WorldWideScience

Sample records for t1-2 n1-2 m0

  1. A new series of oxycarbonate superconductors (Cu{sub 0.5}C{sub 0.5}){sub m}Ba{sub m+1}Ca{sub n-1}Cu{sub n}O{sub 2}({sub m+n})+1

    Energy Technology Data Exchange (ETDEWEB)

    Takayama-Muromachi, E.; Kawashima, T.; Matsui, Y. [National Institute for Research in Inorganic Materials, Ibaraki (Japan)

    1994-12-31

    We found a new series of oxycarbonate superconductors in the Ba-Ca-Cu-C-O system under high pressure of 5 GPa. Their ideal formula is (Cu{sub 0.5}C{sub 0.5}){sub m}Ba{sub m+1}Ca{sub n-1}Cu{sub n}O{sub 2}({sub m+n})+1 ((Cu,C)-m(m+1)(n-1)n). Thus far, n=3, 4 members of the m=1 series, (Cu,C)-1223 and (Cu,C)-1234, have been prepared in bulk while n=4, 5 members, (Cu,C)-2334 and (Cu,C)-2345, have been prepared for the m=2 series. (Cu,C)-1223 shows superconductivity below 67 K while T{sub c}`s of other compounds are above 110 K. In particular, (Cu,C)=1234 has the highest T{sub c} of 117 K.

  2. Benefit of adjuvant chemotherapy after resection of stage II (T1-2N1M0) non-small cell lung cancer in elderly patients.

    Science.gov (United States)

    Berry, Mark F; Coleman, Brooke K; Curtis, Lesley H; Worni, Mathias; D'Amico, Thomas A; Akushevich, Igor

    2015-02-01

    We evaluated the use and efficacy of adjuvant chemotherapy after resection of T1-2N1M0 non-small cell lung cancer (NSCLC) in elderly patients. Factors associated with the use of adjuvant chemotherapy in patients older than 65 years of age who underwent surgical resection of T1-2N1M0 NSCLC without induction chemotherapy or radiation in the Surveillance, Epidemiology, and End Results-Medicare database from 1992 to 2006 were assessed using a multivariable logistic regression model that included treatment, patient, tumor, and census tract characteristics. Overall survival (OS) was analyzed using the Kaplan-Meier approach and inverse probability weight-adjusted Cox proportional hazard models. Overall, 2,781 patients who underwent surgical resection as the initial treatment for T1-2N1M0 NSCLC and survived at least 31 days after surgery were identified, with adjuvant chemotherapy given to 784 patients (28.2 %). Factors that predicted adjuvant chemotherapy use were younger age and higher T status. The 5-year OS was significantly better for patients who received adjuvant chemotherapy compared with patients not given adjuvant chemotherapy: 35.8 % (95 % confidence interval [CI] 31.9-39.6) vs. 28.0 % (95 % CI 25.9-30.0) (p = 0.008). In the inverse probability weight-adjusted Cox proportional hazard regression model, adjuvant chemotherapy use predicted significantly improved survival (hazard ratio 0.84; 95 % CI 0.76-0.92; p = 0.0002). Adjuvant chemotherapy after resection of T1-2N1M0 NSCLC is associated with significantly improved survival in patients older than 65 years. These data can be used to provide elderly patients with realistic expectations of the potential benefits when considering adjuvant chemotherapy in this setting.

  3. Radiotherapy or surgery for T2N0M0 glottic carcinoma?

    International Nuclear Information System (INIS)

    Stalpers, L.J.A.; Daal, W.A.J. van; Verbeek, A.L.M.

    1989-01-01

    Decision analysis was used to evaluate the results of treatment of T 2 N 0 M 0 glottic carcinoma as presented in the literature. Based on mean values for recurrence, salvage eligibility after recurrence and salvage success, the 5-year survival after radiotherapy and surgery proved to be almost identical, 85 and 86%. If the recurrence rates and the salvage rates were varied, a marginal advantage for surgery in small tumours and a major advantage in more extended tumours was seen if only survival is considered. To take the quality of speech into account, a utility analysis was performed. A utility scale was defined ranging from 0.0 as the value for death, to 1.0 for a successfully irradiated patient with preservation of normal speech. A utility of 0.99 or less for the laryngectomized patient would favour radiotherapy over surgery for all T 2 tumours. In patients with T 2b tumours and in extreme circumstances, e.g. if failure rates of radiotherapy are extremely low, an exact assessment of patient utilities may be pivotal. Under normal circumstances radiotherapy is preferred for T 2 N 0 M 0 glottic carcinoma if both survival and the quality of speech are taken into account. (author). 39 refs.; 5 figs.; 1 tab

  4. T1N0 to T2N0 Squamous Cell Carcinoma of the Glottic Larynx Treated With Definitive Radiotherapy

    International Nuclear Information System (INIS)

    Chera, Bhishamjit S.; Amdur, Robert J.; Morris, Christopher G.; Kirwan, Jessica M.; Mendenhall, William M.

    2010-01-01

    Purpose: To report the treatment outcomes of definitive radiotherapy (RT) for early-stage squamous cell carcinoma (SCCA) of the glottic larynx. Methods and Materials: We retrospectively reviewed the medical records of 585 patients with T1N0 to T2N0 invasive SCCA of the glottic larynx treated between 1964 and 2006 with RT alone. All patients had at least 2 years of follow-up, had histologic diagnosis of invasive SCCA, and received continuous-course RT. None of these patients received chemotherapy or had elective nodal RT. The probabilities of local control (LC), ultimate LC, ultimate LC with larynx preservation, neck control, cause-specific survival (CSS), and overall survival (OS) were calculated by the Kaplan-Meier product-limit method. Results: The median follow-up for survivors was 12 years. Five-year LC rates were as follows: T1A, 94%; T1B, 93%; T2A, 80%; and T2B, 70%. Multivariate analysis revealed that overall treatment time greater than 41 days (p = 0.001) and poorly differentiated histology (p = 0.016) adversely affected LC. Five-year rates of ultimate LC with laryngeal preservation were: T1A, 95%; T1B, 94%, T2A, 81%; and T2B, 74%. Twenty-four (4%) of 585 patients failed in the neck; only 7 neck failures (1%) were isolated. Five-year CSS and OS rates were as follows: T1A, 97% and 82%; T1B, 99% and 83%; T2A, 94% and 76%; and T2B, 90% and 78%, respectively. Ten (1.7%) patients had severe and/or fatal complications. One patient died of a radiation-induced carotid artery angiosarcoma. Conclusion: Based on our study results, RT cures a high proportion of patients with T1N0 to T2N0 glottic SCCAs and has a low rate of severe complications.

  5. Coping with uncertainty: T1a,bN0M0 HER2-positive breast cancer, do we have a treatment threshold?

    LENUS (Irish Health Repository)

    Kelly, C M

    2012-02-01

    BACKGROUND: Recent retrospective studies have suggested that patients with T1a,bN0M0 human epidermal growth factor receptor 2 (HER2)-positive breast cancer are at a higher risk for recurrence and might benefit from adjuvant trastuzumab. The absolute benefits associated with treating this subgroup are uncertain. Design: We reviewed recent studies examining the prognostic value of HER2 in patients with node-negative T1a,b HER2-positive breast cancer. We calculated the number needed to treat (NNT) using baseline risk estimates for untreated T1a,bN0M0 breast cancer and the number needed to harm (NNH) using the incidence of cardiac events in each of the adjuvant trastuzumab clinical trials. RESULTS: Several studies were identified, each with limitations inherent to retrospective database analyses: small cohort sizes, lack of systematic HER2 testing in older specimens, variations in the use of adjuvant therapy and definitions of study end points, and lack of information relating to comorbidities. The 5-year disease-free survival in the pre-trastuzumab era ranged from 77% to 95%. Comparisons between small HER2 -positive and small HER2 -negative cancers showed numerically worse outcome for the HER2-positive cohort in some but not all studies. In many instances, the NNH was larger (26-250) than the NNT (13-35); however, in a subset of patients, the NNH was lower (6) than the NNT (13-35). CONCLUSIONS: Better prediction tools to estimate more precisely the risk for death due to comorbid illness versus breast cancer are needed. In some patients, the risks of therapy could outweigh the benefits. Treatment selection for T1a,bN0 HER2-positive cancers remains in the transition area between evidence- and subjective judgment-based medicine.

  6. For or against adjuvant trastuzumab for pT1a-bN0M0 breast cancer patients with HER2-positive tumors: a meta-analysis of published literatures.

    Directory of Open Access Journals (Sweden)

    Qiong Zhou

    Full Text Available BACKGROUND: Although the prognosis of patients with small (≤1cm tumors is generally favorable, emerging data suggests that biological behavior varies between intrinsic subtypes in such patients. Furthermore, it still remains unclear whether HER2-positive pT1a-bN0M0 patients could benefit from adjuvant trastuzumab. For further evaluation, we sought to conduct a meta-analysis so as to get a better understanding of the prognosis for HER2-positive pT1a-bN0M0 patients and their survival benefit from adjuvant trastuzumab, accordingly, offering the implications for current practice. METHODS: The PubMed database, the online proceedings of the American Society of Clinical Oncology (ASCO Annual Meetings, the online proceedings of the San Antonio Breast Cancer Symposium, and the CD proceedings of the International St. Gallen Breast Cancer Conference were searched for all relevant studies published before September 2012. Relative risks (RRs were used to compare the prognosis of different intrinsic subtypes for pT1a-bN0M0 breast cancer. Analyses were also performed to estimate the association between adjuvant trastuzumab and various survival outcomes. RESULTS: With eight eligible studies identified, this meta-analysis demonstrated a deleterious effect of HER2+ phenotype on disease-free survival (DFS; RR = 3.677, 95% CI 2.606-5.189, p <0.001 and distant disease-free survival (DDFS; RR = 3.824, 95% CI 2.249-6.501, p<0.001 as compared to HR+/HER2- subgroup. However, significant difference failed to be achieved in terms of any endpoint between HER2+ and triple negative breast cancer (TNBC. Besides, a marked improvement in DFS was observed with the addition of trastuzumab for HER2-positive pT1a-bN0M0 patients (RR = 0.323, 95% CI 0.191-0.547, p<0.001. CONCLUSION: This meta-analysis clarifies that intrinsic subtypes might be a reliable marker to predict the prognosis in pT1a-bN0M0 breast cancer. Besides, even for such early stage HER2-positive

  7. Infinitely many N=1 dualities from m+1m=1

    Energy Technology Data Exchange (ETDEWEB)

    Agarwal, Prarit; Intriligator, Kenneth; Song, Jaewon [Department of Physics, University of California,San Diego, La Jolla, CA 92093 (United States)

    2015-10-06

    We discuss two infinite classes of 4d supersymmetric theories, T{sub N}{sup (m)} and U{sub N}{sup (m)}, labelled by an arbitrary non-negative integer, m. The T{sub N}{sup (m)} theory arises from the 6d, A{sub N−1} type N=(2,0) theory reduced on a 3-punctured sphere, with normal bundle given by line bundles of degree (m+1,−m); the m=0 case is the N=2 supersymmetric T{sub N} theory. The novelty is the negative-degree line bundle. The U{sub N}{sup (m)} theories likewise arise from the 6d N=(2,0) theory on a 4-punctured sphere, and can be regarded as gluing together two (partially Higgsed) T{sub N}{sup (m)} theories. The T{sub N}{sup (m)} and U{sub N}{sup (m)} theories can be represented, in various duality frames, as quiver gauge theories, built from T{sub N} components via gauging and nilpotent Higgsing. We analyze the RG flow of the U{sub N}{sup (m)} theories, and find that, for all integer m>0, they end up at the same IR SCFT as SU(N) SQCD with 2N flavors and quartic superpotential. The U{sub N}{sup (m)} theories can thus be regarded as an infinite set of UV completions, dual to SQCD with N{sub f}=2N{sub c}. The U{sub N}{sup (m)} duals have different duality frame quiver representations, with 2m+1 gauge nodes.

  8. Evaluation excitation functions for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si, and "1"1"3In(n,γ)"1"1"4"mIn reactions

    International Nuclear Information System (INIS)

    Zolotarev, K.I.

    2014-10-01

    Cross section data for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions are needed for solving a wide spectrum of scientific and technical tasks. The excitation function of "2"8Si(n,p)"2"8Al reaction refers to the nuclear data involved in fusion reactor design calculations. The "2"8Si(n,p)"2"8Al reaction is interesting also as the monitor reaction for measurements at fusion facilities. Activation detectors on the basis of the 31P(n,p)31Si reaction are commonly used in the reactor dosimetry. The "1"1"3In(n,γ)"1"1"4"mIn reaction is promising regarding reactor dosimetry application for two reasons. First, due to the "1"1"4"mIn decay parameters which are rather suitable for activation measurements. Half-life of "1"1"4"mIn is equal to T_1/_2 = (49.51 ± 0.01) days and gamma spectrum accompanying decay has only one line with energy 190.27 keV and intensity (15.56 ± 0.15)%. Second, the "1"1"3In(n,γ)"1"1"4"mIn reaction rate may be measured by using one activation detector simultaneously with the "1"1"5In(n,γ)"1"1"6"mIn reaction. Preliminary analysis of existing evaluated excitation functions for "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions show that new evaluations are needed for all above mentioned reactions. This report is devoted to the preparation of the new evaluations of cross sections data and related covariance matrixes of uncertainties for the "2"8Si(n,p)"2"8Al, "3"1P(n,p)"3"1Si and "1"1"3In(n,γ)"1"1"4"mIn reactions.

  9. Spectral-converting study of La{sub 1−m−n}Er{sub m}Yb{sub n}OCl (m=0.001–0.2, n=00.1) phosphors

    Energy Technology Data Exchange (ETDEWEB)

    Park, Sangmoon, E-mail: spark@silla.ac.kr [Center for Green Fusion Technology and Department of Engineering in Energy and Applied Chemistry, Silla University, Busan 617-736 (Korea, Republic of); Cho, So-Hye [Center for Materials Architecturing, Institute of Multidisciplinary Convergence of Materials, Korea Institute of Science and Technology, Seoul 130-650 (Korea, Republic of)

    2014-09-15

    Optical materials composed of La{sub 1−m−n}Er{sub m}Yb{sub n}OCl (m=0.001–0.2, n=00.1) solid solution were prepared via a solid-state reaction using excess NH{sub 4}Cl flux at 950 °C for 30 min. X-ray diffraction patterns of La{sub 1m}Er{sub m}OCl were compared upon altering the molar ratios of the flux to the La{sup 3+} (Er{sup 3+}, Yb{sup 3+}) ions. By means of photoluminescence spectra, the dependence of the luminescence intensity as a function of the Er{sup 3+} content and the color CIE coordinates of the Er{sup 3+}-doped layered LaOCl compounds were also investigated under excitation by near-ultraviolet (NUV) and visible light. The spectral conversion properties of Er{sup 3+} and Er{sup 3+}–Yb{sup 3+} ions doped into LaOCl phosphors were elucidated under diode-laser irradiation of 980 nm in wavelength. The desired up-conversion of the emitting light, passing throughout the green, orange, and red regions of the spectrum, was achieved by appropriate Er{sup 3+} and/or Yb{sup 3+} concentrations in the LaOCl host structure under 980-nm-excitation light, while its mechanism in the phosphors was described by an energy-level schematic. Up-conversion emission spectra and the dependence of the emission intensity on pump power in the La{sub 0.89}Er{sub 0.1}Yb{sub 0.01}OCl phosphor were investigated under diode-laser irradiation of both wavelengths, 980 and 1550 nm. - Highlights: • Flux-assisted La{sub 1−m−n}Er{sub m}Yb{sub n}OCl (m=0.001–0.2, n=00.1) phosphors were prepared. • Distinctive photoluminescence properties of Er{sup 3+}-doped LaOCl were investigated. • Spectral converting properties of Er{sup 3+} and Yb{sup 3+} in LaOCl phosphors were elucidated. • Up-conversion mechanisms are proposed on the basis of an energy-level diagram. • Dependence of the emission intensity on pump power in the phosphor was investigated.

