature and activation energy. TEP is also correlated to mechanic characteristics. The second degradation phenomenon is the aging of ferritic steels due to neutron irradiation at about 290 deg C. In this case, the degradation mechanism is the formation of clusters of solute atoms and/or copper rich precipitates that causes the hardening of the material. As a first approach, a study of binary Fe-Cu alloys irradiated by electrons at 288 deg C has revealed the possibility of following the copper depletion of the ferritic matrix. Moreover, the recovery of the mechanical properties of the alloy by annealing can be monitored. Finally, a correlation between Vickers hardness and TEP has been established. (author)

  17. Is laparoscopic inguinal hernia repair more effective than open repair

    International Nuclear Information System (INIS)

    Aly, O.; Green, A.; Joy, M.; Wong, C.H.; Malik, M

    2011-01-01

    To systematically review randomized controlled trials, (RCT) evidence comparing Lichtenstein to total extraperitoneal (TEP) hernia repair in terms of clinical and cost effectiveness. Study Design: Case series. Place and Duration of Study: The study was conducted at University of Abderdeen, U.K. Methodology: A comprehensive online literature search was undertaken using databases such as MEDLINE, PubMed, EMBASE and Springerlink. Studies were then short listed according to the selection criteria (RCT with over 100 subject and English language publications from 1995 onwards) and appraised using the SIGN Methodology Checklist. A meta analysis of the data was also performed using RevMan software. Results: Analysis of reported data shows that TEP has less postoperative pain and return to work than Lichtenstein method. Operation time is shown to be longer in the TEP but this difference is shortened with increasing surgeon experience. The meta-analysis of the data on complications shows that there are no significant differences between the two types of procedures. TEP causes more short-term recurrences which are attributed to the learning curve effect. Long term recurrence rates on the other hand show no significant differences. At present TEP is slightly more expensive than Lichtenstein repair. Conclusion: Both TEP and Lichtenstein repair are clinically effective procedures. The choice between them should be made on a case-by-case basis; which depends on the patient's preference and characteristics such as age, work and health status. (author)

  18. 2-[{sup 18}F]fluoro-2-deoxy-D-glucose positron emission tomography (F.D.G.-PET) can identify chronic lymphocytic leukaemia (C.L.L.) stage A et stage B patients; La tomographie par emission de positons au 2-[{sup 18}F] fluoro-2-desoxy-D-glucose (TEP-FDG) permet d'identifier les stades A et B des leucemies lymphoides chroniques (LLC)

    Energy Technology Data Exchange (ETDEWEB)

    Berthelot, C.; Vervueren, L.; Le Jeune, J.J.; Couturier, O. [Centre Hospitalier Universitaire, Service de Medecine Nucleaire, 49 - Angers (France); Truchan-Graczyk, M.; Genevieve, F.; Ifrah, N. [Centre Hospitalier Universitaire, Service d' Hematologie, 49 - Angers (France); Poirier, A.L. [BEC, centre Paul-Papin, 49 -Angers (France); Artur-Guillemette, P. [Centre Hospitalier Universitaire, Service de Radiologie, 49 - Angers (France)

    2009-09-15

    Purpose: There is no data in the literature concerning the utility of 2-[{sup 18}F]fluoro-2-deoxy-d-glucose positron emission tomography (F.D.G.-PET) in chronic lymphocytic leukaemia (C.L.L.), except for the diagnosis of Richter's transformations. The purpose of this study was to assess the potential role of F.D.G.-PET in C.L.L. stages A and B. Materials and methods Thirty-five patients (61 {+-} 9 years; 11 women, 24 men; 8 B and 27 A) have benefited of a F.D.G.-PET scan at baseline, for example, before an eventual treatment. F.D.G.-PET scans were analyzed visually and the maximum values of the Standardised Uptake Value (S.U.V.{sub max}) were measured in the main lymph nodes areas. The ability of F.D.G.-PET to differentiate stages A and B patients was evaluated by Student's tests and Receiver Operating Characteristics (R.O.C.) analysis. Results All patients with a normal F.D.G.-PET (n = 18) were stages A. The remaining 17 patients (9 A and 8 B) showed hyper metabolisms in nodal areas above (n = 17) and below (n = 9) the diaphragm, and no visceral involvement. The lymph nodes hyper metabolisms were always bilateral, and of low intensity (= mediastinum; 9 A), or of higher intensity (= liver, 8 B). The S.U.V.{sub max} of stage B (n = 8) were significantly higher than those of the 27 stages A, in all lymph nodes areas except in mediastinum. The highest intensity of F.D.G. uptake was observed in axillary area in stages B patients (S.U.V.max = 2.74 {+-} 1.03). An axillary S.U.V.{sub max} of 1.33 is the most suitable value for the discrimination between stages A and B patients (R.O.C.; AUC = 0.968; sensitivity 1.00; specificity 0.91). Conclusion Lymph nodes hyper metabolisms are constant in the B stage, and more intense than in stage A. These anomalies are always bilateral, unlike what is observed in Richter's transformation. The intensity of axillary lymph nodes F.D.G. uptake can distinguish C.L.L. stages A and B. (authors)

  19. Temporal variation and interaction of full size spectrum Alcian blue stainable materials and water quality parameters in a reservoir.

    Science.gov (United States)

    Thuy, Nguyen Thi; Lin, Justin Chun-Te; Juang, Yaju; Huang, Chihpin

    2015-07-01

    This paper reports on the fate of different fractions of Alcian blue (AB) stainable material in Pao-Shan reservoir, Taiwan, in a one-year study (2013-2014) and an intensive study during phytoplankton bloom (2014). The interactions between the fractions, including AB stained particles, particle and colloidal transparent exopolymer particles (pTEP and cTEP), dissolved acid polysaccharide (dAPS), and their relationship to other water quality parameters were analyzed. The Flow Cytometer and Microscope (FlowCAM) was for first time used to characterize AB stained particles. The results of the one-year study likely showed relationships of pTEP concentration to phytoplankton count and chlorophyll a, while in the intensive study, AB stained particles abundance and pTEP concentration were correlated neither phytoplankton count nor chlorophyll a, but strongly positively correlated with some phytoplankton species' abundance. The difference indicates that sampling frequency and phytoplankton composition should be addressed for studying the links between AB stained fractions and phytoplankton. The interaction between different AB stained fractions further suggests that the majority of AB stained particles and pTEP would be directly generated by some phytoplankton species, whereas their abiotic generation by cTEP or dAPS may only have contributed partly to their formation. This differs from previous studies which generally posited that pTEP are mainly formed abiotically from dissolved precursors. Successful application of FlowCAM for visualization of AB stained particles recommends this technique by which particle morphologies can be conserved and morphological features of particle can be simultaneously elucidated. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Stochastic modelling of optimum initial body weight, daily weight gain and effect of genetic changes in ovulation rate and age at sexual maturity on total egg production of broiler breeders.

    Science.gov (United States)

    Alvarez, R; Hocking, P M

    2009-01-01

    1. A model that simulates the total production of eggs (TEP) in broiler breeders was used to predict the optimum initial (20 week) body weight (IBWexp), daily weight gains from 20 to 30 (DWGexp(20-30)) and 31 to 62 weeks of age (DWGexp(31-62)), age at photostimulation (affecting age at first egg, AFEexp), coefficients of variation of initial body weight (CV-IBWexp) and age at first egg (CV-AFEexp), and the effect of genetically increasing the numbers of yellow follicles at the onset of lay. 2. The results suggest that TEP in broiler breeders is very sensitive to changes in body weight gain during the first 10 weeks of the production period and body weight at the start of egg production, whereas changes in body weight gain after peak rate of lay showed only minor effects on TEP. Increasing CV-IBWexp was associated with a linear decrease in the mean and increased variability of TEP. 3. Decreasing AFEexp was negatively associated with TEP, whereas higher CV-AFEexp increased variability of TEP and had a trivial affect on the mean. 4. Results of the simulation suggested that reducing ovarian yellow follicle numbers by means of genetic selection could reduce the degree of feed restriction currently used in broiler breeder commercial stocks while maintaining total egg production. Higher numbers of yellow follicles associated with selection for higher growth rate would not result in lower egg production if the body weight target was maintained at the currently recommended commercial level and the effect on TEP of increasing the target in proportion to potential body weight may be relatively small.

  1. High pressure studies of as grown WX2-x single crystals

    International Nuclear Information System (INIS)

    Solanki, G.K.; Agarwal, M.K.; Patel, Yogesh A.

    2011-01-01

    The structural optical and transport properties of tungsten metal dichalogenides having layered structure have been extensively studied in the last two decades. These materials shows highly anisotropic behaviour and have been receiving considerable interest for a variety of applications. Several of these layered semiconductors have attracted attention as a new class of solar cell material. We present here the results of simultaneous resistivity and thermoelectric power (TEP) measurements upto 7 GPa on single crystals of WS 2 , WS 1.9 , WSe 2 and WSe 1.9 grown using Direct Vapour Transport (DVT) technique. The observations clearly shows WS 2 and WS 1.9 are more resistive compared to other two crystals. In all samples an exponential fall of resistivity on increases in pressure upto 2.1 GPa but after 2.2 GPa the resistivity decreases substantially with increases pressure. The TEP of WSe 2 increases steadily and reaches maximum at 0.65 GPa, while for WSe 1.9 TEP increases upto pressure 0.5 GPa. In both the cases after attaining the maximum TEP, then decreases monotonically with increase in pressure. TEP of WS 2 and WS 1.9 increase upto pressure 1.1 GPa, beyond 1.1 GPa pressure in both the cases TEP decreases steadily with further increase in pressure. In all the samples, the sign of TEP is positive indicating that all of them are p-type and remain p-type with increase in pressure. The variation of thermoelectric power factor with pressure has been thoroughly studied. An analysis of the data point out that perfectly stoichiometric crystals of WSe 2 work as superior thermoelectric materials. The results have been presented and implications have been discussed. (author)

  2. Intermittent theta-burst stimulation induces correlated changes in cortical and corticospinal excitability in healthy older subjects.

    Science.gov (United States)

    Gedankien, Tamara; Fried, Peter J; Pascual-Leone, Alvaro; Shafi, Mouhsin M

    2017-12-01

    We studied the correlation between motor evoked potentials (MEPs) and early TMS-evoked EEG potentials (TEPs) from single-pulse TMS before and after intermittent Theta Burst Stimulation (iTBS) to the left primary motor cortex (M1) in 17 healthy older participants. TMS was targeted to the hand region of M1 using a MRI-guided navigated brain stimulation system and a figure-of-eight biphasic coil. MEPs were recorded from the right first dorsal interosseous muscle using surface EMG. TEPs were extracted from a 61-channel EEG recording. Participants received 90 single TMS pulses at 120% of resting motor threshold before and after iTBS. Across all participants, the change in N15-P30 TEP and MEP amplitudes were significantly correlated (r=0.69; piTBS, whereas MEP amplitudes showed a significant increase. Changes in corticospinal reactivity and cortical reactivity induced by iTBS are related. However, the effect of iTBS on TEPs, unlike MEPs, is not straightforward. Our findings help elucidate the relationship between changes in cortical and corticospinal excitability in healthy older individuals. Going forward, TEPs may be used to evaluate the effects of theta-burst stimulation in non-motor brain regions. Copyright © 2017 International Federation of Clinical Neurophysiology. Published by Elsevier B.V. All rights reserved.

  3. Thermoelectric power measurements in Fe doped La sub 0 sub . sub 6 sub 5 Ca sub 0 sub . sub 3 sub 5 MnO sub 3

    CERN Document Server

    Aslam, A; Zubair, M; Akhtar, M J; Nadeem, M

    2002-01-01

    We report measurements of the thermoelectric power (TEP) on the La sub 0 sub . sub 6 sub 5 Ca sub 0 sub . sub 3 sub 5 Mn sub 1 sub - sub x Fe sub x O sub 3 system for 0.00 <= x <= 0.07. The ferromagnetic and metallic transition temperatures are lowered and the TEP shows an increasingly positive trend with the addition of Fe. We also observe a clear magnetic contribution that manifests itself as a peak in the TEP close to the critical temperature. The activation energies determined from the TEP are seen to be insensitive to the Fe content. The data are interpreted firstly as showing a decrease in the density of active holes, i.e. holes that can participate in the hopping process, with increasing Fe content. Secondly the data suggest the role of magnetic scattering due to the clusters formed by the antiferromagnetically coupled Fe. Abrupt changes in the variation of the TEP are observed at the concentration region x approx 0.04 consistent with the hole density variation and with previously reported transp...

  4. Secondary tracheoesophageal puncture in-office using Seldinger technique.

    Science.gov (United States)

    Britt, Christopher J; Lippert, Dylan; Kammer, Rachael; Ford, Charles N; Dailey, Seth H; McCulloch, Timothy; Hartig, Gregory

    2014-05-01

    Evaluate the safety and efficacy of in-office secondary tracheoesophageal puncture (TEP) technique using transnasal esophagoscopy (TNE) and the Seldinger technique in conjunction with a cricothyroidotomy kit for placement. Case series with chart review. Academic medical center. A retrospective chart review was performed on 83 subjects who underwent in-office secondary TEP. Variables that were examined included disease site, staging, histologic diagnosis, extent of resection and reconstruction, chemoradiation, functional voice status (as assessed by speech pathologist in most recent note), and complications directly related to the procedure. Eighty-three individuals from our institution met our criteria for in-office secondary TEP from 2005 to August 2012. Of these, 97.6% (81/83) had no complications of TEP. The overall complication rate was 2.4% (2/83). Complications included bleeding from puncture site and closure of puncture site after dislodgement of prosthesis at the time of puncture. Fluent conversational speech was achieved in 69.9% of all patients (58/83), and an additional 19.3% (16/83) achieved functional/intelligible speech; of those, 3.6% (3/83) were unable to achieve fluent conversational speech due to anatomic defects from previous surgery. An in-office TEP can be safely performed using the Seldinger technique with direct visualization using TNE, despite the extent of resection or reconstruction, with functional speech outcomes comparable to other studies available in the literature.

  5. 3D-printed tracheoesophageal puncture and prosthesis placement simulator.

    Science.gov (United States)

    Barber, Samuel R; Kozin, Elliott D; Naunheim, Matthew R; Sethi, Rosh; Remenschneider, Aaron K; Deschler, Daniel G

    A tracheoesophageal prosthesis (TEP) allows for speech after total laryngectomy. However, TEP placement is technically challenging, requiring a coordinated series of steps. Surgical simulators improve technical skills and reduce operative time. We hypothesize that a reusable 3-dimensional (3D)-printed TEP simulator will facilitate comprehension and rehearsal prior to actual procedures. The simulator was designed using Fusion360 (Autodesk, San Rafael, CA). Components were 3D-printed in-house using an Ultimaker 2+ (Ultimaker, Netherlands). Squid simulated the common tracheoesophageal wall. A Blom-Singer TEP (InHealth Technologies, Carpinteria, CA) replicated placement. Subjects watched an instructional video and completed pre- and post-simulation surveys. The simulator comprised 3D-printed parts: the esophageal lumen and superficial stoma. Squid was placed between components. Ten trainees participated. Significant differences existed between junior and senior residents with surveys regarding anatomy knowledge(p<0.05), technical details(p<0.01), and equipment setup(p<0.01). Subjects agreed that simulation felt accurate, and rehearsal raised confidence in future procedures. A 3D-printed TEP simulator is feasible for surgical training. Simulation involving multiple steps may accelerate technical skills and improve education. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Impact of changes in broth composition on Chlorella vulgaris cultivation in a membrane photobioreactor (MPBR) with permeate recycle.

    Science.gov (United States)

    Discart, V; Bilad, M R; Marbelia, L; Vankelecom, I F J

    2014-01-01

    A membrane photobioreactor (MPBR) is a proven and very useful concept in which microalgae can be simultaneously cultivated and pre-harvested. However, the behavior with respect to accumulation of algogenic organic matter, including transparent exopolymeric particles (TEPs), counter ions and unassimilated nutrients due to the recycling of the medium is still unclear, even though the understanding of this behavior is essential for the optimization of microalgae processing. Therefore, the dynamics of these compounds, especially TEPs, during coupled cultivation and harvesting of Chlorella vulgaris in an MPBR with permeate recycle are addressed in this study. Results show that TEPs are secreted during algae cell growth, and that their presence is thus inevitable. In the system with permeate recycle, substances such as counter ions and unassimilated nutrients get accumulated in the system. This was proven to limit the algae growth, together with the occurrence of bioflocculation due to an increasing broth pH. Copyright © 2013 Elsevier Ltd. All rights reserved.

  7. RNA-Seq of Tumor-Educated Platelets Enables Blood-Based Pan-Cancer, Multiclass, and Molecular Pathway Cancer Diagnostics.

    Science.gov (United States)

    Best, Myron G; Sol, Nik; Kooi, Irsan; Tannous, Jihane; Westerman, Bart A; Rustenburg, François; Schellen, Pepijn; Verschueren, Heleen; Post, Edward; Koster, Jan; Ylstra, Bauke; Ameziane, Najim; Dorsman, Josephine; Smit, Egbert F; Verheul, Henk M; Noske, David P; Reijneveld, Jaap C; Nilsson, R Jonas A; Tannous, Bakhos A; Wesseling, Pieter; Wurdinger, Thomas

    2015-11-09

    Tumor-educated blood platelets (TEPs) are implicated as central players in the systemic and local responses to tumor growth, thereby altering their RNA profile. We determined the diagnostic potential of TEPs by mRNA sequencing of 283 platelet samples. We distinguished 228 patients with localized and metastasized tumors from 55 healthy individuals with 96% accuracy. Across six different tumor types, the location of the primary tumor was correctly identified with 71% accuracy. Also, MET or HER2-positive, and mutant KRAS, EGFR, or PIK3CA tumors were accurately distinguished using surrogate TEP mRNA profiles. Our results indicate that blood platelets provide a valuable platform for pan-cancer, multiclass cancer, and companion diagnostics, possibly enabling clinical advances in blood-based "liquid biopsies". Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  8. Study of the solubility of iron in zirconium by thermoelectric power measurements

    International Nuclear Information System (INIS)

    Borrelly, R.; Merle, P.; Adami, L.; Centre National de la Recherche Scientifique, 69 - Villeurbanne

    1990-01-01

    Thermoelectric power (TEP) measurements are used to determine the solubility of iron in α-zirconium. A preliminary study shows that TEP is very sensitive to elements in solid solution, to cold-working and to the texture due to rolling in a temperature range including room temperature which is choosen for thermoelectric power measurements. The solutioning of iron obtained by a homogenization treatment and water-quench leads to a decrease of thermoelectric power. The conditions of homogenization treatments such that TEP variations are only due to the variation of iron content in solid solution have been determined. From these results the solubility of iron α-zirconium as a function of temperature has been determined. Moreover, the α-domain of the Zr-rich part of the Zr-Fe diagram has been completely delimited. A micrographic study has been made to confirm these results. (orig.)

  9. Thermoelectric power of YBa2Cu3Osub(7-δ) under pressure upto 9GPa

    International Nuclear Information System (INIS)

    Ramasesha, S.K.; Singh, A.K.

    1991-01-01

    Thermoelectric power (TEP) of two YBa 2 Cu 3 Osub(7-δ) compounds (with δ=0.17 and 0.21) was measured as a function of quasi-hydrostatic pressure up to 9GPa at 300 K on samples with low porosity. In both cases TEP decreases with increasing pressure, at a rate ∼0.8μVK -1 /GPa. The data obtained under hydrostatic pressure up to 3 GPa are in good agreement with those under quasi-hydrostatic pressure. The TEP of both compositions is found to decrease linearly at a rate 0.8 μVK -1 /GPa above 1.5 GPA. (author). 17 refs

  10. Reducing DNACPR complaints to zero: designing and implementing a treatment escalation plan using quality improvement methodology.

    Science.gov (United States)

    Shermon, Elizabeth; Munglani, Laura; Oram, Sarah; William, Linda; Abel, Julian

    2017-01-01

    Do Not Attempt Resuscitation (DNAR)decisions have traditionally formed the basis of ceiling of care discussions. However, poor quality discussions can lead to high patient and relative dissatisfaction, generating hospital complaints. Treatment escalation plans (TEPs) aim to highlight the wider remit of treatment options with a focus on effective communication. We aimed to improve TEP discussions and documentation at Weston General Hospital by introducing a standardised form. We aimed to develop a TEP document to reduce resuscitation-related complaints by improving communication and documentation. Qualitative and quantitative data were collected over 2 years and used to develop plan-do-study-act (PDSA) cycles using quality improvement methodology. Main barriers to improvement included time constraints and clinician's resistance. Analysis of patient liaison services data showed a progressive reduction in complaints regarding resuscitation, with no complaints having been received for the final six months of the project. Through use of a standardised form including treatment prompts, the quality of discussions and plans improved. Qualitative feedback demonstrated increased patient and relative satisfaction. In addition, junior doctors report the plans are helpful when making out-of-hours decisions. Development of a user-friendly form to document patient-guided TEPs helped junior doctors to lead advanced care planning discussions. The use of PDSA cycles demonstrated improvement in the quality of forms, which in turn improved communication, documentation and satisfaction. Future developments could include involvement of specialist teams to ensure TEP forms remain relevant to all clinical areas. In addition, with widespread use of the TEP forms, the traditional tick-box DNAR could be replaced to focus on patient-led care planning.

  11. A structured, extended training program to facilitate adoption of new techniques for practicing surgeons.

    Science.gov (United States)

    Greenberg, Jacob A; Jolles, Sally; Sullivan, Sarah; Quamme, Sudha Pavuluri; Funk, Luke M; Lidor, Anne O; Greenberg, Caprice; Pugh, Carla M

    2018-01-01

    Laparoscopic inguinal hernia repair has been shown to have significant benefits when compared to open inguinal hernia repair, yet remains underutilized in the United States. The traditional model of short, hands-on, cognitive courses to enhance the adoption of new techniques fails to lead to significant levels of practice implementation for most surgeons. We hypothesized that a comprehensive program would facilitate the adoption of laparoscopic inguinal hernia repair (TEP) for practicing surgeons. A team of experts in simulation, coaching, and hernia care created a comprehensive training program to facilitate the adoption of TEP. Three surgeons who routinely performed open inguinal hernia repair with greater than 50 cases annually were recruited to participate in the program. Coaches were selected based on their procedural expertise and underwent formal training in surgical coaching. Participants were required to evaluate all aspects of the educational program and were surveyed out to one year following completion of the program to assess for sustained adoption of TEP. All three participants successfully completed the first three steps of the seven-step program. Two participants completed the full course, while the third dropped out of the program due to time constraints and low case volume. Participant surgeons rated Orientation (4.7/5), GlovesOn training (5/5), and Preceptored Cases (5/5) as highly important training activities that contributed to advancing their knowledge and technical performance of the TEP procedure. At one year, both participants were performing TEPs for "most of their cases" and were confident in their ability to perform the procedure. The total cost of the program including all travel, personal coaching, and simulation was $8638.60 per participant. Our comprehensive educational program led to full and sustained adoption of TEP for those who completed the course. Time constraints, travel costs, and case volume are major considerations for

  12. Exopolymer Particles in the Sea Surface Microlayer (SML) of the Coastal Pacific Ocean

    Science.gov (United States)

    Thornton, D. C.; Brooks, S. D.; Chen, J.

    2015-12-01

    Exchanges of matter and energy between the ocean and atmosphere occur through the sea surface microlayer (SML). The SML is biogeochemically distinct from the underlying water and overlying atmosphere in terms of physical environment, chemical composition, and biological community. We sampled the Pacific Ocean in coastal waters off the state of Oregon (United States) along a seaward transect out from the mouth of the Columbia River (3 stations) and in deeper waters beyond the shelf break (2 stations) in July 2011. SML samples were collected using the glass plate method and the underlying water was sampled using a peristaltic pump from 1, 5 and 10 m depth. The samples were analyzed for carbohydrates and exopolymer particles. Carbohydrates were significantly enriched in the SML compared with the underlying water. The concentration of polysaccharides was higher than monosaccharides at all depths. We enumerated two classes of exopolymer particles: transparent exopolymer particles (TEP) and Coomassie staining particles (CSP). TEP are composed of acid polysaccharides and CSP are formed from proteins. While TEP have been widely studied, CSP are generally overlooked, despite the biogeochemical significance of proteins. Our data showed that TEP and CSP concentrations were enriched in the SML compared with the underlying waters in most cases. The ubiquitous presence of empty diatom frustules in the samples indicates that the collapse of a diatom bloom was the source of the exopolymers. Further, we conducted image analysis of particle size and abundance, which indicated that TEP and CSP are not the same particles and form distinct populations in the ocean. Our data confirm recent observations indicating that TEP are an important component of the SML. In addition, these data show that CSP are also important components of the SML.

  13. Customization of the voice prosthesis to prevent leakage from the enlarged tracheoesophageal puncture: results of a prospective trial.

    Science.gov (United States)

    Lewin, Jan S; Hutcheson, Katherine A; Barringer, Denise A; Croegaert, Lindsay E; Lisec, Asher; Chambers, Mark S

    2012-08-01

    Customization of the tracheoesophageal (TE) voice prosthesis (VP) is often preferred over surgical closure to prevent aspiration around the VP in laryngectomized patients with an enlarged tracheoesophageal puncture (TEP), but it has not been thoroughly evaluated. Single-institution prospective trial. A prospective trial was conducted to evaluate the effectiveness of a customized VP with the addition of an enlarged tracheal and/or esophageal collar in patients with leakage around an enlarged TEP. Absence of leakage around the VP after placement defined immediate effectiveness. Long-term success was defined by the prevention of adverse events related to leakage during the study period. Events that defined failure included: permanent gastrostomy dependence, aspiration pneumonia, and/or surgical TEP closure. Twenty-one patients with enlarged TEP were enrolled (2003-2006). Insertion of a customized VP was unsuccessful in one patient; 145 customizations were performed in the remaining 20 patients (median, 3.5 customizations) during the trial period. Of the customizations, 77% (112/145) prevented leakage immediately after VP insertion. The most common adverse event was dislodgement of the prosthesis (11%) or the collar alone (7%) in 18% (26/145) of customized VP placements. Six patients who died of disease were not evaluable for long-term outcomes. Long-term success was achieved in 80% (12/15) of evaluable patients who avoided permanent gastrostomy, aspiration pneumonia, and surgical TEP closure. Prosthetic customization offers an effective method to prevent leakage around the VP in many patients with an enlarged TEP, thereby preserving TE voice while avoiding surgical closure in this high-risk population. Copyright © 2012 The American Laryngological, Rhinological, and Otological Society, Inc.

  14. ESA's Food Security Thematic Exploitation Platform "Supporting Sustainable Food Production from Space"

    Science.gov (United States)

    Gilliams, S. J.

    2017-12-01

    In line with the paradigm shift in Earth Observation of "Bringing the users to the data", ESA provides collaborative, virtual work environments giving access to EO data and tools, processors, and ICT resources through coherent interfaces. These coherent interfaces are categorized thematically, tailored to the related user communities and named Thematic Exploitation Platforms (TEP). The Food Security Thematic Exploitation Platform (FS-TEP) is the youngest out of seven TEPs and is developed in an agile mode in close coordination with its users. It will provide a "one stop platform" for the extraction of information from EO data for services in the food security sector mainly in Europe & Africa, allowing both access to EO data and processing of these data sets. Thereby it will foster smart, data-intensive agricultural and aquacultural applications in the scientific, private and public domain. The FS-TEP builds on a large and heterogeneous user community, spanning from application developers in agriculture to aquaculture, from small-scale farmers to agricultural industry, from public science to the finance and insurance sectors, from local and national administration to international agencies. To meet the requirements of these groups, the FS-TEP will provide different frontend interfaces. Service pilots will demonstrate the platform's ability to support agriculture and aquaculture with tailored EO based information services.The project team developing the FS-TEP and implementing pilot services during a 30 months period (started in April 2017) is led by Vista GmbH, Germany, supported by CGI Italy, VITO, Belgium, and Hatfield Consultants, Canada. It is funded by ESA under contract number 4000120074/17/I-EF.

  15. Effect of heterogeneities on the thermoelectric power of pressure vessel steel

    International Nuclear Information System (INIS)

    Simonet, L.

    2006-12-01

    In service working conditions, the vessel of the Pressurized Water Reactors (PWR) undergoes an ageing due to irradiation. In order to follow the evolution of the mechanical characteristics of the steel in service, EDF launched a surveillance program which consists to carry out mechanical tests on samples aged in reactor. However, the results of these tests have the disadvantage to be affected by the presence of heterogeneities within the steel. Indeed, because of its manufacturing process, the steel contains segregated areas. Thus, EDF launched Thermoelectric Power Measurements (TEP) on the resilience samples of the surveillance program, to complete the mechanical tests and to help with their interpretation. However, these measurements are today difficult to analyse because they include at the same time the effect of the irradiation and the effect of the metallurgical heterogeneities. The aim of this work consisted in evaluating the effect of the heterogeneities on the TEP of the non-irradiated vessel steel. For that, a numerical model was developed which allows to calculate the TEP of a composite structure. We have shown that the model is pertinent to highlight the effect of the heterogeneities on the TEP of the vessel steel, which is considered like a 'matrix'/'segregation' composite. The model allowed us to put emphasis on the influence of different parameters on the TEP measurement. We have thus showed that the measurements conditions have an important effect on the obtained TEP value (influence of the applied pressure, the position of the sample on the device, the site of the metallurgical heterogeneities,...). (author)

  16. Zoogeography of the shorefish fauna of Clipperton Atoll

    Science.gov (United States)

    Robertson, D. R.; Allen, G. R.

    1996-06-01

    One hundred and fifteen species of fishes (14 oceanic, plus 101 shore and nearshore species) are known from Clipperton Island, a small, remote coral atoll in the tropical eastern Pacific (TEP). This fish fauna includes only ˜ 14% of the region's shallow-water species, and also is depauperate relative to the fish faunas of other isolated tropical islands. The island's isolation, small size, reduced habitat diversity, and oceanic environment contribute to this paucity of species. Fifty-two species at Clipperton can be identified as TEP; these include 37 widespread species, six species shared only with the Revillagigedo Islands [the nearest (950 km) offshore shoals], and eight endemic to Clipperton. Endemics species apparently have a mix of west and east Pacific origins. Sixty-three species are transpacific; they include three new records (of Naso surgeonfishes) that maybe vagrants recruited > 4,000 km from Oceania. Clipperton is situated at the juncture between the TEP and Oceania. Its fish fauna contains about equal numbers of TEP and transpacific species. This faunal structure reflects the relative influence of surface currents from Oceania and the TEP. Although most of Clipperton's transpacific shorefishes are widespread in eastern Oceania, the Clipperton fauna has specific affinities to the fauna of the Line Islands, which are located within the main eastbound current from Oceania. Clipperton may therefore be a major stepping stone for dispersal between Oceania and the remainder of the TEP. About 50% of the non-oceanic, tropical transpacific fishes occur there, and at least 75 % of those species apparently have resident populations at the island.

  17. Tromboembolismo pulmonar e anticonceptivos orais – a propósito de um caso clínico.

    Directory of Open Access Journals (Sweden)

    Fernando Matos

    1996-05-01

    Full Text Available RESUMO: A propósito de um caso de Tromboembolismo Pulmonar (TEP, em mulher jovem a fazer anticonceptivo oral (ACO, os AA fazem uma revisão sumária dos ACO como factor de risco no TEP. SUMMARY: In reference to a clinical case of Pulmonary Thromboembolism (PTE in a young woman taking oral contraceptives (OC, the authors review the role of OC as a risk factor in PTE. Palavras-chave: Contracepção oral, Tromboembolismo pulmonar, Factores de risco vascular, Key-words: Oral contraception, Pulmonary embolism, Vascular risk factors

  18. Study of thermoelectric power of Co-B liquid quenched amorphous alloys at relatively high temperature

    International Nuclear Information System (INIS)

    Naqvi, S.M.N.R.; Rizvi, S.D.H.; Raza, S.M.; Rizvi, S.; Hussain, A.; Rehman, F.

    1999-01-01

    Measurements of thermoelectric power TEP were carried out for the samples of Co-1 alloy with appropriate compositions of constitutions in the temperature range, 350K< T<760K. The analysis of data shows an inverse Gaussian profile. Ziman theoretical model was used to fit the resistivity data which shows an agreement. Dynamic recovery processes as well as formation of vacancies, interstials, intersection of basal dislocations and indeed pyramidal interlocking of dislocations for seeding scattering centers are responsible for residual TEP at relatively high temperatures Co-B LQA alloys also undergo into other structural changes at such temperatures. (author)

  19. Towards the Rosetta Stone of planet formation

    Directory of Open Access Journals (Sweden)

    Schmidt T.O.B.

    2011-02-01

    Full Text Available Transiting exoplanets (TEPs observed just ~10 Myrs after formation of their host systems may serve as the Rosetta Stone for planet formation theories. They would give strong constraints on several aspects of planet formation, e.g. time-scales (planet formation would then be possible within 10 Myrs, the radius of the planet could indicate whether planets form by gravitational collapse (being larger when young or accretion growth (being smaller when young. We present a survey, the main goal of which is to find and then characterise TEPs in very young open clusters.

  20. At the Turning Point of the Current Techno-Economic Paradigm: Commons-Based Peer Production, Desktop Manufacturing and the Role of Civil Society in the Perezian Framework

    Directory of Open Access Journals (Sweden)

    Vasilis Kostakis

    2013-01-01

    Full Text Available Following the theory of techno-economic paradigm shifts (TEPS, this paper calls attention to the phenomenon of Commons-based peer production (CBPP. In the context of the current paradigm, it argues that civil society can play an important role in creating favourable conditions for a more sustainable global knowledge society. Approaching tentatively the ways in which 3D printing and other desktop manufacturing technologies can be used in CBPP, it also explores the ways in which the partnership with the state may provide a supportive innovative institutional basis for taking the maximum advantage of the emerging synergies in the vein of TEPS theory.

  1. Unusual perceptual experiences, anomalous/paranormal experiences and proneness to Schizotypy

    OpenAIRE

    Parra, Alejandro; Universidad Abierta Interamericana

    2010-01-01

    Parece haber similitudes entre el trastorno esquizotípico de personalidad (TEP) y las experiencias paranormales. De hecho, algunos de los síntomas en el TEP en el Diagnostic and Statistical Manual of Mental Disorders (DSM-IV-TR) coinciden con un número de experiencias anómalo/paranormales. La esquizotipia positiva, que incluye pensamiento mágico, alucinaciones y otras experiencias perceptuales inusuales, también ha estado relacionada con experiencias y creencias paranormales. Sin embargo, las...

  2. ANALISIS COSTE-EFECTIVIDAD DE DISTINTOS MÉTODOS DE DIAGNÓSTICO POR IMAGEN DEL TROMBOEMBOLISMO PULMONAR AGUDO

    Directory of Open Access Journals (Sweden)

    Stella Maris Batallés

    2009-01-01

    Full Text Available La técnica diagnóstica óptima para detectar tromboembolismo pulmonar agudo (TEP continúa en discusión. La gammagrafía pulmonar de ventilación/perfusión ha sido el examen preferido durante décadas, pero con el advenimiento de nuevas pruebas de imágenes las posibilidades diagnósticas se ampliaron, siendo necesario evaluarlas desde la perspectiva del coste y de la efectividad. El objetivo de este trabajo fue evaluar distintos métodos de diagnóstico por imagen para detectar TEP agudo para determinar el más coste-efectivo. Métodos. Análisis de coste-efectividad (CE empleando un árbol de decisiones para modelar distintas pruebas (centellograma V/Q, TC helicoidal, angiografía por tomografía computada multidetector (TCMD, resonancia magnética por imágenes (RMI y arteriografía convencional. Se obtuvieron valores de sensibilidad, especificidad, valor predictivo positivo (VPP y negativo (VPN de las pruebas diagnósticas. Resultado medido: "caso detectado de TEP". Los costes evaluados fueron los directos, expresados en euros (t, incluyendo los secundarios a las complicaciones de los métodos diagnósticos. Se realizó un análisis de sensibilidad de una vía para evaluar la robustez de las conclusiones. Resultados. No se eliminaron pruebas por dominancia extendida. La tasa cruda de CE para TCMD fue de 486 t por cada caso de TEP detectado. El coste marginal entre la TC helicoidal y el centellograma V/Q fue de 103 t para detectar 8 casos adicionales de TEP, mientras que el coste marginal entre la TCMD y la TC helicoidal fue de 229 t para detectar un caso adicional de TEP. Conclusiones. La prueba diagnóstica más coste-efectiva fue la TCMD, hallazgo que mostró robustez en el análisis de sensibilidad. Sin embargo, el análisis de C-E incremental nos mostró que la TCMD costó 229 t más respeto a la TC helicoidal para lograr una mínima mejora en la efectividad de la prueba (detección de TEP agudo. El alto valor predictivo negativo de

  3. Trombose venosa profunda e suspeita de tromboembolismo pulmonar: avaliação simultânea por meio de angiotomografia pulmonar e venotomografia combinadas Deep venous thrombosis with suspected pulmonary embolism: simultaneous evaluation using combined CT venography and pulmonary CT angiography

    Directory of Open Access Journals (Sweden)

    Laura de Moraes Gomes

    2006-02-01

    Full Text Available OBJETIVO: Avaliar a ocorrência e a correlação de tromboembolismo pulmonar (TEP e trombose venosa profunda (TVP por meio de um protocolo único de angiotomografia computadorizada. MATERIAIS E MÉTODOS: Estudo prospectivo realizado de julho de 2003 a junho de 2004 no Hospital Copa D'Or, Rio de Janeiro, RJ. Foram analisadas 116 angiotomografias de pacientes com suspeita clínica de TEP. Após o estudo do tórax, com um intervalo de três minutos e sem injeção adicional de contraste, foram obtidos cortes do diafragma até os joelhos, a fim de pesquisar TVP. RESULTADOS: De 116 pacientes, 23 (19,8% cursaram com TEP, 24 com TVP (20,7%, 15 (12,9% apresentaram tanto TEP quanto TVP e 9 (7,8% apresentaram TVP na ausência de TEP. Dos 23 casos positivos de TEP, 15 apresentaram concomitantemente TVP (65,2%, enquanto em 8 (34,8% foi visto apenas TEP. Dos 24 casos positivos de TVP, 15 (62,5% apresentaram TEP associado, enquanto em 9 (37,5% foi encontrada TVP isolada. CONCLUSÃO: Os resultados demonstraram a forte relação entre TEP e TVP, a importância de pesquisar TVP nos casos com suspeita de TEP e a utilidade do uso combinado da angiotomografia de tórax e da venotomografia como alternativa de único exame de investigação de TEP e TVP simultaneamente.OBJECTIVE: To evaluate the occurrence and the correlation between pulmonary embolism (PE and deep venous thrombosis (DVT using a single CT angiography protocol. MATERIALS AND METHODS: This was a prospective study performed at Hospital Copa D'Or, Rio de Janeiro, Brazil from July 2003 to June 2004. We analyzed 116 CT angiography examinations of patients with clinical suspicion of PE. After an interval of approximately three minutes, venous phase images from the diaphragm to the knees were acquired without additional contrast injection in order to determine the presence of DVT. RESULTS: From the 116 patients studied, 23 (19.8% had PE, 24 (20.7% had DVT, 15 (12.9% had both PE and DVT and 9 (7.8% had DVT

  4. Tracers development for the PET study of nicotinic receptors: [{sup 11}C]-mecamylamine and [{sup 11}C]-SIB 1553A. Tritium and carbon-11 radiolabelling of a serine proteinase inhibitor: the t-PA{sub stop}; Developpement de traceurs pour l'etude des recepteurs nicotiniques par TEP: la [{sup 11}C]-mecamylamine et le [{sup 11}C]SIB 1553A. Radiomarquages par le tritium et le carbone-11 d'un inhibiteur d'une serine protease: le t-PA{sub stop}

    Energy Technology Data Exchange (ETDEWEB)

    Sobrio, F.

    2002-12-15

    In order to develop radiotracers for the Positron Emission Tomography (PET), we labelled both the mecamylamine and SIB-1553A with carbon-11 to study the nicotinic cholinergic receptors (nAChRs). The radiosynthesis of [{sup 11}C]-t-PA{sub stop} and the labelling with tritium of one analogue were realized for cerebral ischemia PET studies. The [{sup 11}C]-mecamylamine, a non-competitive and non-selective nAChRs antagonist was synthesized in 45 min via a N-[{sup 11}C]-methylation reaction. In the rat brain, the ex vivo studies showed no radio-metabolite 45 min after the injection of [{sup 11}C]-mecamylamine. The uptake kinetics in the rat brain or in vivo by PET in the anesthetized baboon or in the conscious monkey, reached a plateau around 45-50 min after injection. However, the saturation or displacement experiments did not permit to exhibit nor a significant difference of labelling between the different cerebral regions nor a specific uptake. In consequence, the [{sup 11}C]-mecamylamine was not an appropriate radioligand for nAChRs PET study. The labelling of [{sup 11}C]-SIB 1553A, a selective agonist for the nicotinic {beta}4 subunit, required the synthesis in 5 steps (56% overall yield) of precursor for the incorporation of carbon-11. The radiosynthesis was performed in 36 min by a N-[{sup 11}C]-methylation reaction (yield: 75%). The [{sup 11}C]-t-PA{sub stop} was obtained from [{sup 11}C]-KCN with yields from 80 to 90%. For the first time with carbon-11, the formation of an amidine group was realized from a nitrile group. The labelling by isotopic exchange of hydrogen by tritium of the t-PA{sub stop} did not permit to obtain the [{sup 3}H]-t-PA{sub stop} but a tritiated analogue. This compound will be used to study its vectorization by micro-encapsulation. (author)

  5. Pan African Medical Journal - Vol 28, No 1 (2017)

    African Journals Online (AJOL)

    Intérêt de la TEP-TDM dans le cancer broncho-pulmonaire primitif non à petite ..... of Nigerian children: effects of socio-economic, nutritional and housing factors ... among antenatal attendees at health facilities in West Pokot county, Kenya ...

  6. Pan African Medical Journal

    African Journals Online (AJOL)

    Intérêt de la TEP-TDM dans le cancer broncho-pulmonaire primitif non à petite ..... framework governing herbal medicine use and practice in Kenya: a review ... of Nigerian children: effects of socio-economic, nutritional and housing factors ...

  7. Organic carbon movement through two SWRO facilities from source water to pretreatment to product with relevance to membrane biofouling

    KAUST Repository

    Alshahri, Abdullah Hassan Mohammed

    2016-12-29

    The presence of algae, bacteria, various fractions of natural organic matter (NOM), and transparent exopolymer particles (TEP) in the raw water, after each pretreatment process and in the permeate and concentrate streams, were measured at two SWRO plants to assess biofouling potential. It was found that the most significant process controlling the concentration of algae, bacteria, and the biopolymer and humic substances was the intake type with the subsurface intake discharge showing significant reductions. The mixed media filtration process was marginally useful in removing some TOC and NOM, but had little effect on TEP removal. Some bacterial regrowth may be occurring in the cartridge filters, but the evidence is inconsistent. Significant quantities of the biopolymer and humic substance concentrations were found to be retained in the membranes, but the concentrations were significantly greater in the facility using an open-ocean intake. Bacteria and TEP were found in the permeate stream, which may document bacterial regrowth and TEP production downstream of the membrane process. Measurements of the organic carbon passage through SWRO facilities can be successfully used to evaluate pretreatment process effectiveness and to make SWRO plant operational improvements.

  8. Changes in feedwater organic matter concentrations based on intake type and pretreatment processes at SWRO facilities, Red Sea, Saudi Arabia

    KAUST Repository

    Dehwah, Abdullah

    2015-03-01

    Transparent exopolymer particles (TEP), natural organic matter, and bacterial concentrations in feedwater are important factors that can lead to membrane biofouling in seawater reverse osmosis (SWRO) systems. Two methods for controlling these concentrations in the feedwater prior to pretreatment have been suggested; use of subsurface intake systems or placement of the intake at a greater depth in the sea. These proposed solutions were tested at two SWRO facilities located along the Red Sea of Saudi Arabia. A shallow well intake system was very effective in reducing the algae and bacterial concentrations and somewhat effective in reducing TEP concentrations. An intake placed at a depth of 9. m below the surface was found to have limited impact on improving water quality compared to a surface intake. The algae and bacteria concentration in the feedwater (deep) was lower compared to the surface seawater, but the overall TEP concentration was higher. Bacteria and TEP measurements made in the pretreatment process train in the plant and after the cartridge filters suggest that regrowth of bacteria is occurring within the cartridge filters.

  9. A meta-analysis of surgical morbidity and recurrence after laparoscopic and open repair of primary unilateral inguinal hernia.

    LENUS (Irish Health Repository)

    O'Reilly, Elma A

    2012-05-01

    Laparoscopic inguinal hernia repair (LIHR), using a transabdominal preperitoneal (TAPP) or totally extraperitoneal (TEP) technique, is an alternative to conventional open inguinal hernia repair (OIHR). A consensus on outcomes of LIHR when compared with OIHR for primary, unilateral, inguinal hernia has not been reached.

  10. Alcian blue-stained particles in a eutrophic lake

    DEFF Research Database (Denmark)

    Worm, J.; Søndergaard, Morten

    1998-01-01

    We used a neutral solution of Alcian Blue to stain transparent particles in eutrophic Lake Frederiksborg Slotss0, Denmark. Alcian Blue-stained particles (ABSP) appeared to be similar to the so-called transparent exopolymer particles (TEP) identified with an acidic solution of Alcian Blue. Our...

  11. [Patients' intervention in a therapeutic education program dedicated to systemic lupus: definitions, setting and benefits].

    Science.gov (United States)

    Hervier, B; Magar, Y; Allab, F; Richard, K; Neves, Y; Danjou, S; Amoura, Z; Ayçaguer, S

    2015-10-01

    Though recommended, participation of patients with specific expertise in therapeutic education programs (TEP) is rare. This work reports the experience of a national reference centre for rare systemic diseases. Involvement of "expert patients" (EP) has been planned from the development of a TEP dedicated to systemic lupus: patients' roles and required expertise have been defined and linked to the pedagogical tools. Such patients have been recruited during individual interviews and called to participate to specific pedagogical training. EP intervention have been evaluated by questionnaire to EP and health care providers. Three EP's functions have been identified: sharing experiences, giving "tips and tricks" and promoting dialogue. EP's interventions has been organised into a hierarchy (from sharing to co-animation). Among 298 patients enrolled in the TEP, 25 (8.4%) have been identified as possible EP. Eight of them (32%) benefited from a specific training of 12 hours. Among these patients, two (25%) regularly participate to the education sessions. For EP as well as for health care providers, EP's intervention seems beneficial (visual scale scores of 7.5 and 9.5, respectively). Though difficult to organise, EP's intervention in TEP dedicated to rare systemic diseases seems useful and would earn to be increase. Copyright © 2015 Société nationale française de médecine interne (SNFMI). Published by Elsevier SAS. All rights reserved.

  12. SWRO feed water quality improvement using subsurface intakes in Oman, Spain, Turks and Caicos Islands, and Saudi Arabia

    KAUST Repository

    Rachman, Rinaldi; Li, Sheng; Missimer, Thomas M.

    2014-01-01

    water treatment close to that provided by energy-intensive, conventional pretreatment systems. SDI values were reduced in virtually all cases to below 3. In vertical wells, from 70 to 100% of the TEP and 50% of the TOC and DOC found in natural seawater

  13. JPRS Report, Epidemiology.

    Science.gov (United States)

    1989-07-19

    24 JPRS-TEP-89-013 19 JULY 1989 3 FEDERAL REPUBLIC OF GERMANY Bayer, Hoechst Test HIV Vaccine [Bonn TECHNOLOGIE NACHRICHTEN -MANAGEMENT...Hoechst Test HIV Vaccine MI89016 Bonn TECHNOLOGIE NACHRICHTEN - MANAGEMENTINFORMATIONEN in German 21 Feh 89 pp 16-17 [Excerpt] The Bayer and Hoechst

  14. GENDER PARTICIPATION IN TECHNICAL TRAINING INSTITUTIONS

    African Journals Online (AJOL)

    The paper focuses on skill training opportunities for females in Technical Education Programmes (TEP) in Kenya. In Africa, labour markets have become so competitive that females need to be assisted to enter such markets. Expanding skill-training opportunities for females in training institutions could meet this demand.

  15. The Effect of Lamotrigine and Levetiracetam on TMS-Evoked EEG Responses Depends on Stimulation Intensity

    Directory of Open Access Journals (Sweden)

    Isabella Premoli

    2017-10-01

    Full Text Available The combination of transcranial magnetic stimulation and electroencephalography (TMS-EEG has uncovered underlying mechanisms of two anti-epileptic medications: levetiracetam and lamotrigine. Despite their different mechanism of action, both drugs modulated TMS-evoked EEG potentials (TEPs in a similar way. Since both medications increase resting motor threshold (RMT, the current aim was to examine the similarities and differences in post-drug TEPs, depending on whether stimulation intensity was adjusted to take account of post-drug RMT increase. The experiment followed a placebo controlled, double blind, crossover design, involving a single dose of either lamotrigine or levetiracetam. When a drug-induced increase of RMT occurred, post-drug measurements involved two blocks of stimulations, using unadjusted and adjusted stimulation intensity. A cluster based permutation analysis of differences in TEP amplitude between adjusted and unadjusted stimulation intensity showed that lamotrigine induced a stronger modulation of the N45 TEP component compared to levetiracetam. Results highlight the impact of adjusting stimulation intensity.

  16. Authoritarian Parenting and Asian Adolescent School Performance: Insights from the US and Taiwan

    Science.gov (United States)

    Pong, Suet-ling; Johnston, Jamie; Chen, Vivien

    2010-01-01

    Our study re-examines the relationship between parenting and school performance among Asian students. We use two sources of data: wave I of the Adolescent Health Longitudinal Survey (Add Health), and waves I and II of the Taiwan Educational Panel Survey (TEPS). Analysis using Add Health reveals that the Asian-American/European-American difference…

  17. Magnetoelectric effect in cobalt ferrite–barium titanate composites ...

    Indian Academy of Sciences (India)

    relaxation process and resistivity of the materials. However, the conductivity behavior in. CoFe2O4–BaTiO3 composites has not been studied. In this paper we report the dc electrical conductivity and thermoelectric power (TEP) as a function of temperature for this system. Dielectric behavior is also studied to understand the ...

  18. Speech Rehabilitation For 10 Alaryngeal Patients Using Tracheoesophageal Puncture And Prosthesis Insertion In Amir Alam And Imam Khomeini Hospitals 2002-2003

    Directory of Open Access Journals (Sweden)

    M.T. Khorsi Ashtiani

    2006-05-01

    Full Text Available Background and Aim: Total laryngectomy following laryngeal cancer has many sequelae , that loss of voice is the most important of them. Tracheoesophageal puncture (TEP and prosthesis insertion has evolved into the most widely used and accepted technique for vocal rehabilitation. Materials and Methods: 10 patients that underwent TEP in Amir Alam and Imam Khomeini hospitals from Feb. 2002 through Nov. 2003; were included in this study. Prosthesis insertion in 4 patients is primary and in 6 patients is secondary; and all patients are men. Results: The age of patients was between 50 to 70. 90% of patients had history of cigarette smoking and 10% of them had history of drinking alcohol. Salivary leakage was seen in 30% of patients that was improved with conservative management. Fluency of speech in 30% of patients and intelligibility of speech & voice quality in 40% of patients is good. Conclusion: We could conclude that TEP has less complication & better speech results of other vocal rehabilitation methods. Carefully selection of patients & size of prosthesis has important role in results of TEP.

  19. Pre-Service Bilingual Teachers and Their Invisible Scars: Implications for Preparation Programs

    Science.gov (United States)

    Sarmiento-Arribalzaga, Matilde A.; Murillo, Luz A.

    2010-01-01

    In this paper, we describe how language "autobiographies" are used in a teacher preparation program (TEP) as a healing pedagogy to understand the impact longstanding traditions of symbolic violence in education have had on Latino students who are in the process of becoming teachers. Writing about themselves and their education experience…

  20. X-ray photoelectron spectroscopy study and thermoelectric properties of Al-doped ZnO thin films

    International Nuclear Information System (INIS)

    Li Li; Fang Liang; Zhou Xianju; Liu Ziyi; Zhao Liang; Jiang Sha

    2009-01-01

    In this paper, high quality Al-doped ZnO (AZO) thin films were prepared by direct current (DC) reactive magnetron sputtering using a Zn target (99.99%) containing Al of 1.5 wt.%. The films obtained were characterized by X-ray photoelectron spectroscopy (XPS) and thermoelectric measurements. The XPS results reveal that Zn and Al exist only in oxidized state, while there are dominant crystal lattice and rare adsorbed oxygen for O in the annealed AZO thin films. The studies of thermoelectric property show a striking thermoelectric effect in the AZO thin films. On the one hand, the thermoelectromotive and magnetothermoelectromotive forces increase linearly with increasing temperature difference (ΔT). On the other hand, the thermoelectric power (TEP) decreases with the electrical resistance of the sample. But the TEP increases with the increase of temperature below 300 K, and it nearly does not change around room temperature. The experimental results also demonstrate that the annealing treatment increases TEP, while the external magnetic field degrades TEP.

  1. Variations of Human DNA Polymerase Genes as Biomarkers of Prostate Cancer Progression

    Science.gov (United States)

    2011-07-01

    Pesche S, Latil A, Muzeau F, Cussenot O, Fournier G, Longy M, Eng C, Lidereau R. 1998. PTEN/MMAC1/TEP1 involvement in primary prostate cancers. Oncogene 16...skin fibroblasts from heterozygotes for the Lesch-Nyhan syndrome : a sensitive marker for carrier detection. Hum Hered 29:64–68. 48 HUMAN MUTATION, Vol

  2. Electrically Mediated Trauma Repair

    Science.gov (United States)

    1994-07-07

    potential (TEP) (Johnston and Hoshiko, 1971; Rick et al., 1988; Shi and Borgens, 1994). In the axolotl neurulae, a gradient of 10 - 20 mV/mm is...reach 60-80 mV/mm. A more shallow voltage gradient is observed in the transverse plane of axolotl neurulae associated with mirror image outwardly

  3. Mechanical Performance Evaluation of a Top End Piece for Dual Cooled Fuels

    International Nuclear Information System (INIS)

    Kim, Jae Yong; Yoon, Kyung Ho; Kim, Hyung Kyu; Choi, Woo Seok

    2011-01-01

    A fuel assembly consists of five major components, i.e., a top end piece (TEP), a bottom end piece (BEP), spacer grids (SGs), guide tubes (GTs) and an instrumentation tube (IT): in addition, it also includes fuel rods (FRs). The TEP/BEP should satisfy stress intensity limits according to the conditions A and B of ASME, Section III, Division 1.Subsection NB. In a dual-cooled fuel assembly, the array and position of fuel rods are different from those in a conventional PWR fuel assembly; these changes are necessary for achieving power uprating. The flow plates of the TEP and BEP have to be modified accordingly. The pattern and shape of the flow holes were newly designed. To verify the strength compatibility, the Tresca stress limit according to the ASME code was investigated in the case of an axial load of 22.241 kN. In this paper, the stress linearization procedure for strength evaluation of a newly designed TEP is presented

  4. Single incision laparoscopic surgery (SILS) inguinal hernia repair - recent clinical experiences of this novel technique.

    Science.gov (United States)

    Yussra, Y; Sutton, P A; Kosai, N R; Razman, J; Mishra, R K; Harunarashid, H; Das, S

    2013-01-01

    Inguinal hernia remains the most commonly encountered surgical problem. Various methods of repair have been described, and the most suitable one debated. Single port access (SPA) surgery is a rapidly evolving field, and has the advantage of affording 'scarless' surgery. Single incision laparoscopic surgery (SILS) for inguinal hernia repair is seen to be feasible in both total extraperitoneal (TEP) and transabdominal pre-peritoneal (TAPP) approaches. Data and peri-operative information on both of these however are limited. We aimed to review the clinical experience, feasibility and short term complications related to laparoscopic inguinal hernia repair via single port access. A literature search was performed using Google Scholar, Springerlink Library, Highwire Press, Surgical Endoscopy Journal, World Journal of Surgery and Medscape. The following search terms were used: laparoscopic hernia repair, TAPP, TEP, single incision laparoscopic surgery (SILS). Fourteen articles in English language related to SILS inguinal hernia repair were identified. Nine articles were related to TEP repair and the remaining 5 to TAPP. A total of 340 patients were reported within these studies: 294 patients having a TEP repair and 46 a TAPP. Only two cases of recurrence were reported. Various ports have been utilized, including the SILS port, Tri-Port and a custom- made port using conventional laparoscopic instruments. The duration of surgery was 40-100 minutes and the average length of hospital stay was one day. Early outcomes of this novel technique show it to be feasible, safe and with potentially better cosmetic outcome.

  5. Swarm Intelligence-Enhanced Detection of Non-Small-Cell Lung Cancer Using Tumor-Educated Platelets

    NARCIS (Netherlands)

    Best, Myron G.; Sol, Nik; In ‘t Veld, Sjors G.J.G.; Vancura, Adrienne; Muller, Mirte; Niemeijer, Anna Larissa N.; Fejes, Aniko V.; Tjon Kon Fat, Lee Ann; Huis in 't Veld, Anna E; Leurs, Cyra; Le Large, Tessa Y.; Meijer, Laura L.; Kooi, Irsan E.; Rustenburg, François; Schellen, Pepijn; Verschueren, Heleen; Post, Edward; Wedekind, Laurine E.; Bracht, Jillian; Esenkbrink, Michelle; Wils, Leon; Favaro, Francesca; Schoonhoven, Jilian D.; Tannous, Jihane; Meijers-Heijboer, Hanne; Kazemier, Geert; Giovannetti, Elisa; Reijneveld, Jaap C.; Idema, Sander; Killestein, Joep; Heger, Michal; de Jager, Saskia C.; Urbanus, Rolf T.; Hoefer, Imo E.; Pasterkamp, Gerard; Mannhalter, Christine; Gomez-Arroyo, Jose; Bogaard, Harm-Jan; Noske, David P.; Vandertop, W. Peter; van den Broek, Daan; Ylstra, Bauke; Nilsson, R. Jonas A; Wesseling, Pieter; Karachaliou, Niki; Rosell, Rafael; Lee-Lewandrowski, Elizabeth; Lewandrowski, Kent B.; Tannous, Bakhos A.; de Langen, Adrianus J.; Smit, Egbert F.; van den Heuvel, Michel M; Wurdinger, Thomas

    2017-01-01

    Blood-based liquid biopsies, including tumor-educated blood platelets (TEPs), have emerged as promising biomarker sources for non-invasive detection of cancer. Here we demonstrate that particle-swarm optimization (PSO)-enhanced algorithms enable efficient selection of RNA biomarker panels from

  6. Situating ICT in the Teacher Education Program: Overcoming Challenges, Fulfilling Expectations

    Science.gov (United States)

    Martinovic, Dragana; Zhang, Zuochen

    2012-01-01

    This exploratory case study examined pre-service teachers' expectations of and attitudes toward the learning and integrating of ICT into their teaching, and their perceptions of the availability and use of ICT in the Teacher Education Program (TEP) and their placement schools. For two years in a row the researchers collected data through online…

  7. Biogeochemical significance of transport exopolymer particles in the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    DileepKumar, M.; Sarma, V.V.S.S.; Ramaiah, N.; Gauns, M.; DeSousa, S.N.

    was found between waters of the Arabian Sea and the Bay of Bengal. The TEP concentrations were lower in the Bay of Bengal due to faster scavenging from water column because of interaction with mineral particles. They were higher and occurred even in intense...

  8. Effects of transparent exopolymer particles and suspended particles on the survival of Salmonella enterica serovar Typhimurium in seawater.

    Science.gov (United States)

    Davidson, Marion C F; Berardi, Terra; Aguilar, Beatriz; Byrne, Barbara A; Shapiro, Karen

    2015-03-01

    The bacterium Salmonella enterica can infect marine mammals and has been increasingly implicated in seafood-borne disease outbreaks in humans. Despite the risk this zoonotic agent poses to animals and people, little is known regarding the environmental factors that affect its persistence in the sea. The goal of this study was to evaluate the impact of two constituents on the survival of Salmonella in the marine environment: transparent exopolymer particles (TEP) and suspended particles. A decay experiment was conducted by spiking Salmonella into bottles containing seawater, seawater with alginic acid as a source of TEP, filtered seawater or filtered seawater with alginic acid. Survival of Salmonella was monitored using culture followed by enrichment assays to evaluate if the bacteria entered a viable but non-cultivable (VBNC) state. Salmonella cell counts dropped significantly faster (P ≤ 0.05) in the unfiltered seawater samples with and without TEP. The slowest decay occurred in filtered seawater containing alginic acid, with VBNC Salmonella persisting for 17 months. These findings suggest that TEP may favor Salmonella survival while suspended particles facilitate its decay. Insight on the survival of allochthonous, zoonotic pathogens in seawater can guide monitoring, management and policy decisions relevant to wildlife and human public health. © FEMS 2015. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  9. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Surface seawater samples were collected over a period of 27 months at a shallow water station in Dona Paula bay from 1998-2000.The samples were analyzed to assess the seasonal variations, inter-annual variability and the contributions of: transparent exopolymeric particles (TEP)concentration,; two forms of ...

  10. The Urban Exploitation Platform - An instrument for the global provision of indicators related to sustainable cities and communities

    Science.gov (United States)

    Esch, Thomas; Asamer, Hubert; Hirner, Andreas; Marconcini, Mattia; Metz, Annekatrin; Uereyen, Soner; Zeidler, Julian; Boettcher, Martin; Permana, Hans; Boissier, Enguerran; Mathot, Emmanuel; Soukop, Tomas; Balhar, Jakub; Svaton, Vaclav; Kuchar, Stepan

    2017-04-01

    The Sentinel fleet will provide a so-far unique coverage with Earth Observation (EO) data and therewith new opportunities for the implementation of methodologies to generate innovative geo-information products and services supporting the SDG targets. It is here where the TEP Urban project is supposed to initiate a step change by providing an open and participatory platform that allows any interested user to easily exploit large-volume EO data pools, in particular those of the European Sentinel and the US Landsat missions, and derive thematic geo-information, metrics and indicators related to the status and development of the built environment. Key component of TEP Urban initiative is the implementation of a web-based platform (https://urban-tep.eo.esa.int) employing distributed high-level computing infrastructures and providing key functionalities for i) high-performance access to satellite imagery and other data sources such as statistics or topographic data, ii) state-of-the-art pre-processing, analysis, and visualization techniques, iii) customized development and dissemination of algorithms, products and services, and iv) networking and communication. This contribution introduces the main facts about the TEP Urban platform, including a description of the general objectives, the platform systems design and functionalities, and the available portfolio of products and services that can directly serve the global provision of indicators for SDG targets, in particular related to SDG 11.

  11. Untitled

    Indian Academy of Sciences (India)

    These results are in complete conformity with the band model proposed by Dimmock et al (1966). According to this model, dE/dP changes sign from negative to positive values in going from an inverted band ordering to a normal situation. r. The present TEP and resistivity measurements under pressure can also be.

  12. Tank 241-SY-101 surface level rise remediation test and evaluation plan for transfer system

    International Nuclear Information System (INIS)

    BAUER, R.E.

    1999-01-01

    The purpose of this testing and evaluation plan (TEP) is to provide the high level guidance on testing requirements for ensuring that the equipment and systems to be implemented for remediation of the SY-101 waste level rise USQ are effective

  13. Stress Linearization and Strength Evaluation of the BEP's Flow Plates for a Dual Cooled Fuel Assembly

    International Nuclear Information System (INIS)

    Kim, Jae Yong; Yoon, Kyung Ho; Kang, Heung Seok; Lee, Young Ho; Lee, Kang Hee; Kim, Hyung Kyu

    2009-01-01

    A fuel assembly is composed of 5 major components, such as a top end piece (TEP), a bottom end piece (BEP), spacer grids (SGs), guide tubes (GTs) and an instrumentation tube (IT) and fuel rods (FRs). There are no ASME criteria about all components except for a TEP/BEP. The TEP/BEP should satisfy stress intensity limits in case of condition A and B of ASME, Section III, Division 1 . Subsection NB. In a dual cooled fuel assembly, the array and position of fuels are changed from those of a conventional PWR fuel assembly to achieve a power uprating. The flow plates of top/bottom end pieces (TEP/BEP) have to be modified into proper shape to provide flow holes to direct the heated coolant into/out of the fuel assembly but structural intensity of these plates within a 22.241 kN axial loading should satisfy Tresca stress limits in ASME code. In this paper, stress linearization procedure and strength evaluation of a newly designed BEP for the dual cooled fuel assembly are described

  14. Quorum-sensing regulator RhlR but not its autoinducer RhlI enables Pseudomonas to evade opsonization.

    Science.gov (United States)

    Haller, Samantha; Franchet, Adrien; Hakkim, Abdul; Chen, Jing; Drenkard, Eliana; Yu, Shen; Schirmeier, Stefanie; Li, Zi; Martins, Nelson; Ausubel, Frederick M; Liégeois, Samuel; Ferrandon, Dominique

    2018-03-09

    When Drosophila melanogaster feeds on Pseudomonas aeruginosa , some bacteria cross the intestinal barrier and eventually proliferate in the hemocoel. This process is limited by hemocytes through phagocytosis. P. aeruginosa requires the quorum-sensing regulator RhlR to elude the cellular immune response of the fly. RhlI synthesizes the autoinducer signal that activates RhlR. Here, we show that rhlI mutants are unexpectedly more virulent than rhlR mutants, both in fly and in nematode intestinal infection models, suggesting that RhlR has RhlI-independent functions. We also report that RhlR protects P. aeruginosa from opsonization mediated by the Drosophila thioester-containing protein 4 (Tep4). RhlR mutant bacteria show higher levels of Tep4- mediated opsonization, as compared to rhlI mutants, which prevents lethal bacteremia in the Drosophila hemocoel. In contrast, in a septic model of infection, in which bacteria are introduced directly into the hemocoel, Tep4 mutant flies are more resistant to wild-type P. aeruginosa, but not to the rhlR mutant. Thus, depending on the infection route, the Tep4 opsonin can either be protective or detrimental to host defense. © 2018 The Authors.

  15. An Exploratory Study Examining the Influence of the Number of Reading Methods Courses on Pre-Service and In-Service Teacher Perceptions of Ability to Teach Reading

    Science.gov (United States)

    Clark, Sarah

    2016-01-01

    Teacher education programmes (TEPs) are left with limited research on how the coursework they provide influences the perceptions teachers have about their ability to teach young children how to read--especially over the long term. The purpose of this study was to compare how teacher candidates rate their ability to teach reading at the conclusion…

  16. Changes in feedwater organic matter concentrations based on intake type and pretreatment processes at SWRO facilities, Red Sea, Saudi Arabia

    KAUST Repository

    Dehwah, Abdullah; Li, Sheng; Almashharawi, Samir; Winters, Harvey; Missimer, Thomas M.

    2015-01-01

    Transparent exopolymer particles (TEP), natural organic matter, and bacterial concentrations in feedwater are important factors that can lead to membrane biofouling in seawater reverse osmosis (SWRO) systems. Two methods for controlling these concentrations in the feedwater prior to pretreatment have been suggested; use of subsurface intake systems or placement of the intake at a greater depth in the sea. These proposed solutions were tested at two SWRO facilities located along the Red Sea of Saudi Arabia. A shallow well intake system was very effective in reducing the algae and bacterial concentrations and somewhat effective in reducing TEP concentrations. An intake placed at a depth of 9. m below the surface was found to have limited impact on improving water quality compared to a surface intake. The algae and bacteria concentration in the feedwater (deep) was lower compared to the surface seawater, but the overall TEP concentration was higher. Bacteria and TEP measurements made in the pretreatment process train in the plant and after the cartridge filters suggest that regrowth of bacteria is occurring within the cartridge filters.

  17. Total Extraperitoneal Hernia Repair: Residency Teaching Program and Outcome Evaluation.

    Science.gov (United States)

    Garofalo, Fabio; Mota-Moya, Pau; Munday, Andrew; Romy, Sébastien

    2017-01-01

    Total extraperitoneal (TEP) hernia repair has been shown to offer less pain, shorter postoperative hospital stay and earlier return to work when compared to open surgery. Our institution routinely performs TEP procedures for patients with primary or recurrent inguinal hernias. The aim of this study was to show that supervised senior residents can safely perform TEP repairs in a teaching setting. All consecutive patients treated for inguinal hernias by laparoscopic approach from October 2008 to June 2012 were retrospectively analyzed from a prospective database. A total of 219 TEP repairs were performed on 171 patients: 123 unilateral and 48 bilateral. The mean patient age was 51.6 years with a standard deviation (SD) of ± 15.9. Supervised senior residents performed 171 (78 %) and staff surgeons 48 (22 %) TEP repairs, respectively. Thirty-day morbidity included cases of inguinal paresthesias (0.4 %, n = 1), umbilical hematomas (0.9 %, n = 2), superficial wound infections (0.9 %, n = 2), scrotal hematomas (2.7 %, n = 6), postoperative urinary retentions (2.7 %, n = 6), chronic pain syndromes (5 %, n = 11) and postoperative seromas (6.7 %, n = 14). Overall, complication rates were 18.7 % for staff surgeons and 19.3 % for residents (p = 0.83). For staff surgeons and residents, mean operative times for unilateral hernia repairs were 65 min (SD ± 18.9) and 77.6 min (SD ± 29.8) (p = 0.043), respectively, while mean operative times for bilateral repairs were 115 min (SD ± 40.1) and 103.6 (SD ± 25.9) (p = 0.05). TEP repair is a safe procedure when performed by supervised senior surgical trainees. Teaching of TEP should be routinely included in general surgery residency programs.

  18. A top-five list for emergency medicine: a pilot project to improve the value of emergency care.

    Science.gov (United States)

    Schuur, Jeremiah D; Carney, Dylan P; Lyn, Everett T; Raja, Ali S; Michael, John A; Ross, Nicholas G; Venkatesh, Arjun K

    2014-04-01

    IMPORTANCE The mean cost of medical care in the United States is growing at an unsustainable rate; from 2003 through 2011, the cost for an emergency department (ED) visit rose 240%, from $560 to $1354. The diagnostic tests, treatments, and hospitalizations that emergency clinicians order result in significant costs. OBJECTIVE To create a "top-five" list of tests, treatments, and disposition decisions that are of little value, are amenable to standardization, and are actionable by emergency medicine clinicians. DESIGN, SETTING, AND PARTICIPANTS Modified Delphi consensus process and survey of 283 emergency medicine clinicians (physicians, physician assistants, and nurse practitioners) from 6 EDs. INTERVENTION We assembled a technical expert panel (TEP) and conducted a modified Delphi process to identify a top-five list using a 4-step process. In phase 1, we generated a list of low-value clinical decisions from TEP brainstorming and e-mail solicitation of clinicians. In phase 2, the TEP ranked items on contribution to cost, benefit to patients, and actionability by clinicians. In phase 3, we surveyed all ordering clinicians from the 6 EDs regarding distinct aspects of each item. In phase 4, the TEP voted for a final top-five list based on survey results and discussion. MAIN OUTCOMES AND MEASURES A top-five list for emergency medicine. The TEP ranked items on contribution to cost, benefit to patients, and actionability by clinicians. The survey asked clinicians to score items on the potential benefit or harm to patients and the provider actionability of each item. Voting and surveys used 5-point Likert scales. A Pearson interdomain correlation was used. RESULTS Phase 1 identified 64 low-value items. Phase 2 narrowed this list to 7 laboratory tests, 3 medications, 4 imaging studies, and 3 disposition decisions included in the phase 3 survey (71.0% response rate). All 17 items showed a significant positive correlation between benefit and actionability (r, 0.19-0.37 [P

  19. Cortical modulation of short-latency TMS-evoked potentials

    Directory of Open Access Journals (Sweden)

    Domenica eVeniero

    2013-01-01

    Full Text Available Transcranial magnetic stimulation - electroencephalogram (TMS-EEG co-registration offers the opportunity to test reactivity of brain areas across distinct conditions through TMS-evoked potentials (TEPs. Several TEPs have been described, their functional meaning being largely unknown. In particular, short-latency potentials peaking at 5 (P5 and 8 (N8 ms after the TMS pulse have been recently described, but because of their huge amplitude, the problem of whether their origin is cortical or not has been opened. To gain information about these components, we employed a protocol that modulates primary motor cortex excitability (MI through an exclusively cortical phenomena: low frequency stimulation of premotor area (PMC. TMS was applied simultaneously with EEG recording from 70 electrodes. Amplitude of TEPs evoked by 200 single-pulses TMS delivered over MI at 110% of resting motor threshold was measured before and after applying 900 TMS conditioning stimuli to left premotor cortex with 1 Hz repetition rate. Single subject analyses showed reduction in TEPs amplitude after PMC conditioning in a sample of participants and increase in TEPs amplitude in two subjects. No effects were found on corticospinal excitability as recorded by motor evoked potentials (MEPs. Furthermore, correlation analysis showed an inverse relation between the effects of the conditioning protocol on P5-N8 complex amplitude and MEPs amplitude. Because the effects of the used protocol have been ascribed to a cortical interaction between premotor area and MI, we suggest that despite the sign of P5-N8 amplitude modulation is not consistent across participant, this modulation could indicate, at least in part, their cortical origin. We conclude that with an accurate experimental procedure early-latency components can be used to evaluate the reactivity of the stimulated cortex.

  20. The Mosquito Melanization Response Is Implicated in Defense against the Entomopathogenic Fungus Beauveria bassiana

    Science.gov (United States)

    Osta, Mike A.

    2012-01-01

    Mosquito immunity studies have focused mainly on characterizing immune effector mechanisms elicited against parasites, bacteria and more recently, viruses. However, those elicited against entomopathogenic fungi remain poorly understood, despite the ubiquitous nature of these microorganisms and their unique invasion route that bypasses the midgut epithelium, an important immune tissue and physical barrier. Here, we used the malaria vector Anopheles gambiae as a model to investigate the role of melanization, a potent immune effector mechanism of arthropods, in mosquito defense against the entomopathogenic fungus Beauveria bassiana, using in vivo functional genetic analysis and confocal microscopy. The temporal monitoring of fungal growth in mosquitoes injected with B. bassiana conidia showed that melanin eventually formed on all stages, including conidia, germ tubes and hyphae, except the single cell hyphal bodies. Nevertheless, melanin rarely aborted the growth of any of these stages and the mycelium continued growing despite being melanized. Silencing TEP1 and CLIPA8, key positive regulators of Plasmodium and bacterial melanization in A. gambiae, abolished completely melanin formation on hyphae but not on germinating conidia or germ tubes. The detection of a layer of hemocytes surrounding germinating conidia but not hyphae suggested that melanization of early fungal stages is cell-mediated while that of late stages is a humoral response dependent on TEP1 and CLIPA8. Microscopic analysis revealed specific association of TEP1 with surfaces of hyphae and the requirement of both, TEP1 and CLIPA8, for recruiting phenoloxidase to these surfaces. Finally, fungal proliferation was more rapid in TEP1 and CLIPA8 knockdown mosquitoes which exhibited increased sensitivity to natural B. bassiana infections than controls. In sum, the mosquito melanization response retards significantly B. bassiana growth and dissemination, a finding that may be exploited to design transgenic

  1. Effects of triethyl phosphate and nitrate on electrokinetically enhanced biodegradation of diesel in low permeability soils.

    Science.gov (United States)

    Lee, G T; Ro, H M; Lee, S M

    2007-08-01

    Bench-scale experiments for electrokinetically enhanced bioremediation of diesel in low permeability soils were conducted. An electrokinetic reactor (ER) was filled with kaolin that was artificially contaminated with diesel at a level of 2500 mg kg(-1). A constant voltage gradient of 1.0 V cm(-1) was applied. In phosphorus transport experiments, KH2PO4 was not distributed homogeneously along the ER, and most of the transported phosphorus was converted to water-insoluble aluminum phosphate after 12 days of electrokinetic (EK) operation. However, the advancing P front of triethyl phosphate (TEP) progressed with time and resulted in uniform P distribution. The treatments employed in the electrokinetically enhanced bioremediation of diesel were control (no addition of nitrogen and phosphorus), NP (KNO3+ KH2PO4), NT (KNO3+ TEP), UP (urea+ KH2PO4), and UT (urea+TEP). Analysis of effluent collected during the first 12 days of EK operation showed that diesel was not removed from the kaolin. After nutrient delivery, using the EK operation, the ER was transferred into an incubator for the biodegradation process. After 60 days of biodegradation, the concentrations of diesel in the kaolin for the NP, NT, UP, UT, and control treatments were 1356, 1002, 1658, 1612, and 2003 mg kg(-1), respectively. The ratio of biodegraded diesel concentration to initial concentration (2465 mg kg(-1)) in NP, NT, UP, UT, and control were 45.0%, 59.4%, 32.7%, 34.6%, and 18.7%, respectively. This result showed that TEP, treated along with NO3-, was most effective for the biodegradation of diesel. TEP was delivered more efficiently to the target zones and with less phosphorus loss than KH2PO4. However, this facilitated phosphorus delivery was effective in biodegrading diesel under anaerobic conditions only when electron acceptors, such as NO3-, were present.

  2. Protein and carbohydrate exopolymer particles in the sea surface microlayer (SML

    Directory of Open Access Journals (Sweden)

    Daniel Conrad Ogilvie Thornton

    2016-08-01

    Full Text Available Exchanges of matter and energy between ocean and atmosphere occur through the sea surface microlayer (SML. The SML is the thin surface layer of the ocean at the ocean-atmosphere interface that has distinctive physical, chemical and biological properties compared with the underlying water. We measured the concentration of two types of exopolymer particles in the SML and underlying water in the Pacific Ocean off the coast of Oregon (United States during July 2011. Transparent exopolymer particles (TEP are defined by their acidic polysaccharide content, whereas Coomassie staining particles (CSP are composed of protein. TEP and CSP were ubiquitous in the SML. TEP were not significantly enriched in the SML compared with the underlying water. CSP were significantly enriched in the SML, with an enrichment factor (EF of 1.4 to 2.4. The distribution of exopolymer particles in the water and microscopic imaging indicated that TEP and CSP are distinct populations of particles rather than different chemical components of the same particles. Dissolved polysaccharides were not enriched in the SML, whereas monosaccharides had an EF of 1.2 to 1.8. Sampling occurred during the collapse of a diatom bloom, and diatoms were found both in the water column and SML. While there were living diatoms in the samples, most of the diatoms were dead and there were abundant empty frustules covered in layer of TEP. The collapsing diatom bloom was probably the source of exopolymer particles to both the SML and underlying water. Exopolymer particles are a component of the SML that may play a significant role in the marine carbon and nitrogen cycles, and the exchange of material between ocean and atmosphere.

  3. Cryoelectron microscopy imaging of recombinant and tissue derived vaults: localization of the MVP N termini and VPARP.

    Science.gov (United States)

    Mikyas, Yeshi; Makabi, Miriam; Raval-Fernandes, Sujna; Harrington, Lea; Kickhoefer, Valerie A; Rome, Leonard H; Stewart, Phoebe L

    2004-11-12

    The vault is a highly conserved ribonucleoprotein particle found in all higher eukaryotes. It has a barrel-shaped structure and is composed of the major vault protein (MVP); vault poly(ADP-ribose) polymerase (VPARP); telomerase-associated protein 1 (TEP1); and small untranslated RNA (vRNA). Although its strong conservation and high abundance indicate an important cellular role, the function of the vault is unknown. In humans, vaults have been implicated in multidrug resistance during chemotherapy. Recently, assembly of recombinant vaults has been established in insect cells expressing only MVP. Here, we demonstrate that co-expression of MVP with one or both of the other two vault proteins results in their co-assembly into regularly shaped vaults. Particles assembled from MVP with N-terminal peptide tags of various length are compared. Cryoelectron microscopy (cryoEM) and single-particle image reconstruction methods were used to determine the structure of nine recombinant vaults of various composition, as well as wild-type and TEP1-deficient mouse vaults. Recombinant vaults with MVP N-terminal peptide tags showed internal density that varied in size with the length of the tag. Reconstruction of a recombinant vault with a cysteine-rich tag revealed 48-fold rotational symmetry for the vault. A model is proposed for the organization of MVP within the vault with all of the MVP N termini interacting non-covalently at the vault midsection and 48 copies of MVP forming each half vault. CryoEM difference mapping localized VPARP to three density bands lining the inner surface of the vault. Difference maps designed to localize TEP1 showed only weak density inside of the caps, suggesting that TEP1 may interact with MVP via a small interaction region. In the absence of atomic-resolution structures for either VPARP or TEP1, fold recognition methods were applied. A total of 21 repeats were predicted for the TEP1 WD-repeat domain, suggesting an unusually large beta-propeller fold.

  4. Evaluation of outcome of totally extra peritoneal laparoscopic inguinal hernia repair with lichtenstein open repair

    International Nuclear Information System (INIS)

    Ahmed, I.; Dian, A.; Azam, U.F.; Khan, M.

    2015-01-01

    The objective of this study was to evaluate outcome of total extraperitoneal laparoscopic inguinal hernia repair with Lichtenstein open repair in terms of postoperative pain. Study Design: Quasi experimental study. Place and Duration of Study: Surgical unit l Rawalpindi and Allied hospitals from January to June 2012. Patients and Methods: Sixty patients, with unilateral, primary, inguinal hernia were alternately allocated to undergo either total extraperitoneal (TEP) laparoscopic repair of inguinal hernia or Lichtenstein tension free, mesh repair of inguinal hernia. Pain scores at 12, 24, and 48 hours and at 7 days of follow up were noted using a visual analogue scale. Total number of intravenous injections of Diclofenac Sodium requested by the patient for pain relief was also noted. Results: At 12 hours after surgery, the mean pain scores in the TEP group were 3.1 ± 1.8 and in the Lichtenstein group they were 4.2 ± 2.1 (p 0.031). At 24 hours after surgery, the scores were 2.3 ± 1.5 and 3.1 ± 1.9 for the TEP and Lichtenstein groups, respectively (p = 0.026). At 48 hours after surgery, the mean pain scores in the TEP group were 1.5 ± 1.1 while in the Lichtenstein group they were 2.0 ± 1.6 (p = 0.041). At 7 days after surgery, the scores were 0.3 ± 0.5 in the TEP group and 0.4 ± 0.8 in the Lichtenstein group (0.137). The mean number of injection of Diclofenac Sodium required by the TEP and Lichtenstein groups was 3.1 ± 1.6 and 5.8 ± 2.2, respectively (p = 0.011). Conclusion: Less postoperative pain and requirement for analgesics were reported by patients who underwent total extraperitoneal laparoscopic repair of inguinal hernia as compared to those who underwent inguinal hernia repair by Lichtenstein tension free mesh hernioplasty. (author)

  5. Improved final predicted height with the injection of leuprolide in children with earlier puberty: A retrospective cohort study.

    Directory of Open Access Journals (Sweden)

    Yi-Chun Lin

    Full Text Available The adult height of children with early onset puberty is limited by the premature maturation of hypothalamic-pituitary-gonadal axis. To evaluate the effects of gonadotropin-releasing hormone analog (GnRHa treatment on the final height (FH and bone maturation rate (BMR in girls with early puberty (EP or idiopathic central precocious puberty (ICPP, we examined data from girls who were diagnosed with EP or ICPP and underwent GnRHa (Leuplin Depot: 3.75 mg/month at China Medical University Hospital, in Taiwan, between 2006 and 2015. Patients were observed until the achievement of FH and divided into an "EP group" (T-ep and "ICPP group" (T-icpp according to the age of onset of puberty. Eighty-seven patients were enrolled (T-ep, N = 44, puberty onset at 8-10 years; T-icpp, N = 43, puberty onset before 8 years. The demographic data of girls with EP or IPP was characterized. BMR, change in predicted final height (PFH after GnRHa treatment, target height (TH and FH were measured. After GnRHa treatment, the study groups (T-ep: 160.24±6.18 cm, T-icpp: 158.99±5.92 cm both had higher PFH than at initiation (T-ep: 159.83±7.19 cm, T-icpp: 158.58±5.93 cm. There was deceleration of BMR in both groups (T-ep: 0.57±0.39; T-icpp: 0.97±0.97 and a significant difference between the groups (p = 0.027. The gap in FH standard deviation scores (SDS and TH SDS had a significant difference in T-ep (p = 0.045 but not in T-icpp. Moreover, there was no difference in the gap of PFH SDS between the 1st and final treatment in both groups. We concluded that GnRHa decelerated BMR in girls with earlier puberty. Further prospective clinical studies are warranted.

  6. Influence of solids retention time on membrane fouling: characterization of extracellular polymeric substances and soluble microbial products.

    Science.gov (United States)

    Duan, Liang; Tian, Zhiyong; Song, Yonghui; Jiang, Wei; Tian, Yuan; Li, Shan

    2015-01-01

    The objective of this study was to investigate the influence of solids retention time (SRT) on membrane fouling and the characteristics of biomacromolecules. Four identical laboratory-scale membrane bioreactors (MBRs) were operated with SRTs for 10, 20, 40 and 80 days. The results indicated that membrane fouling occurred faster and more readily under short SRTs. Fouling resistance was the primary source of filtration resistance. The modified fouling index (MFI) results suggested that the more ready fouling at short SRTs could be attributed to higher concentrations of soluble microbial products (SMP). Fourier transform infrared (FTIR) spectra indicated that the SRT had a weak influence on the functional groups of the total extracellular polymeric substances (TEPS) and SMP. However, the MBR under a short SRT had more low-molecular-weight (MW) compounds (100 kDa). Aromatic protein and tryptophan protein-like substances were the dominant groups in the TEPS and SMP, respectively.

  7. Tratamento de tromboembolismo pulmonar por aspiração percutânea do trombo: relato de caso

    OpenAIRE

    Góes Junior,Adenauer Marinho de Oliveira; Mascarenhas,Fabricio; Mourão,Guilherme de Souza; Elkis,Henrique; Pieruccetti,Marco Antônio

    2010-01-01

    O tromboembolismo pulmonar (TEP) maciço é uma importante causa de mortalidade. A principal causa de óbito é a disfunção do ventrículo direito, provocada pela alta resistência ao seu fluxo de ejeção, e a sobrevida do paciente, nessas situações, depende da pronta desobstrução das artérias pulmonares. A anticoagulação, o uso de trombolíticos e a embolectomia pulmonar representam opções terapêuticas consolidadas para diferentes cenários clínicos de TEP. A Radiologia Intervencionista representa ho...

  8. Project W-314 specific test and evaluation plan for AZ tank farm upgrades

    International Nuclear Information System (INIS)

    Hays, W.H.

    1998-01-01

    The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made by the addition of the SN-631 transfer line from the AZ-O1A pit to the AZ-02A pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation P1 an (TEP). Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities, etc), Factory Tests and Inspections (FTIs), installation tests and inspections, Construction Tests and Inspections (CTIs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). The STEP will be utilized in conjunction with the TEP for verification and validation

  9. Pulmonary embolism: Prospective comparison of spiral CT with ventilation - perfusion scintigraphy

    International Nuclear Information System (INIS)

    Mayo Jhon R; Remi Jardin, Martine; Muller Mestor I

    1999-01-01

    The pulmonary thromboembolism (PTE) it is an entity common with great morbidity and mortality that it requires a diagnosis soon and specify. Commonly the ventilation gammagraphy - perfusion has been the used exam of first more frequent line when one suspects the PTE but unfortunately a great quantity of reports is called of intermediate probability, for what requires complementary studies, to confirm or to discard the diagnosis. A prospective study was made with 142 patients that had suspicion of TEP in the hospital of Vancouver (Canada) and in the hospital of Calmette (France), being carried out in all gammagraphy of ventilation-perfusion and helical CT, being only taken to lung angiography to those that not had high clinical suspicion of TEP with gammagraphy or helical CT very suggestive or tuneless, undergoing the results valuation for different observers

  10. A study of the inhibiton of copper corrosion by triethyl phosphate and triphenyl phosphate self-assembled monolayers

    Directory of Open Access Journals (Sweden)

    HOUYI MA

    2006-02-01

    Full Text Available Two kinds of phosphates, triethyl phosphate (TEP and triphenyl phosphate (TPP, were used to form self-assembled monolayers for the inhibition of the corrosion of copper in 0.2 mol dm–3 NaCl solution. Electrochemical impedance spectroscopy (EIS was applied to investigate the inhibition effects. The results showed that their inhibition ability first increased with increasing immersion time in ethanolic solutions of the corresponding compounds. However, when the immersion time was increased over some critical point, the inhibition effect decreased. For the same immersion time, the inhibition effect of the TPP monolayer was more pronounced than that of the TEP monolayer. Thus, ab initio calculations were used to interpret the relationship between the inhibition effects and the structures of the compounds.

  11. Swarm Intelligence-Enhanced Detection of Non-Small-Cell Lung Cancer Using Tumor-Educated Platelets.

    Science.gov (United States)

    Best, Myron G; Sol, Nik; In 't Veld, Sjors G J G; Vancura, Adrienne; Muller, Mirte; Niemeijer, Anna-Larissa N; Fejes, Aniko V; Tjon Kon Fat, Lee-Ann; Huis In 't Veld, Anna E; Leurs, Cyra; Le Large, Tessa Y; Meijer, Laura L; Kooi, Irsan E; Rustenburg, François; Schellen, Pepijn; Verschueren, Heleen; Post, Edward; Wedekind, Laurine E; Bracht, Jillian; Esenkbrink, Michelle; Wils, Leon; Favaro, Francesca; Schoonhoven, Jilian D; Tannous, Jihane; Meijers-Heijboer, Hanne; Kazemier, Geert; Giovannetti, Elisa; Reijneveld, Jaap C; Idema, Sander; Killestein, Joep; Heger, Michal; de Jager, Saskia C; Urbanus, Rolf T; Hoefer, Imo E; Pasterkamp, Gerard; Mannhalter, Christine; Gomez-Arroyo, Jose; Bogaard, Harm-Jan; Noske, David P; Vandertop, W Peter; van den Broek, Daan; Ylstra, Bauke; Nilsson, R Jonas A; Wesseling, Pieter; Karachaliou, Niki; Rosell, Rafael; Lee-Lewandrowski, Elizabeth; Lewandrowski, Kent B; Tannous, Bakhos A; de Langen, Adrianus J; Smit, Egbert F; van den Heuvel, Michel M; Wurdinger, Thomas

    2017-08-14

    Blood-based liquid biopsies, including tumor-educated blood platelets (TEPs), have emerged as promising biomarker sources for non-invasive detection of cancer. Here we demonstrate that particle-swarm optimization (PSO)-enhanced algorithms enable efficient selection of RNA biomarker panels from platelet RNA-sequencing libraries (n = 779). This resulted in accurate TEP-based detection of early- and late-stage non-small-cell lung cancer (n = 518 late-stage validation cohort, accuracy, 88%; AUC, 0.94; 95% CI, 0.92-0.96; p swarm intelligence may also benefit the optimization of diagnostics readout of other liquid biopsy biosources. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  12. Test and evaluation of the Navy half-watt RTG

    International Nuclear Information System (INIS)

    Rosell, F.E. Jr.; Eggers, P.E.; Gawthrop, W.E.; Rouklove, P.G.; Truscello, V.C.

    1976-01-01

    In the autumn of 1975 the Navy took delivery of eight small-sized, plutonium-fueled radioisotope thermoelectric generators (RTGs) from four contractors (each contractor provided two RTGs). The purpose of these demonstration models is to prove conclusively that it is possible with state-of-the-art technology and materials to produce a super-battery with a 15-year life for use in the form of distributed power sources for remote undersea applications. It is easy to determine the RTG's beginning-of-life performance by actual measurements, but to forecast accurately its end-of-life performance requires rigorous determination of its reliability. This article discusses the test and evaluation program (TEP) used and the results obtained in determining that reliability. The TEP is divided into three general areas: mechanical-electrical, thermochemical-physical, and thermoelectric

  13. An update to the multitasking thermalhydraulics evaluation package

    Energy Technology Data Exchange (ETDEWEB)

    Guo, Y.; Leung, L.K.H.; Vasic, A. [Atomic Energy of Canada Limited, Chalk River, Ontario (Canada)

    2007-07-01

    An update of the multitasking Thermalhydraulics Evaluation Package (TEP) was implemented to improve the prediction accuracy of critical heat flux (CHF) and post-dryout (PDO) heat transfer for 37-element fuel bundles. The improvement of prediction accuracy was achieved using the latest correlations for CHF and PDO heat transfer derived from fullscale bundle tests. The predictions of TEP were assessed against experimental data and good agreement has been observed. In addition to the improvement, the prediction capability of the package has been expanded to capture the effect of radial power profile on CHF for 37-element bundles. A correlation for the radial power profile effect on CHF has been implemented. It accounts for the deviation in CHF between the bundle of radial power profile of interest and the equivalent bundle of the natural uranium profile. (author)

  14. Authoritarian Parenting and Asian Adolescent School Performance: Insights from the US and Taiwan

    Science.gov (United States)

    Pong, Suet-ling; Johnston, Jamie; Chen, Vivien

    2014-01-01

    Our study re-examines the relationship between parenting and school performance among Asian students. We use two sources of data: wave I of the Adolescent Health Longitudinal Survey (Add Health), and waves I and II of the Taiwan Educational Panel Survey (TEPS). Analysis using Add Health reveals that the Asian-American/European-American difference in the parenting–school performance relationship is due largely to differential sample sizes. When we select a random sample of European-American students comparable to the sample size of Asian-American students, authoritarian parenting also shows no effect for European-American students. Furthermore, analysis of TEPS shows that authoritarian parenting is negatively associated with children's school achievement, while authoritative parenting is positively associated. This result for Taiwanese Chinese students is similar to previous results for European-American students in the US. PMID:24850978

  15. Authoritarian Parenting and Asian Adolescent School Performance: Insights from the US and Taiwan.

    Science.gov (United States)

    Pong, Suet-Ling; Johnston, Jamie; Chen, Vivien

    2010-01-01

    Our study re-examines the relationship between parenting and school performance among Asian students. We use two sources of data: wave I of the Adolescent Health Longitudinal Survey (Add Health), and waves I and II of the Taiwan Educational Panel Survey (TEPS). Analysis using Add Health reveals that the Asian-American/European-American difference in the parenting-school performance relationship is due largely to differential sample sizes. When we select a random sample of European-American students comparable to the sample size of Asian-American students, authoritarian parenting also shows no effect for European-American students. Furthermore, analysis of TEPS shows that authoritarian parenting is negatively associated with children's school achievement, while authoritative parenting is positively associated. This result for Taiwanese Chinese students is similar to previous results for European-American students in the US.

  16. R and D of tritium technology for fusion in CAEP: progress and prospect

    International Nuclear Information System (INIS)

    Jiangfeng, Song; Daqiao, Meng; Rong, Li; Zhiyong, Huang; Guoqiang, Huang; Chang-an, Chen; Xiaojun, Deng; Cheng, Qin; Xiaojing, Qian; Guikai, Zhang

    2015-01-01

    China has decided to develop its own fusion engineering test reactor and has also joined ITER. Tritium plant is one of the key systems of fusion system. Programs supposed by China ministry of Science and technology named 'Conceptual design and key technologies research on TBM tritium system' and 'Conceptual design and key technologies research on tritium plant for fusion reactor' were finished in 2013 and 2014. After several years of research, we have finished the design of TBM tritium system, TEP, SDS, WDS, ISS and tritium safety system. The key technologies such as TES, CPS, hydrogen storage materials for SDS, catalysts for WDS, palladium alloy membranes for TEP are under research. In this paper, the progress and prospect of tritium technology for R and D of fusion is introduced. (author)

  17. Field Performance of Photovoltaic Systems in the Tucson Desert

    Science.gov (United States)

    Orsburn, Sean; Brooks, Adria; Cormode, Daniel; Greenberg, James; Hardesty, Garrett; Lonij, Vincent; Salhab, Anas; St. Germaine, Tyler; Torres, Gabe; Cronin, Alexander

    2011-10-01

    At the Tucson Electric Power (TEP) solar test yard, over 20 different grid-connected photovoltaic (PV) systems are being tested. The goal at the TEP solar test yard is to measure and model real-world performance of PV systems and to benchmark new technologies such as holographic concentrators. By studying voltage and current produced by the PV systems as a function of incident irradiance, and module temperature, we can compare our measurements of field-performance (in a harsh desert environment) to manufacturer specifications (determined under laboratory conditions). In order to measure high-voltage and high-current signals, we designed and built reliable, accurate sensors that can handle extreme desert temperatures. We will present several benchmarks of sensors in a controlled environment, including shunt resistors and Hall-effect current sensors, to determine temperature drift and accuracy. Finally we will present preliminary field measurements of PV performance for several different PV technologies.

  18. A search for transit timing variation

    Directory of Open Access Journals (Sweden)

    Kramm U.

    2011-02-01

    Full Text Available Photometric follow-ups of transiting exoplanets (TEPs may lead to discoveries of additional, less massive bodies in extrasolar systems. This is possible by detecting and then analysing variations in transit timing of transiting exoplanets. In 2009 we launched an international observing campaign, the aim of which is to detect and characterise signals of transit timing variation (TTV in selected TEPs. The programme is realised by collecting data from 0.6-2.2-m telescopes spread worldwide at different longitudes. We present our observing strategy and summarise first results for WASP-3b with evidence for a 15 Earth-mass perturber in an outer 2:1 orbital resonance.

  19. Advanced testing and validation centre gets electric vehicle technology to market faster

    Energy Technology Data Exchange (ETDEWEB)

    Astil, T.; Girard, F. [National Research Council of Canada, Vancouver, BC (Canada). Inst. for Fuel Cell Innovation

    2010-07-01

    The National Research Council (NRC) Institute for Fuel Cell Innovation is advancing Canada's clean energy advantage through NRC's technology cluster initiatives, which help Canadian small and medium enterprises achieve commercialization breakthroughs in key sectors. This presentation discussed the technology evaluation program (TEP) offered by the NRC Institute for Fuel Cell Innovation. The presentation discussed the TEPs mission, advanced testing and validation centre (ATVC), previous ATVC clients, environmental chamber, dynamometer, vibration table, electrochemical battery testing, and electrochemical testing laboratory. The ATVC is a specialized and safe environment for objective, reliable and accurate standardized testing applications of electric vehicle technologies. It offers independent test services to external organizations, making it easier to prove that electric vehicle technologies will perform under specific operating conditions. figs.

  20. KNOWLEDGE BASE AND EFL TEACHER EDUCATION PROGRAMS: A COLOMBIAN PERSPECTIVE

    Directory of Open Access Journals (Sweden)

    Yamith Fandiño

    2013-04-01

    Full Text Available In the 21st century, Colombian pre-service EFL Teacher Education Programs (TEPs should study what constitutes the core knowledge base for language teachers to be effective in their profession. These programs must refrain from simply conceptualizing knowledge base as the acquisition of the basic skills required for teaching, the competency of educators in their subject matter area, and the use of pedagogical skills. Instead, they should strive to reflect on what Colombian language teachers need to know about teaching and learning, and study how their knowledge, beliefs, and attitudes inform their practices. A starting point to do so is to interpret the variety of proposals that have been generated through the years in the field. This paperoffers a review of what teacher knowledge base is, presents an overview of how Colombian EFL TEPs are working on teacher knowledge,and suggests some strategies to envision a more complete framework of reference for teacher formation in Colombia.

  1. Nuclear Fusion Fuel Cycle Research Perspectives

    International Nuclear Information System (INIS)

    Chung, Hongsuk; Koo, Daeseo; Park, Jongcheol; Kim, Yeanjin; Yun, Sei-Hun

    2015-01-01

    As a part of the International Thermonuclear Experimental Reactor (ITER) Project, we at the Korea Atomic Energy Research Institute (KAERI) and our National Fusion Research Institute (NFRI) colleagues are investigating nuclear fusion fuel cycle hardware including a nuclear fusion fuel Storage and Delivery System (SDS). To have a better knowledge of the nuclear fusion fuel cycle, we present our research efforts not only on SDS but also on the Fuel Supply System (FS), Tokamak Exhaust Processing System (TEP), Isotope Separation System (ISS), and Detritiation System (DS). To have better knowledge of the nuclear fusion fuel cycle, we presented our research efforts not only on SDS but also on the Fuel Supply System (FS), Tokamak Exhaust Processing System (TEP), Isotope Separation System (ISS), and Detritiation System (DS). Our efforts to enhance the tritium confinement will be continued for the development of cleaner nuclear fusion power plants

  2. Fiber Optic Coupled Raman Based Detection of Hazardous Liquids Concealed in Commercial Products

    Directory of Open Access Journals (Sweden)

    Michael L. Ramírez-Cedeño

    2012-01-01

    Full Text Available Raman spectroscopy has been widely proposed as a technique to nondestructively and noninvasively interrogate the contents of glass and plastic bottles. In this work, Raman spectroscopy is used in a concealed threat scenario where hazardous liquids have been intentionally mixed with common consumer products to mask its appearance or spectra. The hazardous liquids under consideration included the chemical warfare agent (CWA simulant triethyl phosphate (TEP, hydrogen peroxide, and acetone as representative of toxic industrial compounds (TICs. Fiber optic coupled Raman spectroscopy (FOCRS and partial least squares (PLS algorithm analysis were used to quantify hydrogen peroxide in whiskey, acetone in perfume, and TEP in colored beverages. Spectral data was used to evaluate if the hazardous liquids can be successfully concealed in consumer products. Results demonstrated that FOC-RS systems were able to discriminate between nonhazardous consumer products and mixtures with hazardous materials at concentrations lower than 5%.

  3. Contribution of the modulation of intensity and the optimization to deliver a dose adapted to the biological heterogeneities

    International Nuclear Information System (INIS)

    Kubs, F.

    2007-10-01

    The recent progress in functional imaging by Positron Emission Tomography (TEP) opens new perspectives in the delineation of target volumes in radiotherapy. The functional data is major; we can intend to adapt the irradiation doses on the tumor activity (TA) and to perform a dose escalation. Our objectives were (i) to characterize the TEP threshold, by quantifying the uncertainties of the target volume contour according to the lesion size and the threshold contour level, (ii) to set up the geometry suited to perform a high-precision irradiation based on the TA, (iii) to estimate the dosimetric impact of this new protocol and (iv) to verify that dosimetry is perfectly distributed. Three original phantoms were specially created to satisfy the constraints met, as well as two virtual phantoms containing 3 dose levels (dose level 3 = TA). Our results showed the importance of the effect threshold-volume on the planning in radiotherapy. To use this irradiation method, the diameter of 1 cm for the third level was able to be reached. A dose escalation of 20 Gy was possible between the second (70 Gy) and the third level (90 Gy). The dosimetric impact estimated on two real cases was suitable - increase of COIN (conformal index) from 0.6 to 0.8 and decrease of NTCP (normal tissue complication probability) of a factor 5 -. In absolute and relative dosimetry, the clinical tolerances were respected. So all the treatment process, going from the diagnosis with the TEP to reveal the TA, to the patient treatment made beforehand on phantom, and going through the ballistic and the dose calculation, was estimated and validated according to our objective to adapt the irradiation to the biological heterogeneities. However such high doses should be carefully estimated before being prescribed clinically and progress is also expected in imaging, because the minimal size which we can irradiate is on the limit of the resolution TEP. (author)

  4. Transmission Lines Loading Enhancement Using ADPSO Approach

    OpenAIRE

    M. Mahdavi; H. Monsef; A. Bagheri

    2010-01-01

    Discrete particle swarm optimization (DPSO) is a powerful stochastic evolutionary algorithm that is used to solve the large-scale, discrete and nonlinear optimization problems. However, it has been observed that standard DPSO algorithm has premature convergence when solving a complex optimization problem like transmission expansion planning (TEP). To resolve this problem an advanced discrete particle swarm optimization (ADPSO) is proposed in this paper. The simulation res...

  5. Combination of AC Transmission Expansion Planning and Reactive Power Planning in the restructured power system

    International Nuclear Information System (INIS)

    Hooshmand, Rahmat-Allah; Hemmati, Reza; Parastegari, Moein

    2012-01-01

    Highlights: ► To overcome the disadvantages of DC model in Transmission Expansion Planning, AC model should be used. ► The Transmission Expansion Planning associated with Reactive Power Planning results in fewer new transmission lines. ► Electricity market concepts should be considered in Transmission Expansion Planning problem. ► Reliability aspects should be considered in Transmission Expansion Planning problem. ► Particle Swarm Optimization is a suitable optimization method to solve Transmission Expansion Planning problem. - Abstract: Transmission Expansion Planning (TEP) is an important issue in power system studies. It involves decisions on location and number of new transmission lines. Before deregulation of the power system, the goal of TEP problem was investment cost minimization. But in the restructured power system, nodal prices, congestion management, congestion surplus and so on, have been considered too. In this paper, an AC model of TEP problem (AC-TEP) associated with Reactive Power Planning (RPP) is presented. The goals of the proposed planning problem are to minimize investment cost and maximize social benefit at the same time. In the proposed planning problem, in order to improve the reliability of the system the Expected Energy Not Supplied (EENS) index of the system is limited by a constraint. For this purpose, Monte Carlo simulation method is used to determine the EENS. Particle Swarm Optimization (PSO) method is used to solve the proposed planning problem which is a nonlinear mixed integer optimization problem. Simulation results on Garver and RTS systems verify the effectiveness of the proposed planning problem for reduction of the total investment cost, EENS index and also increasing social welfare of the system.

  6. Release of dissolved carbohydrates by Emiliania huxleyi and formation of transparent exopolymer particles depend on algal life cycle and bacterial activity.

    Science.gov (United States)

    Van Oostende, Nicolas; Moerdijk-Poortvliet, Tanja C W; Boschker, Henricus T S; Vyverman, Wim; Sabbe, Koen

    2013-05-01

    The coccolithophore Emiliania huxleyi plays a pivotal role in the marine carbon cycle. However, we have only limited understanding of how its life cycle and bacterial interactions affect the production and composition of dissolved extracellular organic carbon and its transfer to the particulate pool. We traced the fate of photosynthetically fixed carbon during phosphate-limited stationary growth of non-axenic, calcifying E. huxleyi batch cultures, and more specifically the transfer of this carbon to bacteria and to dissolved high molecular weight neutral aldoses (HMW NAld) and extracellular particulate carbon. We then compared the dynamics of dissolved carbohydrates and transparent exopolymer particles (TEP) between cultures of non-axenic and axenic diploid E. huxleyi. In addition, we present the first data on extracellular organic carbon in (non-axenic) haploid E. huxleyi cultures. Bacteria enhanced the accumulation of dissolved polysaccharides and altered the composition of dissolved HMW NAld, while they also stimulated the formation of TEP containing high densities of charged polysaccharides in diploid E. huxleyi cultures. In haploid E. huxleyi cultures we found a more pronounced accumulation of dissolved carbohydrates, which had a different NAld composition than the diploid cultures. TEP formation was significantly lower than in the diploid cultures, despite the presence of bacteria. In diploid E. huxleyi cultures, we measured a high level of extracellular release of organic carbon (34-76%), retrieved mainly in the particulate pool instead of the dissolved pool. Enhanced formation of sticky TEP due to bacteria-alga interactions, in concert with the production of coccoliths, suggests that especially diploid E. huxleyi blooms increase the efficiency of export production in the ocean during dissolved phosphate-limited conditions. © 2012 Society for Applied Microbiology and Blackwell Publishing Ltd.

  7. Weapons Systems, United States Army 1997.

    Science.gov (United States)

    1997-01-01

    Mexico, Morocco , Philippines, Turkey Co-Production: Korea The Army began fielding the UH-60 in 1978. Between 1978 and 1989 the Army procured UH-60A...Improvement Program ( CSR TEP) to all Area Common User System (ACUS) switch users (except AN/TTC-39-A(V)l). Incorporate Enhanced Switch Operation Program...Finland, Greece, Italy, Kuwait, Morocco , Saudi Arabia National Guard, SHAPE Tech Ctr (NATO), Spain, Special Def Acq Fund (pre-purchased export

  8. Microbial extracellular polymeric substances in marine biogeochemical processes

    Digital Repository Service at National Institute of Oceanography (India)

    Bhaskar, P.V.; Bhosle, N.B.

    and are found in free dissolved form, colloids, discreet partcles like TEP and/or associated with particulate matter, including cell aggregates, detritus, biofilms, microbial mats, etc. The chemical composition of EPS is influenced by various factors... of EPS in marine waters. Hence, various aspects of EPS di- cussed hereafter indicate bacterial and/or phyto origin unless specified. Characteristics of EPS Microorganisms grow in free planktonic state16,17 or are ata- ched to surfaces (natural...