  10. Analysis of the prognostic factors for low rectal cancer with the pT1-2NxM0 stage after abdominoperineal resection.

    Science.gov (United States)

    Zhang, Xing-mao; Ma, Chao; Sun, Da-yong; Wang, Zheng; Zhou, Zhi-xiang

    2015-01-01

    This study was designed to explore the factors influencing local recurrence and survival for low rectal cancer with pT1-2NxM0 stage after an abdominoperineal resection (APR). Data of 429 patients confirmed to have pT1-2NxM0 after APR were reviewed. The recurrence rate in patients with intraoperative perforation, less than 12 lymph nodes (LNs) harvested, T2 staging, and positive circumferential resection margin (CRM) was 25.1, 19.9, 9.5, and 26.1% compared with 6.9, 7.0, 0, and 5.8% in patients with no perforation, 12 or more LNs harvested, T1, and negative CRM. The 5-year survival rate in patients with age of at least 70, perforation, less than 12 LNs harvested, T2, and positive CRM was 71.1, 60.8, 58.8, 69.9, and 46.0%, but 73.4, 73.5, 73.8, 89.4, and 75.0% in patients with age less than 70, no perforation, 12 or more LNs harvested, T1, and negative CRM. Meanwhile, patients with N0, N1, and N2 had a survival rate of 90.7, 69.9, and 63.9%. Multivariate analysis showed that perforation (PCRM status (P=0.002) were associated with local recurrence, whereas age of the patients (P=0.023), N staging (PCRM status (P=0.004) were associated with survival. APR was affected by patients' age, operation performer, perforation, number of LNs harvested, T staging, N staging, differentiation, and CRM status. Perforation, number of LNs harvested, T staging, differentiation, and CRM status were independent factors for recurrence; meanwhile, age of the patients, N staging, differentiation, and CRM status were independent factors influencing survival.

  11. Properties of M1-M2-Si-Al-O-N glasses (M1 = La or Nd, M2 = Y or Er)

    Energy Technology Data Exchange (ETDEWEB)

    Pomeroy, M.J.; Nestor, E.; Hampshire, S. [Limerick Univ. (Ireland). Materials and Surface Science Inst.; Ramesh, R. [Littelfuse Ireland, Dundalk, Co. Louth (Ireland)

    2002-07-01

    Mixed lanthanide cation oxynitride glasses have been prepared in the M1 - M2 - Si-Al-O-N systems where M1 = La or Nd and M2 = Y or Er. The densities ({rho}), Young's moduli (E), microhardnesses (H{sub v}), glass transition temperatures (T{sub g}), dilatometric softening temperatures (T{sub dil}) and coefficients of thermal expansion (CTE) of 13 glasses were determined. The molar volume values (MV) calculated from density data, E, H{sub v}, T{sub g}, T{sub dil} and CTE values were all found to vary linearly with the effective cation field strength arising from the M1 and M2 modifier cations. Least squares intercept and slope values are presented which correlate each property to effective cation field strength together with error values which arise from glass and specimen preparation and measurement inconsistencies. These linear correlations clearly indicate that the overall glass structure remains the same for each of the thirteen glasses with only the modifier cation(s) having any influence. This influence appears to be a cross-linking effect, the strength of which increases as the effective cation field strength of the M1, M2 modifiers increases. (orig.)

  12. Branching ratio for the isoscalar transition 2+, T = 1, 1.95 MeV→0+, T = 1, 0.66 MeV in 22Na

    International Nuclear Information System (INIS)

    Vermeer, W.J.; Poletti, A.R.

    1982-01-01

    The branching ratio for the isoscalar transition 2 + , T = 1, 1.95 MeV→0 + , T = 1, 0.66 MeV in 22 Na was measured as (0.29+-0.05)% of the total decays of the 1.95MeV level. This, together with the measured mean-life of this level, gives an E2 strength of (16+-5) Wu, in good agreement with the estimate of 18 Wu obtained from the analogue transitions in 22 Ne and 22 Mg assuming a linear relationship between M(E2) and Tsub(z). Upper limits for some weak decay branches in 19 F were also obtained. (author)

  13. 6d N=(1,0) theories on S{sup 1}/T{sup 2} and class S theories: part II

    Energy Technology Data Exchange (ETDEWEB)

    Ohmori, Kantaro; Shimizu, Hiroyuki [Department of Physics, Faculty of Science, University of Tokyo,Bunkyo-ku, Tokyo 133-0022 (Japan); Tachikawa, Yuji [Department of Physics, Faculty of Science, University of Tokyo,Bunkyo-ku, Tokyo 133-0022 (Japan); Institute for the Physics and Mathematics of the Universe, University of Tokyo,Kashiwa, Chiba 277-8583 (Japan); Yonekura, Kazuya [Institute for the Physics and Mathematics of the Universe, University of Tokyo,Kashiwa, Chiba 277-8583 (Japan); School of Natural Sciences, Institute for Advanced Study,Princeton, NJ 08540 (United States)

    2015-12-21

    We study the T{sup 2} compactification of a class of 6d N=(1,0) theories that is Higgsable to N=(2,0) theories. We show that the resulting 4d N=2 theory at the origin of the Coulomb branch and the parameter space is generically given by two superconformal matter sectors coupled by an infrared-free gauge multiplet and another conformal gauge multiplet. Our analysis utilizes the 5d theories obtained by putting the same class of 6d theories on S{sup 1}. Our class includes, among others, the 6d theories describing multiple M5 branes on an ALE singularity, and we analyze them in detail. The resulting 4d theory has manifestly both the SL(2,ℤ) and the full flavor symmetry. We also discuss in detail the special cases of 6d theories where the infrared-free gauge multiplet is absent. In an appendix, we give a field-theoretical argument for an F-theoretic constraint that forbids a particular 6d anomaly-free matter content, as an application of our analysis.

  14. Clinical outcomes for T1-2N0-1 oral tongue cancer patients underwent surgery with and without postoperative radiotherapy

    International Nuclear Information System (INIS)

    Shim, Su Jung; Cha, Jihye; Koom, Woong Sub; Kim, Gwi Eon; Lee, Chang Geol; Choi, Eun Chang; Keum, Ki Chang

    2010-01-01

    The aim of this study was to assess the results of curative surgery with and without radiotherapy in patients with T 1-2 N 0-1 oral tongue squamous cell carcinoma (OSCC) and to evaluate survival and prognostic factors. Retrospective analysis of 86 patients with T 1-2 N 0-1 OSCC who received surgery between January 2000 and December 2006. Fourteen patients (16.3%) received postoperative radiotherapy (PORT). Patient characteristics, tumor characteristics, treatment modality, failure patterns, and survival rates were analyzed. The median follow-up was 45 months. The five-year overall survival (OS) and disease-free survival (DFS) rates were 80.8% and 80.2%, respectively. Higher tumor grade and invasion depth ≥ 0.5 cm were the significant prognostic factors affecting five-year OS and DFS (OS rate; 65% vs. 91%, p = 0.001 for grade; 66% vs. 92%, p = 0.01 for invasion depth: DFS rate; 69% vs. 88%, p = 0.005 for grade; 66% vs. 92%, p = 0.013 for invasion depth). In the risk group, there was no local failure in patients with postoperative radiotherapy. In T 1-2 N 0-1 OSCC, factors that affected prognosis after primary surgery were higher tumor grade and deep invasion depth over 0.5 cm. Postoperative radiotherapy should be considered in early oral tongue cancer patients with these high-risk pathologic features

  15. Clinical outcomes for T1-2N0-1 oral tongue cancer patients underwent surgery with and without postoperative radiotherapy

    Directory of Open Access Journals (Sweden)

    Choi Eun

    2010-05-01

    Full Text Available Abstract Background The aim of this study was to assess the results of curative surgery with and without radiotherapy in patients with T1-2N0-1 oral tongue squamous cell carcinoma (OSCC and to evaluate survival and prognostic factors. Methods Retrospective analysis of 86 patients with T1-2N0-1 OSCC who received surgery between January 2000 and December 2006. Fourteen patients (16.3% received postoperative radiotherapy (PORT. Patient characteristics, tumor characteristics, treatment modality, failure patterns, and survival rates were analyzed. Results The median follow-up was 45 months. The five-year overall survival (OS and disease-free survival (DFS rates were 80.8% and 80.2%, respectively. Higher tumor grade and invasion depth ≥ 0.5 cm were the significant prognostic factors affecting five-year OS and DFS (OS rate; 65% vs. 91%, p = 0.001 for grade; 66% vs. 92%, p = 0.01 for invasion depth: DFS rate; 69% vs. 88%, p = 0.005 for grade; 66% vs. 92%, p = 0.013 for invasion depth. In the risk group, there was no local failure in patients with postoperative radiotherapy. Conclusions In T1-2N0-1 OSCC, factors that affected prognosis after primary surgery were higher tumor grade and deep invasion depth over 0.5 cm. Postoperative radiotherapy should be considered in early oral tongue cancer patients with these high-risk pathologic features.

  16. Homoleptic diphosphacyclobutadiene complexes [M(η(4)-P2C2R2)2]x- (M = Fe, Co; x = 0, 1).

    Science.gov (United States)

    Wolf, Robert; Ehlers, Andreas W; Khusniyarov, Marat M; Hartl, František; de Bruin, Bas; Long, Gary J; Grandjean, Fernande; Schappacher, Falko M; Pöttgen, Rainer; Slootweg, J Chris; Lutz, Martin; Spek, Anthony L; Lammertsma, Koop

    2010-12-27

    The preparation and comprehensive characterization of a series of homoleptic sandwich complexes containing diphosphacyclobutadiene ligands are reported. Compounds [K([18]crown-6)(thf)(2)][Fe(η(4)-P(2)C(2)tBu(2))(2)] (K1), [K([18]crown-6)(thf)(2)][Co(η(4)-P(2)C(2)tBu(2))(2)] (K2), and [K([18]crown-6)(thf)(2)][Co(η(4)-P(2)C(2)Ad(2))(2)] (K3, Ad = adamantyl) were obtained from reactions of [K([18]crown-6)(thf)(2)][M(η(4)-C(14)H(10))(2)] (M = Fe, Co) with tBuC[triple bond]P (1, 2), or with AdC[triple bond]P (3). Neutral sandwiches [M(η(4)-P(2)C(2)tBu(2))(2)] (4: M = Fe 5: M = Co) were obtained by oxidizing 1 and 2 with [Cp(2)Fe]PF(6). Cyclic voltammetry and spectro-electrochemistry indicate that the two [M(η(4)-P(2)C(2)tBu(2))(2)](-)/[M(η(4)-P(2)C(2)tBu(2))(2)] moieties can be reversibly interconverted by one electron oxidation and reduction, respectively. Complexes 1-5 were characterized by multinuclear NMR, EPR (1 and 5), UV/Vis, and Mössbauer spectroscopies (1 and 4), mass spectrometry (4 and 5), and microanalysis (1-3). The molecular structures of 1-5 were determined by using X-ray crystallography. Essentially D(2d)-symmetric structures were found for all five complexes, which show the two 1,3-diphosphacyclobutadiene rings in a staggered orientation. Density functional theory calculations revealed the importance of covalent metal-ligand π bonding in 1-5. Possible oxidation state assignments for the metal ions are discussed.

  17. Precision hfs of 126Cs(T1/2=1.63 m) by ABMR

    International Nuclear Information System (INIS)

    Pinard, J.; Duong, H.T.; Marescaux, D.; Stroke, H.H.; Redi, O.; Gustafsson, M.; Nilsson, T.; Matsuki, S.; Kishimoto, Y.; Kominato, K.; Ogawa, I.; Shibata, M.; Tada, M.; Persson, J.R.; Nojiri, Y.; Momota, S.; Inamura, T.T.; Wakasugi, M.; Juncar, P.; Murayama, T.; Nomura, T.; Koizumi, M.

    2005-01-01

    The hfs separation Δν of 126 Cs(T1/2=1.63 m) in the 6s S1/22 ground state was obtained in a precision measurement near zero magnetic field by means of atomic beam magnetic resonance with laser optical pumping on-line with the CERN-PSB-ISOLDE mass separator. The result, Δν=3629.514 (0.001) MHz, corrects significantly a previous published value from a high-field experiment. With our result, the precision of the nuclear magnetic moment, μ(Cs126)∼0.776μN, is now limited by the influence of extended nuclear structure on the hfs (the Bohr-Weisskopf effect)

  18. Curative Radiation Therapy for T2N0M0

    International Nuclear Information System (INIS)

    Park, In Kyu; Kim, Jae Choel

    1995-01-01

    Purpose : Surgery is the treatment of choice for resectable non-small cell lung cancer. For patients who are medically unable to tolerate a surgical resection or who refuse surgery, radiation therapy is an acceptable alternative. A retrospective analysis of patients with stage I non-small cell lung cancer treated with curative radiation therapy was performed to determine the results of curative radiation therapy and patterns of failure, and to identify factors that may influence survival. Materials and Methods : From 1986 through 1993, 39 patients with T2N0M0 non-small cell lung cancer were treated with curative radiation therapy at department of radiation oncology, Kyungpook national university hospital All patients were not candidates for surgical resection because of either patient refusal (16 patients), poor pulmonary function (12 patients), old age (7 patients), poor performance (2 patients) or coexisting medical disease (2 patients). Median age of patients was 67 years. Histologic cell type was squamous cell carcinoma in 1. All patients were treated with megavoltage irradiation and radiation dose raged from 5000cGy to 6150 cGy with a median dose of 600cGy. The median follow-up was 17 months with a range of 4 to 82 months. Survival was measured from the date therapy initiated. Results : The overall survival rate for entire patients was 40.6% at 2 years and 27.7% at 3 years, with a median survival time of 21 months he disease-free survival at 2 and 3 years was 51.7% and 25.8%, respectively. Of evaluable 20 Patients with complete response, 15 Patients were considered to have failed. Of these, 13 patients showed local failure and 2 patients failed distantly. Response to treatment (p=0.0001), tumor size (p=0.0019) and age p=0.0247) were favorably associated with overall survival. Only age was predictive for disease-free survival (p=0.0452). Conclusion : Radiation therapy is an effective treatment for small (less than 3 cm) tumors, and should be offered as an

  19. Laser-radiation therapy for T2N0M0 laryngeal-glottic cancer

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, Gen; Hayabuchi, Naofumi; Toda, Yukihiro; Suefuji, Hiroaki; Ogo, Etuyo; Nakajima, Tadashi [Kurume Univ., Fukuoka (Japan). School of Medicine