  9. CRaTER: The Cosmic Ray Telescope for the Effects of Radiation Experiment on the Lunar Reconnaissance Orbiter Mission

    OpenAIRE

    Spence, H. E.; Case, A. W.; Golightly, M. J.; Heine, T.; Larsen, B. A.; Blake, J. B.; Caranza, P.; Crain, W. R.; George, J.; Lalic, M.; Lin, A.; Looper, M. D.; Mazur, J. E.; Salvaggio, D.; Kasper, J. C.

    2009-01-01

    The Cosmic Ray Telescope for the Effects of Radiation (CRaTER) on the Lunar Reconnaissance Orbiter (LRO) characterizes the radiation environment to be experienced by humans during future lunar missions. CRaTER measures the effects of ionizing energy loss in matter due to penetrating solar energetic protons (SEP) and galactic cosmic rays (GCR), specifically in silicon solid-state detectors and after interactions with tissue-equivalent plastic (TEP), a synthetic analog of human tissue. The CRaT...

  10. Single site and conventional totally extraperitoneal techniques for uncomplicated inguinal hernia repair: A comparative study.

    Science.gov (United States)

    de Araújo, Felipe Brandão Corrêa; Starling, Eduardo Simão; Maricevich, Marco; Tobias-Machado, Marcos

    2014-10-01

    To demonstrate the feasibility of endoscopic extraperitoneal single site (EESS) inguinal hernia repair and compare it outcomes with the conventional totally extraperitoneal (TEP) technique. TEP inguinal hernia repair is a widely accepted alternative to conventional open technique with several perioperative advantages. Transumbilical laparoendoscopic singlesite surgery (LESS) is an emerging approach and has been reported for a number of surgical procedures with superior aesthetic results but other advantages need to be proven. Thirty-eight uncomplicated inguinal hernias were repaired by EESS approach between January 2010 and January 2011. All procedures were performed through a 25 cm infraumbilical incision using the Alexis wound retractor attached to a surgical glove and three trocars. Body mass index, age, operative time, blood loss, complications, conversion rate, analgesia requirement, hospital stay, return to normal activities and patient satisfaction with aesthetic results were analysed and compared with the last 38 matched-pair group of patients who underwent a conventional TEP inguinal hernia repair by the same surgeon. All procedures were performed successfully with no conversion. In both unilateral and bilateral EESS inguinal repairs, the mean operative time was longer than conventional TEP (55± 20 vs. 40± 15 min, P = 0.049 and 70± 15 vs. 55± 10 min, P = 0.014). Aesthetic result was superior in the EESS group (2.88± 0.43 vs. 2.79± 0.51, P = 0.042). There was no difference between the two approaches regarding blood loss, complications, hospital stay, time until returns to normal activities and analgesic requirement. EESS inguinal hernia repair is safe and effective, with superior cosmetic results in the treatment of uncomplicated inguinal hernias. Other advantages of this new technique still need to be proven.

  11. Graphene oxide/MnO2 nanocomposite as destructive adsorbent of nerve-agent simulants in aqueous media

    Czech Academy of Sciences Publication Activity Database

    Šťastný, Martin; Tolasz, Jakub; Štengl, Václav; Henych, Jiří; Žižka, D.

    2017-01-01

    Roč. 412, AUG (2017), s. 19-28 ISSN 0169-4332 R&D Projects: GA MŠk(CZ) LM2015073 Institutional support: RVO:61388980 Keywords : Graphene oxide * Manganese oxide * Nanocomposite * Destructive adsorption * Nerve agent simulants * Dimethyl methyl phosphonate (DMMP) * Triethyl phosphate (TEP) Subject RIV: CA - Inorganic Chemistry OBOR OECD: Inorganic and nuclear chemistry Impact factor: 3.387, year: 2016

  12. Authoritarian Parenting and Asian Adolescent School Performance: Insights from the US and Taiwan

    OpenAIRE

    Pong, Suet-ling; Johnston, Jamie; Chen, Vivien

    2010-01-01

    Our study re-examines the relationship between parenting and school performance among Asian students. We use two sources of data: wave I of the Adolescent Health Longitudinal Survey (Add Health), and waves I and II of the Taiwan Educational Panel Survey (TEPS). Analysis using Add Health reveals that the Asian-American/European-American difference in the parenting–school performance relationship is due largely to differential sample sizes. When we select a random sample of European-American st...

  13. Contribution of the modulation of intensity and the optimization to deliver a dose adapted to the biological heterogeneities; Apport de la modulation d'intensite et de l'optimisation pour delivrer une dose adaptee aux heterogeneites biologiques

    Energy Technology Data Exchange (ETDEWEB)

    Kubs, F

    2007-10-15

    The recent progress in functional imaging by Positron Emission Tomography (TEP) opens new perspectives in the delineation of target volumes in radiotherapy. The functional data is major; we can intend to adapt the irradiation doses on the tumor activity (TA) and to perform a dose escalation. Our objectives were (i) to characterize the TEP threshold, by quantifying the uncertainties of the target volume contour according to the lesion size and the threshold contour level, (ii) to set up the geometry suited to perform a high-precision irradiation based on the TA, (iii) to estimate the dosimetric impact of this new protocol and (iv) to verify that dosimetry is perfectly distributed. Three original phantoms were specially created to satisfy the constraints met, as well as two virtual phantoms containing 3 dose levels (dose level 3 = TA). Our results showed the importance of the effect threshold-volume on the planning in radiotherapy. To use this irradiation method, the diameter of 1 cm for the third level was able to be reached. A dose escalation of 20 Gy was possible between the second (70 Gy) and the third level (90 Gy). The dosimetric impact estimated on two real cases was suitable - increase of COIN (conformal index) from 0.6 to 0.8 and decrease of NTCP (normal tissue complication probability) of a factor 5 -. In absolute and relative dosimetry, the clinical tolerances were respected. So all the treatment process, going from the diagnosis with the TEP to reveal the TA, to the patient treatment made beforehand on phantom, and going through the ballistic and the dose calculation, was estimated and validated according to our objective to adapt the irradiation to the biological heterogeneities. However such high doses should be carefully estimated before being prescribed clinically and progress is also expected in imaging, because the minimal size which we can irradiate is on the limit of the resolution TEP. (author)

  14. Colossal thermoelectric power in charge ordered lanthanum calcium manganites (La{sub 0.5}Ca{sub 0.5}MnO{sub 3})

    Energy Technology Data Exchange (ETDEWEB)

    Joy, Lija K.; Anantharaman, M. R., E-mail: mraiyer@yahoo.com [Department of Physics, Cochin University of Science and Technology, Cochin 682022 (India); Shanmukharao Samatham, S.; Ganesan, V. [Low temperature division, UGC-DAE Consortium for Scientific Research, Indore (India); Thomas, Senoy [Material Science and Technology Division, National Institute for Interdisciplinary Science and Technology, Thiruvananthapuram–695019 (India); Al-Harthi, Salim [Department of Physics, Sultan Qaboos University, Muscat PC 123, Sultanate of Oman (Oman); Liebig, A.; Albrecht, M. [Institute of Physics, University of Augsburg, Augsburg 86135 (Germany)

    2014-12-07

    Lanthanum calcium manganites (La{sub 0.5}Ca{sub 0.5}MnO{sub 3}) with a composition close to charge ordering, synthesized by high energy ball milling, was found to exhibit colossal thermoelectric power. Thermoelectric power (TEP) data was systematically analyzed by dividing the entire temperature range (5 K–300 K) into three different regimes to explore different scattering mechanisms involved. Mandal's model has been applied to explain TEP data in the region below the Curie temperature (T{sub C}). It has been found that the variation of thermoelectric power with temperature is pronounced when the system enters the charge ordered region at T < 200 K. For temperatures lower than 120 K, due to the co-existence of charge ordered state with a spin-glass state, the variation of thermoelectric power is maximum and exhibited a peak value of −80 mV/K at 58 K. This has been explained by incorporating Kondo properties of the spin-glass along with magnon scattering. FC-ZFC magnetization measurements indicate the existence of a glassy state in the region corresponding to a maximum value of thermoelectric power. Phonon drag contribution instead of spin-glass contribution is taken into account to explain TEP in the region 120 K < T < T{sub C}. Mott's polaronic contribution of charge carriers are considered to interpret TEP in the high temperature region (T > T{sub C}). The optimal Mn{sup 4+}-Mn{sup 3+} concentration in charge ordered La{sub 0.5}Ca{sub 0.5}MnO{sub 3} was examined by X-ray Photoelectron Spectroscopy analysis which confirms the charge ordered nature of this compound.

  15. Reaction

    African Journals Online (AJOL)

    raoul

    12 janv. 2012 ... Key words: Métastase, rate, colon, carcinome. Received: 28/12/2011 - Accepted: 09/01/2012 - Published: ... tomodensitométriques au moment du diagnostic du cancer primitif ou lors du suivi radiologique régulier des patients atteints de cancers. Le recours à la TEP-FDG couplée au scanner serait d'un ...

  16. Reviewer Volume 29, Tahun 2009

    OpenAIRE

    Volume 29, Tahun 2009, Reviewer

    2012-01-01

    Achmad Subagio, Fakultas Teknologi Pertanian (FTP), Universitas Jember, Jl. Kalimantan I, Kampus Tegal Boto, Jember 68121Agustin K., Wardani FTP, Universitas Brawijaya, Malang, Jl. Veteran, Malang 65145Bambang Purwantana, Jurusan Teknik Pertanian (TEP), FTP, Universitas Gadjah Mada (UGM), Jl. Flora, Bulaksumur,Yogyakarta 55281Chusnul Hidayat, Jurusan Teknologi Pangan dan Hasil Pertanian (TPHP), FTP, UGMDidik Purwadi, Jurusan Teknologi Industri Pertanian (TIP), FTP, UGMDjagal Wiseso Marseno, ...

  17. Project W-314 specific test and evaluation plan 241-AN-B valve pit

    International Nuclear Information System (INIS)

    Hays, W.H.

    1998-01-01

    The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-B Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

  18. Determination of aluminium nitride or free nitrogen in low carbon steel

    International Nuclear Information System (INIS)

    Guetaz, V.; Soler, M.; Massardier, V.; Merlin, J.; Ravaine, D.

    2001-01-01

    As the aluminium nitrides play an important role in the manufacturing of steel sheets, a specific methodology was developed based on the thermoelectric power (TEP) technique, in order to determine the AIN nitrogen by an indirect method. The free nitrogen was determined and then the AIN nitrogen was calculated by the difference between the total nitrogen and the free nitrogen. Indeed, it is easier to determine the dissolved nitrogen, the content of which gradually decreases during the AIN precipitation, than the AIN nitrogen. A low carbon aluminium killed steel was employed with 580 ppm of aluminium and 50 ppm of nitrogen. A comparison of the results obtained by TEP with those obtained by other techniques (hot hydrogen extraction, electrochemical dissolution followed by a mineralization, electrochemical dissolution followed by a sodic decomposition and the Beeghly method) was conducted, in order to determine a reliable technique likely to quantify the amount of aluminium nitrides in aluminium killed steels. With these techniques, it is possible to determine either free nitrogen or precipitated nitrogen. From an experimental point of view, the precipitation kinetics of AIN was followed during an annealing performed at 973 K (700 C) by TEP and then different precipitation states of AIN were investigated to compare the different techniques: three annealing states (when no nitrogen, half the nitrogen and the total nitrogen has precipitated) and two soaking states (1403 and 1523 K). Thus, it was possible to compare states where the AIN precipitates are in various forms (different shapes, crystallographic structures, sizes, distributions in the matrix). This work showed that the quantification by TEP, hot hydrogen extraction and electrochemical dissolution followed by a mineralization seem reliable whereas the Beeghly method gives good results only for the precipitates formed at high temperatures. In contrast, the quantification by electrochemical dissolution followed by

  19. Water supply as a constraint on transmission expansion planning in the Western interconnection

    Science.gov (United States)

    Tidwell, Vincent C.; Bailey, Michael; Zemlick, Katie M.; Moreland, Barbara D.

    2016-12-01

    Consideration of water supply in transmission expansion planning (TEP) provides a valuable means of managing impacts of thermoelectric generation on limited water resources. Toward this opportunity, thermoelectric water intensity factors and water supply availability (fresh and non-fresh sources) were incorporated into a recent TEP exercise conducted for the electric interconnection in the Western United States. The goal was to inform the placement of new thermoelectric generation so as to minimize issues related to water availability. Although freshwater availability is limited in the West, few instances across five TEP planning scenarios were encountered where water availability impacted the development of new generation. This unexpected result was related to planning decisions that favored the development of low water use generation that was geographically dispersed across the West. These planning decisions were not made because of their favorable influence on thermoelectric water demand; rather, on the basis of assumed future fuel and technology costs, policy drivers and the topology of electricity demand. Results also projected that interconnection-wide thermoelectric water consumption would increase by 31% under the business-as-usual case, while consumption would decrease by 42% under a scenario assuming a low-carbon future. Except in a few instances, new thermoelectric water consumption could be accommodated with less than 10% of the local available water supply; however, limited freshwater supplies and state-level policies could increase use of non-fresh water sources for new thermoelectric generation. Results could have been considerably different if scenarios favoring higher-intensity water use generation technology or potential impacts of climate change had been explored. Conduct of this exercise highlighted the importance of integrating water into all phases of TEP, particularly joint management of decisions that are both directly (e.g., water

  20. Project W-314 specific test and evaluation plan for 241-AN-A valve pit

    International Nuclear Information System (INIS)

    Hays, W.H.

    1998-01-01

    The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-A Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

  1. on association of trialkyl phosphates

    International Nuclear Information System (INIS)

    Petkovic, D.M.; Maksimovic, Z.B.

    1976-01-01

    The association constants of tri-n-butyl (TBP), tri-n-propyl (TPP) and triethyl phosphate (TEP) with chloroform, carbon tetrachloride and benzene were determined by dielectric constant, proton magnetic resonance and vapor pressure measurements. Correlation of the trialkyl phosphate-chloroform association constants, using the Hammett equation, showed their increase with the number of carbon atoms in the aliphatic radicals. The change of trialkyl phosphate reactivity with temperature was used to determine the thermodynamic quantities. (author)

  2. A randomized placebo-controlled study of noninvasive cortical electrostimulation in the treatment of fibromyalgia patients.

    Science.gov (United States)

    Hargrove, Jeffrey B; Bennett, Robert M; Simons, David G; Smith, Susan J; Nagpal, Sunil; Deering, Donald E

    2012-01-01

    The aim of this multicenter study was to evaluate the efficacy, safety, and tolerability of noninvasive cortical electrostimulation in the management of fibromyalgia (FM). A prospective, randomized, double-blind, placebo-controlled design was used. Setting.  Subjects received therapy at two different outpatient clinical locations. There were 77 subjects meeting the American College of Rheumatology 1990 classification criteria for FM. Intervention.  Thirty-nine (39) active treatment (AT) FM patients and 38 placebo controls received 22 applications of either noninvasive cortical electrostimulation or a sham therapy over an 11-week period. The primary outcome measures were the number of tender points (TePs) and pressure pain threshold (PPT). Secondary outcome measures were responses to the Fibromyalgia Impact Questionnaire (FIQ), Symptom Checklist-90 (SCL-90), Beck Depression Inventory-II, and a novel sleep questionnaire, all evaluated at baseline and at the end of treatment. Intervention provided significant improvements in TeP measures: compared with placebo, the AT patients improved in the number of positive TePs (-7.4 vs -0.2, PFIQ score (-15.5 vs -5.6, P=0.03), FIQ pain (-2.0 vs -0.6, P=0.03), FIQ fatigue (-2.0 vs -0.4, P=0.02), and FIQ refreshing sleep (-2.1 vs -0.7, P=0.02); and while FIQ function improved (-1.0 vs -0.2), the between-group change had a 14% likelihood of occurring due to chance (P=0.14). There were no significant side effects observed. Noninvasive cortical electrostimulation in FM patients provided modest improvements in pain, TeP measures, fatigue, and sleep; and the treatment was well tolerated. This form of therapy could potentially provide worthwhile adjunctive symptom relief for FM patients. Wiley Periodicals, Inc.

  3. The invasive snowflake coral (Carijoa riisei in the Tropical Eastern Pacific, Colombia

    Directory of Open Access Journals (Sweden)

    Juan Armando Sánchez

    2014-02-01

    Full Text Available Carijoa riisei (Octocorallia: Cnidaria, a western Atlantic species, has been reported in the Pacific as an invasive species for nearly forty years. C. riisei has been recently observed overgrowing native octocorals at several rocky-coral littorals in the Colombian Tropical Eastern Pacific-(TEP. C. riisei has inhabited these reefs for at least 15 years but the aggressive overgrowth on other octocorals have been noted until recently. Here, we surveyed for the first time the distribution and inter-specific aggression by C. riisei in both coastal and oceanic areas colonized in the Colombian TEP (Malpelo, Gorgona and Cabo Corrientes, including preliminary multiyear surveys during 2007-2013. We observed community-wide octocoral mortalities (including local extinction of some Muricea spp. and a steady occurrence of competing and overgrowing Pacifigorgia seafans and Leptogorgia seawhips. In Gorgona Island, at two different sites, over 87% (n=77 tagged colonies of octocorals (Pacifigorgia spp. and Leptogorgia alba died as a result of C. riisei interaction and/or overgrowth between 2011 and 2013. C. riisei overgrows octocorals with an estimate at linear growth rate of about 1cm m-1. The aggressive overgrowth of this species in TEP deserves more attention and regular monitoring programs. Rev. Biol. Trop. 62 (Suppl. 1: 199-207. Epub 2014 February 01.

  4. Technology-enhanced practice for patients with chronic cardiac disease: home implementation and evaluation.

    Science.gov (United States)

    Brennan, Patricia Flatley; Casper, Gail R; Burke, Laura J; Johnson, Kathy A; Brown, Roger; Valdez, Rupa S; Sebern, Marge; Perez, Oscar A; Sturgeon, Billie

    2010-01-01

    This 3-year field experiment engaged 60 nurses and 282 patients in the design and evaluation of an innovative home-care nursing model, referred to as technology-enhanced practice (TEP). Nurses using TEP augmented the usual care with a web-based resource (HeartCareII) that provided patients with self-management information, self-monitoring tools, and messaging services. Patients exposed to TEP demonstrated better quality of life and self-management of chronic heart disease during the first 4 weeks, and were no more likely than patients in usual care to make unplanned visits to a clinician or hospital. Both groups demonstrated the same long-term symptom management and achievements in health status. This project provides new evidence that the purposeful creation of patient-tailored web resources within a hospital portal is possible; that nurses have difficulty with modifying their practice routines, even with a highly-tailored web resource; and that the benefits of this intervention are more discernable in the early postdischarge stages of care. Copyright © 2010 Elsevier Inc. All rights reserved.

  5. Trait Anticipatory Pleasure Predicts Effort Expenditure for Reward.

    Directory of Open Access Journals (Sweden)

    Joachim T Geaney

    Full Text Available Research in motivation and emotion has been increasingly influenced by the perspective that processes underpinning the motivated approach of rewarding goals are distinct from those underpinning enjoyment during reward consummation. This distinction recently inspired the construction of the Temporal Experience of Pleasure Scale (TEPS, a self-report measure that distinguishes trait anticipatory pleasure (pre-reward feelings of desire from consummatory pleasure (feelings of enjoyment and gratification upon reward attainment. In a university community sample (N = 97, we examined the TEPS subscales as predictors of (1 the willingness to expend effort for monetary rewards, and (2 affective responses to a pleasant mood induction procedure. Results showed that both anticipatory pleasure and a well-known trait measure of reward motivation predicted effort-expenditure for rewards when the probability of being rewarded was relatively low. Against expectations, consummatory pleasure was unrelated to induced pleasant affect. Taken together, our findings provide support for the validity of the TEPS anticipatory pleasure scale, but not the consummatory pleasure scale.

  6. Subsurface intake systems: Green choice for improving feed water quality at SWRO desalination plants, Jeddah, Saudi Arabia

    KAUST Repository

    Dehwah, Abdullah

    2015-10-25

    An investigation of three seawater reverse osmosis facilities located along the shoreline of the Red Sea of Saudi Arabia that use well intake systems showed that the pumping-induced flow of raw seawater through a coastal aquifer significantly improves feed water quality. A comparison between the surface seawater and the discharge from the wells shows that turbidity, algae, bacteria, total organic carbon, most fractions of natural organic matter (NOM), and particulate and colloidal transparent exopolymer particles (TEP) have significant reductions in concentration. Nearly all of the algae, up to 99% of the bacteria, between 84 and 100% of the biopolymer fraction of NOM, and a high percentage of the TEP were removed during transport. The data suggest that the flowpath length and hydraulic retention time in the aquifer play the most important roles in removal of the organic matter. Since the collective concentrations of bacteria, biopolymers, and TEP in the intake seawater play important roles in the biofouling of SWRO membranes, the observed reductions suggest that the desalination facilities that use well intakes systems will have a potentially lower fouling rate compared to open-ocean intake systems. Furthermore, well intake system intakes also reduce the need for chemical usage during complex pretreatment systems required for operation of SWRO facilities using open-ocean intakes and reduce environmental impacts.

  7. Application of nuclear activation analysis (NAA) and low-level gamma counting to determine the radionuclide and trace element pollutant releases from coal-fired power plants in Vietnam

    International Nuclear Information System (INIS)

    Vanduong, P.; Thanh, V.T.; Dien, P.Q.; Binh, N.T.

    1995-01-01

    Results are reported of the application of NAA using research reactors TRIGA II in Dalat, Vietnam, and Vienna, Austria (with pyrolysis separation for Hg, Se, and As before irradiation), to determine As, Cd, Cu, Hg, Ni, Co, Pb, Sn and Zn. Low-level gamma counting was used to measure Ra-226, Th-228 and K-40, released from coal-fired power plants in Vietnam. Results showed that: (1) the content of the air pollutants in the vicinity of the operating power plants (in 1991, the Phalai plant produced 1700 million kWh, and the Ninhbinh plant 100 million kWh) depends on the coal combustion which is used for their applied operation technology, both plants used Quangninh anthracite as fuel. The content of trace elements pollutants (TEP) in the environment of the Ninhbinh plant is higher than in the Phalai plant. (2) In the vicinity of both plants, rain water is highly polluted by trace elements such as As, Cu, Pb, Hg, Ni, Co, Cd, Se, U, Th and sulphuric acid. Therefore, this kind of water is not acceptable for human consumption. (3) The algae growing in the waterfield in the vicinity of the power plants can be used to monitor TEP. Four NAA methods, in combination with low-level gamma counting and AAS, can be successfully used to monitor TEP released from power plants

  8. Effects of Phytoplankton Growth Phase on the Formation and Properties of Marine Snow

    Science.gov (United States)

    Montgomery, Q. W.; Proctor, K. W.; Prairie, J. C.

    2016-02-01

    Marine snow aggregates often dominate carbon export from the upper mixed layer to the deep ocean. Thus, understanding the formation and the properties of these aggregates is essential to the study of the biological pump. Aggregate formation is determined by both the encounter rate and the stickiness of the particles that they are composed of. Stickiness of phytoplankton has been linked to production of transparent exopolymer particles (TEP), which has been previously shown to vary in concentration throughout different parts of the phytoplankton growth cycle. The objective of this study is to determine the effects of the growth phase of the diatom Thalassiosira weissflogii to both TEP production and the properties of the resulting aggregates produced. Cultures of T. weissflogii were stopped at separate phases of the phytoplankton growth curve and incubated in rotating cylindrical tanks to form aggregates. Aggregate properties such as size, density, and porosity were measured at the end of each period of roller incubation. Preliminary results describe little variation in the size of the aggregates formed from different parts of the growth phase, but show a significant effect of growth phase on aggregate density. Density is an important factor in the settling of marine aggregates. Therefore, variations in aggregate density during different growth phases may have large implications for the efficiency of the biological pump during different stages of a phytoplankton bloom. Further examination will be performed on the potential effects of TEP abundance on the properties of the aggregates formed at separate growth phases and the resulting implications for carbon flux.

  9. HAT-P-10b: A LIGHT AND MODERATELY HOT JUPITER TRANSITING A K DWARF

    International Nuclear Information System (INIS)

    Bakos, G. A.; Pal, A.; Torres, G.; Sipocz, B.; Latham, D. W.; Noyes, R. W.; Hartman, J.; Esquerdo, G. A.; Sasselov, D. D.; Kovacs, Gabor; Stefanik, R. P.; Kovacs, Geza; Fischer, D. A.; Johnson, J. A.; Marcy, G. W.; Howard, A. W.; Butler, R. P.; Lazar, J.; Papp, I.; Sari, P.

    2009-01-01

    We report on the discovery of HAT-P-10b, one of the lowest mass (0.487 ± 0.018 M J ) transiting extrasolar planets (TEPs) discovered to date by transit searches. HAT-P-10b orbits the moderately bright V = 11.89 K dwarf GSC 02340-01714, with a period P = 3.7224747 ± 0.0000065 days, transit epoch T c = 2454759.68683 ± 0.00016 (BJD), and duration 0.1090 ± 0.0008 days. HAT-P-10b has a radius of 1.005 +0.032 -0.027 R J yielding a mean density of 0.594 ± 0.052 g cm -3 . Comparing these observations with recent theoretical models we find that HAT-P-10b is consistent with a ∼4.5 Gyr, almost pure hydrogen and helium gas giant planet with a 10 M + core. With an equilibrium temperature of T eq = 1020 ± 17 K, HAT-P-10b is one of the coldest TEPs. Curiously, its Safronov number θ = 0.053 ± 0.002 falls close to the dividing line between the two suggested TEP populations.

  10. Nonmedical interventions for children with ASD: recommended guidelines and further research needs.

    Science.gov (United States)

    Maglione, Margaret A; Gans, Daphna; Das, Lopamudra; Timbie, Justin; Kasari, Connie

    2012-11-01

    To use the findings of a systematic review of scientific evidence to develop consensus guidelines on nonmedical interventions that address cognitive function and core deficits in children with autism spectrum disorders (ASDs) and to recommend priorities for future research. The guidelines were developed by a Technical Expert Panel (TEP) consisting of practitioners, researchers, and parents. A systematic overview of research findings was presented to the TEP; guideline statements were drafted, discussed, debated, edited, reassessed, and presented for formal voting. The strength of evidence of efficacy varied by intervention type from insufficient to moderate. There was some evidence that greater intensity of treatment (hours per week) and greater duration (in months) led to better outcomes. The TEP agreed that children with ASD should have access to at least 25 hours per week of comprehensive intervention to address social communication, language, play skills, and maladaptive behavior. They agreed that applied behavioral analysis, integrated behavioral/developmental programs, the Picture Exchange Communication System, and various social skills interventions have shown efficacy. Based on identified gaps, they recommend that future research focus on assessment and monitoring of outcomes, addressing the needs of pre/nonverbal children and adolescents, and identifying the most effective strategies, dose, and duration to improve specific core deficits. The creation of treatment guidelines and recommendations for future research represents an effort by leading experts to improve access to services for children with ASDs while acknowledging that the research evidence has many gaps.

  11. Thermopower and magnetocaloric properties in NdSrMnO/CrO3 composites

    Science.gov (United States)

    Ahmed, A. M.; Mohamed, H. F.; Paixão, J. A.; Mohamed, Sara A.

    2018-06-01

    The thermoelectric power (TEP) and magnetocaloric effect (MCE) for (Nd0.6Sr0.4MnO3)1-x/(CrO3)x composites have been measured. The TEP measurements show a negative sign value of the Seebeck coefficient (S), in microvolts. TEP data construe in the low range of temperature by the magnon and phonon drag model, whereas at high temperature by small polaron conduction mechanism. Magnetic measurements exhibit that all composites show a paramagnetic-ferromagnetic transition with decreasing temperature. The Arrott plots of composites reveal the occurrence of a second order phase transition. The maximum value of magnetic entropy change (ΔS) is 2.37 J kg-1 K-1, achieved fore the composite with x = 0.015. Moreover, the maximum value of relative cooling power (RCP) is 122.1 J kg-1, achieved for the composite with x = 0.020. These composites may be appropriate for magnetic application near room temperature.

  12. Thermoelectrical power analysis of precipitation in 6013 aluminum alloy

    International Nuclear Information System (INIS)

    Abdala, M.R.W.S.; Garcia de Blas, J.C.; Barbosa, C.; Acselrad, O.

    2008-01-01

    The 6013 aluminum alloy was first developed for application in the aircraft industry and, more recently, as a replacement option for the use of the 6061 alloy in the automotive industry. The present work describes the evolution of the process of formation and dissolution of different kinds of precipitates in 6013 aluminum alloy, subjected to different conditions of heat treatment, using for this purpose measurements of thermoelectrical power, Vickers microhardness and differential scanning calorimeter (DSC). Although in the last years many works have been published on the use of thermoelectrical power (TEP) measurements for the analysis of precipitation process in traditional alloys such as 6061, there is still little information related to 6013 alloy. The results obtained are compared with a previous characterization work on the same alloy using transmission electron microscopy. It was observed that TEP measurements are very sensitive to precipitation phenomena in this alloy, and it has been found that there is an inverse relation between TEP and Vickers microhardness values, which allowed proposing a precipitation sequence for 6013 aluminum alloy

  13. TNFα promotes CAR-dependent migration of leukocytes across epithelial monolayers

    Science.gov (United States)

    Morton, Penny E.; Hicks, Alexander; Ortiz-Zapater, Elena; Raghavan, Swetavalli; Pike, Rosemary; Noble, Alistair; Woodfin, Abigail; Jenkins, Gisli; Rayner, Emma; Santis, George; Parsons, Maddy

    2016-01-01

    Trans-epithelial migration (TEpM) of leukocytes during inflammation requires engagement with receptors expressed on the basolateral surface of the epithelium. One such receptor is Coxsackie and Adenovirus Receptor (CAR) that binds to Junctional Adhesion Molecule-like (JAM-L) expressed on leukocytes. Here we provide the first evidence that efficient TEpM of monocyte-derived THP-1 cells requires and is controlled by phosphorylation of CAR. We show that TNFα acts in a paracrine manner on epithelial cells via a TNFR1-PI3K-PKCδ pathway leading to CAR phosphorylation and subsequent transmigration across cell junctions. Moreover, we show that CAR is hyper-phosphorylated in vivo in acute and chronic lung inflammation models and this response is required to facilitate immune cell recruitment. This represents a novel mechanism of feedback between leukocytes and epithelial cells during TEpM and may be important in controlling responses to pro-inflammatory cytokines in pathological settings. PMID:27193388

  14. Size-effect features on the magnetothermopower of bismuth nanowires

    International Nuclear Information System (INIS)

    Condrea, E.; Nicorici, A.

    2011-01-01

    Full text: In this work we have studied the magnetic field dependence of the thermopower (TEP) and resistance of glass-coated Bi wires with diameter (d) from 100 nm to at 1.5 μm below 80 K. Nanowires have anomalously large values of the thermopower (+100 μV K.1) and relatively high effective resistivities, but their frequencies of SdH oscillations remain those of bulk Bi. The TEP stays positive in longitudinal magnetic fields up to 15 T, where the surface scattering of charge carriers is negligible. Our analysis shows that the anomalous thermopower has a diffusion origin and is a consequence of the microstructure rather than the result of the strong scattering of electrons by the wire walls. The intensities of field at which the size-effect features appear on the magnetothermopower curves correspond to a value at which the diameter of the hole cyclotron orbit equals d. Size-effect features were observed only for set of nanowires with d = 100-350 nm, where diffusion TEP is dominant. The contribution of the phonon-drag effect was observed in a wire with diameter larger than 400 nm and becomes dominant at diameter of 1 μm. (authors)

  15. Turbulent equipartitions in two dimensional drift convection

    International Nuclear Information System (INIS)

    Isichenko, M.B.; Yankov, V.V.

    1995-01-01

    Unlike the thermodynamic equipartition of energy in conservative systems, turbulent equipartitions (TEP) describe strongly non-equilibrium systems such as turbulent plasmas. In turbulent systems, energy is no longer a good invariant, but one can utilize the conservation of other quantities, such as adiabatic invariants, frozen-in magnetic flux, entropy, or combination thereof, in order to derive new, turbulent quasi-equilibria. These TEP equilibria assume various forms, but in general they sustain spatially inhomogeneous distributions of the usual thermodynamic quantities such as density or temperature. This mechanism explains the effects of particle and energy pinch in tokamaks. The analysis of the relaxed states caused by turbulent mixing is based on the existence of Lagrangian invariants (quantities constant along fluid-particle or other orbits). A turbulent equipartition corresponds to the spatially uniform distribution of relevant Lagrangian invariants. The existence of such turbulent equilibria is demonstrated in the simple model of two dimensional electrostatically turbulent plasma in an inhomogeneous magnetic field. The turbulence is prescribed, and the turbulent transport is assumed to be much stronger than the classical collisional transport. The simplicity of the model makes it possible to derive the equations describing the relaxation to the TEP state in several limits

  16. DFT investigations of phosphotriesters hydrolysis in aqueous solution: a model for DNA single strand scission induced by N-nitrosoureas.

    Science.gov (United States)

    Liu, Tingting; Zhao, Lijiao; Zhong, Rugang

    2013-02-01

    DNA phosphotriester adducts are common alkylation products of DNA phosphodiester moiety induced by N-nitrosoureas. The 2-hydroxyethyl phosphotriester was reported to hydrolyze more rapidly than other alkyl phosphotriesters both in neutral and in alkaline conditions, which can cause DNA single strand scission. In this work, DFT calculations have been employed to map out the four lowest activation free-energy profiles for neutral and alkaline hydrolysis of triethyl phosphate (TEP) and diethyl 2-hydroxyethyl phosphate (DEHEP). All the hydrolysis pathways were illuminated to be stepwise involving an acyclic or cyclic phosphorane intermediate for TEP or DEHEP, respectively. The rate-limiting step for all the hydrolysis reactions was found to be the formation of phosphorane intermediate, with the exception of DEHEP hydrolysis in alkaline conditions that the decomposition process turned out to be the rate-limiting step, owing to the extraordinary low formation barrier of cyclic phosphorane intermediate catalyzed by hydroxide. The rate-limiting barriers obtained for the four reactions are all consistent with the available experimental information concerning the corresponding hydrolysis reactions of phosphotriesters. Our calculations performed on the phosphate triesters hydrolysis predict that the lower formation barriers of cyclic phosphorane intermediates compared to its acyclic counter-part should be the dominant factor governing the hydrolysis rate enhancement of DEHEP relative to TEP both in neutral and in alkaline conditions.

  17. Aquifer Treatment of Sea Water to Remove Natural Organic Matter Before Desalination

    KAUST Repository

    Dehwah, Abdullah

    2016-10-18

    An investigation of a sea water reverse osmosis desalination facility located in western Saudi Arabia has shown that aquifer treatment of the raw sea water provides a high degree of removal of natural organic matter (NOM) that causes membrane biofouling. The aquifer is a carbonate system that has a good hydraulic connection to the sea and 14 wells are used to induce sea water movement 400 to 450 m from the sea to the wells. During aquifer transport virtually all of the algae, over 90% of the bacteria, over 90% of the biopolymer fraction of NOM, and high percentages of the humic substance, building blocks, and some of the low molecular weight fractions of NOM are removed. Between 44 and over 90% of the transparent exopolymer particles (TEP) are removed with a corresponding significant reduction in concentration of the colloidal fraction of TEP. The removal rate for TEP appears to be greater in carbonate aquifers compared to siliciclastic systems. Although the production wells range in age from 4 months to 14 years, no significant difference in the degree of water treatment provided by the aquifer was found.

  18. A novel strategy to improve protein secretion via overexpression of the SppA signal peptide peptidase in Bacillus licheniformis.

    Science.gov (United States)

    Cai, Dongbo; Wang, Hao; He, Penghui; Zhu, Chengjun; Wang, Qin; Wei, Xuetuan; Nomura, Christopher T; Chen, Shouwen

    2017-04-24

    Signal peptide peptidases play an important role in the removal of remnant signal peptides in the cell membrane, a critical step for extracellular protein production. Although these proteins are likely a central component for extracellular protein production, there has been a lack of research on whether protein secretion could be enhanced via overexpression of signal peptide peptidases. In this study, both nattokinase and α-amylase were employed as prototypical secreted target proteins to evaluate the function of putative signal peptide peptidases (SppA and TepA) in Bacillus licheniformis. We observed dramatic decreases in the concentrations of both target proteins (45 and 49%, respectively) in a sppA deficient strain, while the extracellular protein yields of nattokinase and α-amylase were increased by 30 and 67% respectively in a strain overexpressing SppA. In addition, biomass, specific enzyme activities and the relative gene transcriptional levels were also enhanced due to the overexpression of sppA, while altering the expression levels of tepA had no effect on the concentrations of the secreted target proteins. Our results confirm that SppA, but not TepA, plays an important functional role for protein secretion in B. licheniformis. Our results indicate that the sppA overexpression strain, B. licheniformis BL10GS, could be used as a promising host strain for the industrial production of heterologous secreted proteins.

  19. Design of the Flow Plates for a Dual Cooled Fuel Assembly

    International Nuclear Information System (INIS)

    Kim, Jae Yong; Yoon, Kyung Ho; Lee, Young Ho; Lee, Kang Hee; Kim, Hyung Kyu

    2009-01-01

    In a dual cooled fuel assembly, the array and position of fuels are changed from those of a conventional PWR fuel assembly to achieve a power uprating. The flow plate provides flow holes to direct the heated coolant into/out of the fuel assembly and structural intensity to insure that the fuel rod is axially restrained within the spacer grids. So, flow plates of top/bottom end pieces (TEP/BEP) have to be modified into proper shape. Because the flow holes' area of a flow plate affects pressure drop, the flow holes' area must be larger than/equal to that of conventional flow plates. And design criterion of the TEP/BEP says that the flow plate should withstand a 22.241 kN axial load during handling lest a calculated stress intensity should exceed the Condition I allowable stress. In this paper, newly designed flow plates of a TEP/BEP are suggested and stress analysis is conducted to evaluate strength robustness of the flow plates for the dual cooled fuel assembly

  20. Aquifer Treatment of Sea Water to Remove Natural Organic Matter Before Desalination

    KAUST Repository

    Dehwah, Abdullah; Almashharawi, Samir; Ng, Kim Choon; Missimer, Thomas M.

    2016-01-01

    An investigation of a sea water reverse osmosis desalination facility located in western Saudi Arabia has shown that aquifer treatment of the raw sea water provides a high degree of removal of natural organic matter (NOM) that causes membrane biofouling. The aquifer is a carbonate system that has a good hydraulic connection to the sea and 14 wells are used to induce sea water movement 400 to 450 m from the sea to the wells. During aquifer transport virtually all of the algae, over 90% of the bacteria, over 90% of the biopolymer fraction of NOM, and high percentages of the humic substance, building blocks, and some of the low molecular weight fractions of NOM are removed. Between 44 and over 90% of the transparent exopolymer particles (TEP) are removed with a corresponding significant reduction in concentration of the colloidal fraction of TEP. The removal rate for TEP appears to be greater in carbonate aquifers compared to siliciclastic systems. Although the production wells range in age from 4 months to 14 years, no significant difference in the degree of water treatment provided by the aquifer was found.

  1. Subsurface intake systems: Green choice for improving feed water quality at SWRO desalination plants, Jeddah, Saudi Arabia

    KAUST Repository

    Dehwah, Abdullah; Missimer, Thomas M.

    2015-01-01

    An investigation of three seawater reverse osmosis facilities located along the shoreline of the Red Sea of Saudi Arabia that use well intake systems showed that the pumping-induced flow of raw seawater through a coastal aquifer significantly improves feed water quality. A comparison between the surface seawater and the discharge from the wells shows that turbidity, algae, bacteria, total organic carbon, most fractions of natural organic matter (NOM), and particulate and colloidal transparent exopolymer particles (TEP) have significant reductions in concentration. Nearly all of the algae, up to 99% of the bacteria, between 84 and 100% of the biopolymer fraction of NOM, and a high percentage of the TEP were removed during transport. The data suggest that the flowpath length and hydraulic retention time in the aquifer play the most important roles in removal of the organic matter. Since the collective concentrations of bacteria, biopolymers, and TEP in the intake seawater play important roles in the biofouling of SWRO membranes, the observed reductions suggest that the desalination facilities that use well intakes systems will have a potentially lower fouling rate compared to open-ocean intake systems. Furthermore, well intake system intakes also reduce the need for chemical usage during complex pretreatment systems required for operation of SWRO facilities using open-ocean intakes and reduce environmental impacts.

  2. TMSEEG: A MATLAB-Based Graphical User Interface for Processing Electrophysiological Signals during Transcranial Magnetic Stimulation

    Science.gov (United States)

    Atluri, Sravya; Frehlich, Matthew; Mei, Ye; Garcia Dominguez, Luis; Rogasch, Nigel C.; Wong, Willy; Daskalakis, Zafiris J.; Farzan, Faranak

    2016-01-01

    Concurrent recording of electroencephalography (EEG) during transcranial magnetic stimulation (TMS) is an emerging and powerful tool for studying brain health and function. Despite a growing interest in adaptation of TMS-EEG across neuroscience disciplines, its widespread utility is limited by signal processing challenges. These challenges arise due to the nature of TMS and the sensitivity of EEG to artifacts that often mask TMS-evoked potentials (TEP)s. With an increase in the complexity of data processing methods and a growing interest in multi-site data integration, analysis of TMS-EEG data requires the development of a standardized method to recover TEPs from various sources of artifacts. This article introduces TMSEEG, an open-source MATLAB application comprised of multiple algorithms organized to facilitate a step-by-step procedure for TMS-EEG signal processing. Using a modular design and interactive graphical user interface (GUI), this toolbox aims to streamline TMS-EEG signal processing for both novice and experienced users. Specifically, TMSEEG provides: (i) targeted removal of TMS-induced and general EEG artifacts; (ii) a step-by-step modular workflow with flexibility to modify existing algorithms and add customized algorithms; (iii) a comprehensive display and quantification of artifacts; (iv) quality control check points with visual feedback of TEPs throughout the data processing workflow; and (v) capability to label and store a database of artifacts. In addition to these features, the software architecture of TMSEEG ensures minimal user effort in initial setup and configuration of parameters for each processing step. This is partly accomplished through a close integration with EEGLAB, a widely used open-source toolbox for EEG signal processing. In this article, we introduce TMSEEG, validate its features and demonstrate its application in extracting TEPs across several single- and multi-pulse TMS protocols. As the first open-source GUI-based pipeline

  3. TMSEEG: A MATLAB-Based Graphical User Interface for Processing Electrophysiological Signals during Transcranial Magnetic Stimulation.

    Science.gov (United States)

    Atluri, Sravya; Frehlich, Matthew; Mei, Ye; Garcia Dominguez, Luis; Rogasch, Nigel C; Wong, Willy; Daskalakis, Zafiris J; Farzan, Faranak

    2016-01-01

    Concurrent recording of electroencephalography (EEG) during transcranial magnetic stimulation (TMS) is an emerging and powerful tool for studying brain health and function. Despite a growing interest in adaptation of TMS-EEG across neuroscience disciplines, its widespread utility is limited by signal processing challenges. These challenges arise due to the nature of TMS and the sensitivity of EEG to artifacts that often mask TMS-evoked potentials (TEP)s. With an increase in the complexity of data processing methods and a growing interest in multi-site data integration, analysis of TMS-EEG data requires the development of a standardized method to recover TEPs from various sources of artifacts. This article introduces TMSEEG, an open-source MATLAB application comprised of multiple algorithms organized to facilitate a step-by-step procedure for TMS-EEG signal processing. Using a modular design and interactive graphical user interface (GUI), this toolbox aims to streamline TMS-EEG signal processing for both novice and experienced users. Specifically, TMSEEG provides: (i) targeted removal of TMS-induced and general EEG artifacts; (ii) a step-by-step modular workflow with flexibility to modify existing algorithms and add customized algorithms; (iii) a comprehensive display and quantification of artifacts; (iv) quality control check points with visual feedback of TEPs throughout the data processing workflow; and (v) capability to label and store a database of artifacts. In addition to these features, the software architecture of TMSEEG ensures minimal user effort in initial setup and configuration of parameters for each processing step. This is partly accomplished through a close integration with EEGLAB, a widely used open-source toolbox for EEG signal processing. In this article, we introduce TMSEEG, validate its features and demonstrate its application in extracting TEPs across several single- and multi-pulse TMS protocols. As the first open-source GUI-based pipeline

  4. Prototype Tsunami Evacuation Park in Padang, West Sumatra, Indonesia

    Science.gov (United States)

    Tucker, B. E.; Cedillos, V.; Deierlein, G.; Di Mauro, M.; Kornberg, K.

    2012-12-01

    Padang, Indonesia, a city of some 900,000 people, half of whom live close to the coast and within a five-meter elevation above sea level, has one of the highest tsunami risks in the world due to its close offshore thrust-fault seismic hazard, flat terrain and dense population. There is a high probability that a tsunami will strike the shores of Padang, flooding half of the area of the city, within the next 30 years. If that tsunami occurred today, it is estimated that several hundred thousand people would die, as they could not reach safe ground in the ~30 minute interval between the earthquake's occurrence and the tsunami's arrival. Padang's needs have been amply demonstrated: after earthquakes in 2007, 2009, 2011 and 2012, citizens, thinking that those earthquakes might cause a tsunami, tried to evacuate in cars and motorbikes, which created traffic jams, and most could not reach safe ground in 30 minutes. Since 2008, GeoHazards International (GHI) and Stanford University have studied a range of options for improving this situation, including ways to accelerate evacuation to high ground with pedestrian bridges and widened roads, and means of "vertical" evacuation in multi-story buildings, mosques, pedestrian overpasses, and Tsunami Evacuation Parks (TEPs), which are man-made hills with recreation facilities on top. TEPs proved most practical and cost-effective for Padang, given the available budget, technology and time. The Earth Observatory Singapore (EOS) developed an agent-based model that simulates pedestrian and vehicular evacuation to assess tsunami risk and risk reduction interventions in Southeast Asia. EOS applied this model to analyze the effectiveness in Padang of TEPs over other tsunami risk management approaches in terms of evacuation times and the number of people saved. The model shows that only ~24,000 people (20% of the total population) in the northern part of Padang can reach safe ground within 30 minutes, if people evacuate using cars and

  5. Structural differences between hip endoprostheses, and implications on a hip kinetics

    Directory of Open Access Journals (Sweden)

    Mirza Biščević

    2005-11-01

    Full Text Available We compared kinetic characteristic of unipolar, bipolar and total hip endoprostheses, implanted after dislocated femoral neck fracture. Ninety patients were divided into three groups (30 patients in each group; a group with unipolar partial hip endoprosthesis (UPEP, a group with bipolar partial hip endoprosthesis (BPEP and a group with total hip endoprosthesis (TEP. The patients from different groups were paired by parameters which could influence the long term functional result: follow up period, comorbidities, functional capabilities before injury, etc. After the average follow up 3.8 +/- 1.9 years, a measuring of range of hip motions (ROM was conducted. The largest mean amplitudes in flexion (104 degrees, extension (13 degrees, abduction (35 degrees and external rotation (38 degrees was achieved BPEP, the largest adduction (14 degrees was achieved UPEP, and internal rotation (34 degrees TEP. Differences in ROMs are partially related to the clinical parameters such as: level of the hip pain, gait pattern, age and rehabilitation period (P < 0.05. Measuring of ROMs is the most reliable part of the clinical exam and it does not depend on subjectivity of patient, as opposed to other clinical parameters (level of pain, walking distance, aids usage, etc. The results obtained are favorable for the bipolar hip endoprosthesis, and they can be related to the biomechanical differences between the three types of hip endoprostheses. Kinetic advantages of the BPEP as compared to the UPEP, can be explained by the BPEP's structure: two-level mobility and a thinner neck which delays impingement in the late motion phase. In comparison to the TEP, clinical advantages of the BPEP can be attributed to less extensive surgery and scarring.

  6. Eficacia de un programa de intervención individual y breve para el trastorno por estrés postraumático en mujeres víctimas de violencia doméstica

    Directory of Open Access Journals (Sweden)

    Francisco Javier Labrador

    2006-01-01

    Full Text Available El objetivo del presente estudio es determinar la eficacia de un programa de tratamiento breve del trastorno por estrés postraumático (TEP en mujeres víctimas de violencia doméstica. La muestra estuvo constituida por 20 participantes, todas cumplían los criterios DSM-IV-TR para el diagnóstico de TEP, constituyendo 10 el grupo de control de lista de espera y 10 el grupo de tratamiento. El programa de tratamiento, derivado del de Labrador y Rincón, se aplicó de forma individual y constaba de 8 sesiones (2 meses, siendo sus componentes fundamentales la psicoeducación, técnicas de desactivación, terapia cognitiva y terapia de exposición. Se utilizó un diseño cuasiexperimental con dos grupos independientes de medidas repetidas (en el pretratamiento y en el postratamiento. Los resultados en el postratamiento indican que el programa fue efectivo para la reducción del TEP en el 100% de los casos. Se produjo además una mejora significativa en otras variables concomitantes: depresión, autoestima, inadaptación y cogniciones postraumáticas. No se encontraron, sin embargo, diferencias significativas en función de que se alterara el orden de aplicación de la terapia cognitiva y la terapia de exposición. Se discuten las implicaciones de este estudio para la práctica clínica y futuras investigaciones.

  7. Temperature-induced assembly of semiconductor nanocrystals into fractal architectures and thermoelectric power properties in Au/Ge bilayer films

    Energy Technology Data Exchange (ETDEWEB)

    Li Quanbao; Wang Jian; Jiao Zheng [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Wu Minghong, E-mail: mhwu@staff.shu.edu.cn [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Shek, Chan-Hung; Lawrence Wu, C.M.; Lai, Joseph K.L. [Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon Tong (Hong Kong); Chen Zhiwen, E-mail: cnzwchen@yahoo.com.cn [Shanghai Applied Radiation Institute, Institute of Nanochemistry and Nanobiology, School of Environmental and Chemical Engineering, Shanghai University, Shanghai 200444 (China); Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon Tong (Hong Kong)

    2011-08-15

    Highlights: > Ge fractal architectures were achieved by temperature-induced assembly. > The appearance of fractal architectures influences the thermoelectric power. > But it has little effect on the resistivity. > The values of the superlocalization exponent were within 1.22 {<=} {xi} {<=} 1.29. > It was higher than expected for two-dimension fractal system. - Abstract: Fractal architectures of semiconductor nanocrystals were successfully achieved by temperature-induced assembly of semiconductor nanocrystals in gold/germanium (Au/Ge) bilayer films. New assessment strategies of fractal architectures are of fundamental importance in the development of micro/nano-devices. Temperature-dependent properties including resistivity and thermoelectric power (TEP) of Au/Ge bilayer films with self-similar fractal patterns were investigated in detail. Experimental results indicated that the microstructure of Au film plays an important role in the characteristics of Au/Ge bilayer films after annealing and the crystallization processes of amorphous Ge accompany by fractal formation of Ge nanocrystals via temperature-induced assembly. The appearance of fractal architectures has significantly influence on the TEP but little effect on the resistivity of the annealed bilayer film. By analysis of the data, we found that the values of superlocalization exponent are within 1.22 {<=} {xi} {<=} 1.29, which are higher than expected for two-dimension fractal systems. The results provided possible evidence for the superlocalization on fractal architectures in Au/Ge bilayer films. The TEP measurements are considered a more effective method than the conductivity for investigating superlocalization in a percolating system.

  8. Evolution of the Deep-space Galactic Cosmic Ray Lineal Energy Transfer Spectrum through Tissue Equivalent Plastic

    Science.gov (United States)

    Case, A. W.; Kasper, J. C.; Spence, H. E.; Golightly, M. J.; Schwadron, N. A.; Mazur, J. E.; Blake, J. B.; Looper, M. D.; Townsend, L.; Zeitlin, C. J.

    2011-12-01

    The Cosmic Ray Telescope for the Effects of Radiation is an energetic particle telescope that resides on the Lunar Reconnaissance Orbiter spacecraft, currently in a 50 km circular lunar polar orbit. The telescope consists of 6 silicon semi-conductor detectors placed in pairs that surround two pieces of Tissue Equivalent Plastic (TEP), which serve to absorb energy from particles as they transit through the instrument. Particles with energies greater than 12 MeV/nucleon can penetrate the outermost shield and be measured by the instrument. The primary measurement made by the instrument is of the Linear Energy Transfer (LET) of energetic particles as they transit through the telescope. CRaTER measures the LET spectrum with unprecedented energy resolution and has done so during a period of historically low solar activity that led to record high intensities of Galactic Cosmic Rays (GCR). These LET spectra are used to study changes in the properties of the incoming particles, and to make detailed measurements of the radiation doses human explorers will experience in deep space on missions to the moon, to asteroids, or to Mars. We present LET spectra accumulated during 2009 and 2010. We show how the LET spectrum evolves through the instrument as the GCR interact with the TEP. Due to the importance of these measurements for human effects, our extensive absolute calibration procedures are presented. Of particular note is a significant reduction in the flux of particles with LET greater than 10 keV/um for detectors that lie deeper within the telescope stack, due to the attenuation of high LET particles within the TEP. By measuring this attenuation we can estimate the depth in human tissue where the highest LET particles that are most likely to cause genetic damage pose the greatest threat to humans in space.