    2002-03-01

    The purpose of this study was to evaluate the laser-radiation combined therapy for T2N0M0 laryngeal-glottic cancer in order to preserve the larynx. The subjects consisted of 52 patients with T2N0M0 laryngeal-glottic cancer treated with laser-radiation combined therapy between 1980 and 1999. Patients ranged in age from 40-88 years, with a median of 70 years, and included 51 men and one woman. During this period, treatment was administered with different radiation devices ({sup 60}Co or 4 MV-X ray), and 40-72 Gy (median, 60Gy) of radiation therapy were administered. Tumor and treatment characteristics were correlated with local control at a median follow-up of 61 months (range 12-210 months). Concurrent chemotherapy was administered to 32 patients; 29 were treated with 5-FU and vitamin A (FAR), and 3 were treated with low-dose CDDP. Post treatment vocal function was examined in 37 patients. The voice was evaluated in terms of four parameters: maximum phonation time (MPT), mean air flow rate during phonation over a comfortable duration (MFR), fundamental frequency range of phonation (F0 range), and sound pressure level range of phonation (SPL range). The five-year cause-specific-survival rate was 98.0%, and the local control rate was 91.8%. Three of 4 patients who had locally relapsed were administered total laryngectomy as salvage therapy. One patient was administered the tracheostomy for late complication. The actuarial laryngeal preservation rate was 92.3%. We did not find any significant relationship between local relapse and extent of disease, subglottic extension, or anterior commissure involvement. Concurrent chemotherapy was not a significant prognostic factor. Laser debulking followed by radiation therapy did not change the voice significantly except the F0 range. We conclude that the laser-radiation combined therapy for T2N0M0 laryngeal-glottic cancer was effective therapy for not only preservation of the voice but also for vocal function. (author)

  20. Laser-radiation therapy for T2N0M0 laryngeal-glottic cancer

    International Nuclear Information System (INIS)

    Suzuki, Gen; Hayabuchi, Naofumi; Toda, Yukihiro; Suefuji, Hiroaki; Ogo, Etuyo; Nakajima, Tadashi

    2002-01-01

    The purpose of this study was to evaluate the laser-radiation combined therapy for T2N0M0 laryngeal-glottic cancer in order to preserve the larynx. The subjects consisted of 52 patients with T2N0M0 laryngeal-glottic cancer treated with laser-radiation combined therapy between 1980 and 1999. Patients ranged in age from 40-88 years, with a median of 70 years, and included 51 men and one woman. During this period, treatment was administered with different radiation devices ( 60 Co or 4 MV-X ray), and 40-72 Gy (median, 60Gy) of radiation therapy were administered. Tumor and treatment characteristics were correlated with local control at a median follow-up of 61 months (range 12-210 months). Concurrent chemotherapy was administered to 32 patients; 29 were treated with 5-FU and vitamin A (FAR), and 3 were treated with low-dose CDDP. Post treatment vocal function was examined in 37 patients. The voice was evaluated in terms of four parameters: maximum phonation time (MPT), mean air flow rate during phonation over a comfortable duration (MFR), fundamental frequency range of phonation (F0 range), and sound pressure level range of phonation (SPL range). The five-year cause-specific-survival rate was 98.0%, and the local control rate was 91.8%. Three of 4 patients who had locally relapsed were administered total laryngectomy as salvage therapy. One patient was administered the tracheostomy for late complication. The actuarial laryngeal preservation rate was 92.3%. We did not find any significant relationship between local relapse and extent of disease, subglottic extension, or anterior commissure involvement. Concurrent chemotherapy was not a significant prognostic factor. Laser debulking followed by radiation therapy did not change the voice significantly except the F0 range. We conclude that the laser-radiation combined therapy for T2N0M0 laryngeal-glottic cancer was effective therapy for not only preservation of the voice but also for vocal function. (author)

  1. Comparación de los métodos de cuantificación de carga viral de VIH: COBAS® AmpliPrep/COBAS® TaqMan HIV-1 test, v 2.0, y VERSANT HIV-1 RNA 1.0 Assay (kPCR Comparison of COBAS® AmpliPrep/COBAS® TaqMan HIV-1 test, v 2.0 and VERSANT HIV-1 RNA 1.0 (kPCR assays for HIV-1 plasma viral load

    Directory of Open Access Journals (Sweden)

    María Isabel Múnera-Jaramillo

    2012-03-01

    Full Text Available Objetivo. El propósito del estudio fue evaluar el desempeño del método VERSANTHIV-1RNA 1.0 Assay® (kPCR (Siemens, para la cuantificación de la carga viral en pacientes con VIH-1, en comparación con el método COBAS® AmpliPrep/COBAS TaqMan HIV-1 test®, v2.0 (Roche Diagnostics (CAP/CTM. Métodos. Las muestras fueron tomadas en dos tubos con EDTA, de 60 pacientes remitidos por el médico tratante para pruebas de carga viral como parte de su control de rutina de VIH/sida, y fueron procesadas para la cuantificación del ARN del VIH-1 por ambas técnicas. Se hizo análisis de regresión y se calcularon los coeficientes de correlación de Pearson, y los de correlación y concordancia de Lin. Se evalúo la concordancia entre las dos técnicas mediante el método de Bland-Altman. Resultados. El promedio de la carga viral por el método CAP/CTM fue 3,2±1,4 long10 copias/ml y, por el método kPCR, 3,0±1,3 long10 copias/ml. El 86,7 % de muestras presentó diferencias entre los dos métodos, menores de 0,5 long10 copias/ml, y el 13,3 % presentó diferencias mayores. El coeficiente de correlación de Pearson entre los dos métodos fue de 0,97 (IC95% 0,95-0,99 y el índice kappa ponderado entre los dos métodos en diferentes rangos de concentración, fue de 0,91 (IC95% 0,87-0,96. El promedio de las diferencias entre las mediciones fue 0,22 long10 copias/ml (IC95% -0,45 a 0,89. Conclusión. Las dos técnicas evaluadas fueron comparables, con el método kPCR se observaron resultados más bajos.Objective: The purpose of this study was to evaluate the performance of the kPCR VERSANT (™ 440 HIV-1RNA 3.0 Assay® (Siemens method for the quantification of viral load in HIV-1 patients, compared to the COBAS AmpliPrep/COBASTaqMan HIV-1 test®, v. 2.0 (Roche Diagnostics (CAP/CTM. Methods: Samples were taken in 2 tubes with EDTA, in 60 patients referred by the attending physician for viral load tests as part of their routine control of HIV/AIDS, and were

  2. Is Biological Subtype Prognostic of Locoregional Recurrence Risk in Women With pT1-2N0 Breast Cancer Treated With Mastectomy?

    International Nuclear Information System (INIS)

    Truong, Pauline T.; Sadek, Betro T.; Lesperance, Maria F.; Alexander, Cheryl S.; Shenouda, Mina; Raad, Rita Abi; Taghian, Alphonse G.

    2014-01-01

    Purpose: To examine locoregional and distant recurrence (LRR and DR) in women with pT1-2N0 breast cancer according to approximated subtype and clinicopathologic characteristics. Methods and Materials: Two independent datasets were pooled and analyzed. The study participants were 1994 patients with pT1-2N0M0 breast cancer, treated with mastectomy without radiation therapy. The patients were classified into 1 of 5 subtypes: luminal A (ER+ or PR+/HER 2−/grade 1-2, n=1202); luminal B (ER+ or PR+/HER 2−/grade 3, n=294); luminal HER 2 (ER+ or PR+/HER 2+, n=221); HER 2 (ER−/PR−/HER 2+, n=105) and triple-negative breast cancer (TNBC) (ER−/PR−/HER 2−, n=172). Results: The median follow-up time was 4.3 years. The 5-year Kaplan-Meier (KM) LRR were 1.8% in luminal A, 3.1% in luminal B, 1.7% in luminal HER 2, 1.9% in HER 2, and 1.9% in TNBC cohorts (P=.81). The 5-year KM DR was highest among women with TNBC: 1.8% in luminal A, 5.0% in luminal B, 2.4% in luminal HER 2, 1.1% in HER 2, and 9.6% in TNBC cohorts (P 2 cm, lobular histology, and close/positive surgical margins. Conclusions: The 5-year risk of LRR in our pT1-2N0 cohort treated with mastectomy was generally low, with no significant differences observed between approximated subtypes. Among the subtypes, TNBC conferred the highest risk of DR and an elevated risk of LRR in the presence of positive or close margins. Our data suggest that although subtype alone cannot be used as the sole criterion to offer postmastectomy radiation therapy, it may reasonably be considered in conjunction with other clinicopathologic factors including tumor size, histology, and margin status. Larger cohorts and longer follow-up times are needed to define which women with node-negative disease have high postmastectomy LRR risks in contemporary practice

  3. Re-evaluation of Ipsilateral Radiation for T1-T2N0-N2b Tonsil Carcinoma at the Princess Margaret Hospital in the Human Papillomavirus Era, 25 Years Later

    International Nuclear Information System (INIS)

    Huang, Shao Hui; Waldron, John; Bratman, Scott V.; Su, Jie; Kim, John; Bayley, Andrew; Cho, John; Giuliani, Meredith; Hope, Andrew; Ringash, Jolie; Hansen, Aaron; Almeida, John R. de; Goldstein, David; Perez-Ordonez, Bayardo; Weinreb, Ilan; Tong, Li; Xu, Wei; O'Sullivan, Brian

    2017-01-01

    Purpose: To report the outcome of ipsilateral radiation therapy (RT) in human papillomavirus (HPV)-positive (HPV+) patients and HPV-negative (HPV−) patients with T1-T2N0-N2b tonsillar cancer treated 25 years after our initial historical cohort. Methods and Materials: Patients with T1-T2N0-N2b tonsillar cancer who received ipsilateral RT or bilateral RT between 1999 and 2014 were reviewed. Overall survival (OS), local control (LC), regional control (RC), and grade 3 to 4 late toxicity (LT) were compared between ipsilateral RT and bilateral RT within HPV+ and HPV− patients, separately. Results: HPV status was ascertained in 379/427 (88%) consecutive patients (ipsilateral RT: 62 HPV+, 34 HPV−; bilateral RT: 240 HPV+ 240, 41 HPV−). The proportion of ipsilateral RT by N category for HPV+ and HPV− patients were as follows: N0: 24/37 (65%) versus 28/48 (74%); N1: 21/49 (43%) versus 4/9 (44%); N2a: 10/39 (26%) versus 1/4 (25%); and N2b: 7/177 (4%) versus 1/24 (4%), respectively. Of the patients receiving ipsilateral RT, 94/96 (98%) were treated with RT alone. The median follow-up time was 5.03 years. The respective 5-year rates of OS, LC, RC, and LT were similar between ipsilateral RT and bilateral RT for the HPV+ patients (OS: 89% vs 87%, P=.55; LC: 97% vs 98%, P=.65; RC: 98% vs 97%, P=.27; LT: 17% vs 12%, P=.83) and HPV− patients (OS: 63% vs 48%, P=.27; LC: 90% vs 80%, P=.19; RC: 94% vs 83%, P=.14; LT: 15% vs 22%, P=.36). Of the 96 patients receiving ipsilateral RT, contralateral neck failure (CNF) occurred in 1/52 HPV+ patients and 1/34 HPV− patients. The 5-year CNF rates were 2% (95% CI: 1-9) (HPV+: 2% [0-14]; HPV−: 3% [0-21], P=.66). Five local failures (2 HPV+; 3 HPV−) and no distant failures were seen. The 5-year rates of LC, RC, and LT were 97% versus 90% (P=.24), 98% versus 94% (P=.25), and 18% versus 15% (P=.75) for the HPV+ and HPV− cohorts, respectively. Osteoradionecrosis occurred in 9 patients: 6/47 (13%) treated with conventional RT

  4. Re-evaluation of Ipsilateral Radiation for T1-T2N0-N2b Tonsil Carcinoma at the Princess Margaret Hospital in the Human Papillomavirus Era, 25 Years Later

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Shao Hui, E-mail: shaohui.huang@rmp.uhn.on.ca [Department of Radiation Oncology, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Waldron, John [Department of Radiation Oncology, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Department of Otolaryngology—Head & Neck Surgery, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Bratman, Scott V. [Department of Radiation Oncology, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Su, Jie [Department of Biostatistics, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Kim, John; Bayley, Andrew; Cho, John; Giuliani, Meredith; Hope, Andrew; Ringash, Jolie [Department of Radiation Oncology, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Hansen, Aaron [Division of Medical Oncology, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Almeida, John R. de; Goldstein, David [Department of Otolaryngology—Head & Neck Surgery, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Perez-Ordonez, Bayardo; Weinreb, Ilan [Department of Pathology, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Tong, Li [Department of Radiation Oncology, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Xu, Wei [Department of Biostatistics, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); O' Sullivan, Brian [Department of Radiation Oncology, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada); Department of Otolaryngology—Head & Neck Surgery, The Princess Margaret Cancer Centre, University of Toronto, Toronto, Ontario (Canada)

    2017-05-01

    Purpose: To report the outcome of ipsilateral radiation therapy (RT) in human papillomavirus (HPV)-positive (HPV+) patients and HPV-negative (HPV−) patients with T1-T2N0-N2b tonsillar cancer treated 25 years after our initial historical cohort. Methods and Materials: Patients with T1-T2N0-N2b tonsillar cancer who received ipsilateral RT or bilateral RT between 1999 and 2014 were reviewed. Overall survival (OS), local control (LC), regional control (RC), and grade 3 to 4 late toxicity (LT) were compared between ipsilateral RT and bilateral RT within HPV+ and HPV− patients, separately. Results: HPV status was ascertained in 379/427 (88%) consecutive patients (ipsilateral RT: 62 HPV+, 34 HPV−; bilateral RT: 240 HPV+ 240, 41 HPV−). The proportion of ipsilateral RT by N category for HPV+ and HPV− patients were as follows: N0: 24/37 (65%) versus 28/48 (74%); N1: 21/49 (43%) versus 4/9 (44%); N2a: 10/39 (26%) versus 1/4 (25%); and N2b: 7/177 (4%) versus 1/24 (4%), respectively. Of the patients receiving ipsilateral RT, 94/96 (98%) were treated with RT alone. The median follow-up time was 5.03 years. The respective 5-year rates of OS, LC, RC, and LT were similar between ipsilateral RT and bilateral RT for the HPV+ patients (OS: 89% vs 87%, P=.55; LC: 97% vs 98%, P=.65; RC: 98% vs 97%, P=.27; LT: 17% vs 12%, P=.83) and HPV− patients (OS: 63% vs 48%, P=.27; LC: 90% vs 80%, P=.19; RC: 94% vs 83%, P=.14; LT: 15% vs 22%, P=.36). Of the 96 patients receiving ipsilateral RT, contralateral neck failure (CNF) occurred in 1/52 HPV+ patients and 1/34 HPV− patients. The 5-year CNF rates were 2% (95% CI: 1-9) (HPV+: 2% [0-14]; HPV−: 3% [0-21], P=.66). Five local failures (2 HPV+; 3 HPV−) and no distant failures were seen. The 5-year rates of LC, RC, and LT were 97% versus 90% (P=.24), 98% versus 94% (P=.25), and 18% versus 15% (P=.75) for the HPV+ and HPV− cohorts, respectively. Osteoradionecrosis occurred in 9 patients: 6/47 (13%) treated with conventional RT

  5. Is Biological Subtype Prognostic of Locoregional Recurrence Risk in Women With pT1-2N0 Breast Cancer Treated With Mastectomy?

    Energy Technology Data Exchange (ETDEWEB)

    Truong, Pauline T., E-mail: ptruong@bccancer.bc.ca [Radiation Therapy Program, British Columbia Cancer Agency, Vancouver Island Centre, University of British Columbia, Victoria, BC (Canada); Breast Cancer Outcomes Unit, British Columbia Cancer Agency, Vancouver Island Centre, University of British Columbia, Victoria, BC (Canada); Sadek, Betro T. [Department of Radiation Oncology, Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts (United States); Lesperance, Maria F. [Radiation Therapy Program, British Columbia Cancer Agency, Vancouver Island Centre, University of British Columbia, Victoria, BC (Canada); Alexander, Cheryl S. [Breast Cancer Outcomes Unit, British Columbia Cancer Agency, Vancouver Island Centre, University of British Columbia, Victoria, BC (Canada); Shenouda, Mina; Raad, Rita Abi; Taghian, Alphonse G. [Department of Radiation Oncology, Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts (United States)

    2014-01-01

    Purpose: To examine locoregional and distant recurrence (LRR and DR) in women with pT1-2N0 breast cancer according to approximated subtype and clinicopathologic characteristics. Methods and Materials: Two independent datasets were pooled and analyzed. The study participants were 1994 patients with pT1-2N0M0 breast cancer, treated with mastectomy without radiation therapy. The patients were classified into 1 of 5 subtypes: luminal A (ER+ or PR+/HER 2−/grade 1-2, n=1202); luminal B (ER+ or PR+/HER 2−/grade 3, n=294); luminal HER 2 (ER+ or PR+/HER 2+, n=221); HER 2 (ER−/PR−/HER 2+, n=105) and triple-negative breast cancer (TNBC) (ER−/PR−/HER 2−, n=172). Results: The median follow-up time was 4.3 years. The 5-year Kaplan-Meier (KM) LRR were 1.8% in luminal A, 3.1% in luminal B, 1.7% in luminal HER 2, 1.9% in HER 2, and 1.9% in TNBC cohorts (P=.81). The 5-year KM DR was highest among women with TNBC: 1.8% in luminal A, 5.0% in luminal B, 2.4% in luminal HER 2, 1.1% in HER 2, and 9.6% in TNBC cohorts (P<.001). Among 172 women with TNBC, the 5-year KM LRR were 1.3% with clear margins versus 12.5% with close or positive margins (P=.04). On multivariable analysis, factors that conferred higher LRR risk were tumors >2 cm, lobular histology, and close/positive surgical margins. Conclusions: The 5-year risk of LRR in our pT1-2N0 cohort treated with mastectomy was generally low, with no significant differences observed between approximated subtypes. Among the subtypes, TNBC conferred the highest risk of DR and an elevated risk of LRR in the presence of positive or close margins. Our data suggest that although subtype alone cannot be used as the sole criterion to offer postmastectomy radiation therapy, it may reasonably be considered in conjunction with other clinicopathologic factors including tumor size, histology, and margin status. Larger cohorts and longer follow-up times are needed to define which women with node-negative disease have high postmastectomy LRR

  6. [Evaluation of central lymph node dissection for papillary thyroid carcinoma in cN0 T1/T2].

    Science.gov (United States)

    Zhao, S Y; Ma, Y H; Yin, Z; Zhan, X X; Cheng, R C; Qian, J

    2018-02-07

    Objective: To evaluate the application of the central lymph node dissection (CLND) for papillary thyroid carcinoma (PTC) in cN0 T1/T2. Methods: Retrospective analysis of 532 cases with PTC in cN0 T1/T2 who underwent CLND between October 2014 and September 2016 in the Department of Thyroid Surgery, the First Affiliated Hospital of the Kunming Medical University. The incidence of central lymph node (CLN) metastasis and risk factors were analyzed. Results: CLN metastasis rates: 41.2% (42/102) in males vs 34.9% (150/430) in females, P =0.252; 33.9% (116/342) in single focal carcinoma vs 40.4% (74/183) in multifocal carcinoma, P =0.157; 44.0% (125/284) in patients with 45 years old or less vs 27.0% (67/248) in patients more than 45 years old, P =0.000; 30.3% (113/373) in microcarcinoma vs 50.9% (81/159) in non-microcarcinoma, P =0.000.In unilateral lesions, ipsilateral CLN metastasis was correlated with the tumor diameter ( P =0.012), but not with the number of lesions ( P =0.653). also contralateral CLN metastasis was correlated with the tumor diameter ( P =0.000), but not with the number of lesions ( P =0.815). For the left or right unilateral single focal lesion, the tumor diameter was not correlated with the metastasis of the posterior to right recurrent laryngeal nerve central lymph nodes (LN-prRLN-CLN) ( P =0.652, P =0.088). But in bilateral multifocal carcinoma the tumor diameter was correlated with metastasis of LN-prRLN-CLN ( P =0.039). Conclusions: Prophylactic CLND is reasonable for PTC in cN0 T1/T2. A bilateral CLND should be conducted for patients with bilateral multi-focus cancer and unilateral or bilateral non-microcarcinoma, especially in patients more than 45 years old. For unilateral single focal microcarcinoma on the right, the content of CLND should be from laryngeal nerve on right center to posterior branche; for unilateral single focal microcarcinoma on the left side, the left CLND should be conducted. An ipsilateral CLND can be considered in

  7. The (p, ρ, T, x) properties of (x1 propane + x2n-butane) with x1 (0.0000, 0.2729, 0.5021, and 0.7308) over the temperature range from (280 to 440) K at pressures from (1 to 200) MPa

    International Nuclear Information System (INIS)

    Miyamoto, H.; Uematsu, M.

    2008-01-01

    The (p, ρ, T, x) properties for (x 1 propane + x 2 n-butane) with x 1 = (0.0000, 0.2729, 0.5021, and 0.7308) in the compressed liquid phase were measured by means of a metal-bellows variable volumometer over the temperature range from (280 to 440) K at pressures from (1 to 200) MPa. The mole fraction purities of the propane and n-butane used in the measurements were 0.9999 and 0.9997, respectively. The expanded uncertainties (k = 2) in temperature, pressure, density, and composition measurements have been estimated to be less than ±3 mK; 1.4 kPa (p ≤ 7 MPa), 0.06% (7 MPa 150 MPa); 0.09%; and 4.4 . 10 -4 , respectively. In the region above 100 MPa at T = (280 and 440) K, the uncertainty in density measurements increases from 0.09% to 0.13% and 0.22%, respectively. Comparisons of the available equation of state with the present measurements are reported. On the basis of the present results, the excess molar volume v m E of the mixtures was calculated and illustrated as a function of temperature and pressure

  8. Exclusive brachytherapy for T1-T2 N0 cancer of the oral tongue: prognostic factors for local control

    International Nuclear Information System (INIS)

    Frezza, G.; Baldissera, A.; Bunkheila, F.; Caliceti, U.; Galuppi, A.; Guidetti, A.; Sorrenti, G.

    1996-01-01

    INTRODUCTION: The files of a group of patients (pts) treated with brachytherapy alone for cancer of the oral tongue were reviewed to assess the prognostic role of T stage, volume of disease, total dose and dose-rate. PATIENTS METHODS AND RESULTS: From 1982 to 1994 46 pts (29 males, 17 females, age 38-84 years, median 63.1 years) were treated with 192 Ir brachytherapy, in 2 cases followed by prophylactic neck dissection for cancer of the oral tongue (T1N0: 19 pts; T2N0: 27 pts). Brachytherapy was performed with hairpins in the early years of the study (17 pts) and more recently with plastic tubes (29 pts), according to the Parts System. Dose ranged from 60-70 Gy with a dose-rate of 0.38-0.62 Gy/h (median 63.8 and 0.52 respectively). Volume of the disease was retrospectively assessed as the product of the three diameters of the lesion calculated for provisional dosimetry (range 0.25- 16 cc.). Median follow up is 72 mos (range: 14-153 mos). RESULTS: Overall local control was 82.6% ((38(46)) pts; T1: (18(19)), 94.7 %; T2: (22(27)), 81.5 %). Five of 8 pts who recurred were submitted to salvage surgery, and 3 of them are alive and free from disease at 34, 52 and 87 mos respectively. Recurrences appeared after 3-13 mos (median 5.5 mos) and were related to total dose ( 63 Gy (1(18)); 5.5 %) and to dose-rate ( 45 cGy/h (4(36)): 11.1 %). The volume of disease was not of prognostic significance since local control was 79.6 % ((6(28)) pts) in pts with a disease smaller than 3 cc. and 88.9 % in pts with large volume ((2(18)) pts). Seven (15.2 %) grade 3 complications (necrosis of the mandibular bone and- or of the soft tissues) were observed. Complication rate was higher in the high dose group (>63 Gy (4(18)) pts: 22.2 %) and was less affected by dose-rate (> 45 cGy/h (6(36)) pts: 16.6 %). No relationship between complications and volume was observed ( 3cc.: 16.6 %). All complications healed spontaneously. DISCUSSION AND CONCLUSION: For T1-T2 cancer of the oral tongue exclusive

  9. Sentinel lymph node biopsy in clinically N0 T1-T2 staged oral cancer: the Dutch multicenter trial

    NARCIS (Netherlands)

    Flach, G.B.; Bloemena, E.; Klop, W.M.C.; van Es, R.J.J.; Schepman, K.P.; Hoekstra, O.S.; Castelijns, J.A.; Leemans, C.R.; de Bree, R.

    2014-01-01

    Objectives Results of the Dutch multi-institutional trial on sentinel lymph node (SLN) biopsy in oral cancer. Patients and methods Patients were consecutively enrolled from 4 institutions, with T1/T2 oral cancer and cN0 neck based on palpation and ultrasound guided fine needle aspiration cytology.

  10. Impact of concomitant chemoradiation on survival for patients with T1-2N1 head and neck cancer.

    Science.gov (United States)

    Zumsteg, Zachary S; Kim, Sungjin; David, John M; Yoshida, Emi J; Tighiouart, Mourad; Shiao, Stephen L; Scher, Kevin; Mita, Alain; Sherman, Eric J; Lee, Nancy Y; Ho, Allen S

    2017-05-01

    Single-modality radiotherapy is considered a standard-of-care option for certain stage III, T1-2N1 head and neck squamous cell carcinomas (HNSCCs). The role of concomitant chemoradiation is not well established because there have been no studies comparing chemoradiation with radiation alone in this population. This study analyzed patients in the National Cancer Data Base with cT1-2N1M0 invasive squamous cell carcinomas of the oropharynx, larynx, and hypopharynx who were diagnosed between 2004 and 2012 and were undergoing definitive radiation. Patients who were undergoing surgery before radiation with unknown follow-up or for whom either the receipt or timing of chemotherapy was unknown were excluded. In all, 5030 patients with T1-2N1 oropharyngeal, laryngeal, or hypopharyngeal cancer were included. The median follow-up was 56.8 months (95% confidence interval [CI], 55.7-58.6 months). Overall, 68% of the patients received concomitant chemoradiation (CCRT). The use of CCRT significantly increased during the time period of this study from 53% in 2004 to 78% in 2012 (P cancer (HR, 0.74; 95% CI, 0.65-0.85; P Cancer 2017;123:1555-1565. © 2017 American Cancer Society. © 2016 American Cancer Society.

  11. Probing the electronic properties of ternary A n M3n-1B2n (n = 1: A = Ca, Sr; M = Rh, Ir and n = 3: A = Ca, Sr; M = Rh) phases: observation of superconductivity.

    Science.gov (United States)

    Takeya, Hiroyuki; ElMassalami, Mohammed; Terrazos, Luis A; Rapp, Raul E; Capaz, Rodrigo B; Fujii, Hiroki; Takano, Yoshihiko; Doerr, Mathias; Granovsky, Sergey A

    2013-06-01

    We follow the evolution of the electronic properties of the titled homologous series when n as well as the atomic type of A and M are varied where for n = 1, A = Ca, Sr and M = Rh, Ir while for n = 3, A = Ca, Sr and M = Rh. The crystal structure of n = 1 members is known to be CaRh 2 B 2 -type ( Fddd ), while that of n = 3 is Ca 3 Rh 8 B 6 -type ( Fmmm ); the latter can be visualized as a stacking of structural fragments from AM 3 B 2 ( P 6/ mmm ) and AM 2 B 2 . The metallic properties of the n = 1 and 3 members are distinctly different: on the one hand, the n = 1 members are characterized by a linear coefficient of the electronic specific heat γ ≈ 3 mJ mol -1 K -2 , a Debye temperature θ D ≈ 300 K, a normal conductivity down to 2 K and a relatively strong linear magnetoresistivity for fields up to 150 kOe. The n = 3 family, on the other hand, exhibits γ ≈ 18 mJ mol -1 K -2 , θ D ≈ 330 K, a weak linear magnetoresistivity and an onset of superconductivity (for Ca 3 Rh 8 B 6 , T c = 4.0 K and H c2 = 14.5 kOe, while for Sr 3 Rh 8 B 6 , T c = 3.4 K and H c2 ≈ 4.0 kOe). These remarkable differences are consistent with the findings of the electronic band structures and density of state (DOS) calculations. In particular, satisfactory agreement between the measured and calculated γ was obtained. Furthermore, the Fermi level, E F , of Ca 3 Rh 8 B 6 lies at almost the top of a pronounced local DOS peak, while that of CaRh 2 B 2 lies at a local valley: this is the main reason behind the differences between the, e.g., superconducting properties. Finally, although all atoms contribute to the DOS at E F , the contribution of the Rh atoms is the strongest.

  12. Results of Neoadjuvant Short-Course Radiation Therapy Followed by Transanal Endoscopic Microsurgery for T1-T2 N0 Extraperitoneal Rectal Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Arezzo, Alberto, E-mail: alberto.arezzo@unito.it [General Surgery I, Department of Surgical Sciences, University of Torino, Torino (Italy); Arolfo, Simone; Allaix, Marco Ettore [General Surgery I, Department of Surgical Sciences, University of Torino, Torino (Italy); Munoz, Fernando [Radiation Oncology, Department of Oncology, University of Torino, Torino (Italy); Cassoni, Paola [Pathology Unit, Department of Medical Sciences, University of Torino, Torino (Italy); Monagheddu, Chiara [Clinical Epidemiology Unit, Piedmont Reference Centre for Epidemiology and Cancer Prevention, City of Health and Science Hospital of Torino, Torino (Italy); Ricardi, Umberto [Radiation Oncology, Department of Oncology, University of Torino, Torino (Italy); Ciccone, Giovannino [Clinical Epidemiology Unit, Piedmont Reference Centre for Epidemiology and Cancer Prevention, City of Health and Science Hospital of Torino, Torino (Italy); Morino, Mario [General Surgery I, Department of Surgical Sciences, University of Torino, Torino (Italy)

    2015-06-01

    Purpose: This study was undertaken to assess the short-term outcomes of neoadjuvant short-course radiation therapy (SCRT) followed by transanal endoscopic microsurgery (TEM) for T1-T2 N0 extraperitoneal rectal cancer. Recent studies suggest that neoadjuvant radiation therapy followed by TEM is safe and has results similar to those with abdominal rectal resection for the treatment of extraperitoneal early rectal cancer. Methods and Materials: We planned a prospective pilot study including 25 consecutive patients with extraperitoneal T1-T2 N0 M0 rectal adenocarcinoma undergoing SCRT followed by TEM 4 to 10 weeks later (SCRT-TEM). Safety, efficacy, and acceptability of this treatment modality were compared with historical groups of patients with similar rectal cancer stage and treated with long-course radiation therapy (LCRT) followed by TEM (LCRT-TEM), TEM alone, or laparoscopic rectal resection with total mesorectal excision (TME) at our institution. Results: The study was interrupted after 14 patients underwent SCRT of 25 Gy in 5 fractions followed by TEM. Median time between SCRT and TEM was 7 weeks (range: 4-10 weeks). Although no preoperative complications occurred, rectal suture dehiscence was observed in 7 patients (50%) at 4 weeks follow-up, associated with an enterocutaneous fistula in the sacral area in 2 cases. One patient required a colostomy. Quality of life at 1-month follow-up, according to European Organization for Research and Treatment of Cancer QLQ-C30 survey score, was significantly worse in SCRT-TEM patients than in LCRT-TEM patients (P=.0277) or TEM patients (P=.0004), whereas no differences were observed with TME patients (P=.604). At a median follow-up of 10 months (range: 6-26 months), we observed 1 (7%) local recurrence at 6 months that was treated with abdominoperineal resection. Conclusions: SCRT followed by TEM for T1-T2 N0 rectal cancer is burdened by a high rate of painful dehiscence of the suture line and enterocutaneous