  9. Attention Modulates TMS-Locked Alpha Oscillations in the Visual Cortex.

    Science.gov (United States)

    Herring, Jim D; Thut, Gregor; Jensen, Ole; Bergmann, Til O

    2015-10-28

    Cortical oscillations, such as 8-12 Hz alpha-band activity, are thought to subserve gating of information processing in the human brain. While most of the supporting evidence is correlational, causal evidence comes from attempts to externally drive ("entrain") these oscillations by transcranial magnetic stimulation (TMS). Indeed, the frequency profile of TMS-evoked potentials (TEPs) closely resembles that of oscillations spontaneously emerging in the same brain region. However, it is unclear whether TMS-locked and spontaneous oscillations are produced by the same neuronal mechanisms. If so, they should react in a similar manner to top-down modulation by endogenous attention. To test this prediction, we assessed the alpha-like EEG response to TMS of the visual cortex during periods of high and low visual attention while participants attended to either the visual or auditory modality in a cross-modal attention task. We observed a TMS-locked local oscillatory alpha response lasting several cycles after TMS (but not after sham stimulation). Importantly, TMS-locked alpha power was suppressed during deployment of visual relative to auditory attention, mirroring spontaneous alpha amplitudes. In addition, the early N40 TEP component, located at the stimulation site, was amplified by visual attention. The extent of attentional modulation for both TMS-locked alpha power and N40 amplitude did depend, with opposite sign, on the individual ability to modulate spontaneous alpha power at the stimulation site. We therefore argue that TMS-locked and spontaneous oscillations are of common neurophysiological origin, whereas the N40 TEP component may serve as an index of current cortical excitability at the time of stimulation. Copyright © 2015 Herring et al.

  10. Off-great-circle paths in transequatorial propagation: 2. Nonmagnetic-field-aligned reflections

    Science.gov (United States)

    Tsunoda, Roland T.; Maruyama, Takashi; Tsugawa, Takuya; Yokoyama, Tatsuhiro; Ishii, Mamoru; Nguyen, Trang T.; Ogawa, Tadahiko; Nishioka, Michi

    2016-11-01

    There is considerable evidence that plasma structure in nighttime equatorial F layer develops from large-scale wave structure (LSWS) in bottomside F layer. However, crucial details of how this process proceeds, from LSWS to equatorial plasma bubbles (EPBs), remain to be sorted out. A major obstacle to success is the paucity of measurements that provide a space-time description of the bottomside F layer over a broad geographical region. The transequatorial propagation (TEP) experiment is one of few methods that can do so. New findings using a TEP experiment, between Shepparton (SHP), Australia, and Oarai (ORI), Japan, are presented in two companion papers. In Paper 1 (P1), (1) off-great-circle (OGC) paths are described in terms of discrete and diffuse types, (2) descriptions of OGC paths are generalized from a single-reflection to a multiple-reflection process, and (3) discrete type is shown to be associated with an unstructured but distorted upwelling, whereas the diffuse type is shown to be associated with EPBs. In Paper 2 (P2), attention is placed on differences in east-west (EW) asymmetry, found between OGC paths from the SHP-ORI experiment and those from another near-identical TEP experiment. Differences are reconciled by allowing three distinct sources for the EW asymmetries: (1) reflection properties within an upwelling (see P1), (2) OGC paths that depend on magnetic declination of geomagnetic field (B), and (3) OGC paths supported by non-B-aligned reflectors at latitudes where inclination of B is finite.

  11. Research paper no. 18. Trading rules for CO2 emission permits systems. A proposal for ceilings on quantities and prices

    International Nuclear Information System (INIS)

    Criqui, P.; Viguier, L.

    2000-01-01

    Tradable emission permit (TEP) systems for greenhouse gases (GHGs) as they could develop following the Kyoto Protocol - that is if they are limited to Annex B countries and are not bound by exchange regulations) - do not appear to be greatly acceptable today, either to the United States or to the European Union. The problem of the uncertainty related to the cost of reducing emissions is strongly highlighted in the United States: in fact, the approach adopted in the Kyoto Protocol, that of quantitative emissions targets, leaves the question of the reduction programme costs wide open. For the European Union, the unregulated TEP system is hardly acceptable because it would not guarantee that the principle of 'supplementarity' adopted in the Kyoto Protocol, that is, the fact that the purchase of permits should be in addition to action taken within each of the Annex B countries. The section two of this paper is an in-depth economic analysis of the european proposal for ''concrete ceilings''. The alternative proposals, formulated in the United States and relating more to permit price ceilings or''trigger price'', are examined in Section 3. After showing that each of the foregoing proposals could have consequences unacceptable to some or others of the parties to the Protocol, Section 4 offers the proposal of a hybrid formula for regulating the rights market. In fact, the main aim of this paper is to show that the implementation of a 'hybrid solution', consisting of limiting the volume of exchanges while at the same time introducing a TEP price ceiling, could provide a market regulation framework effect allowing the benefits of most of the economic advantages to be enjoyed and also having characteristics acceptable to the various parties from an environmental as well as from an international fairness point of view. (A.L.B.)

  12. Long-latency TMS-evoked potentials during motor execution and inhibition

    Directory of Open Access Journals (Sweden)

    Kentaro eYamanaka

    2013-11-01

    Full Text Available Transcranial magnetic stimulation (TMS has often been used in conjunction with electroencephalography (EEG, which is effective for the direct demonstration of cortical reactivity and corticocortical connectivity during cognitive tasks through the spatio-temporal pattern of long-latency TMS-evoked potentials (TEPs. However, it remains unclear what pattern is associated with the inhibition of a planned motor response. Therefore, we performed TMS-EEG recording during a go/stop task, in which participants were instructed to click a computer mouse with a right index finger when an indicator that was moving with a constant velocity reached a target (go trial or to avoid the click when the indicator randomly stopped just before it reached the target (stop trial. Single-pulse TMS to the left (contralateral or right (ipsilateral motor cortex was applied 500 ms before or just at the target time. TEPs related to motor execution and inhibition were obtained by subtractions between averaged EEG waveforms with and without TMS. As a result, in TEPs induced by both contralateral and ipsilateral TMS, small oscillations were followed by a prominent negative deflection around the TMS site peaking at approximately 100 ms post-TMS (N100, and a less pronounced later positive component (LPC over the broad areas that was centered at the midline-central site in both go and stop trials. However, compared to the pattern in go and stop trials with TMS at 500 ms before the target time, N100 and LPC were differently modulated in the go and stop trials with TMS just at the target time. The amplitudes of both N100 and LPC decreased in go trials, while the amplitude of LPC decreased and the latency of LPC was delayed in both go and stop trials. These results suggested that TMS-induced neuronal reactions in the motor cortex and subsequent their propagation to surrounding cortical areas might change functionally according to task demand when executing and inhibiting a motor

  13. Laparoscopic totally extraperitoneal inguinal hernia repair: lessons learned from 3,100 hernia repairs over 15 years.

    Science.gov (United States)

    Dulucq, Jean-Louis; Wintringer, Pascal; Mahajna, Ahmad

    2009-03-01

    Two revolutions in inguinal hernia repair surgery have occurred during the last two decades. The first was the introduction of tension-free hernia repair by Liechtenstein in 1989 and the second was the application of laparoscopic surgery to the treatment of inguinal hernia in the early 1990s. The purposes of this study were to assess the safety and effectiveness of laparoscopic totally extraperitoneal (TEP) repair and to discuss the technical changes that we faced on the basis of our accumulative experience. Patients who underwent an elective inguinal hernia repair at the Department of Abdominal Surgery at the Institute of Laparoscopic Surgery (ILS), Bordeaux, between June 1990 and May 2005 were enrolled retrospectively in this study. Patient demographic data, operative and postoperative course, and outpatient follow-up were studied. A total of 3,100 hernia repairs were included in the study. The majority of the hernias were repaired by TEP technique; the repair was done by transabdominal preperitoneal (TAPP) repair in only 3%. Eleven percent of the hernias were recurrences after conventional repair. Mean operative time was 17 min in unilateral hernia and 24 min in bilateral hernia. There were 36 hernias (1.2%) that required conversion: 12 hernias were converted to open anterior Liechtenstein and 24 to laparoscopic TAPP technique. The incidence of intraoperative complications was low. Most of the patients were discharged at the second day of the surgery. The overall postoperative morbidity rate was 2.2%. The incidence of recurrence rate was 0.35%. The recurrence rate for the first 200 repairs was 2.5%, but it decreased to 0.47% for the subsequent 1,254 hernia repairs According to our experience, in the hands of experienced laparoscopic surgeons, laparoscopic hernia repair seems to be the favored approach for most types of inguinal hernias. TEP is preferred over TAPP as the peritoneum is not violated and there are fewer intra-abdominal complications.

  14. A prospective randomised trial comparing mesh types and fixation in totally extraperitoneal inguinal hernia repairs.

    Science.gov (United States)

    Cristaudo, Adam; Nayak, Arun; Martin, Sarah; Adib, Reza; Martin, Ian

    2015-05-01

    The totally extraperitoneal (TEP) approach for surgical repair of inguinal hernias has emerged as a popular technique. We conducted a prospective randomised trial to compare patient comfort scores using different mesh types and fixation using this technique. Over a 14 month period, 146 patients underwent 232 TEP inguinal hernia repairs. We compared the comfort scores of patients who underwent these procedures using different types of mesh and fixation. A non-absorbable 15 × 10 cm anatomical mesh fixed with absorbable tacks (Control group) was compared with either a non-absorbable 15 × 10 cm folding slit mesh with absorbable tacks (Group 2), a partially-absorbable 15 × 10 cm mesh with absorbable tacks (Group 3) or a non-absorbable 15 × 10 cm anatomical mesh fixed with 2 ml fibrin sealant (Group 4). Outcomes were compared at 1, 2, 4 and 12 weeks using the Carolina Comfort Scale (CCS) scores. At 1, 2, 4 and 12 weeks, the median global CCS scores were low for all treatment groups. Statistically significant differences were seen only for median CCS scores and subscores with the use of partially-absorbable mesh with absorbable tacks (Group 3) at weeks 2 and 4. However, these were no longer significant at week 12. In this study, the TEP inguinal hernia repair with minimal fixation results in low CCS scores. There were no statistical differences in CCS scores when comparing types of mesh, configuration of the mesh or fixation methods. Copyright © 2015 IJS Publishing Group Limited. Published by Elsevier Ltd. All rights reserved.

  15. Marine Synechococcus Aggregation

    Science.gov (United States)

    Neuer, S.; Deng, W.; Cruz, B. N.; Monks, L.

    2016-02-01

    Cyanobacteria are considered to play an important role in the oceanic biological carbon pump, especially in oligotrophic regions. But as single cells are too small to sink, their carbon export has to be mediated by aggregate formation and possible consumption by zooplankton producing sinking fecal pellets. Here we report results on the aggregation of the ubiquitous marine pico-cyanobacterium Synechococcus as a model organism. We first investigated the mechanism behind such aggregation by studying the potential role of transparent exopolymeric particles (TEP) and the effects of nutrient (nitrogen or phosphorus) limitation on the TEP production and aggregate formation of these pico-cyanobacteria. We further studied the aggregation and subsequent settling in roller tanks and investigated the effects of the clays kaolinite and bentonite in a series of concentrations. Our results show that despite of the lowered growth rates, Synechococcus in nutrient limited cultures had larger cell-normalized TEP production, formed a greater volume of aggregates, and resulted in higher settling velocities compared to results from replete cultures. In addition, we found that despite their small size and lack of natural ballasting minerals, Synechococcus cells could still form aggregates and sink at measureable velocities in seawater. Clay minerals increased the number and reduced the size of aggregates, and their ballasting effects increased the sinking velocity and carbon export potential of aggregates. In comparison with the Synechococcus, we will also present results of the aggregation of the pico-cyanobacterium Prochlorococcus in roller tanks. These results contribute to our understanding in the physiology of marine Synechococcus as well as their role in the ecology and biogeochemistry in oligotrophic oceans.

  16. Community-Based Global Health Program for Maltreated Children and Adolescents in Brazil: The Equilibrium Program.

    Science.gov (United States)

    Marques, Andrea Horvath; Oliveira, Paula Approbato; Scomparini, Luciana Burim; Silva, Uiara Maria Rêgo E; Silva, Angelica Cristine; Doretto, Victoria; de Medeiros Filho, Mauro Victor; Scivoletto, Sandra

    2015-01-01

    The maltreatment of children and adolescents is a global public health problem that affects high- and low-middle income countries ("LMICs"). In the United States, around 1.2 million children suffer from abuse, while in LMICs, such as Brazil, these rates are much higher (an estimated 28 million children). Exposition to early environmental stress has been associated with suboptimal physical and brain development, persistent cognitive impairment, and behavioral problems. Studies have reported that children exposed to maltreatment are at high risk of behavioral problems, learning disabilities, communication and psychiatric disorders, and general clinical conditions, such as obesity and systemic inflammation later in life. The aim of this paper is to describe The Equilibrium Program ("TEP"), a community-based global health program implemented in São Paulo, Brazil to serve traumatized and neglected children and adolescents. We will describe and discuss TEP's implementation, highlighting its innovation aspects, research projects developed within the program as well as its population profile. Finally, we will discuss TEP's social impact, challenges, and limitations. The program's goal is to promote the social and family reintegration of maltreated children and adolescents through an interdisciplinary intervention program that provides multi-dimensional bio-psycho-social treatment integrated with the diverse services needed to meet the unique demands of this population. The program's cost effectiveness is being evaluated to support the development of more effective treatments and to expand similar programs in other areas of Brazil. Policy makers should encourage early evidence-based interventions for disadvantaged children to promote healthier psychosocial environments and provide them opportunities to become healthy and productive adults. This approach has already shown itself to be a cost-effective strategy to prevent disease and promote health.

  17. Identifying real and perceived barriers to therapeutic education programs for individuals with inflammatory arthritis.

    Science.gov (United States)

    Bain, Lorna; Sangrar, Ruheena; Bornstein, Carolyn; Lukmanji, Sara; Hapuhennedige, Sandani; Thorne, Carter; Beattie, Karen A

    2016-09-01

    Therapeutic Education Programs (TEPs) grounded in self-management principles have been shown to improve quality of life of patients with chronic conditions and reduce patient-related healthcare costs. Though these programs are becoming more readily available, patients often experience barriers in participating. This study sought to identify barriers faced by inflammatory arthritis (IA) patients in attending a TEP and understand how patients overcame perceived barriers. A mixed-method study design was used. Questionnaires were distributed to individuals with IA who were invited to attend a TEP between 2010 and 2013. Respondents were those that chose not to attend (group A), individuals who attended ≤4 of 10 sessions (group B), individuals who attended ≥5 of 10 sessions prior to May 2013 (group C), and individuals who attended ≥5 of 10 sessions from June 2013 to November 2013 (group D). Individuals in group D were also invited to participate in focus groups to discuss how they had overcome perceived barriers. Real barriers identified by individuals in groups A and B included time, distance, and cost associated with attendance. Individuals who overcame perceived barriers (groups C and D) discussed strategies they used to do so. Aspects of the overall program experience and access to clinic and program also contributed to patients being able to overcome barriers. Time, distance, and cost are external barriers that prevented individuals from utilizing self-management education opportunities. These barriers were overcome if and when individuals had resources available to them. Readiness for behavior change also influenced commitment to participate in the program.

  18. The experience and awareness of laparoendoscopic procedures among Polish surgeons in everyday clinical practice.

    Science.gov (United States)

    Mitura, Kryspin; Dąbrowiecki, Stanisław; Śmietański, Maciej; Matyja, Andrzej

    2017-01-01

    In 2012, a total of 56 647 inguinal hernia repairs were performed in Poland. However, the absence of a uniform hernia repair register obscures the current herniology status in Poland, especially regarding laparoendoscopic procedures. To determine the awareness of laparoendoscopic procedures among Polish surgeons and to ascertain their everyday clinical practice. The data were collected at the national hernia conference in 2016, during an interactive session for surgeons with a special interest in herniology. They could respond to the survey items using the VoxVote application. All items and response options were displayed on participants' smartphones. The questions were related to transabdominal preperitoneal/totally extraperitoneal (TAPP/TEP) hernia repair. The surgeons responded to 27 questions regarding routine inguinal hernia repair. One hundred and six surgeons from all regions of Poland participated in the survey. 19.2% of respondents never inform patients about the possibility of performing laparoendoscopic repair. 45.2% admitted that they had referred a patient with a difficult inguinal hernia to another hospital or surgeon. Seventy-five percent stated they would be willing to perform TAPP/TEP if the reimbursement rates were more favourable. In bilateral hernias, 61.6% of the respondents perform a two-step open repair, while only 25% perform a single-stage laparoendoscopic repair of bilateral hernia. In women, only 13.3% perform laparoendoscopic hernia repairs, and 19.0% do not use mesh. The skill level to perform TAPP/TEP repair is still inadequate among Polish surgeons. The absence of accurate data makes it impossible to verify whether the treatment methods used are compliant with the guidelines.

  19. Species delimitation of common reef corals in the genus Pocillopora using nucleotide sequence phylogenies, population genetics and symbiosis ecology.

    Science.gov (United States)

    Pinzón, Jorge H; LaJeunesse, Todd C

    2011-01-01

    Stony corals in the genus Pocillopora are among the most common and widely distributed of Indo-Pacific corals and, as such, are often the subject of physiological and ecological research. In the far Tropical Eastern Pacific (TEP), they are major constituents of shallow coral communities, exhibiting considerable variability in colony shape and branch morphology and marked differences in response to thermal stress. Numerous intermediates occur between morphospecies that may relate to extensive hybridization. The diversity of the Pocillopora genus in the TEP was analysed genetically using nuclear ribosomal (ITS2) and mitochondrial (ORF) sequences, and population genetic markers (seven microsatellite loci). The resident dinoflagellate endosymbiont (Symbiodinium sp.) in each sample was also characterized using sequences of the internal transcribed spacer 2 (ITS2) rDNA and the noncoding region of the chloroplast psbA minicircle. From these analyses, three symbiotically distinct, reproductively isolated, nonhybridizing, evolutionarily divergent animal lineages were identified. Designated types 1, 2 and 3, these groupings were incongruent with traditional morphospecies classification. Type 1 was abundant and widespread throughout the TEP; type 2 was restricted to the Clipperton Atoll; and type 3 was found only in Panama and the Galapagos Islands. Each type harboured a different Symbiodinium'species lineage' in Clade C, and only type 1 associated with the 'stress-tolerant'Symbiodinium glynni (D1). The accurate delineation of species and implementation of a proper taxonomy may profoundly improve our assessment of Pocillopora's reproductive biology, biogeographic distributions, and resilience to climate warming, information that must be considered when planning for the conservation of reef corals. © 2010 Blackwell Publishing Ltd.

  20. Identifying inequitable exposure to toxic air pollution in racialized and low-income neighbourhoods to support pollution prevention

    Directory of Open Access Journals (Sweden)

    Suzanne Kershaw

    2013-05-01

    Full Text Available Numerous environmental justice studies have confirmed a relationship between population characteristics such as low-income or minority status and the location of environmental health hazards. However, studies of the health risks from exposure to harmful substances often do not consider their toxicological characteristics. We used two different methods, the unit-hazard and the distance-based approach, to evaluate demographic and socio-economic characteristics of the population residing near industrial facilities in the City of Toronto, Canada. In addition to the mass of air emissions obtained from the national pollutant release inventory (NPRI, we also considered their toxicity using toxic equivalency potential (TEP scores. Results from the unit-hazard approach indicate no significant difference in the proportion of low-income individuals living in host versus non-host census tracts (t(107 = 0.3, P = 0.735. However, using the distance-based approach, the proportion of low-income individuals was significantly higher (+5.1%, t(522 = 6.0, P <0.001 in host tracts, while the indicator for “racialized” communities (“visible minority” was 16.1% greater (t(521 = 7.2, P <0.001 within 2 km of a NPRI facility. When the most toxic facilities by non-carcinogenic TEP score were selected, the rate of visible minorities living near the most toxic NPRI facilities was significantly higher (+12.9%, t(352 = 3.5, P = 0.001 than near all other NPRI facilities. TEP scores were also used to identify areas in Toronto that face a double burden of poverty and air toxics exposure in order to prioritise pollution prevention.

  1. EEG-guided transcranial magnetic stimulation reveals rapid shifts in motor cortical excitability during the human sleep slow oscillation

    DEFF Research Database (Denmark)

    Bergmann, Til O; Mölle, Matthias; Schmidt, Marlit A

    2012-01-01

    Evoked cortical responses do not follow a rigid input–output function but are dynamically shaped by intrinsic neural properties at the time of stimulation. Recent research has emphasized the role of oscillatory activity in determining cortical excitability. Here we employed EEG-guided transcranial......, closely resembling a spontaneous SO. However, both MEPs and TEPs were consistently larger when evoked during SO up-states than during down-states, and ampliudes within each SO state depended on the actual EEG potential at the time and site of stimulation. These results provide first-time evidence...... magnetic stimulation (TMS) during non-rapid eye movement sleep to examine whether the spontaneous

  2. Establishing an EnvironMentors Project to Guide Minority Students into Science, Technology, and Environmental Careers

    Energy Technology Data Exchange (ETDEWEB)

    Montague, W. E.

    2003-01-24

    This report of the EnvironMentors Project (TEP) for the period February 1994 through December 1998, provides a summary of activities at our program sites and of our overall organizational accomplishments. Notably, the EnvironMentors Project matched 506 teens from under-resourced neighborhoods in Washington (DC), Trenton (NJ), and Baltimore (MD) with mentors, engaged more than 1,600 members of the public in informative discussions of environmental research, and presented interactive environmental education lessons to approximately 5,700 elementary and middle school children.

  3. Ceramic Membrane combined with Powdered Activated Carbon (PAC) or Coagulation for Treatment of Impaired Quality Waters

    KAUST Repository

    Hamad, Juma Z.

    2013-08-29

    Ceramic membranes (CM) are robust membranes attributed with high production, long life span and stability against critical conditions. While capital costs are high, these are partially offset by lower operation and maintenance costs compared to polymeric membranes. Like any other low-pressure membrane (LPM), CM faces problems of fouling, low removal of organic matter and poor removal of trace organic compounds (TOrCs). Current pretreatment approaches that are mainly based on coagulation and adsorption can remove some organic matter but with a low removal of the biopolymers component which is responsible for fouling. Powdered activated carbon (PAC) accompanied with a LPM maintains good removal of TOrCs. However, enhanced removal of TOrCs to higher level is required. Submicron powdered activated carbon (SPAC), obtained after crushing commercial activated carbon into very fine particle, and novel activated carbon (KCU 6) which is characterized with larger pores and high surface area were employed. A pre-coating approach, which provides intimated contact between PAC and contaminants, was adopted for wastewater and (high DOC) surface water treatment. For seawater, in-line coagulation with iron III chloride was adopted. Both SPAC and KCU 6 showed good removal of biopolymers at a dose of 30 mg/L with > 85 % and 90 %, respectively. A dose of 40 mg/L of SPAC and 30 mg/L KCU 6 pre-coats were successful used in controlling membrane fouling. SPAC is suggested to remove biopolymers by physical means and adsorption while KCU 6 removed biopolymers through adsorption. Both KCU 6 and SPAC attained high removal of TOrCs whereas KCU 6 showed outstanding performance. Out of 29 TOrCs investigated, KCU 6 showed > 87 % TOrCs rejection for 28 compounds. In seawater pretreatment, transparent exopolymer particles (TEP) were found to be an important foulant. TEP promoted both reversible and irreversible fouling. TEP are highly electronegative while alumina CM is positively charged which

  4. CO2-emission trading and green markets for renewable electricity. WILMAR - deliverable 4.1

    International Nuclear Information System (INIS)

    Azuma-Dicke, N.; Weber, C.; Morthorst, P.E.; Ravn, H.F.; Schmidt, R.

    2004-06-01

    This report is Deliverable 4.1 of the EU project 'Wind Power Integration in Liberalised Electricity Markets' (WILMAR) and de-scribes the application of two policy instruments, Tradable Emissions Permits (TEPs) and Tradable Green Certificates (TGCs) for electricity produced from renewable energy sources in the European Union and the implications for implementation in the Wilmar model. The introduction of a common emission-trading system in the EU is expected to have an upward effect on the spot prices at the electric-ity market. The variations of the spot price imply that some types of power generation may change the situation from earning money to losing money despite the increasing spot price. Heavy restrictions on emissions penalise the fossil-fuelled technologies significantly, and the associated increase in the spot price need not compensate for this. Therefore, a market of TEPs is expected to have a significant influence on the electricity spot price. However, the expected price level of TEPs are met with great uncertainty and a study of a number of economical studies shows a price span between zero and 270 USD per ton of CO 2 depending on the participation or non-participation of countries in the scheme. The price-determination at the TGC market is expected to be closely related to the price at the power spot market as the RE-producers of electricity will have expectations to the total price paid for the energy produced, i.e., for the price of electricity at the spot market plus the price per kWh obtained at the green certificate mar-ket. In the Wilmar model, the TGC market can either be handled exogenously, i.e., the increase in renewable capacity and an average annual TGC price are determined outside the model, or a simple TGC module is developed, including the long-term supply functions for the most relevant renewable technologies and an overall TGC quota. Both solutions are rather simple, but to develop a more advanced model for the TGC market seems to be

  5. 173. Carcinoma renal con trombosis de vena cava y extensión a aurícula derecha: Una técnica novedosa sin hipotermia profunda ni parada cardiocirculatoria

    Directory of Open Access Journals (Sweden)

    A.M. Bel Mínguez

    2012-04-01

    Resultados: No hubo muertes quirúrgicas ni intrahospitalarias. El tiempo medio de circulación extracorpórea (CEC fue de 189 min. La estancia media en la unidad de cuidados intensivos (UCI fue de 7 días (rango 4–33 y la estancia postoperatoria media de 19 días (rango 15–60. Hubo un caso de tromboembolismo pulmonar (TEP intraoperatorio. Un paciente desarrolló una encefalopatía hipoxicoanóxica.

  6. Posibilidad de aprovechamiento de residuos textiles para la obtención de etanol

    OpenAIRE

    Zurima Menéndez-Ramírez; Azam Jeihanipour; Mohammad Taherzadeh; Lourdes Zumalacárregui-de Cárdenas

    2010-01-01

    El uso del bioetanol como combustible es una alternativa para minimizar los efectos negativos al medioambiente, ya que reduce el efecto invernadero. En este trabajo se estudian residuos textiles como candidatos para la producción de etanol. Los residuos textiles pretratados con NaOH 12 % (p/v) 0 °C, 3 h (TEP) y sin pretratar (TESP y TDSP), fueron sometidos a procesos simultáneos de sacarificación y fermentación (37 °C, 145 r/min, pH 4,8 a 5). Durante la sacarificación y fermentación, la veloc...

  7. Ecological Studies and Molecular Characterization of Thraustochytrids and Aplanochytrids from Oceanic Water Column

    Digital Repository Service at National Institute of Oceanography (India)

    Damare, V.

    on transparent exopolymeric particles (TEP) abundance and size spectra. J. Plank. Res., 23 (5), 515-525. B-21 Radić T., Kraus R., Fuks D., Radić J. & Pečar O. 2005. Transparent exopolymeric particles’ distribution in the northern Adriatic and their relation... to microphytoplankton biomass and composition. Sci. Total Environ., 353, 151-161. Radić T., Ivančić I., Fuks D. & Radić J. 2006. Marine bacterioplankton production of polysaccharidic and proteinaceous particles under different nutrient regimes. FEMS Microbiol. Ecol...

  8. Repair of inguinal hernia: a comparison between extraperitoneal laparoscopy and Lichtenstein open surgery

    Directory of Open Access Journals (Sweden)

    Tavassoli A

    2010-06-01

    Full Text Available "n Normal 0 false false false EN-US X-NONE AR-SA MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:Arial; mso-bidi-theme-font:minor-bidi;} Background: The inguinal hernia is a common disorder in general surgery. Different methods have been described for repair of these hernias. In modern methods, synthetic mesh is used to cover the wall defect and the most known method is Lichtenstein surgical repair. The laparoscopic totally extra peritoneal procedure (TEP is a newer technique of repairing hernia. The aim of this study is to compare the outcomes of totally extraperitoneal laparoscopic inguinal hernia repair versus Lichtenstein open repair in patients with inguinal hernia."n"nMethods: Among 50 patients, 25 cases underwent Lichtenstein procedure and 25 patients underwent TEP technique for repairing primary unilateral inguinal hernia. Findings during the operation have been recorded and the 12-months follow-up of patients in different views was performed through a questionnaire and then the results were compared."n"nResults: The operation duration, the rate of complications and frequency of recurrence were similar in two groups; but the hospital stay, postoperative pain, chronic groin pain and the required time to return to normal activity were significantly lower in patients who underwent the TEP method compared to the patients who underwent the

  9. Serum cortisol and blood glucose in bitches treated with tramadol and submitted to ovariohysterectomy

    OpenAIRE

    Caldeira, Fátima Maria Caetano; Oliveira, Humberto Pereira; Melo, Eliane Gonçalves; Martins, Claudia; Vieira, Marilisa Souza; Silva, Cristiano Nicomedes da

    2006-01-01

    O tramadol é um analgésico opióide usado em medicina veterinária, embora existam poucos estudos sobre este fármaco. O objetivo deste trabalho foi avaliar o efeito analgésico promovido pela administração do tramadol, mensurando o cortisol sérico e a glicemia de cadelas. Para isso, foram utilizadas 15 fêmeas, submetidas a ovário-histerectomia sob anestesia geral com isofluorano. Os animais foram divididos em três grupos. Grupo 1 (Tep) receberam tramadol pela via epidural (1,0mg kg-1 diluído em ...

  10. Cortisol sérico e glicemia em cadelas tratadas com tramadol e submetidas à ovário-histerectomia

    OpenAIRE

    Caldeira Fátima Maria Caetano; Oliveira Humberto Pereira; Melo Eliane Gonçalves; Martins Claudia; Vieira Marilisa Souza; Silva Cristiano Nicomedes da

    2006-01-01

    O tramadol é um analgésico opióide usado em medicina veterinária, embora existam poucos estudos sobre este fármaco. O objetivo deste trabalho foi avaliar o efeito analgésico promovido pela administração do tramadol, mensurando o cortisol sérico e a glicemia de cadelas. Para isso, foram utilizadas 15 fêmeas, submetidas a ovário-histerectomia sob anestesia geral com isofluorano. Os animais foram divididos em três grupos. Grupo 1 (Tep) receberam tramadol pela via epidural (1,0mg kg-1 diluído em ...

  11. In the field of energy cost reduction, what is the potential?; En matiere de reduction des depenses d`energie: quel est le gisement?

    Energy Technology Data Exchange (ETDEWEB)

    Millet, B. [Departement Industrie, CEREN (France)

    1996-12-31

    Through a segmentation of the fuel and electric power consumptions in the various industrial sectors and energy consumption process types in France in 1990, the energy conservation potential in the French metalworking and mechanical industry is analyzed and its evolution up to 2005 is assessed. It is shown that the reduction potential amounts to 450 kTep or 20 percent of the metalworking and metallic construction industry energy consumption, with an important part for the out-of-process sector (space heating, compressed air production, lighting). In the process sector, important reductions could be realized in thermal treatments and metal heating prior forming

  12. CO{sub 2} intensity in electricity delivered to Swiss end-users. Summary report; Intensite CO{sub 2} de l'electricite vendue aux consommateurs finaux en Suisse. Resume du rapport final

    Energy Technology Data Exchange (ETDEWEB)

    Jakob, M.; Volkart, K.; Widmer, D

    2009-07-15

    In this short summary report published by TEP Energy GmbH in Zuerich the main findings of a study made for the Swiss gas and oil industries on the effective CO{sub 2} intensities involved in Swiss electricity consumption are presented and discussed. The authors present their ideas on how CO{sub 2} emissions should be calculated on the basis of figures on Swiss power generation, imports and exports in a European context. The results obtained from the use of three methods for viewing Swiss electricity consumption involving net and gross power export and import are briefly discussed.

  13. (Re)Programa, Rehabilitación Arquitectónica con criterios de sostenibilidad de un barrio en Andalucía

    OpenAIRE

    Blandón González, Begoña; Gómez de Terreros Guardiola, Pedro; Barrios Padura, Ángela; Molina Huelva, Marta; Mercader-Moyano, Pilar (Coordinador)

    2017-01-01

    Entre los años 2013 a 2015, miembros del grupo TEP 954 InFact trabajaron en el contrato I+D adjudicado por la Agencia de Obra Pública de la Junta de Andalucía, estudiando las necesidades de intervención en el parque edificado andaluz construido desde los años 40 con el objetivo de garantizar el “envejecimiento activo” y “en casa”. Se propone un nuevo modelo urbano que garantiza que las personas puedan permanecer en sus barrios hasta el final de sus días, desde proyectos cent...

  14. Characterization of nanostructured photosensitive cadmium sulphide thin films grown by SILAR deposition technique

    International Nuclear Information System (INIS)

    Ubale, A.U.; Bargal, A.N.

    2010-01-01

    This paper reports the preparation of photosensitive nanostructured CdS thin films by successive ionic layer adsorption and reaction (SILAR) method at room temperature. To obtain good quality CdS thin films, preparative conditions such as concentration of cationic and anionic precursors, adsorption and rinsing time durations etc. are optimized. The structural, optical and electrical characterizations of the as-deposited and annealed CdS thin films were carried out using X-ray diffraction, scanning electron microscopy, optical absorption and electrical resistivity methods. The photoconductivity studies showed that the annealed films are more than that photosensitive. The TEP measurement shows that deposited films are of n-type. (author)

  15. Project W-314 specific test and evaluation plan for 241-AY-02A pump pit upgrade

    International Nuclear Information System (INIS)

    Hays, W.H.

    1998-01-01

    This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the upgrade of the 241-AY-02A Pump Pit for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AY-02A Pump Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

  16. Project W-314 specific test and evaluation plan for 241-AY-01A pump pit upgrade

    International Nuclear Information System (INIS)

    Hays, W.H.

    1998-01-01

    This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the upgrade of the 241-AY-0IA Pump Pit for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AY-01A Pump Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

  17. Avaliação do ventrículo direito pelo ecocardiograma com doppler tecidual na embolia pulmonar aguda

    Directory of Open Access Journals (Sweden)

    Ana Clara Tude Rodrigues

    2013-06-01

    Full Text Available FUNDAMENTO: A avaliação da função Ventricular Direita (VD pelo ecocardiograma em pacientes com Tromboembolismo Pulmonar (TEP é complexa, frequentemente qualitativa; o Doppler tecidual tem sido utilizado para avaliação semiquantitativa dessa câmara, com algumas limitações. OBJETIVO: Avaliar a função do VD no TEP pelo ecocardiograma com Doppler tecidual, complementando com o peptídeo atrial natriurético (BNP. MÉTODOS: Foram estudados pacientes com TEP pelo ecocardiograma com Doppler tecidual e BNP até 24 horas do diagnóstico, obtendo-se as velocidades miocárdicas (s', strain, strain rate e índice de performance miocárdica do VD; disfunção do VD foi iagnosticada por hipocinesia da câmara, movimento anormal septal e relação VD/VE >1. De acordo com o BNP os pacientes foram divididos em Grupo I, BNP 50 pg/mL. RESULTADOS: De 118 pacientes, 100 (60 homens, idade = 55 ± 17 anos foram analisados; observou-se disfunção do VD em 28%, mais frequentemente no grupo II (19 vs. 9 pacientes, p < 0,001. O grupo II era mais idoso (64 ± 19 vs. 50 ± 15 anos, apresentava menor velocidade de s' (10,5 ± 3,5 vs. 13,2 ± 3,1 cm/s e maior pressão pulmonar (48 ± 11 vs. 35 ± 11 mmHg, p < 0,001 para todos. O ponto de corte de s' para disfunção do VD foi de 10,8 cm/s (especificidade = 85%, sensibilidade = 54%, com moderada correlação entre o BNP e a onda s'(r = -0,39. CONCLUSÃO: No TEP, a disfunção do VD pelo ecocardiograma se acompanha de elevação do BNP; apesar confirmar adequadamente a presença de disfunção do VD, o Doppler tecidual apresenta sensibilidade limitada para este diagnóstico.

  18. In vitro ruminal fermentation and methane production of different seaweed species

    DEFF Research Database (Denmark)

    Molina-Alcaide, E.; Carro, M.D.; Roleda, M. Y.

    2017-01-01

    Seaweeds have potentials as alternative feed for ruminants, but there is a limited knowledge on their nutritive value. Seven seaweed species collected along the coast above the Arctic circle of Norway, both in spring and autumn, were assessed for nutrients and total polyphenols (TEP) content, gas...... production kinetics and in vitro rumen fermentation in batch cultures of ruminal microorganisms. The seaweeds were three red species (Mastocarpus stellatus, Palmaria palmata and Porphyra sp.), three brown species (Alaria esculenta, Laminaria digitata and Pelvetia canaliculata) and one green species...

  19. Pompes à chaleur dans l'industrie Heat Pumps in Industry

    OpenAIRE

    Benchecroun N.

    2006-01-01

    Les pompes à chaleur pourraient permettre une réduction de la consommation énergétique de l'industrie française estimée à 3,5 Mtep à l'horizon 1990 (300 000 tep en 1982). Ces installations se situeront dans les domaines du chauffage des locaux industriels, du séchage à basse température, du réchauffage de liquides et de certaines opérations de fractionnement. Pour les utilisations dans des procédés industriels les secteurs concernés sont principalement les industries agroalimentaires et, à pl...

  20. Rural residential energy consumption not electrified in the Municipality of Petrolina-PE, Brazil; Consumo energetico residencial rural nao eletrificado do municipio de Petrolina-PE

    Energy Technology Data Exchange (ETDEWEB)

    Borges Neto, Manuel Rangel; Lopes, Luiz Carlos Nascimento [Centro Federal de Educacao Tecnologica de Petrolina (CEFET/PET), CE (Brazil); Carvalho, Paulo Cesar Marques de [Universidade Federal do Ceara (PPGEE/UFC), Fortaleza (Brazil). Programa de Pos Graduacao em Engenharia Eletrica

    2006-07-01

    This paper brings a study about the energetic profile consumption of the residential rural off-grid population in Petrolina- PE municipality. A community was chose as a sample and trough some interviews it was possible to get enough data to estimate the energetic consumption of this segment in the county. In conclusion it has a specific annual consumption of 0,125 tep/hab, 5.9% higher than the Brazilian average and that the firewood is the source to 91,87% of the energy final use. (author)

  1. TMSEEG: A MATLAB-Based Graphical User Interface for Processing Electrophysiological Signals during Transcranial Magnetic Stimulation

    Directory of Open Access Journals (Sweden)

    Sravya Atluri

    2016-10-01

    Full Text Available Concurrent recording of electroencephalography (EEG during transcranial magnetic stimulation (TMS is an emerging and powerful tool for studying brain health and function. Despite a growing interest in adaptation of TMS-EEG across neuroscience disciplines, its wide-spread utility is limited by signal processing challenges. These challenges arise due to the nature of TMS and the sensitivity of EEG to artifacts that often mask TMS-evoked potentials (TEPs. With an increase in the complexity of data processing methods and a growing interest in multi-site data integration, analysis of TMS-EEG data requires the development of a standardized method to recover TEPs from various sources of artifacts. This paper introduces TMSEEG, an open-source MATLAB application comprised of multiple algorithms organized to facilitate a step-by-step procedure for TMS-EEG signal processing. Using a modular design and interactive GUIs, this toolbox aims to streamline TMS-EEG signal processing for both novice and experienced users. Specifically, TMSEEG provides (i targeted removal of TMS-induced and general EEG artifacts, (ii a step-by-step modular workflow with flexibility to modify existing algorithms and add customized algorithms, (iii a comprehensive display and quantification of artifacts, (iv quality control check points with visual feedback of TEPs throughout the data processing workflow, and (v capability to label and store a database of artifacts. In addition to these features, the software architecture of TMSEEG ensures minimal user effort in initial setup and configuration of parameters for each processing step. This is partly accomplished through a close integration with EEGLAB, a widely used open-source toolbox for EEG signal processing. In this paper we introduce TMSEEG, validate its features, and demonstrate its application in extracting TEPs across several single- and multi-pulse TMS protocols. As the first open-source GUI-based pipeline for TMS-EEG signal

  2. Sol-Gel SiO2-CaO-P2O5 biofilm with surface engineered for medical application

    Directory of Open Access Journals (Sweden)

    Sonia Regina Federman

    2007-06-01

    Full Text Available Sol-gel film in the SiO2-CaO-P2O5 system was prepared from TEOS, TEP, alcohol and hydrated calcium nitrate in an acidic medium. The coatings were deposited on stainless steel using the dip-coating technique. After deposition, the composite was submitted to heat treatment, at different temperatures and exposure times to investigate the influence of such parameters on the surface morphology of the composite. The coated surfaces were characterized by AFM, SEM and FTIR. The present study showed that the formation of different textures (an important parameter in implant fixation could be controlled by temperature and time of heat treatment.

  3. Expansion of the Eclipse Digital Signal Processing System.

    Science.gov (United States)

    1982-12-01

    routed to ind from extended memory through this window. SAct willy, dti is not physically moved, address registers are imply hiai~jt d. ’zThe...method of moving data on the Eclipse is with the extended memory feature. With this feature data is not physically moved, address registers are simply...8217eOU WIdT TO,. Fig 1 IE.ETZIM U2. E( 11 -4., - IULTIPI.E P * S WI) STPM FILTER (- PAWtfTEP FILE PFILE FILTER FILE: WILE FIEP. LENGTH 55 WINIIM OF WQS

  4. Estandarización de un método para la extracción de DNA a partir de muestras clínicas parafinadas

    OpenAIRE

    Tiscornia, María M; Cubilla, Marisa A; Lorenzati, María A; Cariaga Martínez, Ariel E; Zapata, Pedro D

    2010-01-01

    La epidemiología molecular estudia variaciones genotípicas relacionándolas con diversos procesos biológicos, entre ellos los patológicos como el cáncer. Por ello el análisis de muestras clínicas parafinadas es de gran importancia para el diagnóstico, la prevención y la terapia. Se ha informado con anterioridad muchos problemas relacionados con la amplificación de DNA obtenido a partir tejido embebido en parafina (TEP). En este trabajo se comparó la capacidad de 9 metodologías para obtener DNA...

  5. An Overview of Governance and Accountability of Tahfiz Institutions in Malaysian: Religious Councils Perspective

    Directory of Open Access Journals (Sweden)

    Bani Hamidah

    2017-01-01

    Full Text Available Tahfiz education is one of the popular streams of education in Malaysia and well accepted by Muslim community. Originally the education is being offered in “pondok”, a traditional religious school. Developing through times, it is now also being offered in tahfiz centers as well as in modern tahfiz institutions. These entities specialize in producing tahfiz graduates who can memorize and recite the whole Al-Quran and more than 91% of them are privately owned. The applicability of good governance and accountability measures is indeed highly desirable in these Islamic entities as it deals with the responsibility in fulfilling sacred religious obligation. Though the number of tahfiz education providers (TEP has grown up tremendously from only 58 in 1999 to 278 in 2011, literatures on governance and accountability of TEP are still lacking as the areas are rarely examined directly. The lacking may lead to unfavorable inferences that TEP are behaving in the manners contrary to the interest of the stakeholders. An ideally accountable governance of tahfiz centers will gain trust from parents and various stakeholders and will indicate the achievement in fulfilling one of the objective of Maqasid Shariah to preserve and promote the religious faith through preserving the memorization and knowledge of Al Quran (the primary source of Islamic Law by the huffaz. The objective of this research is to investigate external governance mechanism and the accountability of Tahfiz centers as viewed by religious regulatory bodies. A qualitative research approach is undertaken by interviewing representatives from selected State Islamic Religious Councils, State Islamic Foundation and National Religious Departments in Malaysia. Using thematic analysis, findings of this study revealed that there are two-tier governance infrastructures of tahfiz institutions in Malaysia. However, the enforcement of the governance structure is still at infancy level. The accountability

  6. RECIFE: NOTES AROUND THE GENESIS OF A FIELD CULTURAL

    Directory of Open Access Journals (Sweden)

    Flávio Weinstein Teixeira

    2014-12-01

    Full Text Available Regard to the discussion of artistic modernity in Brazil, the article presents a panel of intellectual and cultural debates in Recife (1920-50, in order to give weight to the power lines, literate sociability, as well as the spaces of recognition and consecration the artistic/intellectual making that resulted in a specific dynamic to the cultural field of the city. Therefore, give special attention to the actions of a local theater group (TEP – Pernambuco Students’s Theatre and their contribution to the renewal of artistic and intellectual practices.

  7. George AFB, Victorville, Caifornia Revised Uniform Summary of Surface Weather Observations (RUSSWO) Parts A -F.

    Science.gov (United States)

    1981-09-14

    722 6.21 ; WeB &b 958.j11 25971 36.) 5.77 22 22.5 4 m Do-. 6 44564 20 512 2P.Q 9.261 122 .7 58.4 ,4 • . ,. - 6 1 ...,. , ., . I . . t - GL -!- AL CLI.1A...PSYCHROMETRIC SUMMARY ,E’_ . ",L ,F- C/ P’-773-3- NCV STATION STATION NAME YEARS MONT" NOURS IL. S. T.I Te.p. WET BULB TEMPERATURE DEPRESSION (F) TOTAL

  8. A study for the improvement of top end piece structure strength

    International Nuclear Information System (INIS)

    Song, Kee Nam; Sohn, Dong Seong

    1989-01-01

    As a part of the top end piece(TEP) for the 14 X 14 reload fuel, various models of top end piece structure were analysed, using the ANSYS code, under fuel assembly shipping and handling load conditions. The 3-dimensional isoparametric elements were used in each model. By rearrangement of slots and holes on the adapter plate, without violating the design requirements, and also by changing the enclosure attachment method used on the adapter plate from pin joints to through-weld, the load carrying capacity of the adapter plate was greatly strengthened. These concepts were adopted for the design of the 14 X 14 reload fuel. (Author)

  9. Abundance and relationship of bacteria with transparent exopolymer particles during the 1996 summer monsoon in the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Ramaiah, N.; Sarma, V.V.S.S.; Gauns, M.; DileepKumar, M.; Madhupratap, M.

    .45 m polycarbonate or Durapore filters within a couple of hours of collection and stained with alcian blue (0.1% E. 444 N Ramaiah et al. wt/vol). The TEP were then dissolved in 80% sul- phuric acid and the absorbance of the solution was read at 785 and... denitrification. Further, the gen- eration times of bacteria in the surface (0--120 m) waters along 64 E range from 5.5 to 19 days during different seasons (Ramaiah, unpublished) suggesting faster carbon turnover than those estimated by Wiebinga et al (1997...

  10. Modified Anderson-Darling tests with selective power improvement

    OpenAIRE

    Cabaña Nigro, Alejandra

    2001-01-01

    Transformed empirical processes (TEPs) have been used by the authors in a previous paper to construct consistent and selectively efficient goodness-of-fit tests of the Kolmogorov-Smirnov type. A straightforward application of the same ideas to the construction of tests of the Cramér-von-Mises type with the same properties leads to cumbersome computations. This short note of the incovenients encountered, and introduces a new family of quadratic statistics of the Cramér-von Mises type, in order...

  11. Aspiration of tracheoesophageal prosthesis in a laryngectomized patient

    Directory of Open Access Journals (Sweden)

    Conte Sergio C

    2012-08-01

    Full Text Available Abstract Background The voice prosthesis inserted into a tracheoesophageal fistula has become the most widely used device for voice rehabilitation in patients with total laryngectomy. Case presentation We describe a case of tracheoesophageal prosthesis’ (TEP aspiration in a laryngectomized patient, with permanent tracheal stoma, that appeared during standard cleaning procedure, despite a programme of training for the safe management of patients with voice prosthesis. Conclusions The definitive diagnosis and treatment were performed by flexible bronchoscopy, that may be considered the procedure of choice in these cases, also on the basis of the literature.

  12. Cleaning protocol for a FO membrane fouled in wastewater reuse

    KAUST Repository

    Valladares Linares, Rodrigo

    2013-05-30

    Forward osmosis (FO) is an emerging technology which can be applied in water reuse applications. Osmosis is a natural process that involves less energy consumption than reverse osmosis (RO), and therefore can be applied as a dilution process before low-pressure RO; it is expected to compete favourably against current advanced water reuse technologies that use microfiltration/ultrafiltration and RO. The focus of this research was to assess the efficiency of different cleaning procedures to remove fouling from the surface of a FO membrane during the operation of a submerged system working in FO-mode (active layer (AL) facing feed solution) intended for secondary wastewater effluent (SWWE) recovery, using seawater as draw solution (DS), which will be diluted and can further be fed to a low-pressure RO unit to produce fresh water. Natural organic matter (NOM) fouling was expected to affect the AL, while for the support layer (SL), transparent exopolymer particles (TEP) were used as indicators of fouling due to their stickiness and propensity to enhance the attachment of other foulants in seawater on the membrane surface. The composition of the NOM fouling layer was determined after proper characterisation with a liquid chromatograph coupled with organic carbon detection (LC-OCD), showing biopolymers and protein-like substances as the main constituents. NOM fouling showed high hydraulic reversibility after a 25% flux decline was observed, up to 89.5% when in situ air scouring for 15 min was used as a cleaning technique. Chemical cleaning with a mixture of Alconox, an industrial detergent containing phosphates, and sodium EDTA showed to increase the reversibility (93.6%). Osmotic backwash using a 4% NaCl solution and DI water proved to be ineffective to recover flux due to the salt diffusion phenomena occurring at the AL. Part of the flux that could not be recovered is attributable to TEP fouling on the SL, which forms clusters clearly identifiable with an optical

  13. Cleaning protocol for a FO membrane fouled in wastewater reuse

    KAUST Repository

    Valladares Linares, Rodrigo; Li, Zhenyu; Yangali-Quintanilla, Victor; Li, Qingyu; Amy, Gary L.

    2013-01-01

    Forward osmosis (FO) is an emerging technology which can be applied in water reuse applications. Osmosis is a natural process that involves less energy consumption than reverse osmosis (RO), and therefore can be applied as a dilution process before low-pressure RO; it is expected to compete favourably against current advanced water reuse technologies that use microfiltration/ultrafiltration and RO. The focus of this research was to assess the efficiency of different cleaning procedures to remove fouling from the surface of a FO membrane during the operation of a submerged system working in FO-mode (active layer (AL) facing feed solution) intended for secondary wastewater effluent (SWWE) recovery, using seawater as draw solution (DS), which will be diluted and can further be fed to a low-pressure RO unit to produce fresh water. Natural organic matter (NOM) fouling was expected to affect the AL, while for the support layer (SL), transparent exopolymer particles (TEP) were used as indicators of fouling due to their stickiness and propensity to enhance the attachment of other foulants in seawater on the membrane surface. The composition of the NOM fouling layer was determined after proper characterisation with a liquid chromatograph coupled with organic carbon detection (LC-OCD), showing biopolymers and protein-like substances as the main constituents. NOM fouling showed high hydraulic reversibility after a 25% flux decline was observed, up to 89.5% when in situ air scouring for 15 min was used as a cleaning technique. Chemical cleaning with a mixture of Alconox, an industrial detergent containing phosphates, and sodium EDTA showed to increase the reversibility (93.6%). Osmotic backwash using a 4% NaCl solution and DI water proved to be ineffective to recover flux due to the salt diffusion phenomena occurring at the AL. Part of the flux that could not be recovered is attributable to TEP fouling on the SL, which forms clusters clearly identifiable with an optical

  14. Organic Carbon Reduction in Seawater Reverse Osmosis (SWRO) Plants, Jeddah, Saudi Arabia

    KAUST Repository

    Alshahri, Abdullah

    2015-12-01

    Desalination is considered to be a major source of usable water in the Middle East, especially the Gulf countries which lack fresh water resources. A key and sometimes the only solution to produce high quality water in these countries is through the use of seawater reverse osmosis (SWRO) desalination technology. Membrane fouling is an economic and operational defect that impacts the performance of SWRO desalination technology. To limit this fouling phenomenon, it is important to implement the appropriate type of intake and pre-treatment system design. In this study, two types of systems were investigated, a vertical well system and a surface-water intake at a 9m depth. The purpose of this investigation is to study the impact of the different intake systems and pre-treatment stages in minimizing the concentrations of algae, bacteria, natural organic matter (NOM) and transparent exopolymer particles (TEP), in the feed water prior to pre-treatment, through the pre-treatment stages, and in the product water and concentrate. Water samples were collected from the surface seawater, the intakes (wells for site A, 9 m depth open ocean intake at site B), after the media filter, after the cartridge filter, and from the permeate and reject streams. The measured parameters included physical parameters, algae, bacteria, total organic carbon (TOC), fractions of dissolved NOM, particulate and colloidal TEP. The results of this study prove that the natural filtration and biological treatment of the seawater which occur in the aquifer matrix are very effective in improving the raw water quality to a significant degree. The results demonstrated that algae and biopolymers were 100% removed, the bacterial concentrations were significantly removed and roughly 50% or greater of TOC concentrations was eliminated by the aquifer matrix at site A. The aquifer feeding the vertical wells reduced TEP concentrations, but to differing degree. There is a slight decrease in the concentrations of

  15. A comparison of the resistance of Temporary Edge Protection Systems to static and dynamic loads

    Directory of Open Access Journals (Sweden)

    González, M. N.

    2015-06-01

    Full Text Available Temporary Edge Protection Systems (TEPS are designed to withstand the impact of a worker that walks, stumbles, and falls against them. This is by nature a dynamic action; however, many standards evaluate TEPS when the surface or slope is slightly inclined (less than 10°, applying static requirements. The performance requirements demanded by these standards are assumed to be equivalent to the impact of a worker, however this point has not been tested. In this study, TEPS with tubular steel guardrails and wooden boards of different quality under two types of loads are evaluated using the static requirements detailed in standard EN 13374. TEPS are subjected to an impact energy of 180 J, simulating a worker of 90 kg walking at a speed of 2 m/s. The results demonstrate that the static requirements of EN 13374 are more demanding than the impact of 180 J in all the systems under study.Los sistemas provisionales de protección de borde (SPPB están diseñados para detener el impacto de un trabajador que camina, tropieza y golpea contra ellas. Esto supone una acción de naturaleza dinámica. Sin embargo, muchas normas evalúan SPPB utilizando requisitos de tipo estático cuando la superficie de trabajo está poco inclinada (menos de 10° suponiendo que equivalen al impacto de un trabajador. No obstante, este aspecto no se ha confirmado experimentalmente. En este trabajo SPPB con barandillas de tubos de acero y de tablas de madera se han evaluado usando los requisitos estáticos definidos por la norma EN 13374. Posteriormente, se han sometido a una energía de impacto de 180 J, que simula a un trabajador de 90 kg caminando a una velocidad de 2 m/s. Los resultados demuestran que los requisitos estáticos de la norma EN 13374 son más exigentes que el impacto de 180 J en todos los sistemas estudiados.

  16. Predominant constitutive CFTR conductance in small airways

    Directory of Open Access Journals (Sweden)

    Lytle Christian

    2005-01-01

    Full Text Available Abstract Background The pathological hallmarks of chronic obstructive pulmonary disease (COPD are inflammation of the small airways (bronchiolitis and destruction of lung parenchyma (emphysema. These forms of disease arise from chronic prolonged infections, which are usually never present in the normal lung. Despite the fact that primary hygiene and defense of the airways presumably requires a well controlled fluid environment on the surface of the bronchiolar airway, very little is known of the fluid and electrolyte transport properties of airways of less than a few mm diameter. Methods We introduce a novel approach to examine some of these properties in a preparation of minimally traumatized porcine bronchioles of about 1 mm diameter by microperfusing the intact bronchiole. Results In bilateral isotonic NaCl Ringer solutions, the spontaneous transepithelial potential (TEP; lumen to bath of the bronchiole was small (mean ± sem: -3 ± 1 mV; n = 25, but when gluconate replaced luminal Cl-, the bionic Cl- diffusion potentials (-58 ± 3 mV; n = 25 were as large as -90 mV. TEP diffusion potentials from 2:1 NaCl dilution showed that epithelial Cl- permeability was at least 5 times greater than Na+ permeability. The anion selectivity sequence was similar to that of CFTR. The bionic TEP became more electronegative with stimulation by luminal forskolin (5 μM+IBMX (100 μM, ATP (100 μM, or adenosine (100 μM, but not by ionomycin. The TEP was partially inhibited by NPPB (100 μM, GlyH-101* (5–50 μM, and CFTRInh-172* (5 μM. RT-PCR gave identifying products for CFTR, α-, β-, and γ-ENaC and NKCC1. Antibodies to CFTR localized specifically to the epithelial cells lining the lumen of the small airways. Conclusion These results indicate that the small airway of the pig is characterized by a constitutively active Cl- conductance that is most likely due to CFTR.

  17. Mechanistic Insight in the Function of Phosphite Additives for Protection of LiNi0.5Co0.2Mn0.3O2 Cathode in High Voltage Li-Ion Cells.

    Science.gov (United States)

    He, Meinan; Su, Chi-Cheung; Peebles, Cameron; Feng, Zhenxing; Connell, Justin G; Liao, Chen; Wang, Yan; Shkrob, Ilya A; Zhang, Zhengcheng

    2016-05-11

    Triethlylphosphite (TEP) and tris(2,2,2-trifluoroethyl) phosphite (TTFP) have been evaluated as electrolyte additives for high-voltage Li-ion battery cells using a Ni-rich layered cathode material LiNi0.5Co0.2Mn0.3O2 (NCM523) and the conventional carbonate electrolyte. The repeated charge/discharge cycling for cells containing 1 wt % of these additives was performed using an NCM523/graphite full cell operated at the voltage window from 3.0-4.6 V. During the initial charge process, these additives decompose on the cathode surface at a lower oxidation potential than the baseline electrolyte. Impedance spectroscopy and post-test analyses indicate the formation of protective coatings by both additives on the cathode surface that prevent oxidative breakdown of the electrolyte. However, only TTFP containing cells demonstrate the improved capacity retention and Coulombic efficiency. For TEP, the protective coating is also formed, but low Li(+) ion mobility through the interphase layer results in inferior performance. These observations are rationalized through the inhibition of electrocatalytic centers present on the cathode surface and the formation of organophosphate deposits isolating the cathode surface from the electrolyte. The difference between the two phosphites clearly originates in the different properties of the resulting phosphate coatings, which may be in Li(+) ion conductivity through such materials.

  18. The TROVE module: A common element in Telomerase, Ro and Vault ribonucleoproteins

    Directory of Open Access Journals (Sweden)

    Bateman Alex

    2003-10-01

    Full Text Available Abstract Background Ribonucleoproteins carry out a variety of important tasks in the cell. In this study we show that a number of these contain a novel module, that we speculate mediates RNA-binding. Results The TROVE module – Telomerase, Ro and Vault module – is found in TEP1 and Ro60 the protein components of three ribonucleoprotein particles. This novel module, consisting of one or more domains, may be involved in binding the RNA components of the three RNPs, which are telomerase RNA, Y RNA and vault RNA. A second conserved region in these proteins is shown to be a member of the vWA domain family. The vWA domain in TEP1 is closely related to the previously recognised vWA domain in VPARP a second component of the vault particle. This vWA domain may mediate interactions between these vault components or bind as yet unidentified components of the RNPs. Conclusions This work suggests that a number of ribonucleoprotein components use a common RNA-binding module. The TROVE module is also found in bacterial ribonucleoproteins suggesting an ancient origin for these ribonucleoproteins.

  19. Combined heat and power in the Swedish district heating sector-impact of green certificates and CO2 trading on new investments

    International Nuclear Information System (INIS)

    Knutsson, David; Werner, Sven; Ahlgren, Erik O.

    2006-01-01

    Combined heat and power (CHP) has been identified by the EU administration as an important means of reducing CO 2 -emissions and increasing the energy efficiency. In Sweden, only about one third of the demand for district heat (DH) is supplied from CHP. This share could be significantly larger if the profitability of CHP generation increased. The objective of this study was to analyse the extent to which the profitability for investments in new CHP plants in the Swedish DH sector have changed thanks to the recently implemented trading schemes for green certificates (TGCs) and CO 2 emissions (TEPs). The analysis was carried out using a simulation model of the Swedish DH sector in which the profitability of CHP investments for all DH systems, with and without the two trading schemes applied, is compared. In addition, a comparison was made of the changes in CHP generation, CO 2 emissions, and operation costs if investments are made in the CHP plant shown to be most profitable in each system according to the model. The study shows that the profitability of investments in CHP plants increased significantly with the introductions of TGC and TEP schemes. If all DH utilities also undertook their most profitable CHP investments, the results indicate a major increase in power generation which, in turn, would reduce the CO 2 emissions from the European power sector by up to 13 Mton/year, assuming that coal condensing power is displaced

  20. Structures of the NH tautomers of tetraethylporphyrin and its isocyclic derivative

    International Nuclear Information System (INIS)

    Shul'ga, A.M.; Gladkov, L.L.; Stanishevskii, I.V.; Starukhin, A.S.

    1987-01-01

    Vibronic spectra with detailed structure have been recorded in the fluorescence of the NH tautomers of 2,3,12,13-tetraethylporphyrin (TEP), 13',15'-cyclo-13'-methyl-2,3,12-triethylporphyrin (TEPC), and derivatives of these deuterated at the center, which has involved the use of selective laser excitation at 4.2 K. The degrees of polarization have been measured for the individual phonon-free lines. The vibrational structures and 1 H NMR data (two independent methods) have given the structures of the NH tautomers. The short-wave (main) tautomer of TEP has the imine protons on the pyrrole rings containing ethyl substituents, while the long-wave one has them on the pyrrole rings containing protons in the β positions. The intensities of the lines relating mainly to vibrations of the ethyl groups are sensitive to the positions of the central protons. A difference from the tetraalkylporphyrins is that the main TEPC tautomer has the central protons positioned on opposite pyrrole rings not linked to the isocycle as being more favored by energy considerations

  1. Renewable municipal waste barometer

    International Nuclear Information System (INIS)

    2014-01-01

    In the European Union the production of primary energy from the incineration of municipal waste increased by only 0.7% in 2013 and reached 8.7 million tep (tonnes of oil equivalent). Germany ranks first with the production of 2729 ktep followed by France with 1246 ktep. A positive point is that the sale of heat to heat networks has strongly increased in some countries which means that primary energy is better used. 2 tables give the production of electricity and heat from the incineration of municipal waste in the E.U. member states in 2012 and 2013. Germany ranks first in the 2 tables. The total production of electricity and heat from the incineration of municipal waste in E.U. in 2013 reached 18741 GWh and 2361 tep respectively. A list reviews the most significant companies working in Europe in the sector of waste incineration, 8 companies are listed, 2 are German: EEW, Remondis, 3 are French: SITA (Suez Environment, Veolia and TIRU (EDF), Urbaser is spanish, Gruppo Hera is Italian and AEB-Amsterdan is dutch. (A.C.)

  2. From solid solution to cluster formation of Fe and Cr in α-Zr

    International Nuclear Information System (INIS)

    Burr, P.A.; Wenman, M.R.; Gault, B.; Moody, M.P.; Ivermark, M.; Rushton, M.J.D.; Preuss, M.; Edwards, L.; Grimes, R.W.

    2015-01-01

    To understand the mechanisms by which the re-solution of Fe and Cr additions increase the corrosion rate of irradiated Zr alloys, the solubility and clustering of Fe and Cr in model binary Zr alloys was investigated using a combination of experimental and modelling techniques — atom probe tomography (APT), x-ray diffraction (XRD), thermoelectric power (TEP) and density functional theory (DFT). Cr occupies both interstitial and substitutional sites in the α-Zr lattice; Fe favours interstitial sites, and a low-symmetry site that was not previously modelled is found to be the most favourable for Fe. Lattice expansion as a function of Fe and Cr content in the α-Zr matrix deviates from Vegard's law and is strongly anisotropic for Fe additions, expanding the c-axis while contracting the a-axis. Matrix content of solutes cannot be reliably estimated from lattice parameter measurements, instead a combination of TEP and APT was employed. Defect clusters form at higher solution concentrations, which induce a smaller lattice strain compared to the dilute defects. In the presence of a Zr vacancy, all two-atom clusters are more soluble than individual point defects and as many as four Fe or three Cr atoms could be accommodated in a single Zr vacancy. The Zr vacancy is critical for the increased apparent solubility of defect clusters; the implications for irradiation induced microstructure changes in Zr alloys are discussed.

  3. New results to BDD truncation method for efficient top event probability calculation

    International Nuclear Information System (INIS)

    Mo, Yuchang; Zhong, Farong; Zhao, Xiangfu; Yang, Quansheng; Cui, Gang

    2012-01-01

    A Binary Decision Diagram (BDD) is a graph-based data structure that calculates an exact top event probability (TEP). It has been a very difficult task to develop an efficient BDD algorithm that can solve a large problem since its memory consumption is very high. Recently, in order to solve a large reliability problem within limited computational resources, Jung presented an efficient method to maintain a small BDD size by a BDD truncation during a BDD calculation. In this paper, it is first identified that Jung's BDD truncation algorithm can be improved for a more practical use. Then, a more efficient truncation algorithm is proposed in this paper, which can generate truncated BDD with smaller size and approximate TEP with smaller truncation error. Empirical results showed this new algorithm uses slightly less running time and slightly more storage usage than Jung's algorithm. It was also found, that designing a truncation algorithm with ideal features for every possible fault tree is very difficult, if not impossible. The so-called ideal features of this paper would be that with the decrease of truncation limits, the size of truncated BDD converges to the size of exact BDD, but should never be larger than exact BDD.

  4. Defining a roadmap for harmonizing quality indicators in Laboratory Medicine: a consensus statement on behalf of the IFCC Working Group "Laboratory Error and Patient Safety" and EFLM Task and Finish Group "Performance specifications for the extra-analytical phases".

    Science.gov (United States)

    Sciacovelli, Laura; Panteghini, Mauro; Lippi, Giuseppe; Sumarac, Zorica; Cadamuro, Janne; Galoro, César Alex De Olivera; Pino Castro, Isabel Garcia Del; Shcolnik, Wilson; Plebani, Mario

    2017-08-28

    The improving quality of laboratory testing requires a deep understanding of the many vulnerable steps involved in the total examination process (TEP), along with the identification of a hierarchy of risks and challenges that need to be addressed. From this perspective, the Working Group "Laboratory Errors and Patient Safety" (WG-LEPS) of International Federation of Clinical Chemistry and Laboratory Medicine (IFCC) is focusing its activity on implementation of an efficient tool for obtaining meaningful information on the risk of errors developing throughout the TEP, and for establishing reliable information about error frequencies and their distribution. More recently, the European Federation of Clinical Chemistry and Laboratory Medicine (EFLM) has created the Task and Finish Group "Performance specifications for the extra-analytical phases" (TFG-PSEP) for defining performance specifications for extra-analytical phases. Both the IFCC and EFLM groups are working to provide laboratories with a system to evaluate their performances and recognize the critical aspects where improvement actions are needed. A Consensus Conference was organized in Padova, Italy, in 2016 in order to bring together all the experts and interested parties to achieve a consensus for effective harmonization of quality indicators (QIs). A general agreement was achieved and the main outcomes have been the release of a new version of model of quality indicators (MQI), the approval of a criterion for establishing performance specifications and the definition of the type of information that should be provided within the report to the clinical laboratories participating to the QIs project.

  5. Precipitation Kinetics in a Nb-stabilized Ferritic Stainless Steel

    Science.gov (United States)

    Labonne, M.; Graux, A.; Cazottes, S.; Danoix, F.; Cuvilly, F.; Chassagne, F.; Perez, M.; Massardier, V.

    2017-08-01

    The precipitation occurring in a Nb-stabilized ferritic stainless steel, containing initially Nb(C, N) carbonitrides and Fe3Nb3X precipitates, was investigated during aging treatments performed between 923 K and 1163 K (650 °C and 890 °C) by combining different techniques, (thermoelectric power (TEP), scanning/transmission electron microscopy (SEM/TEM), and atom probe tomography (APT)), in order to determine the precipitation kinetics, the nature and morphology of the newly formed precipitates as well as the chemistry of the initial Fe3Nb3X precipitates, where X stands for C or N. The following composition was proposed for these precipitates: (Fe0.81 Cr0.19)3 (Nb0.85 Si0.08 Mo0.07)3 (N0.8 C0.2), highlighting the simultaneous presence of N and C in the precipitates. With regard to the precipitation in the investigated temperature range, two main phenomena, associated with a hardness decrease, were clearly identified: (i) the precipitation of Fe2Nb precipitates from the niobium initially present in solution or coming from the progressive dissolution of the Fe3Nb3X precipitates and (ii) the precipitation of the χ-phase at grain boundaries for longer aging times. From the TEP kinetics, a time-temperature-precipitation diagram has been proposed.

  6. Flexible Multi-Objective Transmission Expansion Planning with Adjustable Risk Aversion

    Directory of Open Access Journals (Sweden)

    Jing Qiu

    2017-07-01

    Full Text Available This paper presents a multi-objective transmission expansion planning (TEP framework. Rather than using the conventional deterministic reliability criterion, a risk component based on the probabilistic reliability criterion is incorporated into the TEP objectives. This risk component can capture the stochastic nature of power systems, such as load and wind power output variations, component availability, and incentive-based demand response (IBDR costs. Specifically, the formulation of risk value after risk aversion is explicitly given, and it aims to provide network planners with the flexibility to conduct risk analysis. Thus, a final expansion plan can be selected according to individual risk preferences. Moreover, the economic value of IBDR is modeled and integrated into the cost objective. In addition, a relatively new multi-objective evolutionary algorithm called the MOEA/D is introduced and employed to find Pareto optimal solutions, and tradeoffs between overall cost and risk are provided. The proposed approach is numerically verified on the Garver’s six-bus, IEEE 24-bus RTS and Polish 2383-bus systems. Case study results demonstrate that the proposed approach can effectively reduce cost and hedge risk in relation to increasing wind power integration.

  7. A multi-stage stochastic transmission expansion planning method

    International Nuclear Information System (INIS)

    Akbari, Tohid; Rahimikian, Ashkan; Kazemi, Ahad

    2011-01-01

    Highlights: → We model a multi-stage stochastic transmission expansion planning problem. → We include available transfer capability (ATC) in our model. → Involving this criterion will increase the ATC between source and sink points. → Power system reliability will be increased and more money can be saved. - Abstract: This paper presents a multi-stage stochastic model for short-term transmission expansion planning considering the available transfer capability (ATC). The ATC can have a huge impact on the power market outcomes and the power system reliability. The transmission expansion planning (TEP) studies deal with many uncertainties, such as system load uncertainties that are considered in this paper. The Monte Carlo simulation method has been applied for generating different scenarios. A scenario reduction technique is used for reducing the number of scenarios. The objective is to minimize the sum of investment costs (IC) and the expected operation costs (OC). The solution technique is based on the benders decomposition algorithm. The N-1 contingency analysis is also done for the TEP problem. The proposed model is applied to the IEEE 24 bus reliability test system and the results are efficient and promising.

  8. Graphene oxide/MnO{sub 2} nanocomposite as destructive adsorbent of nerve-agent simulants in aqueous media

    Energy Technology Data Exchange (ETDEWEB)

    Šťastný, Martin, E-mail: stastny@iic.cas.cz [Materials Chemistry Department, Institute of Inorganic Chemistry AS CR v.v.i., 25068 Husinec-Řež (Czech Republic); Faculty of the Environment, J.E. Purkyně University in Ústí nad Labem, Králova Výšina 7, 400 96 Ústí nad Labem (Czech Republic); Tolasz, Jakub; Štengl, Václav; Henych, Jiří [Materials Chemistry Department, Institute of Inorganic Chemistry AS CR v.v.i., 25068 Husinec-Řež (Czech Republic); Žižka, David [Faculty of the Environment, J.E. Purkyně University in Ústí nad Labem, Králova Výšina 7, 400 96 Ústí nad Labem (Czech Republic)

    2017-08-01

    Highlights: • Nanocomposite graphene oxide-birnessite-type MnO{sub 2} was synthesized by thermal hydrolysis. • New destructive sorbent for safe degradation of nerve-agent simulants. • 95% degradation activity for DMMP and TEP. - Abstract: Graphene oxide/MnO{sub 2} nanocomposite was prepared by thermal hydrolysis of potassium permanganate (KMnO{sub 4}) and 2-chloroacetamide aqueous solutions with graphene oxide (GO) suspension. The synthesized samples were characterized by specific surface area (BET) and porosity determination (BJH), X-ray Diffraction (XRD) and high-resolution electron microscopes (HRSEM, HRTEM). These nanocomposites were used in an experimental evaluation of their adsorption activity with nerve agent simulants dimethyl methyl phosphonate (DMMP) and triethyl phosphate (TEP) in aqueous media. The nanocomposites exhibited enhanced adsorptive degradation ability compared to pure manganese oxide (MnO{sub 2}) and GO. The GO amount in the nanocomposites affected their degradation activity substantially. The best adsorption efficiency was observed for samples with moderate GO amount. Three methods were used to observe the mechanism of the nerve-agent simulants deactivation: Gas chromatography with mass spectrometry (GC–MS), High-Performance Liquid Chromatography (HPLC) and in situ Infrared spectroscopy (FTIR). It was shown that the hydrolysis on the surface of prepared nanocomposites yields volatile primary alcohols (methanol and ethanol) as the main hydrolysis products.

  9. [European Marketing Authorisation: a long process. Experiences of small biotech companies with the ATMP regulation].

    Science.gov (United States)

    Buljovčić, Z

    2011-07-01

    On 30 December 2008, the Regulation (EC) 1394/2007 on advanced therapy medicinal products (ATMPs) entered into force. Herewith the first EU-wide regulatory framework for ATMPs was established. It requires a central marketing authorisation application to the EMA (European Medicinal Agency). This new framework especially changes the code of regulatory practice for tissue engineered products (TEPs), as no registration procedure had been previously required for autologous TEPs. This also meant that no clinical proof of efficacy achieved by a pivotal clinical trial was necessary. Difficulties and their background as well as the vast requirements for product development that have to be addressed by small companies within a very short time frame are presented. Hereby, it is obvious that regulatory experience which is required to identify and implement the resulting implications was not in place yet and still had to be established. The lack of regulatory experience also resulted in difficulties with scientific advice preparation, expectations toward regulatory agencies, consultants, and transformation of regulatory requirements. Addressing the regulatory requirements within the transition period is even more difficult for entrepreneurs with products which are assigned for indications resulting in complex challenges to the trial design. Due to the enormous time pressure to generate data and due to the implied financial pressure, different adaptation strategies are evolving. In Germany the "hospital exemption" according to §4b AMG (German Medicinal Products Law) is of major importance. A reorientation toward acellular products and a slow down in development of new ATMP products is expected.

  10. ''Turbulent Equipartition'' Theory of Toroidal Momentum Pinch

    International Nuclear Information System (INIS)

    Hahm, T.S.; Diamond, P.H.; Gurcan, O.D.; Rewaldt, G.

    2008-01-01

    The mode-independent part of magnetic curvature driven turbulent convective (TuroCo) pinch of the angular momentum density (Hahm et al., Phys. Plasmas 14,072302 (2007)) which was originally derived from the gyrokinetic equation, can be interpreted in terms of the turbulent equipartition (TEP) theory. It is shown that the previous results can be obtained from the local conservation of 'magnetically weighted angular momentum density', nm i U # parallel# R/B 2 , and its homogenization due to turbulent flows. It is also demonstrated that the magnetic curvature modification of the parallel acceleration in the nonlinear gyrokinetic equation in the laboratory frame, which was shown to be responsible for the TEP part of the TurCo pinch of angular momentum density in the previous work, is closely related to the Coriolis drift coupling to the perturbed electric field. In addition, the origin of the diffusive flux in the rotating frame is highlighted. Finally, it is illustrated that there should be a difference in scalings between the momentum pinch originated from inherently toroidal effects and that coming from other mechanisms which exist in a simpler geometry.

  11. Project W-314 specific test and evaluation plan for SN-633 transfer line (241-AX-B to 241-AY-02A)

    International Nuclear Information System (INIS)

    Hays, W.H.

    1998-01-01

    The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made by the addition of the SN-633 transfer line by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP). This STEP encompasses all testing activities required to demonstrate compliance to the project design criteria as it relates to the addition of transfer line SN-633. The Project Design Specifications (PDS) identify the specific testing activities required for the Project. Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities), Factory Acceptance Tests (FATs), installation tests and inspections, Construction Acceptance Tests (CATs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). It should be noted that POTPs are not required for testing of the transfer line addition. The STEP will be utilized in conjunction with the TEP for verification and validation

  12. Good recovery from aphasia is also supported by right basal ganglia: a longitudinal controlled PET study. EJPRM-ESPRM 2008 award winner.

    Science.gov (United States)

    De Boissezon, X; Marie, N; Castel-Lacanal, E; Marque, P; Bezy, C; Gros, H; Lotterie, J-A; Cardebat, D; Puel, M; Demonet, J-F

    2009-12-01

    It has long been a matter of debate whether recovery from aphasia after left perisylvian lesion is mediated by perilesional left hemispheric regions or by right homologous areas. To investigate the neural substrates of aphasia recovery, a longitudinal study in patients after a left single perisylvian stroke was performed. Thirteen aphasic patients were H2(15)O PET-scanned twice at a one year interval during a word generation task. Patients are divided into two groups according to language performance for the word generation task at PET2. For the Good Recovery (GR) group, patients' performances are indistinguishable from those of normal subjects, while patients from the Poor Recovery (PR) group keep language disorders. Using SPM2, Language-Rest contrast is computed for both groups at both PET stages. Then, Session Effect contrast (TEP2-TEP1>0) is calculated for both groups. For the GR group, the Session Effect contrast shows an increase of activations in the left Postero-Superior Temporal Gyrus PSTG but also in the right thalamus and lenticular nuclei; for PR patients, the right lenticular nucleus activation is more important at PET1 than PET2. The crucial role of the left temporal activation is confirmed and its increase is linked to behavioural recovery. The role of the right basal ganglia to support good recovery from aphasia is a new finding. Their activation may be more task-dependant and related to inhibition of the right frontal cortex.

  13. Air pollutant characterization in Tula industrial corridor, Central Mexico, during the MILAGRO study.

    Science.gov (United States)

    Sosa, G; Vega, E; González-Avalos, E; Mora, V; López-Veneroni, D

    2013-01-01

    Pollutant emissions and their contribution to local and regional air quality at the industrial area of Tula were studied during a four-week period as part of the MILAGRO initiative. A recurrent shallow stable layer was observed in the morning favoring air pollutants accumulation in the lower 100 m atmospheric layer. In the afternoon the mixing layer height reached 3000 m, along with a featuring low level jet which was responsible of transporting air pollutants at regional scales. Average PM10 at Jasso (JAS) and Tepeji (TEP) was 75.1 and 36.8 μ g/m(3), respectively while average PM2.5 was 31.0 and 25.7 μ g/m(3). JAS was highly impacted by local limestone dust, while TEP was a receptor of major sources of combustion emissions with 70% of the PM10 constituted by PM2.5. Average hourly aerosol light absorption was 22 Mm(-1), while aerosol scattering (76 Mm(-1)) was higher compared to a rural site but much lower than at Mexico City. δ(13)C values in the epiphyte Tillandsia recurvata show that the emission plume directly affects the SW sector of Mezquital Valley and is then constrained by a mountain range preventing its dispersion. Air pollutants may exacerbate acute and chronic adverse health effects in this region.

  14. Air Pollutant Characterization in Tula Industrial Corridor, Central Mexico, during the MILAGRO Study

    Directory of Open Access Journals (Sweden)

    G. Sosa

    2013-01-01

    Full Text Available Pollutant emissions and their contribution to local and regional air quality at the industrial area of Tula were studied during a four-week period as part of the MILAGRO initiative. A recurrent shallow stable layer was observed in the morning favoring air pollutants accumulation in the lower 100 m atmospheric layer. In the afternoon the mixing layer height reached 3000 m, along with a featuring low level jet which was responsible of transporting air pollutants at regional scales. Average PM10 at Jasso (JAS and Tepeji (TEP was 75.1 and 36.8 μg/m3, respectively while average PM2.5 was 31.0 and 25.7 μg/m3. JAS was highly impacted by local limestone dust, while TEP was a receptor of major sources of combustion emissions with 70% of the PM10 constituted by PM2.5. Average hourly aerosol light absorption was 22 Mm−1, while aerosol scattering (76 Mm−1 was higher compared to a rural site but much lower than at Mexico City. δ13C values in the epiphyte Tillandsia recurvata show that the emission plume directly affects the SW sector of Mezquital Valley and is then constrained by a mountain range preventing its dispersion. Air pollutants may exacerbate acute and chronic adverse health effects in this region.

  15. Theta Burst Stimulation of the Cerebellum Modifies the TMS-Evoked N100 Potential, a Marker of GABA Inhibition.

    Directory of Open Access Journals (Sweden)

    Allanah Harrington

    Full Text Available Theta burst stimulation (TBS of the cerebellum, a potential therapy for neurological disease, can modulate corticospinal excitability via the dentato-thalamo-cortical pathway, but it is uncertain whether its effects are mediated via inhibitory or facilitatory networks. The aim of this study was to investigate the effects of 30Hz cerebellar TBS on the N100 waveform of the TMS-evoked potential (TEP, a marker of intracortical GABAB-mediated inhibition. 16 healthy participants (aged 18-30 years; 13 right handed and 3 left handed received 30Hz intermittent TBS (iTBS, continuous TBS (cTBS or sham stimulation over the right cerebellum, in three separate sessions. The first 8 participants received TBS at a stimulus intensity of 80% of active motor threshold (AMT, while the remainder received 90% of AMT. Motor evoked potentials (MEP and TEP were recorded before and after each treatment, by stimulating the first dorsal interosseus area of the left motor cortex. Analysis of the 13 right handed participants showed that iTBS at 90% of AMT increased the N100 amplitude compared to sham and cTBS, without significantly altering MEP amplitude. cTBS at 80% of active motor threshold decreased the N100 amplitude and cTBS overall reduced resting MEP amplitude. The study demonstrates effects of 30Hz cerebellar TBS on inhibitory cortical networks that may be useful for treatment of neurological conditions associated with dysfunctional intracortical inhibition.

  16. Investigating consummatory and anticipatory pleasure across motivation deficits in schizophrenia and healthy controls.

    Science.gov (United States)

    Da Silva, Susana; Saperia, Sarah; Siddiqui, Ishraq; Fervaha, Gagan; Agid, Ofer; Daskalakis, Z Jeff; Ravindran, Arun; Voineskos, Aristotle N; Zakzanis, Konstantine K; Remington, Gary; Foussias, George

    2017-08-01

    Anhedonia has traditionally been considered a characteristic feature of schizophrenia, but the true nature of this deficit remains elusive. This study sought to investigate consummatory and anticipatory pleasure as it relates to motivation deficits. Eighty-four outpatients with schizophrenia and 81 healthy controls were administered the Temporal Experience of Pleasure Scale (TEPS), as well as a battery of clinical and cognitive assessments. Multivariate analyses of variance were used to examine the experience of pleasure as a function of diagnosis, and across levels of motivation deficits (i.e. low vs. moderate. vs. high) in schizophrenia. Hierarchical regression analyses were also conducted to evaluate the predictive value of amotivation in relation to the TEPS. There were no significant differences between schizophrenia and healthy control groups for either consummatory or anticipatory pleasure. Within the schizophrenia patients, only those with high levels of amotivation were significantly impaired in consummatory and anticipatory pleasure compared to low and moderate groups, and compared to healthy controls. Further, our results revealed that amotivation significantly predicts both consummatory and anticipatory pleasure, with no independent contribution of group. Utilizing study samples with a wide range of motivation deficits and incorporating objective paradigms may provide a more comprehensive understanding of hedonic deficits. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.

  17. From solid solution to cluster formation of Fe and Cr in α-Zr

    Energy Technology Data Exchange (ETDEWEB)

    Burr, P.A., E-mail: burr.patrick@gmail.com [Centre for Nuclear Engineering and Department of Materials, Imperial College London, London, SW7 2AZ (United Kingdom); Institute of Materials Engineering, Australian Nuclear Science & Technology Organisation, Menai, New South Wales 2234 (Australia); Wenman, M.R. [Centre for Nuclear Engineering and Department of Materials, Imperial College London, London, SW7 2AZ (United Kingdom); Gault, B.; Moody, M.P. [Department of Materials, University of Oxford, Parks Road, Oxford, OX1 3PH (United Kingdom); Ivermark, M. [High Temperature Materials, Sandvik Materials Technology, 734 27 Hallstahammar (Sweden); University of Manchester, School of Materials, M13 9PL (United Kingdom); Rushton, M.J.D. [Centre for Nuclear Engineering and Department of Materials, Imperial College London, London, SW7 2AZ (United Kingdom); Preuss, M. [University of Manchester, School of Materials, M13 9PL (United Kingdom); Edwards, L. [Institute of Materials Engineering, Australian Nuclear Science & Technology Organisation, Menai, New South Wales 2234 (Australia); Grimes, R.W. [Centre for Nuclear Engineering and Department of Materials, Imperial College London, London, SW7 2AZ (United Kingdom)

    2015-12-15

    To understand the mechanisms by which the re-solution of Fe and Cr additions increase the corrosion rate of irradiated Zr alloys, the solubility and clustering of Fe and Cr in model binary Zr alloys was investigated using a combination of experimental and modelling techniques — atom probe tomography (APT), x-ray diffraction (XRD), thermoelectric power (TEP) and density functional theory (DFT). Cr occupies both interstitial and substitutional sites in the α-Zr lattice; Fe favours interstitial sites, and a low-symmetry site that was not previously modelled is found to be the most favourable for Fe. Lattice expansion as a function of Fe and Cr content in the α-Zr matrix deviates from Vegard's law and is strongly anisotropic for Fe additions, expanding the c-axis while contracting the a-axis. Matrix content of solutes cannot be reliably estimated from lattice parameter measurements, instead a combination of TEP and APT was employed. Defect clusters form at higher solution concentrations, which induce a smaller lattice strain compared to the dilute defects. In the presence of a Zr vacancy, all two-atom clusters are more soluble than individual point defects and as many as four Fe or three Cr atoms could be accommodated in a single Zr vacancy. The Zr vacancy is critical for the increased apparent solubility of defect clusters; the implications for irradiation induced microstructure changes in Zr alloys are discussed.

  18. Complement-related proteins control the flavivirus infection of Aedes aegypti by inducing antimicrobial peptides.

    Directory of Open Access Journals (Sweden)

    Xiaoping Xiao

    2014-04-01

    Full Text Available The complement system functions during the early phase of infection and directly mediates pathogen elimination. The recent identification of complement-like factors in arthropods indicates that this system shares common ancestry in vertebrates and invertebrates as an immune defense mechanism. Thioester (TE-containing proteins (TEPs, which show high similarity to mammalian complement C3, are thought to play a key role in innate immunity in arthropods. Herein, we report that a viral recognition cascade composed of two complement-related proteins limits the flaviviral infection of Aedes aegypti. An A. aegypti macroglobulin complement-related factor (AaMCR, belonging to the insect TEP family, is a crucial effector in opposing the flaviviral infection of A. aegypti. However, AaMCR does not directly interact with DENV, and its antiviral effect requires an A. aegypti homologue of scavenger receptor-C (AaSR-C, which interacts with DENV and AaMCR simultaneously in vitro and in vivo. Furthermore, recognition of DENV by the AaSR-C/AaMCR axis regulates the expression of antimicrobial peptides (AMPs, which exerts potent anti-DENV activity. Our results both demonstrate the existence of a viral recognition pathway that controls the flaviviral infection by inducing AMPs and offer insights into a previously unappreciated antiviral function of the complement-like system in arthropods.

  19. Development of engineering program for integrity evaluation of pipes with local wall thinned defects

    International Nuclear Information System (INIS)

    Park, Chi Yong; Lee, Sung Ho; Kim, Tae Ryong; Park, Sang Kyu

    2008-01-01

    Integrity evaluation of pipes with local wall thinning by erosion and corrosion is increasingly important in maintenance of wall thinned carbon steel pipes in nuclear power plants. Though a few program for integrity assessment of wall thinned pipes have been developed in domestic nuclear field, however those are limited to straight pipes and methodology proposed in ASME Sec.XI Code Case N-597. Recently, the engineering program for integrity evaluation of pipes with all kinds of local wall defects such as straight, elbow, reducer and branch pipes was developed successfully. The program was designated as PiTEP (Pipe Thinning Evaluation Program), which name was registered as a trademark in the Korea Intellectual Property Office. A developed program is carried out by sequential step of four integrity evaluation methodologies, which are composed of construction code, code case N-597, its engineering method and two developed owner evaluation method. As PiTEP program will be performed through GUI (Graphic User Interface) with user's familiarity, it would be conveniently used by plant engineers with only measured thickness data, basic operation conditions and pipe data

  20. The brief negative symptom scale: validation of the German translation and convergent validity with self-rated anhedonia and observer-rated apathy.

    Science.gov (United States)

    Bischof, Martin; Obermann, Caitriona; Hartmann, Matthias N; Hager, Oliver M; Kirschner, Matthias; Kluge, Agne; Strauss, Gregory P; Kaiser, Stefan

    2016-11-22

    Negative symptoms are considered core symptoms of schizophrenia. The Brief Negative Symptom Scale (BNSS) was developed to measure this symptomatic dimension according to a current consensus definition. The present study examined the psychometric properties of the German version of the BNSS. To expand former findings on convergent validity, we employed the Temporal Experience Pleasure Scale (TEPS), a hedonic self-report that distinguishes between consummatory and anticipatory pleasure. Additionally, we addressed convergent validity with observer-rated assessment of apathy with the Apathy Evaluation Scale (AES), which was completed by the patient's primary nurse. Data were collected from 75 in- and outpatients from the Psychiatric Hospital, University Zurich diagnosed with either schizophrenia or schizoaffective disorder. We assessed convergent and discriminant validity, internal consistency and inter-rater reliability. We largely replicated the findings of the original version showing good psychometric properties of the BNSS. In addition, the primary nurses evaluation correlated moderately with interview-based clinician rating. BNSS anhedonia items showed good convergent validity with the TEPS. Overall, the German BNSS shows good psychometric properties comparable to the original English version. Convergent validity extends beyond interview-based assessments of negative symptoms to self-rated anhedonia and observer-rated apathy.

  1. Titrimetric determination of ruthenium

    International Nuclear Information System (INIS)

    Velichko, V.V.; Belyaeva, T.I.; Kudinova, V.K.; Usatenko, Yu.I.

    1978-01-01

    Titration of ruthenium(4) hydrochloric-acid solutions with Mohr's salt, hydroquinone, and thiourea has been studied with the use of biampero- and potentiometric indication of the titration end point (t.e.p.) Potentiometric and amperometric indication of the t.e.p. is applicable when Ru(4) concentration is from 20 to 6000 mkg in 20 ml of the titrated solution; biamperometric indication can be used at a concentration of 5-1000 mkg in the same volume. It has been established that titration of Ru(4) (in the form of the Na 2 RuCl 6 solution) with Mohr's salt is not hindered by the presence of 1000-fold excess of alkaline and alkali-earth metals, Al, Ti(4), Mn(2), Cr(3), Fe(3), Co, Ni, Cu, Zn, Ga, Ge(4), As, Se, Mo(6), Cd, In, and Te; 100-fold excess of Rh, Pd, W, Bi, and Sn; 10-fold excess of Ag, Au, Pt, Hg, Os. Along with Ru(4) titrated are Ir(4), Te(3), V(5), and Ce(4). Selectivity of hydroquinone and thiourea is lower. Titrimetric procedure of determining ruthenium has been tested for ruthenium alloy containing cobalt tungsten. It cannot be recommended for analysis of the samples which dissolve in aqua regia

  2. Rhodium, iridium and nickel complexes with a 1,3,5-triphenylbenzene tris-MIC ligand. Study of the electronic properties and catalytic activities

    Directory of Open Access Journals (Sweden)

    Carmen Mejuto

    2015-12-01

    Full Text Available The coordination versatility of a 1,3,5-triphenylbenzene-tris-mesoionic carbene ligand is illustrated by the preparation of complexes with three different metals: rhodium, iridium and nickel. The rhodium and iridium complexes contained the [MCl(COD] fragments, while the nickel compound contained [NiCpCl]. The preparation of the tris-MIC (MIC = mesoionic carbene complex with three [IrCl(CO2] fragments, allowed the estimation of the Tolman electronic parameter (TEP for the ligand, which was compared with the TEP value for a related 1,3,5-triphenylbenzene-tris-NHC ligand. The electronic properties of the tris-MIC ligand were studied by cyclic voltammetry measurements. In all cases, the tris-MIC ligand showed a stronger electron-donating character than the corresponding NHC-based ligands. The catalytic activity of the tri-rhodium complex was tested in the addition reaction of arylboronic acids to α,β-unsaturated ketones.

  3. Excitation functions of 120Te(d,xn)121,120m,gI reactions from threshold up to 13.5 MeV: comparative studies on the production of 120gI

    International Nuclear Information System (INIS)

    Hohn, A.; Coenen, H.H.; Qaim, S.M.

    2000-01-01

    Excitation functions of the nuclear reactions 120 Te(d,xn) 121,120m,g I were measured for the first time from their respective thresholds up to 13.5 MeV. Thin samples prepared by electrolytic deposition of 99.0% enriched 120 Te on Ti-backing were used. Integral yields of 121,120m,g I were calculated from the measured cross section data. A comparison of the 122 Te(p,3n)-, 120 Te(p,n)- and 120 Te(d,2n)-processes for the production of 120g I is given. The 120 Te(d,2n)-process is unsuitable for production purposes since the yield of 120g I is very low and the level of 121 I impurity very high. The choice lies either on the 122 Te(p,3n)- or the 120 Te(p,n)-reaction and is governed by the available proton energy and the financial resources for procuring the enriched target material

  4. Pre-operational HTO/HT surveys in the vicinity of the Chalk River Laboratories tritium extraction plant

    International Nuclear Information System (INIS)

    Workman, W.J.G.; Brown, R.M.

    1993-08-01

    Surveys of the concentrations of HT and HTO in the atmosphere downwind of the Chalk River Laboratories reactor facilities were carried out in 1986 November, and in 1989 March, April and September under different conditions of air temperature, wind direction, and snow or vegetative cover. HT usually amounted to 1-5% of total tritium, but values up to 20% were observed, probably resulting from preferential removal of HTO. In all of the surveys, the greater persistence in the atmosphere of HT than of HTO was evident. The existing levels of HT are such that they will not be augmented significantly by chronic releases from the Tritium Extraction Plant (TEP) when it comes into operation. Hence, operation of the TEP will not facilitate studies of the environmental behaviour of chronically released HT. However, longer term studies of the distribution of HT from the existing facilities would be worthwhile. Soil and vegetation HTO levels in the study area are reported. Further studies of the distribution of tritium between the air, soil and vegetation in areas subjected to chronic exposure would be valuable

  5. Project W-314 specific test and evaluation plan for 241-AN-A valve pit

    International Nuclear Information System (INIS)

    Hays, W.H.

    1997-01-01

    The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made to the 241-AN-A Valve Pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a ''lower tier'' document based on the W-314 Test and Evaluation Plan (TEP) This STEP encompasses all testing activities required to demonstrate compliance to the project design criteria as it relates to the modifications of the AN-A valve pit. The Project Design Specifications (PDS) identify the specific testing activities required for the Project. Testing includes Validations and Verifications (e.g., Commercial Grade Item Dedication activities), Factory Acceptance Tests (FATs), installation tests and inspections, Construction Acceptance Tests (CATs), Acceptance Test Procedures (ATPs), Pre-Operational Test Procedures (POTPs), and Operational Test Procedures (OTPs). It should be noted that POTPs are not required for testing of the modifications to the 241-AN-A Valve Pit. The STEP will be utilized in conjunction with the TEP for verification and validation

  6. The TROVE module: a common element in Telomerase, Ro and Vault ribonucleoproteins.

    Science.gov (United States)

    Bateman, Alex; Kickhoefer, Valerie

    2003-10-16

    Ribonucleoproteins carry out a variety of important tasks in the cell. In this study we show that a number of these contain a novel module, that we speculate mediates RNA-binding. The TROVE module--Telomerase, Ro and Vault module--is found in TEP1 and Ro60 the protein components of three ribonucleoprotein particles. This novel module, consisting of one or more domains, may be involved in binding the RNA components of the three RNPs, which are telomerase RNA, Y RNA and vault RNA. A second conserved region in these proteins is shown to be a member of the vWA domain family. The vWA domain in TEP1 is closely related to the previously recognised vWA domain in VPARP a second component of the vault particle. This vWA domain may mediate interactions between these vault components or bind as yet unidentified components of the RNPs. This work suggests that a number of ribonucleoprotein components use a common RNA-binding module. The TROVE module is also found in bacterial ribonucleoproteins suggesting an ancient origin for these ribonucleoproteins.

  7. Performance characteristics of the 12 GHz, 200 watt Transmitter Experiment Package for CTS. [Communication Technology Satellite

    Science.gov (United States)

    Miller, E. F.; Fiala, J. L.; Hansen, I. G.

    1975-01-01

    Measured performance characteristics from ground test of the Transmitter Experiment Package (TEP) for the Communications Technology Satellite are presented. The experiment package consists of a 200 W Output Stage Tube (OST) powered by a Power Processing System (PPS). Descriptions of both the PPS and OST are given. The PPS provides the necessary voltages with a measured dc/dc conversion efficiency of 89 per cent. The OST, a traveling wave tube with multiple collectors, has a saturated rf output power of 224 W and operates at an overall efficiency exceeding 40 per cent over an 85 MHz bandwidth at 12 GHz. OST performance given includes frequency response, saturation characteristics, group delay, AM to PM conversion, intermodulation distortion, and two channel gain suppression. Single and dual channel FM video performance is presented. It was determined that for 12 MHz peak to peak frequency deviation on each channel, dual channel FM television signals can be transmitted through the TEP at 60 W, each channel, with 40 MHz channel spacing (center to center).

  8. The Development of a Team Empowerment Program in Schools at the Basic Education Level

    Directory of Open Access Journals (Sweden)

    Sakda Khamso

    2017-03-01

    Full Text Available The purpose of this research was to develop a Team Empowerment Program (TEP in Schools at the Basic Education Level (SBEL. The research methodology used in this study was research and development with four phases: 1 investigating actual state and desirable state with regard to team empowerment in SBEL; 2 developing a TEP in SBEL; 3 trying out on the implementation of the developed program in a sample school; and 4 assessing a use of the developed program. The sample consisted of 120 teachers of Chakkaratwittaya School in Nakhon-Ratchasima Province. The instruments used in this study were a set of questionnaires, a set of interview questions, an evaluation form and meeting minutes. The statistics used in the data analysis included percentage, mean ( , standard deviation (S.D., and priority needs index (PNI. The Conclusions were: 1. The current situation of team empowerment in SBEL both at the overall and individual levels indicates a low level of practice. In contrast, the highest level of team empowerment has been found under the most desirable conditions. 2. The developed TEP was comprised of: 1 rationale; 2 objectives and target; 3 content of teachers’ training included 6 aspects: 3.1 improving the administrative structure, 3.2 building a working system, 3.3 building work collaborations, 3.4 building the work environment, 3.5 building motivation to work, and 3.6 building the culture of work; 4 method of development used with intervention process which comprised 3 modules: 4.1 meetings to build awareness, 4.2 meetings to diagnose the relevant situations, and 4.3 meetings to appoint a problem-solving team; and 5 evaluation. 3. The results of the mplementation of the TEP in Chakkaratwittaya School were: 3.1 After the implementation of the developed program the teamwork behaviors of the teachers in each learning area group were significantly higher than before the implementation, with a statistical significance level of 0.1. 3.2 The overall

  9. Cloud Based Earth Observation Data Exploitation Platforms

    Science.gov (United States)

    Romeo, A.; Pinto, S.; Loekken, S.; Marin, A.

    2017-12-01

    In the last few years data produced daily by several private and public Earth Observation (EO) satellites reached the order of tens of Terabytes, representing for scientists and commercial application developers both a big opportunity for their exploitation and a challenge for their management. New IT technologies, such as Big Data and cloud computing, enable the creation of web-accessible data exploitation platforms, which offer to scientists and application developers the means to access and use EO data in a quick and cost effective way. RHEA Group is particularly active in this sector, supporting the European Space Agency (ESA) in the Exploitation Platforms (EP) initiative, developing technology to build multi cloud platforms for the processing and analysis of Earth Observation data, and collaborating with larger European initiatives such as the European Plate Observing System (EPOS) and the European Open Science Cloud (EOSC). An EP is a virtual workspace, providing a user community with access to (i) large volume of data, (ii) algorithm development and integration environment, (iii) processing software and services (e.g. toolboxes, visualization routines), (iv) computing resources, (v) collaboration tools (e.g. forums, wiki, etc.). When an EP is dedicated to a specific Theme, it becomes a Thematic Exploitation Platform (TEP). Currently, ESA has seven TEPs in a pre-operational phase dedicated to geo-hazards monitoring and prevention, costal zones, forestry areas, hydrology, polar regions, urban areas and food security. On the technology development side, solutions like the multi cloud EO data processing platform provides the technology to integrate ICT resources and EO data from different vendors in a single platform. In particular it offers (i) Multi-cloud data discovery, (ii) Multi-cloud data management and access and (iii) Multi-cloud application deployment. This platform has been demonstrated with the EGI Federated Cloud, Innovation Platform Testbed Poland

  10. A Unified Electronic Tool for CPR and Emergency Treatment Escalation Plans Improves Communication and Early Collaborative Decision Making for Acute Hospital Admissions.

    Science.gov (United States)

    Johnson, Mae; Whyte, Martin; Loveridge, Robert; Yorke, Richard; Naleem, Shairana

    2017-01-01

    The National Confidential Enquiry into Patient Outcomes and Death (NCEPOD) report 'Time to Intervene' (2012) stated that in a substantial number of cases, resuscitation is attempted when it was thought a 'do not attempt cardiopulmonary resuscitation' (DNACPR) decision should have been in place. Early decisions about CPR status and advance planning about limits of care now form part of national recommendations by the UK Resuscitation Council (2016). Treatment escalation plans (TEP) document what level of treatment intervention would be appropriate if a patient were to become acutely unwell and were not previously formally in place at King's College Hospital. A unifying paper based form was successfully piloted in the Acute Medical Unit, introducing the TEP and bringing together decision making around both treatment escalation and CPR status. Subsequently an electronic order-set for CPR status and treatment escalation was launched in April 2015 which led to a highly visible CPR and escalation status banner on the main screen at the top of the patient's electronic record. Ultimately due to further iterations in the electronic process by December 2016, all escalation decisions for acutely admitted patients now have high quality supporting, explanatory documentation with 100% having TEPs in place. There is now widespread multidisciplinary engagement in the process of defining limits of care for acutely admitted medical patients within the first 14 hours of admission and a strategy for rolling this process out across all the divisions of the hospital through our Deteriorating Patient Group (DPG). The collaborative design with acute medical, palliative and intensive care teams and the high visibility provided by the electronic process in the Electronic Patient Record (EPR) has enhanced communication with these teams, patients, nursing staff and the multidisciplinary team by ensuring clarity through a universally understood process about escalation and CPR. Clarity and

  11. Environmentally relevant organophosphate triesters in herring gulls: In vitro biotransformation and kinetics and diester metabolite formation using a hepatic microsomal assay

    International Nuclear Information System (INIS)

    Greaves, Alana K.; Su, Guanyong; Letcher, Robert J.

    2016-01-01

    The in vitro biotransformation and kinetics of six organophosphate triester (OPE) flame retardants were investigated in herring gulls (Larus argentatus) from the Great Lakes using a hepatic microsomal metabolism assay. Administration of each individual OPE (tri-n-butyl phosphate (TNBP), tris(2-butoxyethyl) phosphate (TBOEP), triphenyl phosphate (TPHP), triethyl phosphate (TEP), tris(1,3-dichloro-2-propyl) phosphate (TDCIPP) and tris(2-chloroisopropyl) phosphate (TCIPP)) to the in vitro assay (concentration range 0.01 to 10 μM) resulted in rapid depletion with the exception of TEP. Following the Michaelis-Menten enzyme kinetics model, a preliminary 2-minute incubation period was used to estimate the V max (± SE) values (i.e., the maximal rate of reaction for a saturated enzyme system), which ranged from 5.0 ± 0.4 (TPHP) to 29 ± 18 pmol/min/mg protein (TBOEP), as well as the K M (± SE) values (i.e., the OPE concentration corresponding to one half of the V max ), which ranged from 9.8 ± 1 (TPHP) to 189 ± 135 nM (TBOEP). Biotransformation assays over a 100-minute incubation period revealed that TNBP was metabolized most rapidly (with a depletion rate of 73 ± 4 pmol/min/mg protein), followed by TBOEP (53 ± 8 pmol/min/mg), TCIPP (27 ± 1 pmol/min/mg), TPHP (22 ± 2 pmol/min/mg) and TDCIPP (8 ± 1 pmol/min/mg). In vitro biotransformation of OP triesters was clearly structure-dependent where non-halogenated alkyl OP triesters were metabolized more rapidly than halogenated alkyl triesters. Halogenated OP triesters were transformed to their respective diesters more efficiently relative to non-halogenated OP triesters. To our knowledge, this is the first study to investigate OP triester metabolism and OP diester formation in an avian or wildlife model system, which is important to understand the fate and biological activity of OPEs in an exposed organism. - Highlights: • The metabolism and kinetics of 6 OPEs were examined in herring gull liver microsomes. • The

  12. First record and impact of the crown-of-thorns starfish, Acanthaster planci (Spinulosida: Acanthasteridae on corals of Malpelo Island, Colombian Pacific

    Directory of Open Access Journals (Sweden)

    Krupskaya Narváez

    2010-05-01

    Full Text Available The crown-of-thorns starfish, Acanthaster planci, is a major coral predator widely distributed in the Indo-Pacific region, where population outbreaks have caused dramatic impacts on coral reefs. In the Tropical Eastern Pacific (TEP A. planci occurs at low population densities; it has been significantly abundant only in Panama and Cocos Island. We have recently found two individuals of A. planci at Malpelo Island, a small oceanic island with significant coral communities located off the Colombian Pacific coast. The recent discovery of A. planci at Malpelo is significant in light of recent reports of its increased frequency of observation at Cocos Island and occurrence at the Galapagos Islands. The individuals found at Malpelo have been repeatedly sighted since 2004, actively feeding on nine species of coral. Although densities of A. planci are low at Malpelo and other oceanic islands of the TEP, these islands may act as stepping stones for the colonization of other coral reef areas in the region. However, the low densities of A. planci suggest that it currently poses no threat to coral reefs in the TEP. Rev. Biol. Trop. 58 (Suppl. 1: 139-143. Epub 2010 May 01.La estrella de mar corona de espinas Acanthaster planci, es un importante depredador de coral ampliamente distribuido en la región del Indo-Pacifico, donde explosiones poblacionales han causado dramáticos impactos sobre los arrecifes coralinos. En el Pacifico Oriental Tropical (POT A. planci ocurre con densidades poblacionales bajas; solamente en Panamá e Isla de Cocos su abundancia ha sido significativa. Nosotros encontramos recientemente al menos dos individuos de A. planci en la Isla de Malpelo, una pequeña isla oceánica con comunidades coralinas importantes localizada en el Pacífico Colombiano. El hallazgo de A. planci en Malpelo es significativo a la luz de reportes recientes de un incremento en su frecuencia de observación en Isla de Cocos y su registro en Galápagos. Los

  13. The Change of the Seebeck Coefficient Due to Neutron Irradiation and Thermal Fatigue of Nuclear Reactor Pressure Vessel Steel and its Application to the Monitoring of Material Degradation

    International Nuclear Information System (INIS)

    Niffenegger, M.; Reichlin, K.; Kalkhof, D.