  13. Relaxivity of Ferumoxytol at 1.5 T and 3.0 T.

    Science.gov (United States)

    Knobloch, Gesine; Colgan, Timothy; Wiens, Curtis N; Wang, Xiaoke; Schubert, Tilman; Hernando, Diego; Sharma, Samir D; Reeder, Scott B

    2018-05-01

    The aim of this study was to determine the relaxation properties of ferumoxytol, an off-label alternative to gadolinium-based contrast agents, under physiological conditions at 1.5 T and 3.0 T. Ferumoxytol was diluted in gradually increasing concentrations (0.26-4.2 mM) in saline, human plasma, and human whole blood. Magnetic resonance relaxometry was performed at 37°C at 1.5 T and 3.0 T. Longitudinal and transverse relaxation rate constants (R1, R2, R2*) were measured as a function of ferumoxytol concentration, and relaxivities (r1, r2, r2*) were calculated. A linear dependence of R1, R2, and R2* on ferumoxytol concentration was found in saline and plasma with lower R1 values at 3.0 T and similar R2 and R2* values at 1.5 T and 3.0 T (1.5 T: r1saline = 19.9 ± 2.3 smM; r1plasma = 19.0 ± 1.7 smM; r2saline = 60.8 ± 3.8 smM; r2plasma = 64.9 ± 1.8 smM; r2*saline = 60.4 ± 4.7 smM; r2*plasma = 64.4 ± 2.5 smM; 3.0 T: r1saline = 10.0 ± 0.3 smM; r1plasma = 9.5 ± 0.2 smM; r2saline = 62.3 ± 3.7 smM; r2plasma = 65.2 ± 1.8 smM; r2*saline = 57.0 ± 4.7 smM; r2*plasma = 55.7 ± 4.4 smM). The dependence of relaxation rates on concentration in blood was nonlinear. Formulas from second-order polynomial fittings of the relaxation rates were calculated to characterize the relationship between R1blood and R2 blood with ferumoxytol. Ferumoxytol demonstrates strong longitudinal and transverse relaxivities. Awareness of the nonlinear relaxation behavior of ferumoxytol in blood is important for ferumoxytol-enhanced magnetic resonance imaging applications and for protocol optimization.

  14. Closed expressions for $\\int_{0}^{1} t^{-1} log^{n-1}t log^{p}(1 - t) dt$

    CERN Document Server

    Kölbig, Kurt Siegfried

    1982-01-01

    Closed expressions for the integral integral /sub 0//sup 1/ t/sup -1/ log/sup n-1/t log/sup p/(1-t)dt, whose general form is given elsewhere, are listed for n=1(1)9, p=1(1)9. A formula is derived which allows an easy evaluation of these expressions by formula manipulation on a computer. The majority of the above expressions are given in a microfiche supplement to the paper.

  15. Thermal expansion of superconducting phases Bi sub 2 Sr sub 2 Ca sub n-1 Cu sub n O sub 2n+2+. delta. with n=1,2,3. Termicheskoe rasshirenie sverkhprovodyashchikh faz Bi sub 2 Sr sub 2 Ca sub n-1 Cu sub n O sub 2n+2+. delta. s n=1,2,3

    Energy Technology Data Exchange (ETDEWEB)

    Zhurov, V V; Ivanov, S A [Nauchno-Issledovatel' skij Fiziko-Khimicheskij Inst., Moscow (USSR); Bush, A A; Romanov, B N [Moskovskij Inst. Radiotekhniki, Ehlektroniki i Avtomatiki, Moscow (USSR)

    1990-10-01

    Consideration is given to results of X-ray diffraction studies of temperature dependences of a{sub 0},c{sub 0} sublattice parameters of Bi{sub 2}Sr{sub 2}Ca{sub n-1}Cu{sub n}O{sub 2n+2+}{delta} superconducting phases with n=1,2,3 (2201, 2212, 2223) in 90-1000 K range. The obtained dependences are composed of some temperature linear sections, where values of thermal coefficients of linear expansion {alpha}{sub a}, {alpha}{sub c} were determined for all examined phases. During first heating of samples of 2212 phase a{sub 0}(T), c{sub 0}(T) dependences deviate in {approx equal}500-700 K range from linear ones till the occurence of a section with negative a{sub c}. After heating of 2212 phase up to T>{approx equal}700 K and cooling down to 300 K, a{sub 0},c{sub 0} parameters decrease by {approx equal}0.006 and 0.08 A respectively. Data on the effect of preparation method and thermal prehistory of 2212 samples and on relative content of calcium atoms in them for these anomalies were obtained. Some possible reasons of their occurence were analyzed.

  16. Thermal expansion of superconducting phases Bi2Sr2Can-1CunO2n+2+δ with n=1,2,3

    International Nuclear Information System (INIS)

    Zhurov, V.V.; Ivanov, S.A.; Bush, A.A.; Romanov, B.N.

    1990-01-01

    Consideration is given to results of X-ray diffraction studies of temperature dependences of a 0 ,c 0 sublattice parameters of Bi 2 Sr 2 Ca n-1 Cu n O 2n+2+ δ superconducting phases with n=1,2,3 (2201, 2212, 2223) in 90-1000 K range. The obtained dependences are composed of some temperature linear sections, where values of thermal coefficients of linear expansion α a , α c were determined for all examined phases. During first heating of samples of 2212 phase a 0 (T), c 0 (T) dependences deviate in ≅500-700 K range from linear ones till the occurence of a section with negative a c . After heating of 2212 phase up to T>≅700 K and cooling down to 300 K, a 0 ,c 0 parameters decrease by ≅0.006 and 0.08 A respectively. Data on the effect of preparation method and thermal prehistory of 2212 samples and on relative content of calcium atoms in them for these anomalies were obtained. Some possible reasons of their occurence were analyzed

  17. Internal (m=1, n=1) and (m=2, n=1) resistive modes in the toroidal tokamak with circular cross-section

    International Nuclear Information System (INIS)

    Bussac, M.N.; Pellat, R.; Edery, D.; Soule, J.L.

    1977-01-01

    A linear analysis is presented of the toroidal coupling between the internal resistive modes (m=1, n=1) and (m=2, n=1) in the tokamak with circular cross-section. The resistive and diamagnetic effects are included in the singular layers where the safety factor q takes respectively the values one and two. By expanding the MHD equations in powers of epsilon, the local inverse of the aspect ratio, a system of two coupled equations is obtained for the harmonic amplitudes. When the shear is finite on q=1 the toroidal coupling is negligible. In the opposite limit, one can explain (a) the experimental behaviour of the (m=1, n=1) mode before the internal disruption, and (b) the simultaneous observation of the modes (m=1, n=1) and (m=2, n=1) before the main disruption. (author)

  18. Conditional cancer-specific mortality in T4, N1, or M1 prostate cancer: implications for long-term prognosis

    International Nuclear Information System (INIS)

    Muralidhar, Vinayak; Mahal, Brandon A.; Nguyen, Paul L.

    2015-01-01

    The risk of prostate cancer-specific mortality (PCSM) following a diagnosis of prostate cancer may improve after patients have survived a number of years after diagnosis. We sought to determine long-term conditional PCSM for patients with stage T4, N1, or M1 prostate cancer. We identified 66,817 patients diagnosed with stage IV (T4N0M0, N1M0, or M1) prostate cancer between 1973 and 2011 using the Surveillance, Epidemiology, and End Results (SEER) database. Conditional five-year PCSM was evaluated for each group of patients at 5, 10, and 15 years of survival according to the Fine & Gray model for competing risks after adjusting for tumor grade, age, income level, and marital status. Race-stratified analyses were also performed. There were 13,345 patients with T4 disease, 12,450 patients with N1 disease, and 41,022 patients with M1 disease. Median follow-up among survivors in the three groups was 123 months (range: 0–382 months), 61 months (range: 0–410 months), and 30 months (range: 0–370 months), respectively. Conditional PCSM improved in all three groups over time. Among patients with T4 disease, 5-year PCSM improved from 13.9 % at diagnosis to 11.2, 8.1, and 6.5 % conditioned on 5, 10, or 15 years of survival, respectively (p < 0.001 in all cases). In patients with N1 disease, 5-year PCSM increased within the first five years and decreased thereafter, from 18.9 % at diagnosis to 21.4 % (p < 0.001), 17.6 % (p = 0.055), and 13.8 % (p < 0.001), respectively. In patients with metastatic disease, 5-year PCSM improved from 57.2 % at diagnosis to 41.1, 28.8, and 20.8 %, respectively (p < 0.001). White race was associated with a greater increase in conditional survival compared to non-white race among those with T4 or N1 disease. While patients with T4, N1, or M1 prostate cancer are never “cured,” their odds of cancer-specific survival increase substantially after they have survived for 5 or more years. Physicians who take care of patients with prostate cancer

  19. T-duality of Green-Schwarz superstrings on AdS_d×S"d×M"1"0"−"2"d

    International Nuclear Information System (INIS)

    Abbott, Michael C.; Murugan, Jeff; Penati, Silvia; Pittelli, Antonio; Sorokin, Dmitri; Sundin, Per; Tarrant, Justine; Wolf, Martin; Wulff, Linus

    2015-01-01

    We verify the self-duality of Green-Schwarz supercoset sigma models on AdS_d×S"d backgrounds (d=2,3,5) under combined bosonic and fermionic T-dualities without gauge fixing kappa symmetry. We also prove this property for superstrings on AdS_d×S"d×S"d(d=2,3) described by supercoset sigma models with the isometries governed by the exceptional Lie supergroups D(2,1;α) (d=2) and D(2,1;α)×D(2,1;α) (d=3), which requires an additional T-dualisation along one of the spheres. Then, by taking into account the contribution of non-supercoset fermionic modes (up to the second order), we provide evidence for the T-self-duality of the complete type IIA and IIB Green-Schwarz superstring theory on AdS_d×S"d×T"1"0"−"2"d (d=2,3) backgrounds with Ramond-Ramond fluxes. Finally, applying the Buscher-like rules to T-dualising supergravity fields, we prove the T-self-duality of the whole class of the AdS_d×S"d×M"1"0"−"2"d superbackgrounds with Ramond-Ramond fluxes in the context of supergravity.

  20. Dummy run for a phase II study of stereotactic body radiotherapy of T1-T2 N0M0 medical inoperable non-small cell lung cancer

    DEFF Research Database (Denmark)

    Djärv, Emma; Nyman, Jan; Baumann, Pia

    2006-01-01

    of       SBRT of T1-T2N0M0 inoperable NSCLC in a dummy run oriented on volumes and       doses. Six Scandinavian centres participated. Each centre received       CT-scans covering the whole lung volumes of two patients with instructions       to follow the study protocol when outlining tumour and target volumes......In forthcoming multicentre studies on stereotactic body radiotherapy       (SBRT) compliance with volume and dose prescriptions will be mandatory to       avoid unnecessary heterogeneity bias. To evaluate compliance in a       multicentre setting we used two cases from an ongoing phase II study......,       prescribing doses and creating dose plans. Volumes and doses of the 12       dose plans were evaluated according to the study protocol. For the two       patients the GTV volume range was 24 to 39 cm3 and 26 to 41 cm3,       respectively. The PTV volume range was 90 to 116 cm3, and 112 to 155 cm3...

  1. Evolution of Si-2N2Nb island configuration on NbN (0 0 1) surface: A first-principles calculation

    International Nuclear Information System (INIS)

    Ren, Yuan; Xia, Qing; Zhang, Chao; Liu, Xuejie; Li, Zhi; Zhang, Fucheng

    2015-01-01

    Graphical abstract: - Highlights: • We investigate the separation and gathering of Nb, Si and N atom around come to NbN grain. • The adsorption and diffusion of single atom around 2N2Nb island were calculated by DFT. • The adsorption behavior of Si-2N2Nb island on NbN (0 0 1) surface were investigated. • The evolution of Si-2N2Nb island on NbN (0 0 1) were calculated by nudged elastic band. - Abstract: The separation and aggregation of Nb, Si, and N atoms around the NbN grain during the deposition of the Nb–Si–N nanocomposite film were discussed. The evolution behavior of the 2N2Nb island and the adsorption and diffusion energy of Nb, Si, and N atoms around the island on the NbN (0 0 1) surface were investigated using the first-principles method based on density functional theory. Results indicated that the most stable configuration of the Nb–Si–N island was the combination of Nb and N atoms to form the island and the possible aggregation of the Si atom to diagonal Nb atom outside the island. Substitution solid solution was eventually formed, in which the Nb atom of the 2N2Nb island was replaced by the Si atom during deposition. However, the Si atom was easily replaced by the Nb atom at the site with abundant Nb atoms. The diffusion energy of the evolution from Nb-2N1Nb1Si to Si-2N2Nb was 1.58 eV, and the total energy of the configuration decreased. Moreover, the interface of Si and NbN grains tended to separate. The highest energy adsorption sites for Nb, Si, N atoms adsorbed on the NbN (0 0 1) surface around the 2N2Nb island were P3, P1, and P2, respectively. The adsorption energies of Nb, Si, and N atoms on the NbN (0 0 1) surface around the 2N2Nb island were 7.3067, 5.3521, and 6.7113 eV, respectively, and their diffusion energies around the 2N2Nb island were 2.62, 1.35, and 5.094 eV, respectively. The low adsorption and diffusion energies of active Si atoms promoted the distribution of Nb and N atoms during deposition. Furthermore, the NbN

  2. Spontaneous formation of {1 1-bar 0 1} InGaN quantum wells on a (1 1 2-bar 2) GaN template and their electroluminescence characteristics

    International Nuclear Information System (INIS)

    Masui, Hisashi; Kamber, Derrick S; Brinkley, Stuart E; Wu, Feng; Baker, Troy J; Zhong, Hong; Iza, Michael; Speck, James S; Nakamura, Shuji; DenBaars, Steven P

    2010-01-01

    Discrete dies of the light-emitting diode (LED) fabricated on a (1 1 2-bar 2)-oriented GaN template exhibited electroluminescence peaked at 467 nm and optical output power was greater than 200 µW at 20 mA. The LED was found to have quantum well structure grown on spontaneously formed {1 1-bar 0 1} facets, confirmed via transmission electron microscopy. Polarization switching was observed in luminescence perpendicular to the device surface: the dominant polarization was parallel to [1-bar 1-bar 2 3]. The device structure was shown to be advantageous for photovoltaic cell applications by evaluating photo-induced current, although piezoelectric effects on photocurrent were not explicitly determined. The filling rate of band-edge states was estimated to be 0.025 eV per decade of current via low-temperature electroluminescence measurements

  3. Electronic properties of in-plane phase engineered 1T'/2H/1T' MoS2

    Science.gov (United States)

    Thakur, Rajesh; Sharma, Munish; Ahluwalia, P. K.; Sharma, Raman

    2018-04-01

    We present the first principles studies of semi-infinite phase engineered MoS2 along zigzag direction. The semiconducting (2H) and semi-metallic (1T') phases are known to be stable in thin-film MoS2. We described the electronic and structural properties of the infinite array of 1T'/2H/1T'. It has been found that 1T'phase induced semi-metallic character in 2H phase beyond interface but, only Mo atoms in 2H phase domain contribute to the semi-metallic nature and S atoms towards semiconducting state. 1T'/2H/1T' system can act as a typical n-p-n structure. Also high holes concentration at the interface of Mo layer provides further positive potential barriers.