    2002-05-01

    The monitoring of material degradation, that might be caused by neutron irradiation and thermal fatigue, is an important topic in lifetime extension of nuclear power plants. We therefore investigated the application of the Seebeck effect for determining material degradation of common reactor pressure vessel steel. The Seebeck coefficient (SC) of several irradiated Charpy specimens made from Japanese JRQ-steel were measured. The specimens suffered a fluence from 0 up to 4.5 x 10 19 neutrons per cm 2 with energies higher than 1 MeV. The measured changes of the SC within this range were about 500 nV, increasing continuously in the range under investigation. Some indications of saturation appeared at fluencies larger than 4.55 x 10 19 neutrons per cm 2 . We obtained a linear dependency between the SC and the temperature shift ΔT 41 of the Charpy-Energy- Temperature curve which is widely used to characterize material embrittlement. Similar measurements were performed on specimens made from the widely used austenitic steel X6CrNiTi18-10 (according to DIN 1.4541) that were fatigued by applying a cyclic strain amplitude of 0.28%. For this kind of fatigue the observed change of SC was somewhat smaller than for the irradiated specimens. Further investigations were made to quantify the size of the gage volume in which the thermoelectric power is generated. It appeared that the information gathered from a Thermo Electric Power (TEP) measurement is very local. To overcome this problem we propose a novel TEP-method using a Thermoelectric Scanning Microscope (TSM). We finally conclude that the change of the SC has a potential for monitoring of material degradation due to neutron irradiation and thermal fatigue, but it has to be taken into account that several influencing parameters could contribute to the TEP in either an additional or extinguishing manner. A disadvantage of the method is the requirement of a clean surface without any oxide layer. A part of this disadvantage can

  14. Aerosolization, Chemical Characterization, Hygroscopicity and Ice Formation of Marine Biogenic Particles

    Science.gov (United States)

    Alpert, P. A.; Radway, J.; Kilthau, W.; Bothe, D.; Knopf, D. A.; Aller, J. Y.

    2013-12-01

    The oceans cover the majority of the earth's surface, host nearly half the total global primary productivity and are a major source of atmospheric aerosol particles. However, effects of biological activity on sea spray generation and composition, and subsequent cloud formation are not well understood. Our goal is to elucidate these effects which will be particularly important over nutrient rich seas, where microorganisms can reach concentrations of 10^9 per mL and along with transparent exopolymer particles (TEP) can become aerosolized. Here we report the results of mesocosm experiments in which bubbles were generated by two methods, either recirculating impinging water jets or glass frits, in natural or artificial seawater containing bacteria and unialgal cultures of three representative phytoplankton species, Thalassiosira pseudonana, Emiliania huxleyi, and Nannochloris atomus. Over time we followed the size distribution of aerosolized particles as well as their hygroscopicity, heterogeneous ice nucleation potential, and individual physical-chemical characteristics. Numbers of cells and the mass of dissolved and particulate organic carbon (DOC, POC), TEP (which includes polysaccharide-containing microgels and nanogels >0.4 μm in diameter) were determined in the bulk water, the surface microlayer, and aerosolized material. Aerosolized particles were also impacted onto substrates for ice nucleation and water uptake experiments, elemental analysis using computer controlled scanning electron microscopy and energy dispersive analysis of X-rays (CCSEM/EDX), and determination of carbon bonding with scanning transmission X-ray microscopy and near-edge X-ray absorption fine structure spectroscopy (STXM/NEXAFS). Regardless of bubble generation method, the overall concentration of aerosol particles, TEP, POC and DOC increased as concentrations of bacterial and phytoplankton cells increased, stabilized, and subsequently declined. Particles cloud formation and potential

  15. Test and evaluation plan for Project W-314 tank farm restoration and safe operations

    International Nuclear Information System (INIS)

    Hays, W.H.

    1998-01-01

    The ''Tank Farm Restoration and Safe Operations'' (TFRSO), Project W-314 will restore and/or upgrade existing Hanford Tank Farm facilities and systems to ensure that the Tank Farm infrastructure will be able to support near term TWRS Privatization's waste feed delivery and disposal system and continue safe management of tank waste. The capital improvements provided by this project will increase the margin of safety for Tank Farms operations, and will aid in aligning affected Tank Farm systems with compliance requirements from applicable state, Federal, and local regulations. Secondary benefits will be realized subsequent to project completion in the form of reduced equipment down-time, reduced health and safety risks to workers, reduced operating and maintenance costs, and minimization of radioactive and/or hazardous material releases to the environment. The original regulatory (e.g., Executive Orders, WACS, CFRS, permit requirements, required engineering standards, etc.) and institutional (e.g., DOE Orders, Hanford procedures, etc.) requirements for Project W-314 were extracted from the TWRS S/RIDs during the development of the Functions and Requirements (F and Rs). The entire family of requirements were then validated for TWRS and Project W-314. This information was contained in the RDD-100 database and used to establish the original CDR. The Project Hanford Management Contract (PHMC) team recognizes that safety, quality, and cost effectiveness in the Test and Evaluation (T and E) program is achieved through a planned systematic approach to T and E activities. It is to this end that the Test and Evaluation Plan (TEP) is created. The TEP for the TFRSO Project, was developed based on the guidance in HNF-IP-0842, and the Good Practice Guide GPG-FM-005, ''Test and Evaluation,'' which is derived from DOE Order 430.1, ''Life Cycle Asset Management.'' It describes the Test and Evaluation program for the TFRSO project starting with the definitive design phase and ending

  16. Seabed gallery intakes: Investigation of the water pretreatment effectiveness of the active layer using a long-term column experiment

    KAUST Repository

    Dehwah, Abdullah

    2017-05-11

    Seabed gallery intake systems used for seawater reverse osmosis facilities employ the same principle of water treatment as slow sand filtration in freshwater systems. An investigation concerning the effectiveness of the active layer (top layer) in improving raw water quality was conducted by using a long-term bench-scale columns experiment. Two different media types, silica and carbonate sand, were tested in 1 m columns to evaluate the effectiveness of media type in terms of algae, bacteria, Natural Organic Matter (NOM) and Transparent Exopolymer Particles (TEP) removal over a period of 620 days. Nearly all algae in the silica sand column, 87% (σ = 0.04) of the bacteria, 59% (σ = 0.11) of the biopolymer fraction of NOM, 59% (σ = 0.16) of particulate and 32% (σ = 0.25) of colloidal TEP were removed during the last 330 days of the experiment. Total removal was observed in the carbonate sand column for algal concentration, while the bacterial removal was lower at 74% (σ = 0.08). Removal of biopolymers, particulate and colloidal TEP were higher in the carbonate column during the last 330 days with 72% (σ = 0.15), 66% (σ = 0.08) and 36% (σ = 0.12) removed for these organics respectively. Removal of these key organics through the 1 m thick column, representing the active layer, will likely reduce the rate of biofouling, reduce chemical usage and minimize operating cost in SWRO systems. The data show that the media will require several months at the beginning of operation to reach equilibrium so that high organic removal rates can be achieved. No development of a “schmutzdecke” layer occurred. The experimental results suggest that unlike freshwater slow sand filtration wherein most water treatment occurs in the upper 10 cm, in seawater systems treatment occurs throughout the full active layer depth of 1 m. The results of this study will help in designing and operating seabed gallery intake systems in varied geological conditions.

  17. Environmentally relevant organophosphate triesters in herring gulls: In vitro biotransformation and kinetics and diester metabolite formation using a hepatic microsomal assay

    Energy Technology Data Exchange (ETDEWEB)

    Greaves, Alana K. [Wildlife and Landscape Directorate, Science and Technology Branch, Environment and Climate Change Canada, National Wildlife Research Centre, Carleton University, Ottawa, ON K1A 0H3 (Canada); Department of Chemistry, Carleton University, Ottawa, ON K1S 5B6 (Canada); Su, Guanyong, E-mail: guanyong.su85@gmail.com [Wildlife and Landscape Directorate, Science and Technology Branch, Environment and Climate Change Canada, National Wildlife Research Centre, Carleton University, Ottawa, ON K1A 0H3 (Canada); Department of Chemistry, Carleton University, Ottawa, ON K1S 5B6 (Canada); Letcher, Robert J., E-mail: robert.letcher@canada.ca [Wildlife and Landscape Directorate, Science and Technology Branch, Environment and Climate Change Canada, National Wildlife Research Centre, Carleton University, Ottawa, ON K1A 0H3 (Canada); Department of Chemistry, Carleton University, Ottawa, ON K1S 5B6 (Canada)

    2016-10-01

    The in vitro biotransformation and kinetics of six organophosphate triester (OPE) flame retardants were investigated in herring gulls (Larus argentatus) from the Great Lakes using a hepatic microsomal metabolism assay. Administration of each individual OPE (tri-n-butyl phosphate (TNBP), tris(2-butoxyethyl) phosphate (TBOEP), triphenyl phosphate (TPHP), triethyl phosphate (TEP), tris(1,3-dichloro-2-propyl) phosphate (TDCIPP) and tris(2-chloroisopropyl) phosphate (TCIPP)) to the in vitro assay (concentration range 0.01 to 10 μM) resulted in rapid depletion with the exception of TEP. Following the Michaelis-Menten enzyme kinetics model, a preliminary 2-minute incubation period was used to estimate the V{sub max} (± SE) values (i.e., the maximal rate of reaction for a saturated enzyme system), which ranged from 5.0 ± 0.4 (TPHP) to 29 ± 18 pmol/min/mg protein (TBOEP), as well as the K{sub M} (± SE) values (i.e., the OPE concentration corresponding to one half of the V{sub max}), which ranged from 9.8 ± 1 (TPHP) to 189 ± 135 nM (TBOEP). Biotransformation assays over a 100-minute incubation period revealed that TNBP was metabolized most rapidly (with a depletion rate of 73 ± 4 pmol/min/mg protein), followed by TBOEP (53 ± 8 pmol/min/mg), TCIPP (27 ± 1 pmol/min/mg), TPHP (22 ± 2 pmol/min/mg) and TDCIPP (8 ± 1 pmol/min/mg). In vitro biotransformation of OP triesters was clearly structure-dependent where non-halogenated alkyl OP triesters were metabolized more rapidly than halogenated alkyl triesters. Halogenated OP triesters were transformed to their respective diesters more efficiently relative to non-halogenated OP triesters. To our knowledge, this is the first study to investigate OP triester metabolism and OP diester formation in an avian or wildlife model system, which is important to understand the fate and biological activity of OPEs in an exposed organism. - Highlights: • The metabolism and kinetics of 6 OPEs were examined in herring gull liver

  18. Human Reliability Prediction System User’s Manual

    Science.gov (United States)

    1977-12-01

    Pharmacists mate 9 0.05 0 0 0 0 0 0.05 0 0 0 0 0 0 0 Cook/baker 438 Equipment Repair Data CardL An equipment repair data card (card format 6) may 31. be...FLIMa&= TO DDO 00 440 Jalp3O 440 TtTEP~KJi t~ug*O DO 400 Jl.1 ( UTI 5 40 1996K~jo) 1.11 UT� 00Y 46A~e00 JoooIUTPI230 2600 UT~tJuO,0 UTP12?3 OUTFZ uT...i SYOTOUTAIIol6.0T( n)PCI uTPI3IO t14YAB(I 1PITER) a f𔃾TA92 tTR *l t) UTiS uUTAfIlROufA(2).TWFtI TUP30 TOUTAIA(2,)UOUTA(2.K)*TPI3t) OUTP1340 IYAu1I4

  19. Ultra-som terapêutico contínuo térmico em modelo experimental de ciatalgia Continuous thermic therapeutic ultrasound in sciatica experimental model

    Directory of Open Access Journals (Sweden)

    Adriano Polican Ciena

    2009-06-01

    Full Text Available O ultra-som é um recurso fisioterapêutico que pode atuar na redução dos sintomas da ciatalgia. O objetivo deste estudo foi verificar a eficácia do ultra-som terapêutico, no modo contínuo, em duas diferentes densidades de potência (0,5 W/cm² e 1 W/cm², na redução do quadro álgico em ratos submetidos a modelo experimental de ciatalgia. Foram utilizados 20 ratos, divididos em 3 grupos: G1 (n=6 submetido à ciatalgia e a tratamento placebo; G2 (n=7 submetido à ciatalgia e tratado com ultra-som com 0,5 W/cm²; e G3 (n=7 submetido à ciatalgia e tratado com ultra-som com 1 W/cm². A ciatalgia foi provocada por lesão cirúrgica de compressão do nervo no membro posterior direito de todos os animais. O tratamento na região do procedimento cirúrgico, iniciado no 3º dia pós-operatório, consistiu em 10 sessões diárias de 5 minutos. Verificou-se a dor pelo do tempo de elevação da pata (TEP durante a marcha, medido pré-cirurgia e em mais cinco momentos. Os resultados mostram aumentos no TEP em todos os grupos após a lesão; e, naqueles tratados com ultra-som terapêutico, houve diminuição significativa da TEP, restaurando-se os valores iniciais, sendo mais precoce e intensa em G2. Conclui-se que a entrega na forma continua do ultra-som terapêutico foi eficaz na redução da dor ciática.Therapeutic ultrasound is a physical therapy resource for relieving sciatic pain. The aim of this study was to assess the effectiveness of continuous therapeutic ultrasound in two different power densities (0,5 W/cm² and 1 W/cm², on reducing pain in rats submitted to a sciatica experimental model. Twenty rats were used, divided into 3 groups: G1 (n=6 submitted to sciatica and placebo treatment; G2 (n=7 submitted to sciatica and treated with 0.5 W/cm² ultrasound; and G3 (n=7, submitted to sciatica and treated with 1 W/cm² ultrasound. Sciatica was provoked by surgical nerve compression on the right posterior limb of all animals. Treatment on the

  20. Physiological studies on photochemical oxidants injury in rice plants. I. Varietal difference of abscisic acid content and its relation to the resistance to ozone

    Energy Technology Data Exchange (ETDEWEB)

    Jeong, Y.H.; Nakamura, H.; Ota, Y.

    1980-01-01

    In order to determine the abscisic acid relationships in the resistance of the rice plants to ozone, endogeneous abscisic acid content in varieties with different sensitivity to ozone was examined. The cultivars differed in their visible injury to ozone fumigation. Nipponbare and Jinheung were more sensitive than Tongil, Milyang No. 23 and Te-tep. Endogeneous abscisic acid content in the resistant variety (Tongil) was higher than in the sensitive one (Nipponbare). Visible injury caused by ozone fumigation was decreased by application of abscisic acid. Abscisic acid content in rice cultivars was found to increase differently depending on varieties response to ozone fumigation (0.3 ppM for 3 hours). The increase of abscisic acid content caused by ozone fumigation was higher in Nipponbare than in Tongil, although the endogeneous level of abscisic acid was higher in Tongil than Nipponbare.

  1. Electrical transport properties of CuXSn1-X metallic glasses

    Science.gov (United States)

    Vora, A. M.; Gajjar, P. N.

    2018-05-01

    In the present paper, we report the electrical resistivity (ρ), the thermoelectric power (TEP) and thermal conductivity (σ) of CuXSn1-X metallic glasses computed from Faber-Ziman formulation with Percus-Yevic (PY) hard sphere structure factors of Ashcroft and Langreth. Our well-recognized model potential is used to represent ionic interaction for the first time with seven local field correction functions due to Hartree (H), Hubbard-Sham (HS), Vashishta-Singwi (VS), Taylor (T), Ichimaru-Utsumi (IU), Farid et al. (F) and Sarkar et al. (S) in the present computation and found suitable for such study. The percentile influence of various local field corrections with respect to Hartree (H) is found in the range of 17.35%-71.55%. It is concluded that, the comparison of present and experimental findings of electrical resistivity (ρ) is highly promising.

  2. Investigation of Continuously Variable Slope Delta Modulator/Demodulator Compatability.

    Science.gov (United States)

    1980-12-01

    20 d,"mO Test Signal) 4 stp Ize Pratio -J-l Li] c4 u FnoR~e mx -,cli - td 32k/ I’.’: (2 .Bm’ et i~ l z s tep g ize Ratio MJismatc(_h Bd FREQUENCY (HZJ...Ste~p Size it-tio flisriatch ’ F] - ,a tc he d 0 - 2 dB [: L’\\- 4 dB 4Bd B 0’ 0 0 b l - FREQUENCY (HZ) Figure 49a. CVSD Encoder/Decoder Back-to-Back...APPENDIX rl Total t’,ar-onic i tor’i w’. -r -,,,t ,ntl Po’..’r PROGRAM DTHD(I PUT,OUTPUT,TAPES-INPUT.TAPE6-OUTPUT,PLOT) CT_---- -- - TD US. INPUT POER

  3. Zlepšování limitů detekce spektroskopie laserem indukovaného plazmatu (LIBS) pomocí aplikace nanočástic

    OpenAIRE

    Képeš, Erik

    2014-01-01

    Bakalárska práca popisuje možnosti zlepšovania detekčných limít metódy spektroskopie laserom indukovanej plazmy (LIBS). Zhŕňa modifikácie klasickej aparatúry, ktoré využívajú metódy double-pulsed LIBS (DPLIBS), Townsend effect plasma sectroscopy (TEPS), resonance enhanced LIBS (RELIBS), spark discharge LIBS (SDLIBS), flame-enhanced LIBS (FELIBS) aj nové postupy pri príprave vzoriek, ktoré používa metóda nanoparticle enhanced LIBS (NELIBS). Popisuje mechanizmy, ktoré využívajú jednotlivé metód...

  4. A Study of Light Level Effect on the Accuracy of Image Processing-based Tomato Grading

    Science.gov (United States)

    Prijatna, D.; Muhaemin, M.; Wulandari, R. P.; Herwanto, T.; Saukat, M.; Sugandi, W. K.

    2018-05-01

    Image processing method has been used in non-destructive tests of agricultural products. Compared to manual method, image processing method may produce more objective and consistent results. Image capturing box installed in currently used tomato grading machine (TEP-4) is equipped with four fluorescence lamps to illuminate the processed tomatoes. Since the performance of any lamp will decrease if its service time has exceeded its lifetime, it is predicted that this will affect tomato classification. The objective of this study was to determine the minimum light levels which affect classification accuracy. This study was conducted by varying light level from minimum and maximum on tomatoes in image capturing boxes and then investigates its effects on image characteristics. Research results showed that light intensity affects two variables which are important for classification, for example, area and color of captured image. Image processing program was able to determine correctly the weight and classification of tomatoes when light level was 30 lx to 140 lx.

  5. Olfactory identification deficit and its relationship with hedonic traits in patients with first-episode schizophrenia and individuals with schizotypy.

    Science.gov (United States)

    Zou, Lai-Quan; Zhou, Han-Yu; Lui, Simon S Y; Wang, Yi; Wang, Ya; Gan, Jun; Zhu, Xiong-Zhao; Cheung, Eric F C; Chan, Raymond C K

    2018-04-20

    Olfactory identification impairments have been consistently found in schizophrenia patients. However, few previous studies have investigated this in first-episode patients. There are also inconsistent findings regarding olfactory identification ability in psychometrically-defined schizotypy individuals. In this study, we directly compared the olfactory identification ability of first-episode schizophrenia patients with schizotypy individuals. The relationship between olfactory identification impairments and hedonic traits was also examined. Thirty-five first-episode schizophrenia patients, 40 schizotypy individuals as defined by the Chapman's Anhedonia Scales and 40 demographically matched controls were recruited. The University of Pennsylvania Smell Identification Test was administered. Hedonic capacity was assessed using the Temporal Experience of Pleasure Scale (TEPS). The results showed that both the schizophrenia and schizotypy groups showed poorer olfactory identification ability than controls, and the impairment was significantly correlated with reduced pleasure experiences. Our findings support olfactory identification impairment as a trait marker for schizophrenia. Copyright © 2018 Elsevier Inc. All rights reserved.

  6. Effect of deviation from stoichiometry on the nature of shallow acceptor states in CdTe crystals

    International Nuclear Information System (INIS)

    Agrinskaya, N.V.; Shashkova, V.V.

    1988-01-01

    Photoconductivity and photoluminescence spectra in the region of donor-acceptor recombination of pure CdTe crystals, grown under conditions of different deviations from stoichiometry are investigated. It is shown that the predominant type of minor acceptors in n-type crystals (with Cd excess) differs from acceptors in p-type crystals (with Te excess). Residual acceptors replacing Te(P, As) prevail in n-type crystals and acceptors replacing Cd(Li, Na) prevail in p-type crystals. As a result of p-type crystal annealing a change of the type of prevailing aceptors accurs in Cd pairs (bands linked with P, As prevail) which testifies to the residual impurity reconstruction in Cd and Te sublattices

  7. Trastorno de estrés postraumático en mujeres víctimas de violencia doméstica : evaluación de programas de intervención

    OpenAIRE

    Rincón González, Paulina Paz

    2003-01-01

    El objetivo de este trabajo es establecer un programa de tratamiento breve y eficaz para víctimas de violencia doméstica que sufren trastorno de estrés postraumático (TEP). Para ello, se hace una revisión teórica de la violencia doméstica: Definición y caracterización, epidemiología, consecuencias, modelos explicativos y tratamientos que se han desarrollado para sus víctimas. Asimismo, se revisa la definición y caracterización del trastorno de estrés postraumático, epidemiología, modelos expl...

  8. Estimates of reproductive potential of Greenland halibut (Reinhardtius hippoglossoides) in East Greenland based on an update of maturity status

    DEFF Research Database (Denmark)

    Kennedy, James; Hedeholm, Rasmus B.; Gundersen, Agnes C.

    2014-01-01

    When estimating reproductive potential (RP), correct interpretation of the maturity status is essential. It has now become apparent the presence of vitellogenic oocytes within the ovary of Greenland halibut (Reinhardtius hippoglossoides) does not necessarily indicate they will spawn within the next...... twelve months. This has led to a revision of the interpretation of the maturity scale where fish which contain only a developing cohort (DC) of oocytes are considered immature. Comparisons were made of estimates of L50 of female Greenland halibut in East Greenland using the previous interpretation......), respectively. Combining the maturity data with abundance data of Greenland halibut in East Greenland, spawning stock biomass (SSB) and total egg production (TEP) was estimated in four quadrants between 1998 and 2012 using both the previous and current interpretation of the maturity scale. Using the new...

  9. A multi-objective framework for dynamic transmission expansion planning in competitive electricity market

    International Nuclear Information System (INIS)

    Foroud, Asghar Akbari; Abdoos, Ali Akbar; Keypour, Reza; Amirahmadi, Meisam

    2010-01-01

    Restructuring of power system has changed the traditional planning objectives and introduced challenges in the field of Transmission Expansion Planning (TEP). Due to these changes, new approaches and criteria are needed for transmission planning in deregulated environment. Therefore, in this paper, a dynamic expansion methodology is presented using a multi-objective optimization framework. Investment cost, congestion cost and reliability are considered in the optimization as three objectives. To overcome the difficulties in solving the non-convex and mixed integer nature of the optimization problems, a Non-Dominated Sorting Genetic Algorithm (NSGA II) approach is used followed by a fuzzy decision making analysis to obtain the final optimal solution. The planning methodology has been demonstrated on the IEEE 24-bus test system and north-east of Iran national 400 kV transmission grid to show the feasibility and capabilities of the proposed algorithm in electricity market environment. (author)

  10. Review of the State-of-the-Art in Power Electronics Suitable for 10-KW Military Power Systems

    Energy Technology Data Exchange (ETDEWEB)

    Staunton, R.H.

    2003-12-19

    The purpose of this report is to document the technological opportunities of integrating power electronics-based inverters into a TEP system, primarily in the 10-kW size range. The proposed enhancement offers potential advantages in weight reduction, improved efficiency, better performance in a wider range of generator operating conditions, greater versatility and adaptability, and adequate reliability. In order to obtain strong assurance of the availability of inverters that meet required performance and reliability levels, a market survey was performed. The survey obtained positive responses from several manufacturers in the motor drive and distributed generation industries. This study also includes technology reviews and assessments relating to circuit topologies, reliability issues, vulnerability to pulses of electromagnetic energy, potential improvements in semiconductor materials, and potential performance improvement through cryogenics.

  11. Feasibility Study for Paragon - Bisti Solar Ranch

    Energy Technology Data Exchange (ETDEWEB)

    Benally, Thomas [Navajo Hopi Land Commission Office (NHLCO), Window Rock, AZ (United States)

    2015-06-01

    The Navajo Hopi Land Commission Office (NHLCO) and Navajo Nation (NN) plan to develop renewable energy (RE) projects on the Paragon-Bisti Ranch (PBR) lands, set aside under the Navajo Hopi Land Settlement Act (NHLSA) for the benefit of Relocatees. This feasibility study (FS), which was funded under a grant from DOE’s Tribal Energy Program (TEP), was prepared in order to explore the development of the 22,000-acre PBR in northwestern New Mexico for solar energy facilities. Topics covered include: • Site Selection • Analysis of RE, and a Preliminary Design • Transmission, Interconnection Concerns and Export Markets • Financial and Economic Analysis • Environmental Study • Socioeconomic and Cultural Factors • Next Steps.

  12. Applications of nucleoside-based molecular probes for the in vivo assessment of tumour biochemistry using positron emission tomography (PET

    Directory of Open Access Journals (Sweden)

    Leonard I. Wiebe

    2007-05-01

    Full Text Available Positron emission tomography (PET is a non-invasive nuclear imaging technique. In PET, radiolabelled molecules decay by positron emission. The gamma rays resulting from positron annihilation are detected in coincidence and mapped to produce three dimensional images of radiotracer distribution in the body. Molecular imaging with PET refers to the use of positron-emitting biomolecules that are highly specific substrates for target enzymes, transport proteins or receptor proteins. Molecular imaging with PET produces spatial and temporal maps of the target-related processes. Molecular imaging is an important analytical tool in diagnostic medical imaging, therapy monitoring and the development of new drugs. Molecular imaging has its roots in molecular biology. Originally, molecular biology meant the biology of gene expression, but now molecular biology broadly encompasses the macromolecular biology and biochemistry of proteins, complex carbohydrates and nucleic acids. To date, molecular imaging has focused primarily on proteins, with emphasis on monoclonal antibodies and their derivative forms, small-molecule enzyme substrates and components of cell membranes, including transporters and transmembrane signalling elements. This overview provides an introduction to nucleosides, nucleotides and nucleic acids in the context of molecular imaging.A tomografia por emissão de pósitrons (TEP é uma técnica de imagem não invasiva da medicina nuclear. A TEP utiliza moléculas marcadas com emissores de radiação beta positiva (pósitrons. As radiações gama medidas que resultam do aniquilamento dos pósitrons são detectadas por um sistema de coincidência e mapeadas para produzir uma imagem tridimensional da distribuição do radiotraçador no corpo. A imagem molecular com TEP refere-se ao uso de biomoléculas marcadas com emissor de pósitron que são substratos altamente específicos para alvos como enzimas, proteínas transportadoras ou receptores prot

  13. Project W-314 specific test and evaluation plan for SN-635 transfer line (241-AY-01A to 241-AY-02A) and SN-633 transfer line tie in

    International Nuclear Information System (INIS)

    Hays, W.H.

    1998-01-01

    This Specific Test and Evaluation Plan (STEP) defines the test and evaluation activities encompassing the installation of the SN-635 transfer line for the W-314 Project. The purpose of this Specific Test and Evaluation Plan (STEP) is to provide a detailed written plan for the systematic testing of modifications made by the addition of the SN-635 transfer line and the tie in of SN-633 to the AY-02A pit by the W-314 Project. The STEP develops the outline for test procedures that verify the system's performance to the established Project design criteria. The STEP is a lower tier document based on the W-314 Test and Evaluation Plan (TEP)

  14. The importance of circulating tumor products as „liquid biopsies” in colorectal cancer

    Directory of Open Access Journals (Sweden)

    Alina Miscoci

    2018-04-01

    Full Text Available Liquid biopsies represent an array of plasma analysis tests that are studied to evaluate and identify circulating tumor products, especially circulating tumor cells (CTCs and circulating tumor DNA (ctDNA. Examining such biomarkers in the plasma of colorectal cancer patients has attracted attention due to its clinical significance in the treatment of malignant diseases. Given that tissue samples are sometimes challenging to procure or unsatisfactory for genomic profiling from patients with colorectal cancer, trustworthy biomarkers are mandatory for guiding treatment, monitoring therapeutic response, and detecting recurrence. This review considers the relevance of flowing tumor products like circulating tumor cells (CTCs, circulating tumor DNA (ctDNA, circulating messenger RNA (mRNA, circulating micro RNA (miRNA, circulating exosomes, and tumor educated platelets (TEPs for patients with colorectal cancer.

  15. Developing alternative indices of reproductive potential for use in fisheries management : Case studies for stocks spanning an information gradient

    DEFF Research Database (Denmark)

    Marshall, C.T.; O'Brien, L.; Tomkiewicz, Jonna

    2003-01-01

    There is accumulating evidence to suggest that spawning stock biomass (SSB) may not bedirectly proportional to reproductive potential. The wide-ranging implications of this conclu-sion necessitate that it be tested for as many stocks as possible. Undertaking such tests iscomplicated by the fact...... that fish stocks vary in the amount and type of information that isavailable to estimate reproductive potential. In this review, nine stocks illustrate the range of approaches that are being taken to developing alternative indices of reproductive potential fromexisting data resources. Three stocks had...... sufficient data to reconstruct a time series of total eggproduction (TEP), whereas, the remaining stocks were limited to estimating proxies for stockreproductive potential. For some of the case studies the alternative indices explained a higheramount of recruitment variation than did SSB. Other case studies...

  16. [Report from the Committee for Advanced Therapies (CAT). Pitfalls on the way from concept to medical treatment with advanced therapy medicinal products].

    Science.gov (United States)

    Reiss, M; Büttel, I C; Schneider, C K

    2011-07-01

    Advanced therapy medicinal products (ATMP) are highly innovative and complex medicines. They comprise gene therapy medicinal products, somatic cell therapy medicinal products, and tissue-engineered products (TEP). With the European Regulation on ATMP that came into force in 2008, a consolidated regulatory framework was created, where the Committee for Advanced Therapies (CAT) at the European Medicines Agency (EMA) plays a central role. This article discusses pitfalls and challenges that the CAT has experienced in its discussions of various procedures. Often ATMPs are developed by small and medium-sized enterprises (SME) which also face nonscientific challenges. The CAT wishes to meet these challenges on a scientific and regulatory level during its 2010-2015 work program.

  17. Fault detection of Tennessee Eastman process based on topological features and SVM

    Science.gov (United States)

    Zhao, Huiyang; Hu, Yanzhu; Ai, Xinbo; Hu, Yu; Meng, Zhen

    2018-03-01

    Fault detection in industrial process is a popular research topic. Although the distributed control system(DCS) has been introduced to monitor the state of industrial process, it still cannot satisfy all the requirements for fault detection of all the industrial systems. In this paper, we proposed a novel method based on topological features and support vector machine(SVM), for fault detection of industrial process. The proposed method takes global information of measured variables into account by complex network model and predicts whether a system has generated some faults or not by SVM. The proposed method can be divided into four steps, i.e. network construction, network analysis, model training and model testing respectively. Finally, we apply the model to Tennessee Eastman process(TEP). The results show that this method works well and can be a useful supplement for fault detection of industrial process.

  18. The state of itinerant charge carriers and thermoelectric effects in correlated oxide metals

    International Nuclear Information System (INIS)

    Kuzemsky, A.L.; Abdus Salam International Centre for Theoretical Physics, Trieste

    2000-10-01

    We analyzed the physics of transport processes and, in particular, the thermoelectric power in the mercurocuprates and other cuprates to get a better insight into the state of the carriers in these compounds. The actual problems related to the complicated mechanisms of carriers scattering above Tc are discussed. The experimental studies of thermoelectric power showed that the state of carriers in cuprates can be influenced by many complicated scattering processes, however the underlying mechanism for the linear decreasing of the TEP with increasing the temperature for most hole-doped HTSC cuprates is still not yet known. The actual problems related to the complicated mechanisms of carriers scattering above Tc are discussed for a few models of charge transport. A comparison between the analytical and experimental results is also made. It is concluded that the crucial factor for the understanding of the transport properties of correlated oxide metals is the nature of itinerant charge carriers, i.e. renormalized quasiparticles. (author)

  19. On the nature of the dhcp to fcc transition under pressure in Pr and Pr-Th alloys

    International Nuclear Information System (INIS)

    Vijayakumar, V.; Godwal, B.K.; Sikka, S.K.; Chidambaram, R.

    1988-01-01

    The results of electrical resistance (R), thermoelectric power (TEP) and X-ray diffraction measurements on praseodymium (Pr) and its alloys with thorium under pressure are reported. The maximum in R vs P curve exhibited by Pr persists only in the dhcp phase of Pr-Th alloy. X-ray measurements confirmed that in the alloys also the maximum in R vs P curve is due to the dhcp → fcc transition. Thus the behaviour of Pr and Pr-Th alloys is different from that of La and its alloys with Ce and Th where the maximum in the R vs P curve is electronic in origin and is exhibited by the dhcp, fcc and dist fcc phases. (author). 14 refs

  20. Media education perspectives with multimedia resources

    Directory of Open Access Journals (Sweden)

    Jaime Gabriel Espinosa Izquierdo

    2016-08-01

    Full Text Available It is indisputable that today’s society has undergone changes in this decade, related to technological and educational advances. This has created the new era of knowledge for changing from analog to digital era, this has created the birth of new tools to improve the teaching and learning process where the teacher is the protagonist of these changes for secondary education, the which it has had major transformations for the rapid development of information technology and communications (ICT; to be implemented in the training process of prospective students, that is where the concept of learning technologies and knowledge (TAC and technologies for empowerment and participation (TEP appears; constituting them in educational tools necessary for the teaching-learning process of education.

  1. An evaluation of Admedus' tissue engineering process-treated (ADAPT) bovine pericardium patch (CardioCel) for the repair of cardiac and vascular defects.

    Science.gov (United States)

    Strange, Geoff; Brizard, Christian; Karl, Tom R; Neethling, Leon

    2015-03-01

    Tissue engineers have been seeking the 'Holy Grail' solution to calcification and cytotoxicity of implanted tissue for decades. Tissues with all of the desired qualities for surgical repair of congenital heart disease (CHD) are lacking. An anti-calcification tissue engineering process (ADAPT TEP) has been developed and applied to bovine pericardium (BP) tissue (CardioCel, AdmedusRegen Pty Ltd, Perth, WA, Australia) to eliminate cytotoxicity, improve resistance to acute and chronic inflammation, reduce calcification and facilitate controlled tissue remodeling. Clinical data in pediatric patients, and additional pre-market authorized prescriber data demonstrate that CardioCel performs extremely well in the short term and is safe and effective for a range of congenital heart deformations. These data are supported by animal studies which have shown no more than normal physiologic levels of calcification, with good durability, biocompatibility and controlled healing.

  2. Aggregate Formation During the Viral Lysis of a Marine Diatom

    Directory of Open Access Journals (Sweden)

    Yosuke Yamada

    2018-05-01

    Full Text Available Recent studies have suggested that the viral lysis of microbes not only facilitates the conversion of particulate organic matter into dissolved organic matter, but also promotes the formation of organic aggregates, which enhance the export of organic carbon from the surface ocean to the deep sea. However, experimental data supporting this proposition are limited. Here, we tested the hypothesis that the viral infection of marine diatoms enhances aggregate formation. We used a model system consisting of Chaetoceros tenuissimus, a bloom-forming diatom with an approximate cell size of 3–10 μm, and a DNA virus, CtenDNAV type II, which replicates in the nucleus of C. tenuissimus. The volume of large particles (50–400 μm in equivalent spherical diameters, determined from photographic images was measured over time (up to 15 days in the diatom-alone control and a virus-added diatom culture. We also determined the concentrations of Coomassie-stainable particles (CSP, proteinaceous particles and transparent exopolymeric particles (TEP, acid-polysaccharide-rich particles with colorimetric methods. The total volume of large particles was significantly higher (5–59 fold in the virus-added diatoms than in the diatom-alone control during the period in which the viral lysis of the diatoms proceeded. One class of large particles produced in the virus-added diatoms was flake-shaped. The flakes were tightly packed and dense, and sank rapidly, possibly playing an important role in the vertical delivery of materials from the surface to the deep sea. The bulk CSP concentrations tended to be higher in the virus-added diatoms than in the diatom-alone control, whereas the reverse was true for the TEP. These results suggest that proteinaceous polymers are involved in aggregate formation. Our data support the emerging notion that the viral lysis of microbes facilitates aggregate formation and the export of organic carbon in the ocean.

  3. Relationships between anhedonia, alexithymia, impulsivity, suicidal ideation, recent suicide attempt, C-reactive protein and serum lipid levels among 122 inpatients with mood or anxious disorders.

    Science.gov (United States)

    Loas, Gwenolé; Dalleau, Elodie; Lecointe, Héloïse; Yon, Valérie

    2016-12-30

    Several studies have explored the relationship between C-reactive protein (CRP), serum lipid levels, risk of suicide and alexithymia or impulsivity in mood or anxiety disorders. However, to date, no study has evaluated the effects of anhedonia on these parameters. The aim of the study was to evaluate the relationship between anhedonia, alexithymia, impulsivity, suicidal ideation, recent suicide attempt, C-reactive protein (CRP) and lipid levels in patients with mood or anxiety disorders. One hundred and twenty-two inpatients with mood or anxiety disorders were recruited. Alexithymia and impulsivity were rated by the 20-item Toronto Alexithymia Scale (TAS-20) and the Barratt impulsivity scale (BIS-10), respectively. Anhedonia and depression were rated by the Temporal Experience Pleasure Scale (TEPS) and the Beck Depression inventory (BDI-II). The TEPS contained two subscales rating anticipatory and consummatory anhedonia. From the BDI-II an anhedonia subscale was extracted rating anhedonia-state. Trait consummatory anhedonia and state anhedonia were associated with low levels of total cholesterol or HDL and low levels of triglycerides respectively. Trait anticipatory anhedonia and state anhedonia were associated with suicidal ideations. The difficulty of identifying feelings component of alexithymia was associated with low levels of total cholesterol and LDL. A high level of suicidal ideation was associated with low levels of HDL. Higher levels of CRP were found in inpatients having recently attempted suicide compared with inpatients who had not attempted suicide. In mood and anxiety disorders, anhedonia and the "difficulty of identifying feelings" component of alexithymia (which has previously been found to be associated with suicide risk) could explain the relationship between serum lipid levels and higher suicide risk. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  4. Premenstrual syndrome and fibromyalgia: the frequency of the coexistence and their effects on quality of life.

    Science.gov (United States)

    Soyupek, Feray; Aydogan, Cigdem; Guney, Mehmet; Kose, Seyit Ali

    2017-07-01

    We aimed to investigate the association between Premenstrual syndrome (PMS) and fibromyalgia syndrome (FMS), to assess common symptoms and quality of life (QOL) of them. Patients with PMS formed the PMS group and age-matched healthy normal controls were included in the control group. The diagnosis of the FMS and PMS were based on new American College of Rheumatology FMS criteria and DSM-IV PMS criteria. FMS-related symptoms assessed by visual analog scale and number of tender points (TePs) were analyzed. QOL, PMS severity and FMS severity were assessed with SF-36, fibromyalgia impact questionnaire (FIQ) and premenstrual assessment form (PAF), respectively. Patients with PMS were divided into two subgroups according to coexistence of FMS or not. The frequency of FMS in PMS and control group were 20 and 0%, respectively (p = 0.002). FMS-related symptoms, number of TePs in the PMS group were higher than those in the control group. The mean mental component summary (MCS) score of SF-36 was low in the PMS group. The mean PAF score in PMS with FMS subgroup was higher than those in without FMS subgroup. The mean physical component summary of SF-36 was low in the PMS patient with FMS. There was correlation between PAF score and FIQ score (r = 0.476, p < 0.001). FMS was common among the patients with PMS and frequently seen in the PMS patients having severe premenstrual complaints. Mental QOL was distressed in the patients with PMS but while FMS accompanied to PMS, the physical QOL was decreased.

  5. Esophageal desalination is mediated by Na⁺, H⁺ exchanger-2 in the gulf toadfish (Opsanus beta).

    Science.gov (United States)

    Esbaugh, Andrew J; Grosell, Martin

    2014-05-01

    Esophageal desalination is a crucial step in the gastrointestinal water absorption pathway, as this pre-intestinal processing establishes the osmotic conditions necessary for water absorption. Previous work has shown that esophageal Na(+) absorption is amiloride sensitive; however, it is as yet unclear if Na(+), H(+) exchangers (NHE) or Na(+) channels (ENaC) are responsible. The purpose of the current study was therefore to investigate the roles that NHE isoforms may play in this process in a marine teleost, the gulf toadfish (Opsanus beta), as well as what role NHE isoforms may play in the downstream intestinal Na(+) transport. A combination of symmetrical current clamp and asymmetrical voltage clamp experiments showed the esophagus to contain both an ion absorptive current (I(sc)=0.83±0.68) and serosal side negative transepithelial potential (TEP=-4.9±0.6). (22)Na uptake (J(Na)(m→s)) was inhibited by 0.5 mM EIPA, with no effect of 0.1 mM amiloride, 1 mM furosemide or 1 mM thiazide. A Cl(-) free saline reduced J(Na)(m→s) by 40% while also reducing conductance and reversing TEP. These results suggest that both transcellular and paracellular components contribute to esophageal Na(+) transport, with transcellular transport mediated by NHE. The NHE1, NHE2 and NHE3 genes were amplified and tissue distribution analysis by real-time PCR showed high NHE2 expression levels in the esophagus and stomach. Little NHE3 expression was observed throughout the gastrointestinal tract, and NHE2 expression was absent from the intestine. Hypersalinity (60 ppt) had no effect on the expression profile of NHE2, slc4a2, scl26a6, CAc or V-type ATPase (β-subunit), suggesting that esophageal desalination is less flexible in response to osmotic stress than the intestine. Copyright © 2014 Elsevier Inc. All rights reserved.

  6. A new pathogen transmission mechanism in the ocean: the case of sea otter exposure to the land-parasite Toxoplasma gondii.

    Directory of Open Access Journals (Sweden)

    Fernanda F M Mazzillo

    Full Text Available Toxoplasma gondii is a land-derived parasite that infects humans and marine mammals. Infections are a significant cause of mortality for endangered southern sea otters (Enhydra lutris nereis, but the transmission mechanism is poorly understood. Otter exposure to T. gondii has been linked to the consumption of marine turban snails in kelp (Macrocystis pyrifera forests. It is unknown how turban snails acquire oocysts, as snails scrape food particles attached to surfaces, whereas T. gondii oocysts enter kelp beds as suspended particles via runoff. We hypothesized that waterborne T. gondii oocysts attach to kelp surfaces when encountering exopolymer substances (EPS forming the sticky matrix of biofilms on kelp, and thus become available to snails. Results of a dietary composition analysis of field-collected snails and of kelp biofilm indicate that snails graze the dense kelp-biofilm assemblage composed of pennate diatoms and bacteria inserted within the EPS gel-like matrix. To test whether oocysts attach to kelp blades via EPS, we designed a laboratory experiment simulating the kelp forest canopy in tanks spiked with T. gondii surrogate microspheres and controlled for EPS and transparent exopolymer particles (TEP - the particulate form of EPS. On average, 19% and 31% of surrogates were detected attached to kelp surfaces covered with EPS in unfiltered and filtered seawater treatments, respectively. The presence of TEP in the seawater did not increase surrogate attachment. These findings support a novel transport mechanism of T. gondii oocysts: as oocysts enter the kelp forest canopy, a portion adheres to the sticky kelp biofilms. Snails grazing this biofilm encounter oocysts as 'bycatch' and thereby deliver the parasite to sea otters that prey upon snails. This novel mechanism can have health implications beyond T. gondii and otters, as a similar route of pathogen transmission may be implicated with other waterborne pathogens to marine wildlife and

  7. Integrated resource planning in the power sector and economy-wide changes in environmental emissions

    International Nuclear Information System (INIS)

    Shrestha, Ram M.; Marpaung, Charles O.P.

    2006-01-01

    This paper analyzes the roles of key factors (i.e., changes in structure, fuel mix and final demand) on total economy-wide changes in CO 2 , SO 2 and NO x emissions when power sector development follows the integrated resource planning (IRP) approach instead of traditional supply-based electricity planning (TEP). It also considers the rebound effect (RE) of energy efficiency improvements in the demand side and analyzes the sensitivity of the results to variations in the values of the RE. A framework is developed to decompose the total economy-wide change in the emission of a pollutant into four major components, i.e., structural change-, fuel mix- , final demand- and joint-effects. The final demand effect is further decomposed into three categories, i.e., construction of power plants, electricity final demand and final demand related to electricity using equipments. The factor decomposition framework is then applied in the case of the power sector in Indonesia. A key finding in the case of Indonesia is that in the absence of the RE, there would be total economy-wide reductions in CO 2 , SO 2 and NO x emissions of 431, 1.6 and 1.3 million tons respectively during the planning horizon of 2006-2025 under IRP as compared to that under TEP. The decomposition analysis shows that the final demand effect would account for 38% of the total CO 2 emission reduction followed by the structural change effect (35.1%) and fuel mix effect (27.6%) while the joint effect is negligible. The study also shows that economy-wide CO 2 emission reduction due to IRP considering the RE of 45% would be 241 million tons as compared to 333 million tons when the RE is 25%

  8. Insights on the neural basis of motor plasticity induced by theta burst stimulation from TMS-EEG

    Science.gov (United States)

    VERNET, Marine; BASHIR, Shahid; YOO, Woo-Kyoung; PEREZ, Jennifer M.; NAJIB, Umer; PASCUAL-LEONE, Alvaro

    2014-01-01

    Transcranial magnetic stimulation (TMS) is a useful tool to induce and measure plasticity in the human brain. However, the cortical effects are generally indirectly evaluated with motor-evoked potentials (MEPs) reflective of modulation of cortico-spinal excitability. In this study, we aim to provide direct measures of cortical plasticity by combining TMS with electroencephalography (EEG). Continuous theta-burst stimulation (cTBS) was applied over the primary motor cortex (M1) of young healthy adults; and we measured modulation of (i) motor evoked-potentials (MEPs), (ii) TMS-induced EEG evoked potentials (TEPs), (iii) TMS-induced EEG synchronization and (iv) eyes-closed resting EEG. Our results show the expected cTBS-induced decrease in MEPs size, which we found to be paralleled by a modulation of a combination of TEPs. Furthermore, we found that cTBS increased the power in the theta band of eyes-closed resting EEG, whereas it decreased single-pulse TMS-induced power in the theta and alpha bands. In addition, cTBS decreased the power in the beta band of eyes-closed resting EEG, whereas it increased single-pulse TMS-induced power in the beta band. We suggest that cTBS acts by modulating the phase alignment between already active oscillators; it synchronizes low frequency (theta and/or alpha) oscillators and desynchronizes high frequency (beta) oscillators. These results provide novel insights into the cortical effects of cTBS and could be useful for exploring cTBS-induced plasticity outside of the motor cortex. PMID:23190020

  9. Effects of acute ocean acidification on spatially-diverse polar pelagic foodwebs: Insights from on-deck microcosms

    Science.gov (United States)

    Tarling, G. A.; Peck, V. L.; Ward, P.; Ensor, N. S.; Achterberg, E.; Tynan, E.; Poulton, A. J.; Mitchell, E.; Zubkov, M. V.

    2016-05-01

    The polar oceans are experiencing some of the largest levels of ocean acidification (OA) resulting from the uptake of anthropogenic carbon dioxide (CO2). Our understanding of the impacts this is having on polar marine communities is mainly derived from studies of single species in laboratory conditions, while the consequences for food web interactions remain largely unknown. This study carried out experimental manipulations of natural pelagic communities at different high latitude sites in both the northern (Nordic Seas) and southern hemispheres (Scotia and Weddell Seas). The aim of this study was to identify more generic responses and achieve greater experimental reproducibility through implementing a series of short term (4 d), multilevel (3 treatment) carbonate chemistry manipulation experiments on unfiltered natural surface-ocean communities, including grazing copepods. The experiments were successfully executed at six different sites, covering a diverse range of environmental conditions and differing plankton community compositions. The study identified the interaction between copepods and dinoflagellate cell abundance to be significantly altered by elevated levels of dissolved CO2 (pCO2), with dinoflagellates decreasing relative to ambient conditions across all six experiments. A similar pattern was not observed in any other major phytoplankton group. The patterns indicate that copepods show a stronger preference for dinoflagellates when in elevated pCO2 conditions, demonstrating that changes in food quality and altered grazing selectivity may be a major consequence of ocean acidification. The study also found that transparent exopolymeric particles (TEP) generally increased when pCO2 levels were elevated, but the response was dependent on the exact set of environmental conditions. Bacteria and nannoplankton showed a neutral response to elevated pCO2 and there was no significant relationship between changes in bacterial or nannoplankton abundance and that of

  10. The energy balance of Quebec in 1991: Energy consumption decreases for a second consecutive year and the part provided by electricity increases

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    An estimate is presented of the energy balance of Quebec for 1991 (unconventional energy sources excluded), and the definitive energy balance for 1990. The estimates for 1991 are based on sales data for the whole year for electric power, petroleum products, and natural gas, and on the first 9 months of data for coal and coke. In 1990, the energy consumption of Quebec reached 32.2 M TEP (tonnes of equivalent petroleum), or a decrease of 1.8% with respect to 1989. In 1991, it reached 31.1 M TEP, or a decrease of 3.5% with respect to 1990. The electric power consumption in 1991 was 149.1 TWh, an increase of 1.0% with respect to 1990, attributed in part to the economic effects of the recession. The consumption of petroleum products for energy uses attained 93.5 M bbl in 1991, or a drop of 7.3% with respect to 1990. This drop is also attributed to economic reasons. Natural gas sales in 1991 totalled 193.2 billion ft 3 , or a decrease of 2.3% from 1990. In the residential sector, natural gas sales fell 8%, while sales in the industrial and commercial sectors fell 1.6% and 1.3% respectively. Data on energy consumption are given as a function of the energy source (petroleum, coal and coke, natural gas and electric power), as a function of the consuming sector (for electric power and natural gas) or as a function of the nature of the product (for petroleum products). 4 figs., 4 tabs

  11. Investigating the empirical support for therapeutic targets proposed by the temporal experience of pleasure model in schizophrenia: A systematic review.

    Science.gov (United States)

    Edwards, Clementine J; Cella, Matteo; Tarrier, Nicholas; Wykes, Til

    2015-10-01

    Anhedonia and amotivation are substantial predictors of poor functional outcomes in people with schizophrenia and often present a formidable barrier to returning to work or building relationships. The Temporal Experience of Pleasure Model proposes constructs which should be considered therapeutic targets for these symptoms in schizophrenia e.g. anticipatory pleasure, memory, executive functions, motivation and behaviours related to the activity. Recent reviews have highlighted the need for a clear evidence base to drive the development of targeted interventions. To review systematically the empirical evidence for each TEP model component and propose evidence-based therapeutic targets for anhedonia and amotivation in schizophrenia. Following PRISMA guidelines, PubMed and PsycInfo were searched using the terms "schizophrenia" and "anhedonia". Studies were included if they measured anhedonia and participants had a diagnosis of schizophrenia. The methodology, measures and main findings from each study were extracted and critically summarised for each TEP model construct. 80 independent studies were reviewed and executive functions, emotional memory and the translation of motivation into actions are highlighted as key deficits with a strong evidence base in people with schizophrenia. However, there are many relationships that are unclear because the empirical work is limited by over-general tasks and measures. Promising methods for research which have more ecological validity include experience sampling and behavioural tasks assessing motivation. Specific adaptations to Cognitive Remediation Therapy, Cognitive Behavioural Therapy and the utilisation of mobile technology to enhance representations and emotional memory are recommended for future development. Copyright © 2015. Published by Elsevier B.V.

  12. The SGC beyond structural genomics: redefining the role of 3D structures by coupling genomic stratification with fragment-based discovery.

    Science.gov (United States)

    Bradley, Anthony R; Echalier, Aude; Fairhead, Michael; Strain-Damerell, Claire; Brennan, Paul; Bullock, Alex N; Burgess-Brown, Nicola A; Carpenter, Elisabeth P; Gileadi, Opher; Marsden, Brian D; Lee, Wen Hwa; Yue, Wyatt; Bountra, Chas; von Delft, Frank

    2017-11-08

    The ongoing explosion in genomics data has long since outpaced the capacity of conventional biochemical methodology to verify the large number of hypotheses that emerge from the analysis of such data. In contrast, it is still a gold-standard for early phenotypic validation towards small-molecule drug discovery to use probe molecules (or tool compounds), notwithstanding the difficulty and cost of generating them. Rational structure-based approaches to ligand discovery have long promised the efficiencies needed to close this divergence; in practice, however, this promise remains largely unfulfilled, for a host of well-rehearsed reasons and despite the huge technical advances spearheaded by the structural genomics initiatives of the noughties. Therefore the current, fourth funding phase of the Structural Genomics Consortium (SGC), building on its extensive experience in structural biology of novel targets and design of protein inhibitors, seeks to redefine what it means to do structural biology for drug discovery. We developed the concept of a Target Enabling Package (TEP) that provides, through reagents, assays and data, the missing link between genetic disease linkage and the development of usefully potent compounds. There are multiple prongs to the ambition: rigorously assessing targets' genetic disease linkages through crowdsourcing to a network of collaborating experts; establishing a systematic approach to generate the protocols and data that comprise each target's TEP; developing new, X-ray-based fragment technologies for generating high quality chemical matter quickly and cheaply; and exploiting a stringently open access model to build multidisciplinary partnerships throughout academia and industry. By learning how to scale these approaches, the SGC aims to make structures finally serve genomics, as originally intended, and demonstrate how 3D structures systematically allow new modes of druggability to be discovered for whole classes of targets. © 2017 The

  13. Transport properties of Pb-doped Bi4Sr3Ca3Cu4Ox semiconducting glasses and glass-ceramic superconductors

    International Nuclear Information System (INIS)

    Chatterjee, S.; Banerjee, S.; Mollah, S.; Chaudhuri, B.K.

    1996-01-01

    Electrical conductivity and thermoelectric power (TEP) of the as-quenched and annealed (at 500 degree C for 10 h and 840 degree C for 24 h) Bi 4-n Pb n Sr 3 Ca 3 Cu 4 O x (x = 0 endash 1.0) glasses have been measured. The dc conductivity data of the as-quenched and the partially annealed (at 500 degree C) glasses can be explained by considering the small-polaron hopping conduction mechanism which is found to change from the nonadiabatic to the adiabatic regime with annealing the glasses at 500 degree C. This change over is due to the presence of microcrystals in the partially annealed glasses as observed from x-ray-diffraction and scanning electron microscopic studies. This adiabatic behavior is also visualized even for some as-quenched glasses having a very small amount of the more conducting microcrystalline phase. All the 840 degree C annealed glasses are superconductors with T c between 110 and 115 K. The Seebeck coefficient (S) of the partially annealed glass system is found to be positive and increases linearly with temperature. The S values of the corresponding glass-ceramic superconductors showing broad peaks around T c . A change over in the values of S from positive (below ∼290 K) to negative (above ∼290 K) indicates the coexistence of both electrons and holes in these superconductors. The TEP data can be fitted with both the two-band model of Forro et al. [Solid State Commun. 73, 501 (1990)] and the Nagaosa-Lee model [Phys. Rev. Lett. 64, 2450 (1990)]. Therefore, the bosonic contribution in the transport properties of these superconductors, as suggested by the Nagaosa-Lee model, is supported. copyright 1996 The American Physical Society

  14. Mesopelagic N2 Fixation Related to Organic Matter Composition in the Solomon and Bismarck Seas (Southwest Pacific.

    Directory of Open Access Journals (Sweden)

    Mar Benavides

    Full Text Available Dinitrogen (N2 fixation was investigated together with organic matter composition in the mesopelagic zone of the Bismarck (Transect 1 and Solomon (Transect 2 Seas (Southwest Pacific. Transparent exopolymer particles (TEP and the presence of compounds sharing molecular formulae with saturated fatty acids and sugars, as well as dissolved organic matter (DOM compounds containing nitrogen (N and phosphorus (P were higher on Transect 1 than on Transect 2, while oxygen concentrations showed an opposite pattern. N2 fixation rates (up to ~1 nmol N L-1 d-1 were higher in Transect 1 than in Transect 2, and correlated positively with TEP, suggesting a dependence of diazotroph activity on organic matter. The scores of the multivariate ordination of DOM molecular formulae and their relative abundance correlated negatively with bacterial abundances and positively with N2 fixation rates, suggesting an active bacterial exploitation of DOM and its use to sustain diazotrophic activity. Sequences of the nifH gene clustered with Alpha-, Beta-, Gamma- and Deltaproteobacteria, and included representatives from Clusters I, III and IV. A third of the clone library included sequences close to the potentially anaerobic Cluster III, suggesting that N2 fixation was partially supported by presumably particle-attached diazotrophs. Quantitative polymerase chain reaction (qPCR primer-probe sets were designed for three phylotypes and showed low abundances, with a phylotype within Cluster III at up to 103 nifH gene copies L-1. These results provide new insights into the ecology of non-cyanobacterial diazotrophs and suggest that organic matter sustains their activity in the mesopelagic ocean.

  15. Integrated resource planning in the power sector and economy-wide changes in environmental emissions

    International Nuclear Information System (INIS)

    Shrestha, Ram M.; Marpaung, Charles O.P.

    2006-01-01

    This paper analyzes the roles of key factors (i.e., changes in structure, fuel mix and final demand) on total economy-wide changes in CO 2 , SO 2 and NO x emissions when power sector development follows the integrated resource planning (IRP) approach instead of traditional supply-based electricity planning (TEP). It also considers the rebound effect (RE) of energy efficiency improvements in the demand side and analyzes the sensitivity of the results to variations in the values of the RE. A framework is developed to decompose the total economy-wide change in the emission of a pollutant into four major components, i.e., structural change-, fuel mix- , final demand- and joint-effects. The final demand effect is further decomposed into three categories, i.e., construction of power plants, electricity final demand and final demand related to electricity using equipment. The factor decomposition framework is then applied in the case of the power sector in Indonesia. A key finding in the case of Indonesia is that in the absence of the RE, there would be total economy-wide reductions in CO 2 , SO 2 and NO x emissions of 431, 1.6 and 1.3 million tons respectively during the planning horizon of 2006-2025 under IRP as compared to that under TEP. The decomposition analysis shows that the final demand effect would account for 38% of the total CO 2 emission reduction followed by the structural change effect (35.1%) and fuel mix effect (27.6%) while the joint effect is negligible. The study also shows that economy-wide CO 2 emission reduction due to IRP considering the RE of 45% would be 241 million tons as compared to 333 million tons when the RE is 25%. (Author)

  16. Distribution of calcifying and silicifying phytoplankton in relation to environmental and biogeochemical parameters during the late stages of the 2005 North East Atlantic Spring Bloom

    Directory of Open Access Journals (Sweden)

    K. Leblanc

    2009-10-01

    Full Text Available The late stage of the North East Atlantic (NEA spring bloom was investigated during June 2005 along a transect section from 45 to 66° N between 15 and 20° W in order to characterize the contribution of siliceous and calcareous phytoplankton groups and describe their distribution in relation to environmental factors. We measured several biogeochemical parameters such as nutrients, surface trace metals, algal pigments, biogenic silica (BSi, particulate inorganic carbon (PIC or calcium carbonate, particulate organic carbon, nitrogen and phosphorus (POC, PON and POP, respectively, as well as transparent exopolymer particles (TEP. Results were compared with other studies undertaken in this area since the JGOFS NABE program. Characteristics of the spring bloom generally agreed well with the accepted scenario for the development of the autotrophic community. The NEA seasonal diatom bloom was in the late stages when we sampled the area and diatoms were constrained to the northern part of our transect, over the Icelandic Basin (IB and Icelandic Shelf (IS. Coccolithophores dominated the phytoplankton community, with a large distribution over the Rockall-Hatton Plateau (RHP and IB. The Porcupine Abyssal Plain (PAP region at the southern end of our transect was the region with the lowest biomass, as demonstrated by very low Chla concentrations and a community dominated by picophytoplankton. Early depletion of dissolved silicic acid (DSi and increased stratification of the surface layer most likely triggered the end of the diatom bloom, leading to coccolithophore dominance. The chronic Si deficiency observed in the NEA could be linked to moderate Fe limitation, which increases the efficiency of the Si pump. TEP closely mirrored the distribution of both biogenic silica at depth and prymnesiophytes in the surface layer suggesting the sedimentation of the diatom bloom in the form of aggregates, but the relative contribution of diatoms and

  17. An in vitro biotic ligand model (BLM) for silver binding to cultured gill epithelia of freshwater rainbow trout (Oncorhynchus mykiss)

    International Nuclear Information System (INIS)

    Zhou Bingsheng; Nichols, Joel; Playle, Richard C.; Wood, Chris M.

    2005-01-01

    'Reconstructed' gill epithelia on filter supports were grown in primary culture from dispersed gill cells of freshwater rainbow trout (Oncorhynchus mykiss). This preparation contains both pavement cells and chloride cells, and after 7-9 days in culture, permits exposure of the apical surface to true freshwater while maintaining blood-like culture media on the basolateral surface, and exhibits a stable transepithelial resistance (TER) and transepithelial potential (TEP) under these conditions. These epithelia were used to develop a possible in vitro version of the biotic ligand model (BLM) for silver; the in vivo BLM uses short-term gill binding of the metal to predict acute silver toxicity as a function of freshwater chemistry. Radio-labeled silver ( 110m Ag as AgNO 3 ) was placed on the apical side (freshwater), and the appearance of 110m Ag in the epithelia (binding) and in the basolateral media (flux) over 3 h were monitored. Silver binding (greater than the approximate range 0-100 μg l -1 ) and silver flux were concentration-dependent with a 50% saturation point (apparent K d ) value of about 10 μg l -1 or 10 -7 M, very close to the 96-h LC50 in vivo in the same water chemistry. There were no adverse effects of silver on TER, TEP, or Na + , K + -ATPase activity, though the latter declined over longer exposures, as in vivo. Silver flux over 3 h was small ( + and dissolved organic carbon (humic acid) concentrations, increased by elevations in freshwater Cl - and reductions in pH, and insensitive to elevations in Ca 2+ . With the exception of the pH response, these effects were qualitatively and quantitatively similar to in vivo BLM responses. The results suggest that an in vitro BLM approach may provide a simple and cost-effective way for evaluating the protective effects of site-specific waters

  18. Organophosphate esters in East Greenland polar bears and ringed seals: Adipose tissue concentrations and in vitro depletion and metabolite formation.

    Science.gov (United States)

    Strobel, Adelle; Willmore, William G; Sonne, Christian; Dietz, Rune; Letcher, Robert J

    2018-04-01

    East Greenland is a contamination "hot spot" for long-range transported anthropogenic chemicals, including organophosphate esters (OPEs). High concentrations of OPEs have been reported in arctic air while very little is known for wildlife where OPE tissue residues levels appear to be strongly influenced by biotransformation. In the present study, the hepatic in vitro metabolism of six environmentally relevant organophosphate (OP) triesters and corresponding OP diester formation were investigated in East Greenland polar bears (PBs) and ringed seals (RSs). The in vitro metabolism assay results were compared to adipose levels in field samples from the same individuals. In vitro OP triester metabolism was generally rapid and structure-dependent, where PBs metabolized OPEs more rapidly than RSs. Exceptions were the lack of triethyl phosphate (TEP) metabolism and slow metabolism of tris(2-ethylhexyl) phosphate (TEHP) in both species. OP diester metabolites were also formed with the exception of TEP which was not metabolized at all. Tris(1,3-dichloro-2-propyl) phosphate was completely converted to its corresponding diester. However, the mass balances showed that OP diester formation corresponding to TEHP, tri(n-butyl) phosphate, and tris(2-butyoxyethyl) phosphate did not account for 100% of the OP triester depletion, which indicated alternate pathways of OP triester metabolism had occurred. Triphenyl phosphate was completely converted to its OP diester metabolite in PBs but not in RSs suggesting species-specific differences. The results demonstrated that OP triester bioaccumulation and fate in PBs versus their RS prey is substantially influenced by biotransformation. Copyright © 2018 Elsevier Ltd. All rights reserved.

  19. Application of electrochemical processes to membrane bioreactors for improving nutrient removal and fouling control.

    Science.gov (United States)

    Borea, Laura; Naddeo, Vincenzo; Belgiorno, Vincenzo

    2017-01-01

    Membrane bioreactor (MBR) technology is becoming increasingly popular as wastewater treatment due to the unique advantages it offers. However, membrane fouling is being given a great deal of attention so as to improve the performance of this type of technology. Recent studies have proven that the application of electrochemical processes to MBR represents a promising technological approach for membrane fouling control. In this work, two intermittent voltage gradients of 1 and 3 V/cm were applied between two cylindrical perforated electrodes, immersed around a membrane module, at laboratory scale with the aim of investigating the treatment performance and membrane fouling formation. For comparison purposes, the reactor also operated as a conventional MBR. Mechanisms of nutrient removal were studied and membrane fouling formation evaluated in terms of transmembrane pressure variation over time and sludge relative hydrophobicity. Furthermore, the impact of electrochemical processes on transparent exopolymeric particles (TEP), proposed as a new membrane fouling precursor, was investigated in addition to conventional fouling precursors such as bound extracellular polymeric substances (bEPS) and soluble microbial products (SMP). All the results indicate that the integration of electrochemical processes into a MBR has the advantage of improving the treatment performance especially in terms of nutrient removal, with an enhancement of orthophosphate (PO 4 -P) and ammonia nitrogen (NH 4 -N) removal efficiencies up to 96.06 and 69.34 %, respectively. A reduction of membrane fouling was also observed with an increase of floc hydrophobicity to 71.72 %, a decrease of membrane fouling precursor concentrations, and, thus, of membrane fouling rates up to 54.33 %. The relationship found between TEP concentration and membrane fouling rate after the application of electrochemical processes confirms the applicability of this parameter as a new membrane fouling indicator.

  20. Implementing model-based system engineering for the whole lifecycle of a spacecraft

    Science.gov (United States)

    Fischer, P. M.; Lüdtke, D.; Lange, C.; Roshani, F.-C.; Dannemann, F.; Gerndt, A.

    2017-09-01

    Design information of a spacecraft is collected over all phases in the lifecycle of a project. A lot of this information is exchanged between different engineering tasks and business processes. In some lifecycle phases, model-based system engineering (MBSE) has introduced system models and databases that help to organize such information and to keep it consistent for everyone. Nevertheless, none of the existing databases approached the whole lifecycle yet. Virtual Satellite is the MBSE database developed at DLR. It has been used for quite some time in Phase A studies and is currently extended for implementing it in the whole lifecycle of spacecraft projects. Since it is unforeseeable which future use cases such a database needs to support in all these different projects, the underlying data model has to provide tailoring and extension mechanisms to its conceptual data model (CDM). This paper explains the mechanisms as they are implemented in Virtual Satellite, which enables extending the CDM along the project without corrupting already stored information. As an upcoming major use case, Virtual Satellite will be implemented as MBSE tool in the S2TEP project. This project provides a new satellite bus for internal research and several different payload missions in the future. This paper explains how Virtual Satellite will be used to manage configuration control problems associated with such a multi-mission platform. It discusses how the S2TEP project starts using the software for collecting the first design information from concurrent engineering studies, then making use of the extension mechanisms of the CDM to introduce further information artefacts such as functional electrical architecture, thus linking more and more processes into an integrated MBSE approach.

  1. Pulmonary embolism and difficult-to-treat asthma

    Directory of Open Access Journals (Sweden)

    Catarina Teles Martins

    2007-11-01

    asthma. Resumo: O controlo da asma é um factor crucial na abordagem do doente: a mais recente actualização do GINA considera que uma “asma difícil de tratar” é uma asma para investigar. O não cumprimento da terapêutica, a DPOC concomitante, o tabagismo, a rinossinusite, o refluxo gastroesofágico e a obesidade são considerados os principais motivadores da asma difícil de controlar.O presente trabalho teve por objectivo avaliar o papel do tromboembolismo pulmonar (TEP na asma grave de difícil controlo.Foram revistos os processos clínicos de doentes asmáticos da consulta de Alergologia Respiratória do nosso Serviço, entre 2004 e 2006, com asma “persistente grave” de acordo com o GINA 2005. Foram seleccionados os que, apesar de terapêutica optimizada, apresentavam asma “não controlada” (GINA 2006 e analisadas as suas causas. Dos 254 doentes estudados, 28 (11% preenchiam os critérios de “asma persistente grave” (idade média 44 ± 18 anos; 86% sexo feminino; destes, 57% (n = 16 tinham doença “não controlada” – 35% (n = 6 por má adesão à terapêutica; 29% (n = 5 por TEP (confirmado gamagraficamente; 12% (n = 2 por rinossinusite grave; 6% (n = 1 por síndroma hipereosinofílica; 6% (n = 1 por contacto mantido com alérgenos e 6% (n = 1 em estudo.Os doentes com TEP (idade média 56 ± 9 anos; 80% sexo feminino; 80% raça branca tiveram o diagnóstico de asma na idade adulta (média 37 anos, tendo decorrido cerca de 18 anos até ao diagnóstico de TEP. A análise dos factores predisponentes para TEP revelou: insuficiência venosa periférica (40%, HTA (40% e deficiência de proteína C e S funcionais (20%. Todos os doentes efectuaram terapêutica anticoagulante (80% ainda mantém, referindo-se que, após o início da anticoagulação, 40% dos doentes alcan

  2. Transtorno de estresse pós-traumático em uma unidade de saúde de atenção primária Trastorno de estrés postraumático en una unidad de salud de atención primaria Posttraumatic stress disorder in a primary health care service

    Directory of Open Access Journals (Sweden)

    Airton Tetelbom Stein

    2004-08-01

    Full Text Available INTRODUÇÃO: O transtorno de estresse pós-traumático (TEPT caracteriza-se pelo desenvolvimento de sintomas como a re-experienciação do evento traumático (pesadelos, idéias intrusivas, sintomas somáticos relacionados ao momento do trauma, evitação e embotamento (evitar situações, pessoas ou comportamentos que relembrem o trauma e ter dificuldade para lidar com novas situações ou sentimentos e excitabilidade aumentada (insônia, irritação, dificuldade de concentração e um estado permanente de alerta e sobressalto. É importante saber a freqüência do transtorno numa comunidade pobre. OBJETIVO: Identificar a freqüência de TEPT e a presença de sintomas depressivos e alcoolismo em um serviço de atenção primária. METODOLOGIA: O estudo ocorreu na Unidade de Saúde Divina Providência, do Serviço de Saúde Comunitária do Grupo Hospitalar Conceição. Realizou-se uma amostragem aleatória dos pacientes que consultaram no posto. Foram aplicados instrumentos para a identificação de TEPT, sintomas depressivos, alcoolismo e perfil sociodemográfico. RESULTADOS: Dos 54 pacientes entrevistados, 83,3% eram mulheres, e a média da idade foi de 39 anos. Os sintomas depressivos severos foram identificados em 28% dos pacientes; 59% tinham o critério de TEPT e 12,5% apresentavam problemas com álcool. CONCLUSÕES: A amostra do sexo feminino foi predominante e houve uma elevada prevalência de TEPT.INTRODUCCÍON: El trastorno de estrés postraumático (TEP se caracteriza por el desarrollo de síntomas como la retomada de la experimentación del evento traumático (pesadilla, ideas de intrusión, síntomas somáticos relacionados a la ocasión del trauma; evitación y embotamiento (evitar situaciones, personas o comportamientos que recuerden el trauma y tener dificultad para convivir con nuevas situaciones o sentimientos y excitabilidad ampliada (insomnio, irritación, dificultad de concentración y un estado permanente de alerta y

  3. Cortisol sérico e glicemia em cadelas tratadas com tramadol e submetidas à ovário-histerectomia

    Directory of Open Access Journals (Sweden)

    Caldeira Fátima Maria Caetano

    2006-01-01

    Full Text Available O tramadol é um analgésico opióide usado em medicina veterinária, embora existam poucos estudos sobre este fármaco. O objetivo deste trabalho foi avaliar o efeito analgésico promovido pela administração do tramadol, mensurando o cortisol sérico e a glicemia de cadelas. Para isso, foram utilizadas 15 fêmeas, submetidas a ovário-histerectomia sob anestesia geral com isofluorano. Os animais foram divididos em três grupos. Grupo 1 (Tep receberam tramadol pela via epidural (1,0mg kg-1 diluído em água bidestilada ao volume final de 3,0mL e, após 15 minutos, 3,0mL de água bidestilada pela via intravenosa. No grupo 2 (Tiv, foi administrado 3,0mL de água bidestilada pela via epidural e, após 15 minutos, tramadol pela via intravenosa (1,0mg kg-1 diluído em água bidestilada ao volume final de 3,0mL. No grupo 3 (CT, os animais receberam 3,0mL de água bidestilada pela via epidural e, após 15 minutos, 3,0mL de água bidestilada pela via intravenosa. A eficácia de cada regime analgésico foi avaliada durante 12 horas após a administração da injeção epidural. Não houve diferença significativa entre os grupos experimentais para as variáveis estudadas (P>0,05. Foram observadas diferenças significativas dentro de cada tratamento. No grupo Tep houve aumento do cortisol sérico aos 25 minutos do trans-operatório (M3, em relação ao valor obtido imediatamente após a indução anestésica (M2 (P>0,05. Nos tratamentos Tiv e CT, verificou-se elevação das variáveis, duas (M4 e quatro (M5 horas da injeção epidural (P<0,05, quando comparadas ao pré-tratamento (M1. Nesses períodos, as variáveis estudadas no tratamento Tep foram estatisticamente semelhantes ao pré-tratamento (M1. Com base nos resultados, conclui-se que: 1 a metodologia empregada foi sensível para determinar os momentos de maior estresse cirúrgico, dentre os estudados e 2 o tramadol por via epidural produz analgesia mais duradoura quando comparado à administra

  4. Variáveis capnográficas pré e pós-tromboendarterectomias pulmonares Pre and post-pulmonary thromboendarterectomies campnographic variables

    Directory of Open Access Journals (Sweden)

    Marcos Mello Moreira

    2007-12-01

    Full Text Available Este relato de dois casos com os resultados da fração tardia de espaço morto (fDlate, fração do espaço morto alveolar end-tidal (AVDSf, gradiente artério-alveolar de CO2 [P(a-etCO2] e slope da fase 3 do espirograma, submetidos à tromboendarterectomia pulmonar por tromboembolismo pulmonar (TEP. O TEP foi diagnosticado pela cintilografia pulmonar, tomografia helicoidal computadorizada e por arteriografia pulmonar. O cálculo da fDlate, AVDSf e P(a-etCO2 baseou-se na capnografia volumétrica associada à gasometria arterial. A fDlate préoperatória do primeiro paciente foi de 0,16 (cutoff de 0,12 e a AVDSf = 0,30 (cutoff de 0,15. Já a fDlate do segundo paciente resultou falso-negativa (0,01, embora a AVDSf resultasse positiva (0,28. A fDlate pós-operatória do primeiro paciente foi de -0,04 e a AVDSf de 0,16; a fDlate do segundo paciente foi de 0,07 e a AVDSf = 0,28. A associação destas variáveis com os exames por imagem reforça a importância deste método como ferramenta diagnóstica não-invasiva no diagnóstico de TEP.In these case report, the results of late dead space fraction (fDlate, end-tidal alveolar dead space fraction (AVDSf, arterial-alveolar gradient CO2 [P(a-etCO2], and slope phase 3 of spirogram of two patients who underwent thromboendarterectomy for pulmonary embolism (PE are shown. PE was diagnosed by pulmonary scintigraphy, helical tomography, and pulmonary angiography. The calculation of fDlate, AVDSf and P(a-etCO2 was based on volumetric capnography associated with arterial blood gas analysis. The pre-operative fDlate of the first patient was 0.16 (cutoff 0.12 and AVDSf was 0.30 (cutoff 0.15. However, the fDlate of the second patient was false-negative (0.01 but, the AVDSf was positive (0.28. Postoperative fDlate of the first patient was -0.04 and AVDSf was 0.16; for the second patient, the values were 0.07 and 0.28, respectively. The association of these capnographic variables with image exams reinforces the

  5. Fibrinogênio sérico pré-operatório como preditor de infarto do miocárdio na cirurgia de revascularização miocárdica Preoperative serum fibrinogen as a predictor of myocardial infarction in the surgical myocardial revascularization

    Directory of Open Access Journals (Sweden)

    Cristiano Pederneiras Jaeger

    2006-09-01

    Full Text Available OBJETIVO: Determinar o valor preditivo do nível sérico de fibrinogênio pré-operatório para a ocorrência de infarto do miocárdio (IM no período perioperatório de cirurgia de revascularização miocárdica (CRM, bem como para outros desfechos de impacto, como acidente vascular encefálico isquêmico (AVEI, tromboembolismo pulmonar (TEP e morte, isoladamente e de maneira composta. MÉTODOS: Estudo de coorte retrospectivo com análise do banco de dados de cirurgia cardíaca do Hospital São Lucas da PUC-RS, com 1.471 pacientes consecutivos que realizaram CRM com circulação extracorpórea entre janeiro de 1998 e dezembro de 2002. RESULTADOS: IM perioperatório ocorreu em 14% dos pacientes da amostra. Não foi observada associação entre o fibrinogênio pré-operatório e IM perioperatório (410,60 ± 148,83 mg/dl para o grupo em estudo x 401,57 ±135,23 mg/dl para o grupo controle - p = 0,381 - RC = 1,000 - IC95%: 0,998-1,002 - p = 0,652, o desfecho combinado de IM, AVEI, TEP e morte (411,40 ± 153,52 mg/dl para o grupo com o desfecho x 400,31 ± 131,98 mg/dl para o grupo sem o desfecho - p = 0,232 e nem com cada um destes isoladamente. CONCLUSÃO: Nesta amostra, o nível sérico de fibrinogênio pré-operatório não apresentou associação com a ocorrência de IM perioperatório nas CRM, nem mesmo com outros desfechos de impacto, incluindo AVEI, TEP e morte, isoladamente ou em conjunto.OBJECTIVE: Determine the predictive level of preoperative serum fibrinogen level for the occurrence of MI in perioperative surgical myocardial revascularization (SMR, as well as for other impacting outcomes, such as stroke, pulmonary thromboembolism (PTE, and death, separately or in combination. METHODS: A retrospective cohort study based on the heart surgery database analysis from São Lucas Hospital, at Rio Grande do Sul Catholic University with 1,471 consecutive patients submitted to extracorporeal SMR between January, 1998 and December, 2002. RESULTS

  6. The role of policy instruments for promoting combined heat and power production with low CO2 emissions in district heating systems

    International Nuclear Information System (INIS)

    Marbe, A.; Harvey, S.

    2005-01-01

    tradable emission permits (TEP) in such a system is 250 SEK tonne -1 , COE is 353 SEK MWh -1 compared to the reference power price of 384 SEK MWh -1 . It is possible to integrate a pressurized biofuel gasifier to the NGCC CHP plant without any major re-design of the combined cycle provided that the maximum degree of co-firing is limited to 27-38% (energy basis) product gas, depending on the design of the gasifier system. There are many parameters that affect the economic performance of an integrated biofuel gasifier for product gas co-firing of a NGCC CHP plant. The premium value of the co-generated renewable electricity and the value of TEPs are very important parameters. Assuming a future CO 2 trading system with a TEP value of 250 SEK tonne -1 and a premium value of renewable electricity of 200 SEK MWh -1 COE from a CHP plant with an integrated biofuelled gasifier could be 336 SEK MWh -1 , which is lower than both the reference market electric power price and COE for the plant operating on natural gas alone. (Author)

  7. Freqüência cardíaca máxima em idosas brasileiras: uma comparação entre valores medidos e previstos Maximum heart rate in Brazilian elderly women: comparing measured and predicted values

    Directory of Open Access Journals (Sweden)

    Valter Abrantes Pereira da Silva

    2007-03-01

    Full Text Available OBJETIVO: O presente estudo objetivou comparar os valores de freqüência cardíaca máxima (FCmáx medidos durante um teste de esforço progressivo (TEP, com os obtidos através de equações de predição, em idosas brasileiras. MÉTODOS: Um TEP máximo sob o protocolo modificado de Bruce, realizado em esteira, foi utilizado para obtenção dos valores de referência da freqüência cardíaca máxima (FCmáx, em 93 mulheres idosas (67,1±5,16 anos. Os valores obtidos foram comparados aos estimados pelas equações "220 - idade" e a de Tanaka e cols., através da ANOVA, para amostras repetidas. A correlação e a concordância entre os valores medidos e os estimados foram testadas. Adicionalmente, a correlação entre os valores de FCmáx medidos e a idade das voluntárias foi examinada. RESULTADOS: Os resultados foram os seguintes: 1 a média da FCmáx atingida no TEP foi de 145,5±12,5 batimentos por minuto (bpm; 2 as equações "220 - idade" e a de Tanaka e cols. (2001 superestimaram significativamente (p OBJECTIVE: This study sought to compare maximum heart rate (HRmax values measured during a graded exercise test (GXT with those calculated from prediction equations in Brazilian elderly women. METHODS: A treadmill maximal graded exercise test in accordance with the modified Bruce protocol was used to obtain reference values for maximum heart rate (HRmax in 93 elderly women (mean age 67.1 ± 5.16. Measured values were compared with those estimated from the "220 - age" and Tanaka et al formulas using repeated-measures ANOVA. Correlation and agreement between measured and estimated values were tested. Also evaluated was the correlation between measured HRmax and volunteers’ age. RESULTS: Results were as follows: 1 mean HRmax reached during GXT was 145.5 ± 12,5 beats per minute (bpm; 2 both the "220 - age" and Tanaka et al (2001 equations significantly overestimated (p < 0.001 HRmax by a mean difference of 7.4 and 15.5 bpm, respectively; 3

  8. Mid-term coral-algal dynamics and conservation status of a Gorgona Island (Tropical Eastern Pacific coral reef

    Directory of Open Access Journals (Sweden)

    Fernando A Zapata

    2010-05-01

    Full Text Available Colombian coral reefs, as other reefs worldwide, have deteriorated significantly during the last few decades due to both natural and anthropogenic disturbances. The National Monitoring System for Coral Reefs in Colombia (SIMAC was established in 1998 to provide long-term data bases to assess the changes of Colombian coral reefs against perturbations and to identify the factors responsible for their decline or recovery. On the Pacific coast, data on coral and algal cover have been collected yearly during seven consecutive years (1998-2004 from 20 permanent transects in two sites at La Azufrada reef, Gorgona Island. Overall, coral cover was high (55.1%-65.7% and algal cover low (28.8%-37.5% and both exhibited significant changes among years, most notably on shallow areas. Differences between sites in both coral and algal cover were present since the study began and may be explained by differences in sedimentation stress derived from soil runoff. Differences between depths most likely stem from the effects of low tidal sub-aerial exposures. Particularly intense sub-aerial exposures occurred repeatedly during January-March, 2001 and accounted for a decrease in coral and an increase in algal cover on shallow depths observed later that year. Additionally, the shallow area on the Northern site seems to be negatively affected by the combined effect of sedimentation and low tidal exposure. However, a decrease in coral cover and an increase of algal cover since 2001 on deep areas at both sites remain unexplained. Comparisons with previous studies suggest that the reef at La Azufrada has been more resilient than other reefs in the Tropical Eastern Pacific (TEP, recovering pre-disturbance (1979 levels of coral cover within a 10 year period after the 1982-83 El Niño, which caused 85% mortality. Furthermore, the effects of the 1997-98 El Niño, indicated by the difference in overall live coral cover between 1998 and 1999, were minor (<6% reduction. Despite

  9. Mid-term coral-algal dynamics and conservation status of a Gorgona Island (Tropical Eastern Pacific) coral reef.

    Science.gov (United States)

    Zapata, Fernando A; Rodríguez-Ramírez, Alberto; Caro-Zambrano, Carlos; Garzón-Ferreira, Jaime

    2010-05-01

    Colombian coral reefs, as other reefs worldwide, have deteriorated significantly during the last few decades due to both natural and anthropogenic disturbances. The National Monitoring System for Coral Reefs in Colombia (SIMAC) was established in 1998 to provide long-term data bases to assess the changes of Colombian coral reefs against perturbations and to identify the factors responsible for their decline or recovery. On the Pacific coast, data on coral and algal cover have been collected yearly during seven consecutive years (1998-2004) from 20 permanent transects in two sites at La Azufrada reef, Gorgona Island. Overall, coral cover was high (55.1%-65.7%) and algal cover low (28.8%-37.5%) and both exhibited significant changes among years, most notably on shallow areas. Differences between sites in both coral and algal cover were present since the study began and may be explained by differences in sedimentation stress derived from soil runoff. Differences between depths most likely stem from the effects of low tidal sub-aerial exposures. Particularly intense sub-aerial exposures occurred repeatedly during January-March, 2001 and accounted for a decrease in coral and an increase in algal cover on shallow depths observed later that year. Additionally, the shallow area on the Northern site seems to be negatively affected by the combined effect of sedimentation and low tidal exposure. However, a decrease in coral cover and an increase of algal cover since 2001 on deep areas at both sites remain unexplained. Comparisons with previous studies suggest that the reef at La Azufrada has been more resilient than other reefs in the Tropical Eastern Pacific (TEP), recovering pre-disturbance (1979) levels of coral cover within a 10 year period after the 1982-83 El Niño, which caused 85% mortality. Furthermore, the effects of the 1997-98 El Niño, indicated by the difference in overall live coral cover between 1998 and 1999, were minor (< 6% reduction). Despite recurrent

  10. Rationale, design, and protocol for the prevention of low back pain in the military (POLM trial (NCT00373009

    Directory of Open Access Journals (Sweden)

    Dugan Jessica L

    2007-09-01

    Full Text Available Abstract Background There are few effective strategies reported for the primary prevention of low back pain (LBP. Core stabilization exercises targeting the deep abdominal and trunk musculature and psychosocial education programs addressing patient beliefs and coping styles represent the current best evidence for secondary prevention of low back pain. However, these programs have not been widely tested to determine if they are effective at preventing the primary onset and/or severity of LBP. The purpose of this cluster randomized clinical trial is to determine if a combined core stabilization exercise and education program is effective in preventing the onset and/or severity of LBP. The effect of the combined program will be compared to three other standard programs. Methods/Design Consecutive Soldiers participating in advanced individual training (AIT will be screened for eligibility requirements and consented to study participation, as appropriate. Companies of Soldiers will be randomly assigned to receive the following standard prevention programs; a core stabilization exercise program (CSEP alone, a CSEP with a psychosocial education (PSEP, a traditional exercise (TEP, or a TEP with a PSEP. Proximal outcome measures will be assessed at the conclusion of AIT (a 12 week training period and include imaging of deep lumbar musculature using real-time ultrasound imaging and beliefs about LBP by self-report questionnaire. We are hypothesizing that Soldiers receiving the CSEP will have improved thickness of selected deep lumbar musculature (transversus abdominus, multifidi, and erector spinae muscles. We are also hypothesizing that Soldiers receiving the PSEP will have improved beliefs about the management of LBP. After AIT, Soldiers will be followed monthly to measure the distal outcomes of LBP occurrence and severity. This information will be collected during the subsequent 2 years following completion of AIT using a web-based data entry system

  11. Molecular insights into the microbial formation of marine dissolved organic matter: recalcitrant or labile?

    Science.gov (United States)

    Koch, B. P.; Kattner, G.; Witt, M.; Passow, U.

    2014-08-01

    The degradation of marine dissolved organic matter (DOM) is an important control variable in the global carbon cycle. For our understanding of the kinetics of organic matter cycling in the ocean, it is crucial to achieve a mechanistic and molecular understanding of its transformation processes. A long-term microbial experiment was performed to follow the production of non-labile DOM by marine bacteria. Two different glucose concentrations and dissolved algal exudates were used as substrates. We monitored the bacterial abundance, concentrations of dissolved and particulate organic carbon (DOC, POC), nutrients, amino acids and transparent exopolymer particles (TEP) for 2 years. The molecular characterization of extracted DOM was performed by ultrahigh resolution Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS) after 70 days and after ∼2 years of incubation. Although glucose quickly degraded, a non-labile DOC background (5-9% of the initial DOC) was generated in the glucose incubations. Only 20% of the organic carbon from the algal exudate degraded within the 2 years of incubation. The degradation rates for the non-labile DOC background in the different treatments varied between 1 and 11 μmol DOC L-1 year-1. Transparent exopolymer particles, which are released by microorganisms, were produced during glucose degradation but decreased back to half of the maximum concentration within less than 3 weeks (degradation rate: 25 μg xanthan gum equivalents L-1 d-1) and were below detection in all treatments after 2 years. Additional glucose was added after 2 years to test whether labile substrate can promote the degradation of background DOC (co-metabolism; priming effect). A priming effect was not observed but the glucose addition led to a slight increase of background DOC. The molecular analysis demonstrated that DOM generated during glucose degradation differed appreciably from DOM transformed during the degradation of the algal exudates. Our

  12. Dinitrogen fixation in aphotic oxygenated marine environments

    Directory of Open Access Journals (Sweden)

    Eyal eRahav

    2013-08-01

    Full Text Available We measured N2 fixation rates from oceanic zones that have traditionally been ignored as sources of biological N2 fixation; the aphotic, fully oxygenated, nitrate (NO3--rich, waters of the oligotrophic Levantine Basin (LB and the Gulf of Aqaba (GA. N2 fixation rates measured from pelagic aphotic waters to depths up to 720 m, during the mixed and stratified periods, ranged from 0.01 nmol N L-1 d-1 to 0.38 nmol N L-1 d-1. N2 fixation rates correlated significantly with bacterial productivity and heterotrophic diazotrophs were identified from aphotic as well as photic depths. Dissolved free amino acid amendments to whole water from the GA enhanced bacterial productivity by 2to 3.5 and N2 fixation rates by ~ 2 fold in samples collected from aphotic depths while in amendments to water from photic depths bacterial productivity increased 2 to 6 fold while N2 fixation rates increased by a factor of 2 to 4 illustrating that both BP an heterotrophic N2 fixation are carbon limited. Experimental manipulations of aphotic waters from the LB demonstrated a significant positive correlation between transparent exopolymeric particles (TEP concentration and N2 fixation rates. This suggests that sinking organic material and high carbon (C: nitrogen (N micro-environments (such as TEP-based aggregates or marine snow could support high heterotrophic N2 fixation rates in oxygenated surface waters and in the aphotic zones. Indeed, our calculations show that aphotic N2 fixation accounted for 37 to 75 % of the total daily integrated N2 fixation rates at both locations in the Mediterranean and Red Seas with rates equal or greater to those measured from the photic layers. Moreover, our results indicate that that while N2 fixation may be limited in the surface waters, aphotic, pelagic N2 fixation may contribute significantly to new N inputs in other oligotrophic basins, yet it is currently not included in regional or global N budgets.

  13. Sense of Place and the National Parks, Strategies for Communicating the Interconnected Nature of Earth Science

    Science.gov (United States)

    Vye, E. C.; Rose, W. I.; Huntoon, J. E.; Nash, B. L.

    2010-12-01

    Using sense of place can help scientists improve their communication of complex concepts related to the connectivity of the environment, geological processes, and human societies. National parks afford excellent examples of places that contain intellectual and emotional stimuli for diverse individuals - in other words, they foster a sense of place. Parks contain spectacular examples of how the processes that shape the earth influence ecosystem and societal development. Parks can therefore be used as outdoor classrooms to engage people in place-based Earth Science education. Incorporating place-based teaching methods can promote learning about Earth’s processes that ensures that a wider audience can be reached than by traditional instructional methods. Specific examples of using national parks on the Colorado Plateau, in the Rocky Mountains and the Keweenaw Peninsula for K-12 teacher training have resulted in a deepening of Earth Science content-area knowledge. The National Parks “Views of the National Park (Views)” multimedia education program can subsequently be used to promote engagement of students in the teachers’ classrooms. Teachers who wish to continue their education as interns in the parks are served by programs such as Geoscientists-in-the-Parks, Volunteers-in-Parks, and Teacher-Ranger-Teacher programs. The Michigan Teaching Excellence Program (MiTEP), multi-year teacher leadership and professional development program is working with middle-grade science teachers from selected urban districts and using the parks of the Midwest as natural classrooms. MiTEP has partnered with the NPS to develop internship opportunities for teachers in the parks. These internships will result in educational materials that can be hosted by “Views”. The goal of the internships are to improve teachers’ understanding of the natural environment and the processes that it reflects, and to assist park personnel in producing materials that are standards-based, age

  14. Necrotizing Fasciitis Associated with Pregnancy: a Population-Based Cohort Study.

    Science.gov (United States)

    Oud, Lavi; Watkins, Phillip

    2014-12-01

    Necrotizing fasciitis (NF) is a rare complication in pregnant women. There have been no population-level data reported to date on its epidemiology, clinical features, resource utilization, and outcomes. This was a retrospective, population-based cohort study, using the Texas Inpatient Public Use Data File to identify pregnancy-associated hospitalizations for the years 2001-2010. Hospitalizations with a diagnosis of NF were then identified using the International Classification of Diseases, Ninth Revision, Clinical Modification code 728.86. Denominator data for incidence estimates were derived from the Texas Center for Health Statistics reports of live births, abortions and fetal deaths, and previously reported population-based, age-specific linkage data on miscarriage, and were used to estimate the annual total number of pregnancies (TEP). The incidence of pregnancy-associated NF (PANF), hospitalization type, clinical features, resource utilization and outcomes were examined. There were 4,060,201 pregnancy-associated hospitalizations and 148 PANF hospitalizations during study period. Postpartum hospitalizations accounted for 82.4% of all PANF events, and intensive care unit care was required in 61.5%. The key trends noted between 2001-2002 and 2009-2010 included rising incidence of PANF from 1.1 vs. 3.8 per 100,000 TEP-years (P = 0.0001), chronic comorbidities 0% vs. 31.7% (P = 0.0777), and development of organ failure in 9.1% vs. 31.7% (P = 0.0302). There was no significant change in total hospital charges or hospital length of stay. Three patients (2%) died in the hospital and 55% of survivors had routine home discharge. The present cohort of PANF is the largest reported to date. The incidence of PANF rose nearly 3.5-fold over the past decade, with most events developing following delivery hospitalization. Chronic illness has been increasingly present, along with rising severity of illness. The majority of patients required ICU care. Hospital mortality was

  15. Evolving trends in the epidemiology, resource utilization, and outcomes of pregnancy-associated severe sepsis: a population-based cohort study.

    Science.gov (United States)

    Oud, Lavi; Watkins, Phillip

    2015-06-01

    Infections are a well-known complication of pregnancy. However, pregnancy-associated severe sepsis (PASS) has not been as well-characterized, with limited population-level data reported to date. We performed a population-based study of the evolving patterns of the epidemiology, clinical characteristics, resource utilization, and outcomes of PASS in Texas over the past decade. The Texas Inpatient Public Use Data File was used to identify pregnancy-associated hospitalizations and PASS hospitalizations for the years 2001 - 2010. The Texas Center for Health Statistics reports of live births, abortions and fetal deaths, and a previously reported population-based, age-specific linkage study on miscarriage were used to derive the annual total estimated pregnancies (TEPs). The incidence, demographics, clinical characteristics, resource utilization and outcomes of PASS were examined. Logistic regression modeling was used to explore the predictors of PASS and its associated mortality. There were 4,060,201 pregnancy-associated hospitalizations and 1,007 PASS hospitalizations during study period. The incidence of PASS was increased by 236% over the past decade, rising from 11 to 26 hospitalizations per 100,000 TEPs. The key changes between 2001 - 2002 and 2009 - 2010 within PASS hospitalizations included: admission to ICU 78% vs. 90% (P = 0.002); development of ≥ 3 organ failures 9% vs. 35% (P < 0.0001); and inflation-adjusted median hospital charges (2,010 dollars) $64,034 vs. $89,895 (P = 0.0141). Hospital mortality (11%) remained unchanged during study period. Chronic liver disease (adjusted odds ratio (aOR) 41.4) and congestive heart failure (CHF) (aOR 20.5) were associated with the highest risk of PASS, in addition to black race, poverty, drug abuse, and lack of health insurance. The highest risk of death was among women with HIV infection (aOR 45.5), need for mechanical ventilation (aOR 4.5), drug abuse (aOR 3.0), and lacking health insurance (aOR 2.9). The incidence

  16. Advanced Therapy Medicinal Products for Rare Diseases: State of Play of Incentives Supporting Development in Europe

    Directory of Open Access Journals (Sweden)

    Andreas M. Farkas

    2017-05-01

    Full Text Available In 2008, the European Union introduced the Advanced Medicines Regulation aiming to improve regulation of advanced therapy medicinal products (ATMPs. We applied the ATMPs classification definitions in this Regulation to understand the link of this emerging group of medicinal products and the use of the Orphan Regulation. A total of 185 products that can be classified as ATMPs based on this Regulation have been submitted for orphan designation. Prior to its introduction in 2008, 4.5% of the products submitted for orphan designation met these criteria. This percentage went up to 15% after 2008. We analyzed several parameters associated with active ATMP ODDs focusing on sponsor type and EU-Member State origin, therapeutic area targeted, and ATMP classification [i.e., somatic cell therapy medicinal product, tissue-engineered product (TEP, or gene therapy medicinal product (GTMP] and the use of regulatory services linked to incentives such as the use of protocol assistance (PA and other Committees [Committee for Advanced Therapies (CAT and the Pediatric Committee]. The aim here was to gain insight on the use of different services. The UK submits the largest number of ATMPs for ODD representing ~30% of the total to date. Few submissions have been received from central and Eastern European Member States as well as some of the larger Member States such as Germany (3.6%. ATMPs ODDs were primarily GTMPs (48.7% and SCTMPs (43.3%. TEPs only represented 8% of all submissions for this medicinal class. This is different from non-ODDs ATMPs where GTMPs make only 20% of ATMPs. A total of 11.7% of ATMP ODDs had received formal CAT classification. A total of 29.8% of all orphan drug (OD ATMPs requested PA. A total of 71.8% did not have an agreed pediatric investigation plan (PIP. Four products (Glybera one PA; Zalmoxis two; Holoclar one; Strimvelis three have received a marketing authorization (MAA and a 10-year market exclusivity. Strimvelis also completed their

  17. Yb-based heavy fermion compounds and field tuned quantum chemistry

    Energy Technology Data Exchange (ETDEWEB)

    Mun, Eundeok [Iowa State Univ., Ames, IA (United States)

    2010-01-01

    The motivation of this dissertation was to advance the study of Yb-based heavy fermion (HF) compounds especially ones related to quantum phase transitions. One of the topics of this work was the investigation of the interaction between the Kondo and crystalline electric field (CEF) energy scales in Yb-based HF systems by means of thermoelectric power (TEP) measurements. In these systems, the Kondo interaction and CEF excitations generally give rise to large anomalies such as maxima in ρ(T) and as minima in S(T). The TEP data were use to determine the evolution of Kondo and CEF energy scales upon varying transition metals for YbT2Zn20 (T = Fe, Ru, Os, Ir, Rh, and Co) compounds and applying magnetic fields for YbAgGe and YbPtBi. For YbT2Zn20 and YbPtBi, the Kondo and CEF energy scales could not be well separated in S(T), presumably because of small CEF level splittings. A similar effect was observed for the magnetic contribution to the resistivity. For YbAgGe, S(T) has been successfully applied to determine the Kondo and CEF energy scales due to the clear separation between the ground state and thermally excited CEF states. The Kondo temperature, TK, inferred from the local maximum in S(T), remains finite as magnetic field increases up to 140 kOe. In this dissertation we have examined the heavy quasi-particle behavior, found near the field tuned AFM quantum critical point (QCP), with YbAgGe and YbPtBi. Although the observed nFL behaviors in the vicinity of the QCP are different between YbAgGe and YbPtBi, the constructed H-T phase diagram including the two crossovers are similar. For both YbAgGe and YbPtBi, the details of the quantum criticality turn out to be complicated. We expect that YbPtBi will provide an additional example of field tuned quantum criticality, but clearly there are further experimental investigations left and more ideas needed to understand the basic physics of field-induced quantum

  18. Thermal ageing of steels; from expertise and understanding of the ageing mechanisms to a maintenance strategy for operating nuclear power plants

    International Nuclear Information System (INIS)

    Bezdikian, G.; Ould, P.

    2004-01-01

    Some parts of reactor coolant circuit on Nuclear PWR power plants, elbows on primary circuit, are made in cast duplex stainless steel material. It is now identify that the mechanical characteristic of this material should be decrease under thermal ageing mainly after a long time in operation in at reactor coolant circuit temperature conditions. The sensitiveness to the thermal ageing of these components is in relation with chemical composition and the ferrite content, especially the grade of Chromium equivalent (Ceq %Cr + %Si + %Mo). In the context of justification to maintain in operation on the plants these cat duplex components, an important programme of expertises was carried out on cast elbows after removing on the plants during the Steam Generators replacements (SGR). Several expertises, performed in the objective to understand the thermal ageing phenomenon and mechanism on cast components in service on plants, were permit to validate the prediction formulas established from a large database and programme in laboratories. The expertises were based on a lot of metallurgical, mechanical and chemical characteristics of components in operation Small Angle Neutrons Scattering (SANS), Thermal Electric Power (TEP), micro hardness and toughness measurement on small specimens from boat sample (CT10-5) The expertise carried out on one SG inlet elbows from DAMPIERRE, removed a during SGR after 100000 h in operation is shown, the toughness values are very high compared to the prediction formulas. The TEP measurements performed on the specimen cut off on two elbows and the ingots of the same material aged in laboratory in furnace, are very coherent; it is confirmed that this methodology is a good indicator to follow the ageing characteristic of material. The results of expertises on aged material are a mean of validation of the methodology applied on the file of demonstration of maintaining in operation of cast duplex stainless steel sensitive to thermal ageing. So the

  19. HAT-P-11b: A SUPER-NEPTUNE PLANET TRANSITING A BRIGHT K STAR IN THE KEPLER FIELD

    International Nuclear Information System (INIS)

    Bakos, G. A.; Torres, G.; Pal, A.; Hartman, J.; Noyes, R. W.; Latham, D. W.; Sasselov, D. D.; Sipocz, B.; Esquerdo, G. A.; Kovacs, Gabor; Fernandez, J.; Kovacs, Geza; Moor, A.; Fischer, D. A.; Isaacson, H.; Johnson, J. A.; Marcy, G. W.; Howard, A.; Butler, R. P.; Vogt, S.

    2010-01-01

    We report on the discovery of HAT-P-11b, the smallest radius transiting extrasolar planet (TEP) discovered from the ground, and the first hot Neptune discovered to date by transit searches. HAT-P-11b orbits the bright (V = 9.587) and metal rich ([Fe/H] = +0.31 ± 0.05) K4 dwarf star GSC 03561-02092 with P = 4.8878162 ± 0.0000071 days and produces a transit signal with depth of 4.2 mmag, the shallowest found by transit searches that is due to a confirmed planet. We present a global analysis of the available photometric and radial velocity (RV) data that result in stellar and planetary parameters, with simultaneous treatment of systematic variations. The planet, like its near-twin GJ 436b, is somewhat larger than Neptune (17 M + , 3.8 R + ) both in mass M p = 0.081 ± 0.009 M J (25.8 ± 2.9 M + ) and radius R p = 0.422 ± 0.014 R J (4.73 ± 0.16 R + ). HAT-P-11b orbits in an eccentric orbit with e = 0.198 ± 0.046 and ω = 355. 0 2 ± 17. 0 3, causing a reflex motion of its parent star with amplitude 11.6 ± 1.2 m s -1 , a challenging detection due to the high level of chromospheric activity of the parent star. Our ephemeris for the transit events is T c = 2454605.89132 ± 0.00032 (BJD), with duration 0.0957 ± 0.0012 days, and secondary eclipse epoch of 2454608.96 ± 0.15 days (BJD). The basic stellar parameters of the host star are M * = 0.809 +0.020 -0.027 M sun , R * = 0.752 ± 0.021 R sun , and T eff* = 4780 ± 50 K. Importantly, HAT-P-11 will lie on one of the detectors of the forthcoming Kepler mission; this should make possible fruitful investigations of the detailed physical characteristic of both the planet and its parent star at unprecedented precision. We discuss an interesting constraint on the eccentricity of the system by the transit light curve and stellar parameters. This will be particularly useful for eccentric TEPs with low-amplitude RV variations in Kepler's field. We also present a blend analysis, that for the first time treats the case of a

  20. Cultured branchial epithelia from freshwater fish gills

    Science.gov (United States)

    Wood; PÄRt

    1997-01-01

    We have developed a method for the primary culture of gill epithelial cells from freshwater rainbow trout on permeable supports, polyethylene terephthalate membranes ('filter inserts'). Primary cultures of gill cells (6-9 days in Leibowitz L-15 culture medium plus foetal bovine serum and glutamine) are trypsinized and the cells seeded onto the inserts. After 6 days of growth with L-15 medium on both surfaces (approximately isotonic to trout plasma), the cells form a tight epithelium as judged from a progressive rise in transepithelial resistance which reaches a stable plateau for a further 6 days, as long as L-15 exposure is continued on both surfaces. The cultured epithelium (approximately 8 µm thick) typically consists of 2-4 overlapping cell layers organized as in the lamellae in vivo, with large intercellular spaces, multiple desmosomes and putative tight junctions. The cells appear to be exclusively pavement-type cells with an apical surface glycocalyx, an abundance of rough endoplasmic reticulum, no selective DASPEI staining and relatively few mitochondria. Transepithelial resistance (approximately 3.5 k cm2), permeability to a paracellular marker (polyethylene glycol-4000; 0.17x10(-6) cm s-1) and unidirectional flux of Na+ and Cl- (approximately 300 nmol cm-2 h-1) all appear realistic because they compare well with in vivo values; net fluxes of Na+ and Cl- are zero. The preparation acidifies the apical medium, which accumulates a greater concentration of ammonia. Upon exposure to apical freshwater, resistance increases six- to elevenfold and a basolateral-negative transepithelial potential (TEP) develops as in vivo. These responses occur even when mannitol is used to prevent changes in apical osmotic pressure. Net Na+ and Cl- loss rates are low over the first 12 h (-125 nmol cm-2 h-1) but increase substantially by 48 h. The elevated resistance and negative TEP gradually attenuate but remain significantly higher than pre-exposure values after 48 h of apical

  1. In-service and pre-service teacher education in IBSE: The ESTABLISH approach

    International Nuclear Information System (INIS)

    Ješková, Zuzana; Kireš, Marián; McLoughlin, Eilish; Finlayson, Odilla; Ottander, Christina; Ekborg, Margareta

    2015-01-01

    One of the main goals of the ESTABLISH 7fp project (available on line at http://www.establish-fp7.eu/) was the development and implementation of the professional development teacher education programmes (TEP) to support teachers in adopting inquiry-based strategies in their teaching. Within the project there was a model for in-service and pre-service teacher training in IBSE designed and implemented across 12 participating countries. The programme is based on 4 core elements and 4 additional elements that are built around the IBSE teaching units developed within the project. As accepted by ESTABLISH partners, all teacher training programmes include the minimum of the four elements, i.e. introduction to IBSE, industrial content knowledge, teacher as implementer and teacher as developer of IBSE teaching materials. There are also four additional elements designed in detail, i.e. ICT for IBSE, argumentation in the classroom, research and design projects for students, assessment of IBSE. These can be added to the programme optionally with regard to the level of teachers’ IBSE skills and current situation in education and teachers’ professional development within the country. This ESTABLISH model of TEP was followed in participating countries in order to change teachers’ attitudes from traditional ways of teaching towards adopting inquiry strategies and their successful implementation in the classroom. Within the face-to-face workshops teachers experienced and developed their inquiry based teaching strategies using specifically developed materials. In addition, the e-platform has been developed to provide on-line support. This platform provides educators and teachers with all the necessary materials for the training and IBSE teaching units and other teaching materials for teachers’ ongoing help. The teacher training programme was successfully implemented in Slovakia. There were two runs of teacher training workshops on IBSE already carried out. Moreover, the

  2. An Assessment of Subsurface Intake Systems: Planning and Impact on Feed Water Quality for SWRO Facilities

    KAUST Repository

    Dehwah, Abdullah

    2017-12-01

    Subsurface intake systems are known to improve the feed water quality for SWRO plants. However, a little is known about the feasibility of implementation in coastal settings, the degree of water quality improvements provided by these systems, and the internal mechanisms of potential fouling compounds removal within subsurface intake systems. A new method was developed to assess the feasibility of using different subsurface intake systems in coastal areas and was applied to Red Sea coastline of Saudi Arabia. The methodology demonstrated that five specific coastal environments could support well intake systems use for small-capacity SWRO plants, whereas large-capacity SWRO facilities could use seabed gallery intake systems. It was also found that seabed intake system could run with no operational constraints based on the high evaporation rates and associated diurnal salinity changes along the coast line. Performance of well intake systems in several SWRO facilities along the Red Sea coast showed that the concentrations of organic compounds were reduced in the feed water, similar or better than traditional pretreatment methodologies. Nearly all algae, up to 99% of bacteria, between 84 and 100% of the biopolymer fraction of NOM, and a high percentage of TEP were removed during transport through the aquifer. These organics cause membrane biofouling and using well intakes showed a 50-75% lower need to clean the SWRO membranes compared to conventional open-ocean intakes. An assessment of the effectiveness of seabed gallery intake systems was conducted through a long-term bench-scale column experiment. The simulation of the active layer (upper 1 m) showed that it is highly effective at producing feed water quality improvements and acts totally different compared to slow sand filtration systems treating freshwater. No development of a “schmutzdecke” layer occurred and treatment was not limited to the top 10 cm, but throughout the full column thickness. Algae and

  3. Pulmonary thromboembolism in AIDS patient with chronic venous insufficiency, pulmonary tuberculosis and breast cancer: a case report and pathophysiology review Tromboembolismo pulmonar em uma paciente com AIDS com insuficiência venosa profunda, tuberculose pulmonar e câncer de mama: relato de um caso e revisão da fisiopatologia

    Directory of Open Access Journals (Sweden)

    Juan José Cortez-Escalante

    2006-04-01

    ções tromboembólicas incluindo o TEP nos pacientes com AIDS. O TEP nesta paciente foi um desafio diagnóstico, considerando todas as outras doenças graves que apresentou simultaneamente.