  4. VizieR Online Data Catalog: Orion Integral Filament ALMA+IRAM30m N2H+(1-0) data (Hacar+, 2018)

    Science.gov (United States)

    Hacar, A.; Tafalla, M.; Forbrich, J.; Alves, J.; Meingast, S.; Grossschedl, J.; Teixeira, P. S.

    2018-01-01

    Combined ALMA+IRAM30m large-scale N2H+(1-0) emission in the Orion ISF. Two datasets are presented here in FITS format: 1.- Full data cube: spectral resolution = 0.1 kms-1 2.- Total integrated line intensity (moment 0) map Units are in Jy/beam See also: https://sites.google.com/site/orion4dproject/home (2 data files).

  5. Radiologically occult scaphoid and wrist fractures. Preliminary results in comparison of 0.2-T and 1.0-T units

    International Nuclear Information System (INIS)

    Breitenseher, M.J.; Trattnig, S.; Happel, B.; Bankier, A.; Rand, T.; Imhof, H.; Gaebler, C.; Kukla, C.

    1997-01-01

    The study was performed to determine the diagnostic value of different MR systems and field strengths in patients with occult scaphoid and wrist fractures. Twelve patients with clinical suspicion of a scaphoid fracture but normal plain radiographs were examined by MRI. A dedicated 0.2-T unit (Esaote) and a 1.0-T unit (NT10, Philips) were used. Coronal T1W-SE, STIR, and T2*W-GE sequences were obtained with both systems. Images were evaluated for a bone marrow abnormality, a trabecular or cortical fracture line, and were compared to the 6-week follow-up radiographs. Seven wrist fractures were found at 0.2 T and 1.0 T, proven in the follow-up radiographs. A bone marrow abnormality was present in all seven fractures on both systems. Trabecular and cortical fracture lines were visualized at 0.2 T in four cases and at 1.0 T in seven cases. Low-field MR imaging at 0.2 T and mid-field MR imaging at 1.0 T seem to be equivalent in the diagnosis of a fracture in radiographically occult scaphoid and wrist fractures. In the visualization of fracture details, important for therapeutic and prognostic considerations, 1.0 T seems to be superior. (orig.) [de

  6. CT characteristics and pathological implications of early stage (T1N0M0) lung adenocarcinoma with pure ground-glass opacity

    Energy Technology Data Exchange (ETDEWEB)

    Jin, Xin; Zhao, Shao-hong; Wu, Jian; Wu, Chong-chong; Chang, Rui-ping; Ju, Hai-yue [Chinese PLA General Hospital, Department of Radiology, Beijing (China); Gao, Jie; Wang, Dian-jun [Chinese PLA General Hospital, Department of Pathology, Beijing (China)

    2015-09-15

    To analyze the CT characteristics and pathological classification of early lung adenocarcinoma (T1N0M0) with pure ground-glass opacity (pGGO). Ninety-four lesions with pGGO on CT in 88 patients with T1N0M0 lung adenocarcinoma were selected from January 2010 to December 2012. All lesions were confirmed by pathology. CT appearances were analyzed including lesion location, size, density, uniformity, shape, margin, tumour-lung interface, internal and surrounding malignant signs. Lesion size and density were compared using analysis of variance, lesion size also assessed using ROC curves. Gender of patients, lesion location and CT appearances were compared using χ2-test. There were no significant differences in gender, lesion location and density with histological invasiveness (P > 0.05). The ROC curve showed that the possibility of invasive lesion was 88.73 % when diameter of lesion was more than 10.5 mm. There was a significant difference between lesion uniformity and histological invasiveness (P = 0.01). There were significant differences in margin, tumour-lung interface, air bronchogram with histological invasiveness (P = 0.02,P = 0.00,P = 0.048). The correlation index of lesion size and uniformity was r = 0.45 (P = 0.00). The lesion size and uniformity, tumour-lung interface and the air bronchogram can help predict invasive extent of early stage lung adenocarcinoma with pGGO. (orig.)

  7. Crystal structure and optical property of complex perovskite oxynitrides ALi0.2Nb0.8O2.8N0.2, ANa0.2Nb0.8O2.8N0.2, and AMg0.2Nb0.8O2.6N0.4 (A = Sr, Ba)

    Science.gov (United States)

    Moon, Keon Ho; Avdeev, Maxim; Kim, Young-Il

    2017-10-01

    Oxynitride type complex perovskites AM0.2Nb0.8O3-xNx (A = Sr, Ba; M = Li, Na, Mg) were newly synthesized by the solid state diffusion of Li+, Na+, or Mg2+ into the layered oxide, A5Nb4O15, with concurrent O/N substitution. Neutron and synchrotron X-ray Rietveld refinement showed that SrLi0.2Nb0.8O2.8N0.2, SrNa0.2Nb0.8O2.8N0.2, and SrMg0.2Nb0.8O2.6N0.4 had body-centered tetragonal symmetry (I4/mcm), while those with A = Ba had simple cubic symmetry (Pm 3 ̅ m). In the tetragonal Sr-compounds, the nitrogen atoms were localized on the c-axial 4a site. However, the octahedral cations, M/Nb (M = Li, Na, Mg) were distributed randomly in all six compounds. The lattice volume of AM0.2Nb0.8O3-xNx was dependent on various factors including the type of A and the electronegativity of M. Compared to the simple perovskites, ANbO2N (A = Sr, Ba), AM0.2Nb0.8O3-xNx had wider band gaps (1.76-2.15 eV for A = Sr and 1.65-2.10 eV for A = Ba), but significantly lower sub-gap absorption.

  8. Internal (m=1, n=1) and (m=2, n=1) resistive modes in the toroidal Tokomak with circular cross sections

    International Nuclear Information System (INIS)

    Bussac, M.N.; Pellat, R.; Edery, D.; Soule, J.L.

    1976-01-01

    A linear analysis is presented of the toroidal coupling between the internal resistive modes (m=1, n=1) and (m=2, n=1) in the Tokomak with circular cross sections. One includes the resistive and diamagnetic effects in the singular layers where the safety factor q takes respectively the values one and two. By expanding the MHD equations in powers of epsilon, the local inverse of the aspect ratio, one obtains a system of two coupled equations for the harmonic amplitudes. When the shear is finite on q=1, the toroidal coupling is negligible. In the opposite limit, one can explain: the experimental behaviour of the (m=1, n=1) mode before the internal disruption; the simultaneous observation of the modes (m=1, n=1) and [de

  9. Long-term follow-up and salvage surgery in patients with T2N0M0 squamous cell carcinoma of the glottic larynx who received concurrent chemoradiation therapy with carboplatin (CBDCA) - AUC 1.5 vs AUC 2.0.

    Science.gov (United States)

    Furusaka, Tohru; Matsuda, Hiroshi; Saito, Tsutomu; Katsura, Yoshihisa; Ikeda, Minoru

    2012-11-01

    Patients who received concurrent chemoradiation therapy with carboplatin were followed up on a long-term basis. In 25 patients treated with carboplatin at an AUC of 2.0 mg/ml, the complete response (CR), 10-year survival, and 10-year larynx preservation rates were 96.0%, 91.1%, and 75.2%, respectively, and the safety margin for partial laryngectomy was 4 mm from the gross tumor. To perform long-term follow-up of the therapeutic outcomes of concurrent chemoradiation therapy and salvage surgery to determine the additive and synergistic effects of anticancer drugs combined with chemoradiotherapy. Fifty male patients (aged 33-76 years) with untreated T2N0M0 squamous cell carcinoma of the glottic larynx were included. Carboplatin was intravenously administered once a week for 4 weeks. Radiotherapy was delivered by an external beam of 4 MV linac X-ray (total = 66 Gy). The AUC 1.5 combination group showed overall response, CR, 5-year survival, 10-year survival, 5-year larynx preservation, and 10-year larynx preservation rates of 100.0%, 68.0%, 83.4%, 77.0%, 75.2%, and 75.2%, respectively. The AUC 2.0 combination group showed corresponding rates of 100%, 96.0%, 95.7%, 91.1%, 82.9%, and 72.7%, respectively. The most common side effects of grade 3 or more were leukopenia, neutropenia, and mucositis (stomatitis), and all were reversible. Thirteen patients (52.0%) in the AUC 1.5 combination group and nine patients (36.0%) in the AUC 2.0 combination group required salvage surgery. Histologically, concurrent chemoradiation therapy with carboplatin caused more severe cancer tissue degeneration. Pathological examinations indicated that the safety margin for partial laryngectomy was 4 mm from the gross tumor.

  10. Identification of a High-Risk Group Among Patients With Oral Cavity Squamous Cell Carcinoma and pT1-2N0 Disease

    Energy Technology Data Exchange (ETDEWEB)

    Liao, Chun-Ta [Department of Otorhinolaryngology, Head and Neck Surgery, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Department of Head and Neck Oncology Group, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Lin, Chien-Yu [Department of Head and Neck Oncology Group, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Department of Radiation Oncology, Chang Gung Memorial Hospital and Graduate Institute of Clinical Medical Sciences of Chang Gung University, Taoyuan, Taiwan (China); Fan, Kang-Hsing [Department of Otorhinolaryngology, Head and Neck Surgery, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Department of Radiation Oncology, Chang Gung Memorial Hospital and Graduate Institute of Clinical Medical Sciences of Chang Gung University, Taoyuan, Taiwan (China); Wang, Hung-Ming [Department of Otorhinolaryngology, Head and Neck Surgery, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Department of Hema-Oncology, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Ng, Shu-Hang [Department of Otorhinolaryngology, Head and Neck Surgery, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Department of Diagnostic Radiology, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Lee, Li-Yu; Hsueh, Chuen [Department of Head and Neck Oncology Group, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Department of Pathology, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Chen, I-How; Huang, Shiang-Fu; Kang, Chung-Jan [Department of Otorhinolaryngology, Head and Neck Surgery, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); Department of Head and Neck Oncology Group, Chang Gung Memorial Hospital and Chang Gung University, Taoyuan, Taiwan (China); and others

    2012-01-01

    Purpose: In the American Joint Committee on Cancer 2010 classification system, pT1-2N0 oral cavity squamous cell carcinoma (OSCC) is considered an early-stage cancer treatable with surgery alone (National Comprehensive Cancer Network 2010 guidelines). Our aim was to evaluate the feasibility of surgery alone for pT1-2N0 OSCC patients. Methods and Materials: Among 1279 previously untreated OSCC patients referred to our hospital between January 1996 and May 2008, we identified 457 consecutive patients with pT1-2N0 disease. All had radical tumor excision with neck dissection. A total of 387 patients showing pathologic margins greater than 4 mm and treated by surgery alone were included in the final analysis. All were followed up for at least 24 months after surgery or until death. The 5-year rates of control, distant metastasis, and survival were the main outcome measures. Results: The 5-year rates in the entire group of pT1-2N0 patients were as follows: local control, 91%; neck control, 92%; distant metastases, 1%; disease-free survival, 85%; disease-specific survival, 93%; and overall survival, 84%. Multivariate analysis identified poor differentiation and pathologic tumor depth of 4 mm or greater as independent risk factors for neck control, disease-free survival, and disease-specific survival. A scoring system using poor differentiation and tumor depth was formulated to define distinct prognostic groups. The presence of both poorly differentiated tumors and a tumor depth of 4 mm or greater resulted in significantly poorer 5-year neck control (p < 0.0001), disease-free (p < 0.0001), disease-specific (p < 0.0001), and overall survival (p = 0.0046) rates. Conclusion: The combination of poor differentiation and pathologic tumor depth of 4 mm or greater identified a subset of pT1-2N0 OSCC patients with poor outcome, who may have clinical benefit from postoperative adjuvant radiotherapy.

  11. Synthesis and structure of the extended phosphazane ligand [(1,4-C6H4){N(μ-PN(t)Bu)2N(t)Bu}2](4).

    Science.gov (United States)

    Sevilla, Raquel; Less, Robert J; García-Rodríguez, Raúl; Bond, Andrew D; Wright, Dominic S

    2016-02-07

    The reaction of the phenylene-bridged precursor (1,4-C6H4)[N(PCl2)2]2 with (t)BuNH2 in the presence of Et3N gives the new ligand precursor (1,4-C6H4)[N(μ-N(t)Bu)2(PNH(t)Bu)2]2, deprotonation of which with Bu2Mg gives the novel tetraanion [(1,4-C6H4){N(μ-N(t)Bu)2(PN(t)Bu)2}2](4-).

  12. Iridium-192 curietherapy for T1 and T2 epidermoid carcinomas of the floor of mouth

    International Nuclear Information System (INIS)

    Mazeron, J.J.; Grimard, L.; Raynal, M.; Haddad, E.; Piedbois, P.; Martin, M.; Marinello, G.; Nair, R.C.; Le Bourgeois, J.P.; Pierquin, B.

    1990-01-01

    From 1970 to 1986, 117 patients with T1 (47) or T2 (70) epidermoid carcinomas of the floor of the mouth (SCC) were treated by iridium-192 implantation (192 Ir). The dose was prescribed according to the Paris System and varied over those years. Follow-up information was available on 116 patients. There were 46 T1N0, 47 T2N0, and 23 T2N1-3. Neck management varied for the 93 N0 patients consisting of surveillance (24 T1, 17 T2) or elective neck dissection (22 T1:all pN-, 30 T2: 20 pN-, 10 pN+). Cause specific survival rates were 94% for T1N0, 61.5% for T2N0, and 28% for T2N1-3 at 5 years. Primary local control was 93.5%, 74.5%, and 65%, respectively, and 98%, 79%, and 65% after salvage. Patients with gingival extension or a tumor size over 3 cm (T2b) had a local control of 50% (9/18) and 58% (15/26), respectively. Nodal control was 93.5% for Stage I, 85% for Stage II, and 48% for T2N1-3 patients. There was no difference in nodal control with regard to treatment policy for Stage I-II patients. There were few complications including three deaths: two from surgery and one from 192 Ir. Nodal status, tumor size defined as T1, T2a (less than or equal to 3 cm), T2b (greater than 3 cm), and gingival extension were the only independent prognostic factors. The management of T1N0 and T2N0 SCC by 192 Ir to a dose of 65 or 70 Gy, using the Paris System, is recommended for lesions 3 cm or less and without gingival extension

  13. Thermospheric neutral temperatures derived from charge-exchange produced N{sub 2}{sup +} Meinel (1,0) rotational distributions

    Energy Technology Data Exchange (ETDEWEB)

    Mutiso, C.K.; Zettergren, M.D.; Hughes, J.M.; Sivjee, G.G. [Embry-Riddle Aeronautical Univ., Daytona Beach, FL (United States). Space Physics Research Lab.

    2013-06-01

    Thermalized rotational distributions of neutral and ionized N{sub 2} and O{sub 2} have long been used to determine neutral temperatures (T{sub n}) during auroral conditions. In both bright E-region (T{sub n} in the E-region cannot likewise be used to obtain T{sub n} in the F-region. Nevertheless, charge-exchange reactions between high-altitude (>or similar 130 km) species provide an exception to this situation. In particular, the charge-exchange reaction O{sup +}({sup 2}D)+N{sub 2}(X) {yields}N{sub 2}{sup +} (A{sup 2}{Pi}{sub u}, {nu}' = 1) + O({sup 3}P) yields thermalized N{sub 2}{sup +} Meinel (1,0) emissions, which, albeit weak, can be used to derive neutral temperatures at altitudes of {proportional_to} 130 km and higher. In this work, we present N{sub 2}{sup +} Meinel (1,0) rotational temperatures and brightnesses obtained at Svalbard, Norway, during various auroral conditions. We calculate T{sub n} at thermospheric altitudes of 130-180 km from thermalized rotational populations of N{sub 2}{sup +} Meinel (1,0); these emissions are excited by soft electron (1 keV) impact and charge-exchange reactions. We model the contributions of the respective excitation mechanisms, and compare derived brightnesses to observations. The agreement between the two is good. Emission heights obtained from optical data, modeling, and ISR data are consistent. Obtaining thermospheric T{sub n} from chargeexchange excited N{sub 2}{sup +} Meinel (1,0) emissions provides an additional means of remotely sensing the neutral atmosphere, although certain limiting conditions are necessary. These include precipitation of low-energy electrons, and a non-sunlit emitting layer. (orig.)