  4. Risk of discontinuation of Advanced Therapy Medicinal Products clinical trials.

    Science.gov (United States)

    Hanna, Eve; Rémuzat, Cecile; Auquier, Pascal; Toumi, Mondher

    2016-01-01

    Advanced therapy medicinal products (ATMPs) constitute a class of innovative products that encompasses gene therapy, somatic cell therapy, and tissue-engineered products (TEP). There is an increased investment of commercial and non-commercial sponsors in this field and a growing number of ATMPs randomized clinical trials (RCT) and patients enrolled in such trials. RCT generate data to prove the efficacy of a new therapy, but the discontinuation of RCTs wastes scarce resources. Our objective is to identify the number and characteristics of discontinued ATMPs trials in order to evaluate the rate of discontinuation. We searched for ATMPs trials conducted between 1999 to June 2015 using three databases, which are Clinicaltrials.gov, the International Clinical Trials Registry Platform (ICTRP), and the EU Drug Regulating Authorities Clinical Trials (EudraCT). We selected the ATMPs trials after elimination of the duplicates. We identified the disease areas and the sponsors as commercial or non-commercial organizations. We classified ATMPs by type and trial status, that is, ongoing, completed, terminated, discontinued, and prematurely ended. Then, we calculated the rate of discontinuation. Between 1999 and June 2015, 143 withdrawn, terminated, or prematurely ended ATMPs clinical trials were identified. Between 1999 and June 2013, 474 ongoing and completed clinical trials were identified. Therefore, the rate of discontinuation of ATMPs trials is 23.18%, similar to that for non-ATMPs drugs in development. The probability of discontinuation is, respectively, 27.35, 16.28, and 16.34% for cell therapies, gene therapies, and TEP. The highest discontinuation rate is for oncology (43%), followed by cardiology (19.2%). It is almost the same for commercial and non-commercial sponsors; therefore, the discontinuation reason may not be financially driven. No failure risk rate per development phase is available for ATMPs. The discontinuation rate may prove helpful when assessing the

  5. Measurement of the energy and power radiated by a pulsed blackbody x-ray source

    International Nuclear Information System (INIS)

    Chandler, Gordon Andrew; McDaniel, Dillon Heirman; Jorgenson, Roy E.; Warne, Larry Kevin; Dropinski, Steven Clark; Hanson, Donald L.; Johnson, William Arthur; York, Mathew William; Lewis, D.F.; Korde, R.; Haslett, C.L.; Wall, D.L.; Ruggles, Laurence E.; Ramirez, L.E.; Stygar, William A.; Porter, John Larry Jr.; McKenney, John Lee; Bryce, Edwin Anthony; Cuneo, Michael Edward; Torres, Jose A.; Mills, Jerry Alan; Leeper, Ramon Joe; McGurn, John Stephen; Fehl, David Lee; Spielman, R. B.; Pyle, John H.; Mazarakis, Michael Gerrassimos; Ives III, Harry Crockett; Seamen, Johann F.; Simpson, Walter W.

    2006-01-01

    We have developed a diagnostic system that measures the spectrally integrated (i.e. the total) energy and power radiated by a pulsed blackbody x-ray source. The total-energy-and-power (TEP) diagnostic system is optimized for blackbody temperatures between 50 and 350 eV. The system can view apertured sources that radiate energies and powers as high as 2 MJ and 200 TW, respectively, and has been successfully tested at 0.84 MJ and 73 TW on the Z pulsed-power accelerator. The TEP system consists of two pinhole arrays, two silicon-diode detectors, and two thin-film nickel bolometers. Each of the two pinhole arrays is paired with a single silicon diode. Each array consists of a 38 x 38 square array of 10-(micro)m-diameter pinholes in a 50-(micro)m-thick tantalum plate. The arrays achromatically attenuate the x-ray flux by a factor of ∼1800. The use of such arrays for the attenuation of soft x rays was first proposed by Turner and co-workers [Rev. Sci. Instrum. 70, 656 (1999)RSINAK0034-674810.1063/1.1149385]. The attenuated flux from each array illuminates its associated diode; the diode's output current is recorded by a data-acquisition system with 0.6-ns time resolution. The arrays and diodes are located 19 and 24 m from the source, respectively. Because the diodes are designed to have an approximately flat spectral sensitivity, the output current from each diode is proportional to the x-ray power. The nickel bolometers are fielded at a slightly different angle from the array-diode combinations, and view (without pinhole attenuation) the same x-ray source. The bolometers measure the total x-ray energy radiated by the source and--on every shot--provide an in situ calibration of the array-diode combinations. Two array-diode pairs and two bolometers are fielded to reduce random uncertainties. An analytic model (which accounts for pinhole-diffraction effects) of the sensitivity of an array-diode combination is presented

  6. Advanced Therapy Medicinal Products for Rare Diseases: State of Play of Incentives Supporting Development in Europe.

    Science.gov (United States)

    Farkas, Andreas M; Mariz, Segundo; Stoyanova-Beninska, Violeta; Celis, Patrick; Vamvakas, Spiros; Larsson, Kristina; Sepodes, Bruno

    2017-01-01

    In 2008, the European Union introduced the Advanced Medicines Regulation aiming to improve regulation of advanced therapy medicinal products (ATMPs). We applied the ATMPs classification definitions in this Regulation to understand the link of this emerging group of medicinal products and the use of the Orphan Regulation. A total of 185 products that can be classified as ATMPs based on this Regulation have been submitted for orphan designation. Prior to its introduction in 2008, 4.5% of the products submitted for orphan designation met these criteria. This percentage went up to 15% after 2008. We analyzed several parameters associated with active ATMP ODDs focusing on sponsor type and EU-Member State origin, therapeutic area targeted, and ATMP classification [i.e., somatic cell therapy medicinal product, tissue-engineered product (TEP), or gene therapy medicinal product (GTMP)] and the use of regulatory services linked to incentives such as the use of protocol assistance (PA) and other Committees [Committee for Advanced Therapies (CAT) and the Pediatric Committee]. The aim here was to gain insight on the use of different services. The UK submits the largest number of ATMPs for ODD representing ~30% of the total to date. Few submissions have been received from central and Eastern European Member States as well as some of the larger Member States such as Germany (3.6%). ATMPs ODDs were primarily GTMPs (48.7%) and SCTMPs (43.3%). TEPs only represented 8% of all submissions for this medicinal class. This is different from non-ODDs ATMPs where GTMPs make only 20% of ATMPs. A total of 11.7% of ATMP ODDs had received formal CAT classification. A total of 29.8% of all orphan drug (OD) ATMPs requested PA. A total of 71.8% did not have an agreed pediatric investigation plan (PIP). Four products (Glybera one PA; Zalmoxis two; Holoclar one; Strimvelis three) have received a marketing authorization (MAA) and a 10-year market exclusivity. Strimvelis also completed their PIP

  7. Obtención de modelos de cálculo de sistemas provisionales de protección de borde mediante la técnica de Análisis Modal Operacional

    Directory of Open Access Journals (Sweden)

    González, M. N.

    2013-03-01

    Full Text Available In this work were obtained by Operational Modal Analysis (OMA vibration modes and frequencies associated with temporary of protection systems (TEPS built with planks of pine wood and steel poles. These systems have been evaluated analytically, using a finite element model (FEM. For the FEM we obtained the elastic constants of wood using ultrasound. The results of experimental and analytical assessment in the first vibration modes match in reasonable ways.

    En este trabajo se han obtenido experimentalmente mediante Análisis Modal Operacional (AMO los modos de vibración y las frecuencias asociadas de sistemas provisionales de protección de borde (SPPB fabricados con tablas de madera de pino silvestre y postes de sección tubular de acero. Los mismos sistemas se han evaluado analíticamente, usando un modelo de elementos finitos (MEF. Para el MEF se han obtenido las constantes elásticas de la madera mediante ultrasonidos. Los resultados de la evaluación experimental y analítica concuerdan en los primeros modos de vibración.

  8. Minimally invasive 'step-up approach' versus maximal necrosectomy in patients with acute necrotising pancreatitis (PANTER trial): design and rationale of a randomised controlled multicenter trial [ISRCTN13975868].

    Science.gov (United States)

    Besselink, Marc G H; van Santvoort, Hjalmar C; Nieuwenhuijs, Vincent B; Boermeester, Marja A; Bollen, Thomas L; Buskens, Erik; Dejong, Cornelis H C; van Eijck, Casper H J; van Goor, Harry; Hofker, Sijbrand S; Lameris, Johan S; van Leeuwen, Maarten S; Ploeg, Rutger J; van Ramshorst, Bert; Schaapherder, Alexander F M; Cuesta, Miguel A; Consten, Esther C J; Gouma, Dirk J; van der Harst, Erwin; Hesselink, Eric J; Houdijk, Lex P J; Karsten, Tom M; van Laarhoven, Cees J H M; Pierie, Jean-Pierre E N; Rosman, Camiel; Bilgen, Ernst Jan Spillenaar; Timmer, Robin; van der Tweel, Ingeborg; de Wit, Ralph J; Witteman, Ben J M; Gooszen, Hein G

    2006-04-11

    The initial treatment of acute necrotizing pancreatitis is conservative. Intervention is indicated in patients with (suspected) infected necrotizing pancreatitis. In the Netherlands, the standard intervention is necrosectomy by laparotomy followed by continuous postoperative lavage (CPL). In recent years several minimally invasive strategies have been introduced. So far, these strategies have never been compared in a randomised controlled trial. The PANTER study (PAncreatitis, Necrosectomy versus sTEp up appRoach) was conceived to yield the evidence needed for a considered policy decision. 88 patients with (suspected) infected necrotizing pancreatitis will be randomly allocated to either group A) minimally invasive 'step-up approach' starting with drainage followed, if necessary, by videoscopic assisted retroperitoneal debridement (VARD) or group B) maximal necrosectomy by laparotomy. Both procedures are followed by CPL. Patients will be recruited from 20 hospitals, including all Dutch university medical centres, over a 3-year period. The primary endpoint is the proportion of patients suffering from postoperative major morbidity and mortality. Secondary endpoints are complications, new onset sepsis, length of hospital and intensive care stay, quality of life and total (direct and indirect) costs. To demonstrate that the 'step-up approach' can reduce the major morbidity and mortality rate from 45 to 16%, with 80% power at 5% alpha, a total sample size of 88 patients was calculated. The PANTER-study is a randomised controlled trial that will provide evidence on the merits of a minimally invasive 'step-up approach' in patients with (suspected) infected necrotizing pancreatitis.

  9. Preparation of hybrid biomaterials for bone tissue engineering

    Directory of Open Access Journals (Sweden)

    Vilma Conceição Costa

    2007-03-01

    Full Text Available Tissue engineering has evolved from the use of biomaterials for bone substitution that fulfill the clinical demands of biocompatibility, biodegradability, non-immunogeneity, structural strength and porosity. Porous scaffolds have been developed in many forms and materials, but few reached the need of adequate physical, biological and mechanical properties. In the present paper we report the preparation of hybrid porous polyvinyl alcohol (PVA/bioactive glass through the sol-gel route, using partially and fully hydrolyzed polyvinyl alcohol, and perform structural characterization. Hybrids containing PVA and bioactive glass with composition 58SiO2-33CaO-9P2O5 were synthesized by foaming a mixture of polymer solution and bioactive glass sol-gel precursor solution. Sol-gel solution was prepared from mixing tetraethoxysilane (TEOS, triethylphosphate (TEP, and calcium chloride as chemical precursors. The hybrid composites obtained after aging and drying at low temperature were chemically and morphologically characterized through infrared spectroscopy and scanning electron microscopy. The degree of hydrolysis of PVA, concentration of PVA solution and different PVA-bioglass composition ratios affect the synthesis procedure. Synthesis parameters must be very well combined in order to allow foaming and gelation. The hybrid scaffolds obtained exhibited macroporous structure with pore size varying from 50 to 600 µm.

  10. Polystyrene star-shaped polymers made by the new In-Inmethod

    International Nuclear Information System (INIS)

    Fazeli, N.; Afshar Toromi, F.

    2002-01-01

    Three main methods are usually used for the synthesis of star-shaped polymers, where each one has its own advantages and disadvantages. Among these techniques, i n-out m ethod is the best one to produce hetero arm star polymers with narrow molecular weight distribution and long arms with active sites at the end of the second-generation arms. This method, however, has some difficulties during the synthesis of hetero-arm star polymers with styrene or dienes as the second monomers. The reason is that in the o ut s tep, the carbanions of the growing chain attack the existing double bonds of the other cores and produce an irreversible gel. The new i n-in m ethod mentioned in this paper, is used to synthesize double-star polystyrene polymers with relatively narrow molecular weight distribution and without occurrence of any gelation during the process. With the monomers, which are able to attack the existing double bonds of the cores of the star polymers, it is also possible to produce-hetero-arm star polymers using this new method

  11. Study of aluminum content in a welding metal by thermoelectric measurements

    Science.gov (United States)

    Carreón, H.; Ramirez, S.; Coronado, C.; Salazar, M.

    2018-03-01

    This work investigates the effect caused by the aluminum content in a welding metal and its variation in mechanical properties through the use of a non-destructive thermoelectric technique. It is known that aluminum has positive effects as deoxidizer in low percentages and alloying element together with Niobium and Vanadium. Aluminum has a positive and negative effect, initially improves the mechanical properties of the metal, as it acts as a grain refiner, increasing the yield strength, but in larger quantities, important mechanical properties such as hardness and toughness are seriously affected. For this purpose, HSLA ASTM 572 Gr. 50 steel was used as the base metal, where the weld metal was deposited, after which the specimens were fabricated and the mechanical tests and non-destructive tests were carried out. The sensitivity of the thermoelectric potential technique to microstructural and chemical composition changes was confirmed. The evolution of absolute thermoelectric potential (TEP) values with respect to the percentage of aluminum added to the weld was observed, being also quite sensitive to defects such as micro-cracks.

  12. On detecting variables using ROTSE-IIId archival data

    Science.gov (United States)

    Yesilyaprak, C.; Yerli, S. K.; Aksaker, N.; Gucsav, B. B.; Kiziloglu, U.; Dikicioglu, E.; Coker, D.; Aydin, E.; Ozeren, F. F.

    ROTSE (Robotic Optical Transient Search Experiment) telescopes can also be used for variable star detection. As explained in the system description tep{2003PASP..115..132A}, they have a good sky coverage and they allow a fast data acquisition. The optical magnitude range varies between 7^m to 19^m. Thirty percent of the telescope time of north-eastern leg of the network, namely ROTSE-IIId (located at TUBITAK National Observatory, Bakirlitepe, Turkey http://www.tug.tubitak.gov.tr/) is owned by Turkish researchers. Since its first light (May 2004) considerably a large amount of data has been collected (around 2 TB) from the Turkish time and roughly one million objects have been identified from the reduced data. A robust pipeline has been constructed to discover new variables, transients and planetary nebulae from this archival data. In the detection process, different statistical methods were applied to the archive. We have detected thousands of variable stars by applying roughly four different tests to light curve of each star. In this work a summary of the pipeline is presented. It uses a high performance computing (HPC) algorithm which performs inhomogeneous ensemble photometry of the data on a 36 core cluster. This study is supported by TUBITAK (Scientific and Technological Research Council of Turkey) with the grant number TBAG-108T475.

  13. Comparative analysis of greenhouse gas emissions between scenarios - Contribution of the Experts Group - National Debate on Energy Transition

    International Nuclear Information System (INIS)

    Salomon, Thierry

    2013-01-01

    Within the frame of the French national debate on energy transition, this document briefly presents and comments calculations of greenhouse gas emissions according to 11 scenarios associated with 4 pathways: electrification and de-carbonation (NegaTEP), steady demand and diversification (Ancre DIV), efficiency and diversification (Ademe), and energy saving and phasing out nuclear (Negawatt). These pathways and scenarios are analysed in terms of greenhouse gas emissions and with respect to the objective of a factor-4 reduction by 2050. Emission data for 1990 and 2011 are recalled, as well as France commitments. The author outlines that only four scenarios reach this factor-4 objective as far as CO 2 combustion is concerned, that a factor 2 seems to be possible for some specific sectors (agriculture and wastes). He notices significant decreases in industrial processes since 1990, that only 2 scenarios and 2 pathways reach the factor-4 as far as all greenhouse gases are concerned. When taking energy demand into account, no scenario is able to reach the factor-4 without any strong policy of energy saving. Two conditions are therefore identified to reach this factor: a significant decrease of energy demand, and an action on all emission sources

  14. SWRO feed water quality improvement using subsurface intakes in Oman, Spain, Turks and Caicos Islands, and Saudi Arabia

    KAUST Repository

    Rachman, Rinaldi

    2014-10-01

    Water quality sampling and analysis conducted at four global locations, along the shorelines of the Arabian Sea, the Red Sea, the Mediterranean Sea, and the Caribbean Sea, demonstrated that subsurface intakes (wells) provide a robust degree of feed water treatment close to that provided by energy-intensive, conventional pretreatment systems. SDI values were reduced in virtually all cases to below 3. In vertical wells, from 70 to 100% of the TEP and 50% of the TOC and DOC found in natural seawater were removed in the aquifer. Reduction in the concentration of the organic fractions was selective based on molecular weight with the biopolymers nearly fully removed. Humic substances, building blocks, and light organic substances were removed at lesser percentages. Site geology was not the predominant factor affecting the removal efficiency, but the length of the flow path from the sea to the wells and the hydraulic retention time appear to be most significant. A comparison between vertical wells, a tunnel intake system, and a horizontal drain system at Alicante, Spain, demonstrated that the vertical wells performed best followed by the tunnel system, and the horizontal drain system which showed a breakthrough of algae and a very high organic carbon concentration. © 2014 Elsevier B.V.

  15. Tritium research activities in Korea

    Energy Technology Data Exchange (ETDEWEB)

    Jung, Ki Jung, E-mail: kjjung@nfri.re.kr [National Fusion Research Institute, Yusung-gu, Daejeon 305-333 (Korea, Republic of); Yun, Sei-Hun, E-mail: shyun@nfri.re.kr [National Fusion Research Institute, Yusung-gu, Daejeon 305-333 (Korea, Republic of); Chang, Min Ho; Kang, Hyun-Goo; Chung, Dongyou; Cho, Seungyon; Lee, Hyeon Gon [National Fusion Research Institute, Yusung-gu, Daejeon 305-333 (Korea, Republic of); Chung, Hongsuk; Choi, Woo-Seok [Korea Atomic Energy Research Institute, Yusung-gu, Daejeon 305-353 (Korea, Republic of); Song, Kyu-Min; Moon, Chang-Bae [Korea Hydro & Nuclear Power Central Research Institute, Yusung-gu, Daejeon 305-343 (Korea, Republic of); Lee, Euy Soo [Dongguk University, Jung-gu, Seoul, 100-715 (Korea, Republic of); Cho, Jungho; Kim, Dong-Sun [Kongju National University, Cheonan, Chungnam, 330-717 (Korea, Republic of); Moon, Hung-Man [Daesung Industrial Gases Co., Ltd., Danwon-gu, Ansan-si, Gyeonggi-do, 425-090 (Korea, Republic of); Noh, Seung Jeong [Dankook University, Suji-gu, Yongin-si, Gyeonggi-do, 448-701 (Korea, Republic of); Ju, Hyunchul [Inha University, Nam-gu, Incheon, 402-751 (Korea, Republic of); Hong, Tae-Whan [Korea National University of Transportation, Chungju, Chungbuk, 380-702 (Korea, Republic of)

    2016-12-15

    Highlights: • NFRI, KAERI and KHNP CRI are major leading group for the ITER tritium SDS design; studying engineering, simulation of hydride bed, risk analysis (on safety, HAZOP), basic study, control logic & sequential operation, and others. KHNP has WTRF which gives favorable experiences for collaboration researchers. • Supplementary research partners: Five Universities (Dongguk University and POSTECH, Inha University, Dankook University, Korea National Transport University, and Kongju National University) and one industrial company (Daesung Industrial Gases Co., Ltd.); studying on basic and engineering, programming & simulation on the various topics for ITER tritium SDS, TEP, ISS, ADS, and etc. - Abstract: Major progress in tritium research in the Republic of Korea began when Korea became responsible for ITER tritium Storage and Delivery System (SDS) procurement package which is part of the ITER Fuel Cycle. To deliver the tritium SDS package, a variety of research institutes, universities and industry have respectively taken roles and responsibilities in developing technologies that have led to significant progress. This paper presents the current work and status of tritium related technological research and development (R&D) in Korea and introduces future R&D plans in the area of fuel cycle systems for fusion power generation.

  16. Capillary Electrophoresis as Analysis Technique for Battery Electrolytes: (i Monitoring Stability of Anions in Ionic Liquids and (ii Determination of Organophosphate-Based Decomposition Products in LiPF6-Based Lithium Ion Battery Electrolytes

    Directory of Open Access Journals (Sweden)

    Marcelina Pyschik

    2017-09-01

    Full Text Available In this work, a method for capillary electrophoresis (CE hyphenated to a high-resolution mass spectrometer was presented for monitoring the stability of anions in ionic liquids (ILs and in commonly used lithium ion battery (LIB electrolytes. The investigated ILs were 1-methyl-1-propylpyrrolidinium bis(trifluoromethanesulfonylimide (PYR13TFSI and 1-methyl-1-propylpyrrolidinium bis(fluorosulfonylimide (PYR13FSI. The method development was conducted by adjusting the following parameters: buffer compositions, buffer concentrations, and the pH value. Also the temperature and the voltage applied on the capillary were optimized. The ILs were aged at room temperature and at 60 °C for 16 months each. At both temperatures, no anionic decomposition products of the FSI− and TFSI− anions were detected. Accordingly, the FSI− and TFSI− anions were thermally stable at these conditions. This method was also applied for the investigation of LIB electrolyte samples, which were aged at 60 °C for one month. The LP30 (50/50 wt. % dimethyl carbonate/ethylene carbonate and 1 M lithium hexafluorophosphate electrolyte was mixed with the additive 1,3-propane sultone (PS and with one of the following organophosphates (OP: dimethyl phosphate (DMP, diethyl phosphate (DEP, and triethyl phosphate (TEP, to investigate the influence of these compounds on the formation of OPs.

  17. Carbon dioxide in electricity delivered to Swiss end-users. Final report; CO{sub 2}-Intensitaet des Stromabsatzes an Schweizer Endkunden. Schlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Jakob, M.; Volkart, K.; Widmer, D

    2009-07-15

    In this comprehensive final report, made by TEP Energy GmbH - Technology Economics Policy - Research and Advice - a spin-off company of ETH Zuerich for the Swiss gas and oil industries, the effective CO{sub 2} intensities involved in Swiss electricity consumption are calculated and discussed. The authors present details on how CO{sub 2} emissions should be calculated on the basis of figures both on Swiss power generation and, also, on electricity imports and exports in a European context. Daily and seasonal export-import balances are discussed. In particular the authors note that the actual production-mix for electricity in Switzerland should not be used as a basis for judging actual consumption. Three methods for viewing Swiss electricity consumption involving net and gross power export and import are introduced and discussed. The determination of the CO{sub 2} intensity of Swiss power is discussed, as are power demand profiles and international agreements. The results obtained using the three methods used are presented and discussed. Future developments are also examined. The report is completed with an appendix.

  18. Advanced LWIR hyperspectral sensor for on-the-move proximal detection of liquid/solid contaminants on surfaces

    Science.gov (United States)

    Giblin, Jay P.; Dixon, John; Dupuis, Julia R.; Cosofret, Bogdan R.; Marinelli, William J.

    2017-05-01

    Sensor technologies capable of detecting low vapor pressure liquid surface contaminants, as well as solids, in a noncontact fashion while on-the-move continues to be an important need for the U.S. Army. In this paper, we discuss the development of a long-wave infrared (LWIR, 8-10.5 μm) spatial heterodyne spectrometer coupled with an LWIR illuminator and an automated detection algorithm for detection of surface contaminants from a moving vehicle. The system is designed to detect surface contaminants by repetitively collecting LWIR reflectance spectra of the ground. Detection and identification of surface contaminants is based on spectral correlation of the measured LWIR ground reflectance spectra with high fidelity library spectra and the system's cumulative binary detection response from the sampled ground. We present the concepts of the detection algorithm through a discussion of the system signal model. In addition, we present reflectance spectra of surfaces contaminated with a liquid CWA simulant, triethyl phosphate (TEP), and a solid simulant, acetaminophen acquired while the sensor was stationary and on-the-move. Surfaces included CARC painted steel, asphalt, concrete, and sand. The data collected was analyzed to determine the probability of detecting 800 μm diameter contaminant particles at a 0.5 g/m2 areal density with the SHSCAD traversing a surface.

  19. Energy balance from Parana State: 1980-1993; Balanco energetico do Parana: 1980-1993

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-12-31

    This energetic balance from the Parana State, Brazil, includes the data referent to the year of 1993. It aims to be a planning tool to the public sector embraced to the energetic question and to orient productive investments to the private sector. It also shows the energetic information during the period of 1980-1993, presenting energetic streams of energetic primary and secondary sources, since its production to the final consumption, according to the main sectors of the economy in the Parana State. The balance is divided in seven chapters, as follows: resume - a synthetic analysis of the energetic sector evolution during the last 14 years and the consolidated data about production, consumption, etc concerning to 1993; energetic supply and demand; energetic interchange transformation centers; another energetic information; energy and socio economy; consolidated energetic balances; and annex - balance structure, information treatment, units, conversion table to medium tEP and specific masses and higher calorific capacities 5 figs., 7 graphs, 1 map, 92 tabs.

  20. Impacto de la envolvente en la demanda de energía en calefacción residencial de la región metropolitana de La Plata, tomando como caso testigo el reciclado energético de una vivienda

    Directory of Open Access Journals (Sweden)

    María de la Paz Diulio

    Full Text Available Resumen El área metropolitana de La Plata representa el 1,6% de las viviendas de la Argentina. A partir del análisis del reciclado de una vivienda se construyen indicadores básicos con el fin de proponer una metodología que facilite la extrapolación, a nivel regional, del impacto que causaría un programa de eficiencia energética en viviendas. Se exponen desde el nivel micro a macro los resultados obtenidos en un contexto de carestía energética y recurrentes crisis en la oferta de combustibles y electricidad en la Argentina. La mejora en la resistencia térmica de muros y techos en todo el parque residencial de La Plata conllevaría a una reducción del 12% de la energía consumida en calefacción, y un ahorro de 30.000 TEP/año. Se concluye que la incidencia que implica la colocación de aislación adicional respecto del costo de la construcción justifica su uso, resolviendo parcialmente la falta de combustibles en el país, reduciendo gastos fijos en la vivienda, otorgando confort térmico a los usuarios y generando reactivación del sector de la construcción.

  1. Joint Planning Of Energy Storage and Transmission Considering Wind-Storage Combined System and Demand Side Response

    Science.gov (United States)

    Huang, Y.; Liu, B. Z.; Wang, K. Y.; Ai, X.

    2017-12-01

    In response to the new requirements of the operation mode of wind-storage combined system and demand side response for transmission network planning, this paper presents a joint planning of energy storage and transmission considering wind-storage combined system and demand side response. Firstly, the charge-discharge strategy of energy storage system equipped at the outlet of wind farm and demand side response strategy are analysed to achieve the best comprehensive benefits through the coordination of the two. Secondly, in the general transmission network planning model with wind power, both energy storage cost and demand side response cost are added to the objective function. Not only energy storage operation constraints and but also demand side response constraints are introduced into the constraint condition. Based on the classical formulation of TEP, a new formulation is developed considering the simultaneous addition of the charge-discharge strategy of energy storage system equipped at the outlet of the wind farm and demand side response strategy, which belongs to a typical mixed integer linear programming model that can be solved by mature optimization software. The case study based on the Garver-6 bus system shows that the validity of the proposed model is verified by comparison with general transmission network planning model. Furthermore, the results demonstrate that the joint planning model can gain more economic benefits through setting up different cases.

  2. Possible development of nuclear energy in the European Community and consequences of different reactor strategies

    International Nuclear Information System (INIS)

    Decressin, A.; Haytinck, B.; Orlowski, S.

    1974-01-01

    The Commission of the European Communities recommended to stimulate the development of the nuclear energy, in order to ensure in the middle or long term, a diversification of the energy supply sources of the Community. According to such a policy, nuclear energy could cover nearly 80% of the Community needs in electrical power in the year 2000 - these being estimated at 50% of total energy needs of the Community - and correspond to 1,3 billion tep for that year alone. In the year 2000, the installed nuclear capacity in the Community (i.e. nearly 1000 GWe) would imply the consumption of roughly 150.000 metric tons of natural uranium and necessitate 90.000 tons of SWU in enrichment services, whatever ''average'' strategy is considered for the period 1980 - 2000. The choices between these various strategies made by public or industrial decision centers, will be the result of a complex assessment of many factors. In any case, the flow of nuclear material between countries will remain very important and a Community nuclear self sufficiency based on breeding is not conceivable before the time at which new energy sources could be brought in effective uses

  3. Partitioning and distribution of dissolved copper, cadmium and organic matter in Mediterranean marine coastal areas: The case of a mucilage event

    Science.gov (United States)

    Scoullos, Michael; Plavšić, Marta; Karavoltsos, Sotiris; Sakellari, Aikaterini

    2006-04-01

    Dissolved copper and cadmium partitioning and their interaction with organic matter were investigated in shallow coastal areas of the Aegean Sea (Eastern Mediterranean). The percentage of DGT-labile copper as for total dissolved copper ranged from 13 to 34% during summer and from 23 to 36% during winter, whereas the corresponding percentage for DGT-labile cadmium was higher in summer (38-68%), in comparison to winter (29-44%). The CCu was found to be 100-260 nM during summer while in winter the range was 42-430 nM. The corresponding CCd reached 27 and 45 nM, respectively. The mean TEP value in summer was high (208 μg/L xanthan equiv.), while in winter it reached 441 μg/L xanthan equiv., which indicates significant phytoplankton activity in winter, a feature occasionally observed in the stratified study areas after the breaking down of the thermocline/pycnocline, followed by consequent nutrient enrichment of the surface layers by nutrients accumulated in the sea bottom. A significant fraction of dissolved organic carbon (DOC) exhibited surface active properties and was determined as surface active substances (SAS) in mg/L eq. of nonionic surfactant Triton-X-100. Carbohydrates were also determined and they represented up to 33% of the DOC.

  4. MVP and vaults: a role in the radiation response

    International Nuclear Information System (INIS)

    Lara, Pedro C; Pruschy, Martin; Zimmermann, Martina; Henríquez-Hernández, Luis Alberto

    2011-01-01

    Vaults are evolutionary highly conserved ribonucleoproteins particles with a hollow barrel-like structure. The main component of vaults represents the 110 kDa major vault protein (MVP), whereas two minor vaults proteins comprise the 193 kDa vault poly(ADP-ribose) polymerase (vPARP) and the 240 kDa telomerase-associated protein-1 (TEP-1). Additionally, at least one small and untranslated RNA is found as a constitutive component. MVP seems to play an important role in the development of multidrug resistance. This particle has also been implicated in the regulation of several cellular processes including transport mechanisms, signal transmission and immune responses. Vaults are considered a prognostic marker for different cancer types. The level of MVP expression predicts the clinical outcome after chemotherapy in different tumour types. Recently, new roles have been assigned to MVP and vaults including the association with the insulin-like growth factor-1, hypoxia-inducible factor-1alpha, and the two major DNA double-strand break repair machineries: non-homologous endjoining and homologous recombination. Furthermore, MVP has been proposed as a useful prognostic factor associated with radiotherapy resistance. Here, we review these novel actions of vaults and discuss a putative role of MVP and vaults in the response to radiotherapy

  5. Physicochemical characteristics and sorption capacities of heavy metal ions of activated carbons derived by activation with different alkyl phosphate triesters

    Science.gov (United States)

    Wang, Jing; Liu, Hai; Yang, Shaokun; Zhang, Jian; Zhang, Chenglu; Wu, Haiming

    2014-10-01

    Five alkyl phosphate triesters (APTEs), including trimethyl phosphate (TMP), triethyl phosphate (TEP), triisopropyl phosphate (TPP), tributyl phosphate (TBP) and trioctyl phosphate (TOP), were used as activating agents for preparing activated carbons (AC-APTEs) with high surface acidity and metal ion sorption capacity. N2 adsorption/desorption isotherms, surface morphologies, elemental compositions, results of Boehm's titration and sorption capacities of heavy metal ions of the carbons were investigated. AC-APTEs contained much more acidic groups and exhibited much less surface area (phosphoric acid activation. For the AC-APTEs, AC-TOP had the highest surface area (488 m2/g), AC-TMP showed the highest yield (41.1%), and AC-TBP possessed the highest acidic groups (2.695 mmol/g), oxygen content (47.0%) and metal ion sorption capacities (40.1 mg/g for Ni(II) and 53.5 mg/g for Cd(II)). For the carbons, AC-APTEs showed much larger Ni(II) and Cd(II) sorption capacities than AC-PPA, except AC-TPP. The differences of the carbons in the physicochemical and sorption properties suggested surface chemistry of the carbons was the main factor influencing their sorption capacities whereas the pore structure played a secondary role.

  6. Correlation Among Students’ Family Background, Academic Performance in Junior High School, and Senior High School Tracking in Taiwan

    Directory of Open Access Journals (Sweden)

    Ming-Fu Huang

    2014-12-01

    Full Text Available There were numerous previous studies on educational tracking. However, most of the data adopted in these studies were collected a decade ago, involving sample population 20-64 years of age. Among them, many elderly samples had undergone senior high school tracking in the early years. The present study used the data of students and parents from the 3rd wave (2005 of the Taiwan Education Panel Survey (TEPS. A path analysis was conducted to investigate the inequality of opportunities involved in the influence of student family background on educational tracking at the senior high school stage. The results show: although the overall percentage of junior high school graduates entering advanced levels was approximately 100% and almost all students of different family backgrounds entered advanced levels, the most crucial factor among those affecting educational tracking of senior high school stage was students’ academic performance during junior high school. Students with higher family socioeconomic status and fewer siblings showed better academic performance in junior high schools, and consequently had higher possibilities of entering public senior high schools leading to a more promising future. This indicates that though the inequality in the quantity of opportunities approached 0, the inequality in the quality of opportunities still remained, which fails to support the hypothesis of the maximally maintained inequality of educational opportunity (MMI; however, the result supports the hypothesis of the effectively maintained inequality of educational opportunity (EMI.

  7. Growth and characterization of tin disulfide (SnS2) thin film deposited by successive ionic layer adsorption and reaction (SILAR) technique

    International Nuclear Information System (INIS)

    Deshpande, N.G.; Sagade, A.A.; Gudage, Y.G.; Lokhande, C.D.; Sharma, Ramphal

    2007-01-01

    Thin films of tin disulfide (SnS 2 ) have been deposited by using low cost successive ionic layer adsorption and reaction (SILAR) technique. The deposition parameters such as SILAR cycles (60), immersion time (20 s), rinsing time (10 s) and deposition temperature (27 o C) were optimized to obtain good quality of films. Physical investigations were made to study the structural, optical and electrical properties. X-ray diffraction (XRD) patterns reveal that the deposited SnS 2 thin films have hexagonal crystal structure. Energy dispersive X-ray analysis (EDAX) indicated elemental ratio close to those for tin disulfide (SnS (2.02) ). Uniform deposition of the material over the entire glass substrate was revealed by scanning electron microscopy (SEM). Atomic force microscopy (AFM) showed the film is uniform and the substrate surface is well covered with small spherical grains merged in each other. A direct band gap of 2.22 eV was obtained. Photoluminescence (PL) showed two strong peaks corresponding to green and red emission. Ag/SnS 2 junction showed Schottky diode like I-V characteristics. The barrier height calculated was 0.22 eV. Thermoelectric power (TEP) properties showed that tin disulfide exhibits n-type conductivity

  8. MVP and vaults: a role in the radiation response

    Directory of Open Access Journals (Sweden)

    Zimmermann Martina

    2011-10-01

    Full Text Available Abstract Vaults are evolutionary highly conserved ribonucleoproteins particles with a hollow barrel-like structure. The main component of vaults represents the 110 kDa major vault protein (MVP, whereas two minor vaults proteins comprise the 193 kDa vault poly(ADP-ribose polymerase (vPARP and the 240 kDa telomerase-associated protein-1 (TEP-1. Additionally, at least one small and untranslated RNA is found as a constitutive component. MVP seems to play an important role in the development of multidrug resistance. This particle has also been implicated in the regulation of several cellular processes including transport mechanisms, signal transmission and immune responses. Vaults are considered a prognostic marker for different cancer types. The level of MVP expression predicts the clinical outcome after chemotherapy in different tumour types. Recently, new roles have been assigned to MVP and vaults including the association with the insulin-like growth factor-1, hypoxia-inducible factor-1alpha, and the two major DNA double-strand break repair machineries: non-homologous endjoining and homologous recombination. Furthermore, MVP has been proposed as a useful prognostic factor associated with radiotherapy resistance. Here, we review these novel actions of vaults and discuss a putative role of MVP and vaults in the response to radiotherapy.

  9. Analysis of MVP and VPARP promoters indicates a role for chromatin remodeling in the regulation of MVP.

    Science.gov (United States)

    Emre, Nil; Raval-Fernandes, Sujna; Kickhoefer, Valerie A; Rome, Leonard H

    2004-04-16

    Multi-drug-resistant cancer cells frequently express elevated levels of ribonucleoprotein complexes termed vaults. The increased expression of vault proteins and their mRNAs has led to the suggestion that vaults may play a direct role in preventing drug toxicity. To further understand vault component up-regulation, the three proteins that comprise the vault, the major vault protein (MVP), vault poly(ADP-ribose) polymerase (VPARP), and telomerase-associated protein-1 (TEP1), were examined with respect to gene amplification and drug-induced chromatin remodeling. Gene amplification was not responsible for increased vault component levels in multi-drug-resistant cancer cell lines. The TATA-less murine MVP and human VPARP promoters were identified and functionally characterized. There was no significant activation of either the MVP or VPARP promoters in drug-resistant cell lines in comparison to their parental, drug-sensitive counterparts. Treatment of various cell lines with sodium butyrate, an inhibitor of histone deacetylase (HDAC), led to an increase in vault component protein levels. Furthermore, treatment with trichostatin A (TSA), a more specific inhibitor of HDAC, caused an increase in MVP protein, mRNA, and promoter activity. These results suggest that up-regulation of MVP in multi-drug resistance (MDR) may involve chromatin remodeling.

  10. MVP and vaults: a role in the radiation response.

    Science.gov (United States)

    Lara, Pedro C; Pruschy, Martin; Zimmermann, Martina; Henríquez-Hernández, Luis Alberto

    2011-10-31

    Vaults are evolutionary highly conserved ribonucleoproteins particles with a hollow barrel-like structure. The main component of vaults represents the 110 kDa major vault protein (MVP), whereas two minor vaults proteins comprise the 193 kDa vault poly(ADP-ribose) polymerase (vPARP) and the 240 kDa telomerase-associated protein-1 (TEP-1). Additionally, at least one small and untranslated RNA is found as a constitutive component. MVP seems to play an important role in the development of multidrug resistance. This particle has also been implicated in the regulation of several cellular processes including transport mechanisms, signal transmission and immune responses. Vaults are considered a prognostic marker for different cancer types. The level of MVP expression predicts the clinical outcome after chemotherapy in different tumour types. Recently, new roles have been assigned to MVP and vaults including the association with the insulin-like growth factor-1, hypoxia-inducible factor-1alpha, and the two major DNA double-strand break repair machineries: non-homologous endjoining and homologous recombination. Furthermore, MVP has been proposed as a useful prognostic factor associated with radiotherapy resistance. Here, we review these novel actions of vaults and discuss a putative role of MVP and vaults in the response to radiotherapy.

  11. An atlas of L-T transition brown dwarfs with VLT/XShooter

    Science.gov (United States)

    Marocco, F.; Day-Jones, A. C.; Jones, H. R. A.; Pinfield, D. J.

    In this contribution we present the first results from a large observing campaign we are carrying out using VLT/Xshooter to obtain spectra of a large sample (˜250 objects) of L-T transition brown dwarfs. Here we report the results based on the first ˜120 spectra already obtained. The large sample, and the wide spectral coverage (300-2480 nm) given by Xshooter, will allow us to do a new powerful analysis, at an unprecedent level. By fitting the absorption lines of a given element (e.g. Na) at different wavelengths we can test ultracool atmospheric models and draw for the first time a 3D picture of stellar atmospheres at temperatures down to 1000K. Determining the atmospheric parameters (e.g. temperature, surface gravity and metallicity) of a big sample of brown dwarfs, will allow us to understand the role of these parameters on the formation of their spectra. The large number of objects in our sample also will allow us to do a statistical significant test of the birth rate and initial mass function predictions for brown dwarfs. Determining the shape of the initial mass function for very low mass objects is a fundamental task to improve galaxy models, as recent studies tep{2010Natur.468..940V} have shown that low-mass objects dominate in massive elliptical galaxies.

  12. MF/UF rejection and fouling potential of algal organic matter from bloom-forming marine and freshwater algae

    KAUST Repository

    Villacorte, Loreen O.

    2015-07-01

    Pretreatment with microfiltration (MF) or ultrafiltration (UF) membranes has been proposed for seawater reverse osmosis (SWRO) plants to address operational issues associated with algal blooms. Here, we investigated the MF/UF rejection and fouling potential of algal organic matter (AOM) released by common species of bloom-forming marine (Alexandrium tamarense and Chaetoceros affinis) and freshwater (Microcystis sp.) algae. Batch culture monitoring of the three algal species illustrated varying growth pattern, cell concentration, AOM released and membrane fouling potential. The high membrane fouling potential of the cultures can be directly associated (R2>0.85) with AOM such as transparent exopolymer particle (TEP) while no apparent relationship with algal cell concentration was observed. The AOM comprised mainly biopolymers (e.g., polysaccharides and proteins) and low molecular weight organic compounds (e.g., humic-like substances). The former were largely rejected by MF/UF membranes while the latter were poorly rejected. MF (0.4μm and 0.1μm pore size) rejected 14%-56% of biopolymers while conventional UF (100kDa) and tight UF (10kDa) rejected up to 83% and 97%, respectively. The retention of AOM resulted in a rapid increase in trans-membrane pressure (δP) over time, characterised by pore blocking followed by cake filtration with enhanced compression as illustrated by an exponential progression of δP. © 2015 Elsevier B.V.

  13. [Cardiac sarcoidosis: Diagnosis and therapeutic challenges].

    Science.gov (United States)

    Cohen Aubart, F; Nunes, H; Mathian, A; Haroche, J; Hié, M; Le-Thi Huong Boutin, D; Cluzel, P; Soussan, M; Waintraub, X; Fouret, P; Valeyre, D; Amoura, Z

    2017-01-01

    Sarcoidosis is a granulomatous disorder of unknown cause characterized by non-caseating granuloma in young adults. Cardiac involvement is rare and range from 2 to 75% depending on diagnostic criteria. Cardiac involvement in sarcoidosis may be asymptomatic or may manifest as rhythm/conduction troubles or congestive heart failure. The diagnosis and treatment of cardiac sarcoidosis may be challenging. However, advances have come in recent years from the use of cardiac MRI and 18 FDG-TEP scanner, as well as from the stratification of the risk of ventricular tachycardia/fibrillation. Due to the rarity of the disease, there is no reliable prospective large study to guide therapeutic strategy for cardiac sarcoidosis. Corticosteroids are probably efficacious, in particular in case of atrio-ventricular block or moderate heart failure. Immunosuppressive drugs have not been largely studied but methotrexate could be helpful. In refractory forms, TNF-α antagonists have been used with success. Copyright © 2016 Société Nationale Française de Médecine Interne (SNFMI). Published by Elsevier SAS. All rights reserved.

  14. Synthesis and characterization of cadmium hydroxide nano-nest by chemical route

    International Nuclear Information System (INIS)

    Salunkhe, R.R.; Patil, U.M.; Gujar, T.P.; Lokhande, C.D.

    2009-01-01

    A facile chemical route based on room temperature chemical bath deposition (CBD) was developed to deposit the Cd(OH) 2 nano-nest. The growth mechanism follows two-stage crystallization with initial growth of nucleation centers, followed by subsequent anisotropic growth. The nano-nest morphological evolution of Cd(OH) 2 on different substrates has been carried out. These films have been characterized by the techniques; such as X-ray diffraction (XRD), scanning electron microscope (SEM), transmission electron microscope (TEM), optical absorption, contact angle measurement and thermoelectric power (TEP) measurements. The X-ray diffraction study revealed that the as deposited film consists of cadmium hydroxide (Cd(OH) 2 ) phase. The nano-nest consisted of wires with nearly uniform in dimensions, with diameter around 30 nm and length of few microns. As-deposited Cd(OH) 2 film used in this study showed water contact angle of 66 o . The optical bandgap was found to be 3.2 eV, with n-type electrical conductivity as confirmed from thermo-emf measurements.

  15. Positron emission tomography with 18 F-FDG and ovarian cancer

    International Nuclear Information System (INIS)

    Corone, C.; Sarandi, F.; Gutman, F.; Collignon, M.A.; Wartski, M.; Alberini, J.L.; Pecking, A.P.

    2004-01-01

    Ovarian carcinoma is the most frequent gynecologic cancer and its prognosis is severe, despite chemo sensibility, with a global 5 years survival around 50 %. This poor prognosis is related to initial extend of the disease as well as to high frequency of residual disease after initial treatment and recurrences. In those situations, efficacy of conventional imaging is usually low and FDG PET can be useful. French national cancer centres federation guidelines for clinical practice (SORs) recommend FDG TEP as a B2 proof level option when recurrence or metastasis is suspected. FDG PET seems also useful, in limited series, to improve initial staging and might be an alternative to second look laparoscopy residual disease evaluation. Because microscopic disease might be not detected, predictive positive value of FDG PET should be considered more reliable than its negative predictive value. In this carcinoma, due to the proximity of intestinal and urinary tract potential artefacts and because precise disease location is of high prognosis and therapeutic value, PET - CT technology seems of particular interest. (author)

  16. Iodine-123 and bromine-75 production and development program at Juelich

    International Nuclear Information System (INIS)

    Stoecklin, G.

    1985-01-01

    The iodine-123 and bromine-75 production and development program at the Nuclear Research Center in Juelich as of 1982 is described, and examples of recent 123 I- and 75 Br-analogue tracers that have been developed to the level of clinical trial are given. Iodine-123 is produced via the 127 I(d,6n) 123 Xe → 123 I process and by the 124 Te(p,2n) 123 I and 122 Te(d,n) 123 I reactions. These production methods are critically reviewed. Bromine-75-labeled benzodiazenes have been prepared for in vivo mapping of benzodiazepine receptor sites. The 7-( 75 Br)-5-(2-fluorophenyl)-1-methyl-1,3-dihydro-2H-1,4-benzodiazepine-2-one (BFB) was prepared with a specific activity of > 10 4 Ci/mmole. Finally, preparation and applications of the halogenated amino acid L-3-( 123 I)-iodo-α-methyltyrosine (IMT) and the analogous 75 Br compound (BMT) are reported. Both IMT and BMT have been successfully applied for pancreas imaging and tomography, and IMT has been used for imaging both melanotic and amelanotic malignant melanoma of the eye

  17. Dispersive Liquid-Liquid Microextraction Combined with Ultrahigh Performance Liquid Chromatography/Tandem Mass Spectrometry for Determination of Organophosphate Esters in Aqueous Samples

    Directory of Open Access Journals (Sweden)

    Haiying Luo

    2014-01-01

    Full Text Available A new technique was established to identify eight organophosphate esters (OPEs in this work. It utilised dispersive liquid-liquid microextraction in combination with ultrahigh performance liquid chromatography/tandem mass spectrometry. The type and volume of extraction solvents, dispersion agent, and amount of NaCl were optimized. The target analytes were detected in the range of 1.0–200 µg/L with correlation coefficients ranging from 0.9982 to 0.9998, and the detection limits of the analytes were ranged from 0.02 to 0.07 µg/L (S/N=3. The feasibility of this method was demonstrated by identifying OPEs in aqueous samples that exhibited spiked recoveries, which ranged between 48.7% and 58.3% for triethyl phosphate (TEP as well as between 85.9% and 113% for the other OPEs. The precision was ranged from 3.2% to 9.3% (n=6, and the interprecision was ranged from 2.6% to 12.3% (n=5. Only 2 of the 12 selected samples were tested to be positive for OPEs, and the total concentrations of OPEs in them were 1.1 and 1.6 µg/L, respectively. This method was confirmed to be simple, fast, and accurate for identifying OPEs in aqueous samples.

  18. Landfill gas management: View from Italy

    Energy Technology Data Exchange (ETDEWEB)

    De Poli, F.; Pasqualini, S. [ENEA, Casaccia (Italy). Area Energia Ambiente e Salute

    1993-03-01

    Landfilling is the most widely used waste disposal system in Italy. More than 85% of the total refuse produced is landfilled, as the other ways still have many problems. People do not easily accept landfilling, and many regions of the country have very difficult problems in identifying new sites. At any rate, landfills are more accepted than other systems, such as incinerators. In accordance with present legislation, all landfill sites must have a biogas extraction system; only the smaller plants are allowed to avoid gas removal. For this reason, many extraction plants were built in the last few years about 10 in 1987, 25 in 1988, more 40 in 1989. A partial census the existing extraction plants showed the existence, in January, 1990, of 45 systems producing over 750,000 cubic meters of biogas (over 400 tep) per day. The plants were mainly built by two firms that have made 91% of the existing systems (93% of the daily gas yield). Anaerobic digestion of garbage in reactors was tried in the Bellaria plant, in which the organic fraction is mixed with sewage sludges in a CSTR reactor; the results were interesting from the technical point of view, but very poor as regards economics. A dry digestion plant is planned for the future.

  19. TOTAL HIP ARTHROPLASTY IN OSTEOPETROSIS – REPORT OF A CASE

    Directory of Open Access Journals (Sweden)

    Zmago Krajnc

    2004-04-01

    Full Text Available Background. Authors introduced a case of a 27-year men with osteopetrosis with hip arthrosis. He has an autosomal – dominant form of disease and he needed total hip arthroplasty. There are seven cases described in literature with developed hip arthrosis by osteopetrosis.Methods. TEP implantation represents the greates surgical challenge in this patients, especially creation of intramedullary canal in femur and implantation of the femoral stem because of the very dense and brittle bones. This article describes the operative technique used in the case involved. It proved to be a very good solution.Results. The patient was released from the hospital ten days after implantation of total hip endoprosthesis. Three months after the operation the patient started to walk without aid of canes, he had non pain, and his range of motion was almost normal.Conclusions. Severe coxarthrosis is a rare complication of osteopetrosis. Great care must be taken with implantation of total hip endoprosthesis, especially with preparation of medular canal. It was recommended hand drilling under x-rays to exercise maximal control because reaming can cause false root of stem and greater probability of fracture.

  20. Irregular ionization and scintillation of the ionosphere in equator region

    International Nuclear Information System (INIS)

    Shinno, Kenji

    1974-01-01

    The latest studies on the scintillation in satellite communication and its related irregularities of ionosphere are reviewed. They were made clear by means of spread-F, the direct measurement with scientific satellites, VHF radar observation, and radio wave propagation in equator region. The fundamental occurrence mechanism may be instability of plasma caused by the interaction of movement of neutral atmosphere and magnetic field. Comparison of the main characteristics of scintillation, namely the dependence on region, solar activity, season, local time, geomagnetic activity, movement in ionosphere, scattering source, frequency and transmission mode, was made and the correlation among spread-F, TEP and scintillation was summarized. The latest principal studies were the observations made by Intelsat and by ATS. Scintillation of Syncom-3 and Intelsat-II-F2 and spread-F by ionosphere observation were compared by Huang. It is reasonable to consider that the occurrence of scintillation is caused by the irregularities in ionosphere which are particular in equator region, because of the similar characteristics of spread-F and VHF propagation in the equator region. These three phenomena may occur in relation to the irregularities of ionosphere. Interpretation of spread-F and the abnormal propagation wave across the equator are given. The study using VHF radar and the movement of irregular ionization by the direct observation with artificial satellites are reviewd. (Iwakiri, K.)