  14. Identification of a High-Risk Group Among Patients With Oral Cavity Squamous Cell Carcinoma and pT12N0 Disease

    International Nuclear Information System (INIS)

    Liao, Chun-Ta; Lin, Chien-Yu; Fan, Kang-Hsing; Wang, Hung-Ming; Ng, Shu-Hang; Lee, Li-Yu; Hsueh, Chuen; Chen, I-How; Huang, Shiang-Fu; Kang, Chung-Jan

    2012-01-01

    Purpose: In the American Joint Committee on Cancer 2010 classification system, pT12N0 oral cavity squamous cell carcinoma (OSCC) is considered an early-stage cancer treatable with surgery alone (National Comprehensive Cancer Network 2010 guidelines). Our aim was to evaluate the feasibility of surgery alone for pT12N0 OSCC patients. Methods and Materials: Among 1279 previously untreated OSCC patients referred to our hospital between January 1996 and May 2008, we identified 457 consecutive patients with pT12N0 disease. All had radical tumor excision with neck dissection. A total of 387 patients showing pathologic margins greater than 4 mm and treated by surgery alone were included in the final analysis. All were followed up for at least 24 months after surgery or until death. The 5-year rates of control, distant metastasis, and survival were the main outcome measures. Results: The 5-year rates in the entire group of pT12N0 patients were as follows: local control, 91%; neck control, 92%; distant metastases, 1%; disease-free survival, 85%; disease-specific survival, 93%; and overall survival, 84%. Multivariate analysis identified poor differentiation and pathologic tumor depth of 4 mm or greater as independent risk factors for neck control, disease-free survival, and disease-specific survival. A scoring system using poor differentiation and tumor depth was formulated to define distinct prognostic groups. The presence of both poorly differentiated tumors and a tumor depth of 4 mm or greater resulted in significantly poorer 5-year neck control (p < 0.0001), disease-free (p < 0.0001), disease-specific (p < 0.0001), and overall survival (p = 0.0046) rates. Conclusion: The combination of poor differentiation and pathologic tumor depth of 4 mm or greater identified a subset of pT12N0 OSCC patients with poor outcome, who may have clinical benefit from postoperative adjuvant radiotherapy.

  15. Investigation of characteristics of sup 2 sup 0 sup 1 Tl -> sup 2 sup 0 sup 1 Hg

    CERN Document Server

    Kharitonov, V V

    2002-01-01

    The estimated intensities of transitions on the ground and first-excited levels in the sup 2 sup 0 sup 1 Hg at the decay of sup 2 sup 0 sup 1 Tl and estimated constants lg ft are obtained from the analysis of the relative intensities of the mercury M sub 4 N sub 6 sub , sub 7 N sub 6 sub , sub 7 Auger-electron line, initiated by the e-capture and of the conversion O sub 3 -mercury line, due to the nuclear transition with the energy 1.56 keV

  16. The high affinity selectin glycan ligand C2-O-sLex and mRNA transcripts of the core 2 β-1,6-N-acetylglusaminyltransferase (C2GnT1) gene are highly expressed in human colorectal adenocarcinomas

    International Nuclear Information System (INIS)

    St Hill, Catherine A; Farooqui, Mariya; Mitcheltree, Gregory; Gulbahce, H Evin; Jessurun, Jose; Cao, Qing; Walcheck, Bruce

    2009-01-01

    The metastasis of cancer cells and leukocyte extravasation into inflamed tissues share common features. Specialized carbohydrates modified with sialyl Lewis x (sLe x ) antigens on leukocyte membranes are ligands for selectin adhesion molecules on activated vascular endothelial cells at inflammatory sites. The activity of the enzyme core 2 β1,6 N-acetylglucosaminyltransferase (C2GnT1) in leukocytes greatly increases their ability to bind to endothelial selectins. C2GnT1 is essential for the synthesis of core 2-branched O-linked carbohydrates terminated with sLe x (C2-O-sLe x ). Our goal was to determine the expression profiles of C2-O-sLe x in the malignant progression and metastasis of colorectal adenocarcinomas. The well characterized CHO-131 monoclonal antibody (mAb) specifically recognizes C2-O-sLe x present in human leukocytes and carcinoma cells. Using CHO-131 mAb, we investigated whether C2-O-sLe x was present in 113 human primary colorectal adenocarcinomas, 10 colorectal adenomas, 46 metastatic liver tumors, 28 normal colorectal tissues, and 5 normal liver tissues by immunohistochemistry. We also examined mRNA levels of the enzyme core 2 β1,6-N-acetylglucosaminyltransferase (C2GnT1) in 20 well, 15 moderately, and 2 poorly differentiated colorectal adenocarcinomas, and in 5 normal colorectal tissues by using quantitative real-time polymerase chain reactions (RT-PCR). We observed high reactivity with CHO-131 mAb in approximately 70% of colorectal carcinomas and 87% of metastatic liver tumors but a lack of reactivity in colorectal adenomas and normal colonic and liver tissues. Positive reactivity with CHO-131 mAb was very prominent in neoplastic colorectal glands of well to moderately differentiated adenocarcinomas. The most intense staining with CHO-131 mAb was observed at the advancing edge of tumors with the deepest invasive components. Finally, we analyzed C2GnT1 mRNA levels in 37 colorectal adenocarcinomas and 5 normal colorectal tissues by RT

  17. Specific immunotherapy effect on peripheral blood T1/T2 lymphocytes in atopic patients

    Directory of Open Access Journals (Sweden)

    Manuela Rebordão

    2006-03-01

    , characteristically increased in atopic disease. The increase of IL-10 that we found in our study suggested the existence of a profile T2 regulatory population, more evident in CD8+T lymphocytes. Resumo: A coordenação das características humorais e celulares da resposta alérgica, sabe-se hoje, está dependente da regulação por linfócitos T. As vacinas de alergénios são uma terapêutica que consegue modular a resposta das células T, e cujos mecanismos imunológicos permanecem incompletamente esclarecidos. Objectivo: Avaliar o efeito da imunoterapia, após um ano de tratamento, na expressão de citocinas de perfil T1 e T2 em linfócitos de sangue periférico de doentes atópicos. Material e métodos: Estudaram-se dez doentes atópicos sensibilizados a aeroalergénios comuns a fazerem vacinas de alergénios num período médio de um ano. Dentre estes, seis foram estudados antes e após a vacina. Como controlo estudou-se um grupo atópico sem imunoterapia constituído por 14 doentes também sensibilizados a aeroalergénios comuns e um grupo de indivíduos não atópicos, saudáveis, constituído por 7 elementos. A activação dos linfócitos T fez-se com PMA, ionomicina e brefeldina e estudaram-se as citocinas intracitoplasmáticas IFN-γ, IL-4, IL-5 e IL-10 por citometria de fluxo. Procedeu-se a análise estatística por testes não paramétricos (Teste de Mann-Whitney U e Wilcoxon, considerando-se significativo p≤0,05. Resultados: A expressão de IL-4 e IL-5 nas células T, caracteristicamente aumentada nos doentes atópicos, respectivamente 13,8 (3,1-31,8 e 6,7% (1,0-20,4, é significativamente mais baixa no grupo que realizou a imunoterapia 5,4 (2,9-15,6 p= 0,007 e 2,1% (0,6-4,8 p=0,035 não diferindo do grupo controlo não atópico 5,1 (4,1-6,9 e 1,0 (0,4-2,1. Os níveis de IFN-γ não variaram significativamente entre os três grupos estudados, mas a raz

  18. Identification of candidates for postmastectomy radiotherapy in patients with pT3N0M0 breast cancer

    International Nuclear Information System (INIS)

    Hamamoto, Yasushi; Ohsumi, Shozo; Aogi, Kenjiro; Takashima, Shigemitsu; Shinohara, Shuichi; Nakajima, Naomi; Kataoka, Masaaki

    2013-01-01

    There is still controversy concerning the indication of postmastectomy radiotherapy (PMRT) for pT3N0M0 breast cancer. To identify the candidates for PMRT in this subset, we investigated failure patterns, and searched for risk factors for isolated locoregional failure in pT3N0M0 breast cancer after mastectomy without PMRT. Among 1,176 patients who received mastectomy without PMRT for untreated unilateral breast cancer between 1990 and 2002, 64 patients (5%) had pT3N0M0 breast cancer (age 30-81 years; median 52.5 years). Isolated locoregional failure as the initial failure occurred in three patients. For all 64 patients, the 8-year failure-free survival rate, the isolated locoregional failure-free rate, and the distant failure-free rate were 76, 93, and 82%, respectively. Incidence of isolated locoregional failure as the initial failure was 18% (2/11) for patients 40 years or younger and 2% (1/53) for patients older than 40 years. The 8-year isolated locoregional failure-free rates were 73% for patients 40 years or younger and 98% for patients older than 40 years (p=0.0135). Concerning pT3N0M0 breast cancer, incidence of isolated locoregional failure was comparatively low after mastectomy without PMRT. Routine use of PMRT for all pT3N0M0 patients seemed to be unacceptable. PMRT may be useful for younger patients because of the comparatively high incidence of isolated locoregional failure. Because of the small number of cases in our series, further studies are necessary to determine the usefulness of PMRT for younger patients with pT3N0M0 breast cancer. (author)

  19. Solvothermal synthesis and characterisation of new one-dimensional indium and gallium sulphides: [C1N4H26]0.5[InS2] and [C1N4H26]0.5[GaS2

    International Nuclear Information System (INIS)

    Vaqueiro, Paz

    2006-01-01

    Two new main group metal sulphides, [C 1 N 4 H 26 ] 0.5 [InS 2 ] (1) and [C 1 N 4 H 26 ] 0.5 [GaS 2 ] (2) have been prepared solvothermally in the presence of 1,4-bis(3-aminopropyl)piperazine and their crystal structures determined by single-crystal X-ray diffraction. Both compounds are isostructural and crystallise in the monoclinic space group P2 1 /n (Z=4), with a=6.5628(5), b=11.2008(9), c=12.6611(9) A and β=94.410(4) o (wR=0.035) for compound (1) and a=6.1094(5), b=11.2469(9), c=12.7064(10) A and β=94.313(4) o (wR=0.021) for compound (2). The structure of [C 1 N 4 H 26 ] 0.5 [MS 2 ] (M=In,Ga) consists of one-dimensional [MS 2 ] - chains which run parallel to the crystallographic a axis and are separated by diprotonated amine molecules. These materials represent the first example of solvothermally prepared one-dimensional gallium and indium sulphides. -- Graphical abstract: [C 1 N 4 H 26 ] 0.5 [InS 2 ] and [C 1 N 4 H 26 ] 0.5 [GaS 2 ], prepared under solvothermal conditions, consist of one-dimensional [MS 2 ] - chains separated by diprotonated 1,4-bis(3-aminopropyl)piperazine molecules

  20. Excess molar volumes of the ternary system {methylcyclohexane (1)+cyclohexane (2)+n-alkanes (3)} at T=298.15 K

    International Nuclear Information System (INIS)

    Iloukhani, Hossein; Rezaei-Sameti, Mahdi

    2005-01-01

    Densities were experimentally determined in the whole range of composition at T=298.15 K for the ternary system {methylcyclohexane (1)+cyclohexane (2)+n-alkanes (3)} and for the seven corresponding binary systems. The n-alkanes include n-hexane, n-heptane, and n-octane. Excess molar volumes, V E , were calculated for the binaries and ternaries systems. The V 123 E data are positive over the entire range of composition for the systems {methylcyclohexane (1)+cyclohexane (2)+n-heptane (3) or n-octane (3)} at three fixed compositions (f m =X 1 /X 2 ). For the system {methylcyclohexane (1)+cyclohexane (2)+n-hexane (3)}, the V E values showed positive for f m =0.3 and negative for f m =3. The V E data exhibit, an inversion in sign in the mixture containing f m =1 for later ternary system. Several empirical expressions are used to predict and correlate the ternary excess molar volumes from experimental results on the constituted binaries and analyzed to gain insight about liquid mixture interactions

  1. Excitations of the isobaric analog states T=0, 1, 2 and 2 in isobars 60Zn (Tz=0), 60Cu (Tz=1) and 60Ni (Tz=2) by the two-nucleon (2p, pn, 2n) stripping transfer reactions of 16O ions on 58Ni nuclei

    International Nuclear Information System (INIS)

    Okuma, Yasuhiko

    1992-01-01

    The isobaric analog states (IAS's) T=0, 1, 2 and 2 in isobars 60 Zn (Tz=0), 60 Cu (Tz=1) and 60 Ni (Tz=2) were studied by the three types of two-nucleon (2p, pn, 2n) stripping transfer reactions induced by the same beams 16 O and targets 58 Ni at an incident energy 80 MeV. The excitation energies of observed IAS's are in good fits with those calculated theoretically. The g'nd state 2 + , T=1 in 60 Cu may not be populated vy the ( 16 O, 14 N) reaction. The mutual excitation ( 16 O, 14 N * ) may be considered in the present population in 50 Cu. The isospin aspects of these reactions are quite prominent. All angular distributions of these IAS's have a forward peaked shape. Those of the O + states show a strongly oscillated pattern. Those of the 2 + states have no evidences of the clear oscillations. The similarities are observed between the angular distributions of IAS's. The EFR-DWBA calculations, in which the direct one-step cluster transferrs of two nucleons are assumed, reproduce reasonably the data points. The similarities between the heavy and the light ion induced two-nucleon stripping transfer reactions appear in both the reaction mechanisms and the spectroscopies of residual nuclei. The excitations of these IAS's will be an appearances of the single particle properties of transferred two-nucleons. (author)

  2. Prognostic stratification of patients with T3N1M0 non-small cell lung cancer: which phase should it be?

    Science.gov (United States)

    Kilicgun, Ali; Tanriverdi, Ozgur; Turna, Akif; Metin, Muzaffer; Sayar, Adnan; Solak, Okan; Urer, Nur; Gurses, Atilla

    2012-06-01

    In the 1997 revision of the TNM staging system for lung cancer, patients with T3N0M0 disease were moved from stage IIIA to stage IIB since these patients have a better prognosis. Despite this modification, the local lymph node metastasis remained the most important prognostic factor in patients with lung cancer. The present study aimed to evaluate the prognosis of patients with T3N1 disease as compared with that of patients with stages IIIA and IIB disease. During 7-year period, 313 patients with non-small cell lung cancer (297 men, 16 women) who had resection were enrolled. The patients were staged according the 2007 revision of Lung Cancer Staging by American Joint Committee on Cancer. The Kaplan-Meier statistics was used for survival analysis, and comparisons were made using Cox proportional hazard method. The 5-year survival of patients with stage IIIA disease excluding T3N1 patients was 40%, whereas the survival of the patients with stage IIB disease was 66% at 5 years. The 5-year survival rates of stage III T3N1 patients (single-station N1) was found to be higher than those of patients with stage IIIA disease (excluding pT3N1 patients, P = 0.04), while those were found to be similar with those of patients with stage IIB disease (P = 0.4). Survival of the present cohort of patients with T3N1M0 disease represented the survival of IIB disease rather than IIIA non-small cell lung cancer. Further studies are needed to suggest further revisions in the recent staging system regarding T3N1MO disease.

  3. M1 and M2 Monocytes in Rheumatoid Arthritis: A Contribution of Imbalance of M1/M2 Monocytes to Osteoclastogenesis

    Directory of Open Access Journals (Sweden)

    Shoichi Fukui

    2018-01-01

    Full Text Available ObjectivesWe investigated the relationships among M1 monocytes, M2 monocytes, osteoclast (OC differentiation ability, and clinical characteristics in patients with rheumatoid arthritis (RA.MethodsPeripheral blood mononuclear cells (PBMCs were isolated from RA patients and healthy donors, and we then investigated the number of M1 monocytes or M2 monocytes by fluorescence-activated cell sorting. We also obtained and cultured CD14-positive cells from PBMCs from RA patients and healthy donors to investigate OC differentiation in vitro.ResultsForty RA patients and 20 healthy donors were included. Twenty-two patients (55% were anticitrullinated protein antibody (ACPA positive. The median M1/M2 ratio was 0.59 (0.31–1.11, interquartile range. There were no significant differences between the RA patients and healthy donors. There was a positive correlation between the M1/M2 ratio and the differentiated OC number in vitro in RA patients (ρ = 0.81, p < 0.001. The ACPA-positive patients had significantly higher M1/M2 ratios in vivo (p = 0.028 and significantly greater numbers of OCs in vitro (p = 0.005 than the ACPA-negative patients. Multivariable regression analysis revealed that the M1/M2 ratio was the sole significant contribution factor to in vitro osteoclastogenesis. RA patients with M1/M2 ratios >1 (having relatively more M1 monocytes had higher C-reactive protein and erythrocyte sedimentation rates than RA patients with M1/M2 ratios ≤1. M1-dominant monocytes in vitro produced higher concentrations of interleukin-6 upon stimulation with lipopolysaccharide than M2 monocytes.ConclusionM1/M2 monocytes imbalance strongly contributes to osteoclastogenesis of RA patients. Our findings cast M1 and M2 monocyte subsets in a new light as a new target of treatments for RA to prevent progression of osteoclastic bone destruction.

  4. Radiation therapy for T1,2 glottic carcinoma: impact of overall treatment time on local control

    International Nuclear Information System (INIS)

    Nishimura, Yasumasa; Nagata, Yasushi; Okajima, Kaoru; Mitsumori, Michihide; Hiraoka, Masahiro; Masunaga, Shin-ichirou; Ono, Koji; Shoji, Kazuhiko; Kojima, Hisayosi

    1996-01-01

    Purpose: Local control probabilities of T1,2 glottic laryngeal cancer were evaluated in relation to dose and fractionation of radiation therapy (RT). Materials and methods: Between 1975 and 1993, 96 T1N0M0 glottic cancers and 32 T2N0M0 glottic cancers were treated with definitive RT. Total RT dose was 60-66 Gy/2 Gy for most of the T1 and T2 tumors, although 10 T2 tumors were treated with hyperfractionation (72-74.4 Gy/1.2 Gy bid). Of the 128 patients, 90 T1 glottic tumors and 30 T2 glottic tumors were followed for >2 years after treatment. Multivariate analyses using the Cox proportional hazards model and a logistic regression analysis were performed to evaluate the significance of prognostic variables on local control. Results: The 5-year local control probability for T1 tumors was 85%, whereas that for T2 tumors was 71%. Multivariate analyses demonstrated that only overall treatment time (OTT) was a significant variable for local control. Total RT dose, normalized total doses at a fraction size of 2 Gy, and fraction size were not significant. Local control probability of T1 tumors with an OTT of 42-49 days was significantly higher than that of tumors with an OTT of >49 days (P < 0.02). Only a 1-week interruption of RT, due to holidays, significantly reduced the 5-year local control probability of T1 glottic tumors from 89 to 74% (P < 0.05). Conclusions: These results indicate that OTT is a significant prognostic factor for local control of T1 glottic tumors

  5. Identification of Aquifex aeolicus tRNA (m2(2G26) methyltransferase gene.

    Science.gov (United States)

    Takeda, Hiroshi; Hori, Hiroyuki; Endo, Yaeta

    2002-01-01

    The modifications of N2,N2-dimethylguanine (m2(2)G) are found in tRNAs and rRNAs from eukarya and archaea. In tRNAs, modification at position G26 is generated by tRNA (m2(2)G26) methyltransferase, which is encoded by the corresponding gene, trm1. This enzyme catalyzes the methyl-transfer from S-adenosyl-L-methionine to the semi-conserved residue, G26, via the intermediate modified base, m2G26. Recent genome sequencing project has been reported that the putative trm1 is encoded in the genome of Aquifex aeolicus, a hyper-thermophilic eubacterium as only one exception among eubacteria. In order to confirm whether this bacterial trm1 gene product is a real tRNA (m2(2)G26) methyltransferase or not, we expressed this protein by wheat germ in vitro cell-free translation system. Our biochemical analysis clearly showed that this gene product possessed tRNA (m2(2)G26) methyltransferase activity.

  6. Enrofloxacin and Probiotic Lactobacilli Influence PepT1 and LEAP-2 mRNA Expression in Poultry.

    Science.gov (United States)

    Pavlova, Ivelina; Milanova, Aneliya; Danova, Svetla; Fink-Gremmels, Johanna

    2016-12-01

    Expression of peptide transporter 1 (PepT1) and liver-expressed antimicrobial peptide 2 (LEAP-2) in chickens can be influenced by food deprivation, pathological conditions and drug administration. Effect of three putative probiotic Lactobacillus strains and enrofloxacin on the expression of PepT1 and LEAP-2 mRNA was investigated in Ross 308 chickens. One-day-old chicks (n = 24) were allocated to following groups: control (without treatment); group treated with probiotics via feed; group treated with a combination of probiotics and enrofloxacin; and a group given enrofloxacin only. The drug was administered at a dose of 10 mg kg -1 , via drinking water for 5 days. Samples from liver, duodenum and jejunum were collected 126 h after the start of the treatment. Expression levels of PepT1 and LEAP-2 were determined by real-time polymerase chain reaction and were statistically evaluated by Mann-Whitney test. Enrofloxacin administered alone or in combination with probiotics provoked a statistically significant up-regulation of PepT1 mRNA levels in the measured organ sites. These changes can be attributed to a tendency of improvement in utilization of dietary peptide and in body weight gain. LEAP-2 mRNA expression levels did not change significantly in enrofloxacin-treated chickens in comparison with control group.

  7. Absolute M1 and E2 Transition Probabilities in 2{sup 33}U

    Energy Technology Data Exchange (ETDEWEB)

    Malmskog, S G; Hoejeberg, M

    1967-08-15

    Using the delayed coincidence technique, the following half lives have been determined for different excited states in {sup 233}U: T{sub 1/2} (311.9 keV level) = (1.20 {+-} 0.15) x 10{sup -10} sec, T{sub 1/2} (340.5 keV level) = (5.2 {+-} 1.0) x 10{sup -11} sec, T{sub 1/2} (398.6 keV level) = (5.5 {+-} 2.0) x 10{sup -11} sec and T{sub 1/2} (415.8 keV level) < 3 x 10{sup -11}sec. From these half life determinations, together with earlier known electron intensities and conversion coefficients, 22 reduced B(Ml) and B(E2) transition probabilities (including 9 limits) have been deduced. The rotational transitions give information on the parameters {delta} and (g{sub K} - g{sub R}) . The experimental M1 and E2 transition rates between members of different bands have been analysed in terms of the predictions of the Nilsson model, taking also pairing correlations and Coriolis coupling effects into account.

  8. Integral Representation of the Pictorial Proof of Sum of [superscript n][subscript k=1]k[superscript 2] = 1/6n(n+1)(2n+1)

    Science.gov (United States)

    Kobayashi, Yukio

    2011-01-01

    The pictorial proof of the sum of [superscript n][subscript k=1] k[superscript 2] = 1/6n(n+1)(2n+1) is represented in the form of an integral. The integral representations are also applicable to the sum of [superscript n][subscript k-1] k[superscript m] (m greater than or equal to 3). These representations reveal that the sum of [superscript…

  9. Meniscal T1rho and T2 measured with 3.0T MRI increases directly after running a marathon

    Energy Technology Data Exchange (ETDEWEB)

    Stehling, Christoph [University of California, Musculoskeletal and Quantitative Imaging Group (MQIR), Department of Radiology and Biomedical Imaging, San Francisco, CA (United States); University of Muenster, Department of Clinical Radiology, Muenster (Germany); Luke, Anthony [University of California, Department of Orthopedic Surgery, San Francisco, CA (United States); Stahl, Robert [University of California, Musculoskeletal and Quantitative Imaging Group (MQIR), Department of Radiology and Biomedical Imaging, San Francisco, CA (United States); Ludwig Maximilians University of Munich, Department of Clinical Radiology, Munich (Germany); Baum, Thomas; Joseph, Gabby; Pan, Judong; Link, Thomas M. [University of California, Musculoskeletal and Quantitative Imaging Group (MQIR), Department of Radiology and Biomedical Imaging, San Francisco, CA (United States)

    2011-06-15

    To prospectively evaluate changes in T1rho and T2 relaxation time in the meniscus using 3.0 T MRI in asymptomatic knees of marathon runners and to compare these findings with those of age-matched healthy subjects. Thirteen marathon runners underwent 3.0 T MRI including T1rho and T2 mapping sequences before, 48-72 h after, and 3 months after competition. Ten controls were examined at baseline and after 3 months. All images were analyzed by two musculoskeletal radiologists identifying and grading cartilage, meniscal, ligamentous. and other knee abnormalities with WORMS scores. Meniscal segmentation was performed to generate T1rho and T2 maps in six compartments. No differences in morphological knee abnormalities were found before and after the marathon. However, all marathon runners showed a significant increase in T1rho and T2 values after competition in all meniscus compartments (p < 0.0001), which may indicate changes in the biochemical composition of meniscal tissue. While T2 values decreased after 3 months T1rho values remained at a high level, indicating persisting changes in the meniscal matrix composition after a marathon. T2 values in menisci have the potential to be used as biomarkers for identifying reversible meniscus matrix changes indicating potential tissue damage. T1rho values need further study, but may be a valuable marker for diagnosing early, degenerative changes in the menisci following exercise. (orig.)

  10. An N=1 superfield action for M2 branes

    International Nuclear Information System (INIS)

    Mauri, Andrea; Petkou, Anastasios C.

    2008-01-01

    We present an octonionic N=1 superfield action that reproduces in components the action of Bagger and Lambert for M2 branes. By giving an expectation value to one of the scalars we obtain the maximally supersymmetric superfield action for D2 branes

  11. Super Yang-Mills theory in 10+2 dimensions, The 2T-physics Source for N=4 SYM and M(atrix) Theory

    CERN Document Server

    Bars, Itzhak

    2010-01-01

    In this paper we construct super Yang-Mills theory in 10+2 dimensions, a number of dimensions that was not reached before in a unitary supersymmetric field theory, and show that this is the 2T-physics source of some cherished lower dimensional field theories. The much studied conformally exact N=4 Super Yang-Mills field theory in 3+1 dimensions is known to be a compactified version of N=1 SYM in 9+1 dimensions, while M(atrix) theory is obtained by compactifications of the 9+1 theory to 0 dimensions (also 0+1 and others). We show that there is a deeper origin of these theories in two higher dimensions as they emerge from the new theory with two times. Pursuing various alternatives of gauge choices, solving kinematic equations and/or dimensional reductions of the 10+2 theory, we suggest a web of connections that include those mentioned above and a host of new theories that relate 2T-physics and 1T-physics field theories, all of which have the 10+2 theory as the parent. In addition to establishing the higher spa...

  12. Study of epitaxial lateral overgrowth of semipolar (1 12 2) GaN by using different SiO2 pattern sizes

    International Nuclear Information System (INIS)

    Song, Ki-Ryong; Lee, Jae-Hwan; Han, Sang-Hyun; Yi, Hye-Rin; Lee, Sung-Nam

    2013-01-01

    Graphical abstract: - Highlights: • We examine comparative studies of semipolar ELO-GaN film. • Semipolar ELO-GaN film was grown by three step growth method. • The achievement of smooth surface morphology of semipolar ELO-GaN. • The crystal and optical properties was significantly improved by ELO process. - Abstract: We investigated the growth mode and the crystal properties of lateral epitaxial overgrowth (LEO) semipolar (1 12 2) GaN by using the various SiO 2 pattern sizes of 6, 8, 10 and 12 μm with the window width of 4.0 μm. By using three-step growth technique, we successfully obtained the fully-coalescenced semipolar (1 12 2) LEO-GaN films regardless of the SiO 2 pattern sizes. However, the coalescence thickness of LEO-GaN film was decreased with decreasing SiO 2 pattern size, indicating that the coalescence of semipolar (1 12 2) GaN was easily formed by decreasing the pattern size of SiO 2 mask. The full width at half maximums (FWHMs) of X-ray rocking curves (XRCs) of LEO-GaN films decreased with increasing SiO 2 pattern size. In the pattern size of 4 × 10 μm, we achieved the minimum XRCs FWHM of 537 and 368 arc s with two different X-ray incident beam directions of [1 12 − 3] and [11 0 0], respectively. Moreover, the photoluminescence bandedge emission of semipolar (1 12 2) GaN was 45 times increased by LEO process. Based on these results, we concluded that the LEO pattern size of 4 × 10 μm would effectively decrease crystal defects of semipolar (1 12 2) GaN epilayer, resulting in an improvement of the optical properties

  13. CYP1A1 m1 and m2 polymorphisms: genetic susceptibility to lung cancer

    Directory of Open Access Journals (Sweden)

    Paula Mota

    2010-01-01

    ção T6235C e m2 (transição A4889G, estão associados a uma maior actividade enzimática, tendo sido referidos como factores genéticos de susceptibilidade para o cancro do pulmão.Este trabalho teve como objectivo verificar esta possível associação em 175 doentes com cancro do pulmão e 217 controlos da Região Centro de Portugal, por RFLP (polimorfismo de comprimento de fragmentos de restrição.Foi encontrada a seguinte distribuição para as frequências alélicas: 0.12 e 1.14, para os alelos mutados C e G, respectivamente, na população controlo. Os resultados não revelaram significado estatístico quando comparados com a distribuição encontrada na população de doentes. Relativamente à distribuição genotípica, a situação foi semelhante, não se registando significado estatístico, mesmo quando foram considerados genótipos de alto risco. Tal como noutras populações de diferente origem étnica, parece existir desequilíbrio de ligação para ambos os polimorfimos na população-controlo. Concluímos que nesta amostra de população portuguesa os polimorfismos m1 e m2 de CYP1A1 são particularmente raros, parecendo não existir relevância clínica nem associação à susceptibilidade ao cancro do pulmão. Key-words: Lung cancer, smoking, cytochrome P450, CYP1A1, linkage disequilibrium, Palavras-chave: Cancro do pulmão, tabaco, citocromo p450, CYP1A1, desequilíbrio de ligação

  14. Electro-optical 1 x 2, 1 x N and N x N fiber-optic and free-space switching over 1.55 to 3.0 μm using a Ge-Ge(2)Sb(2)Te(5)-Ge prism structure.

    Science.gov (United States)

    Hendrickson, Joshua; Soref, Richard; Sweet, Julian; Majumdar, Arka

    2015-01-12

    New device designs are proposed and theoretical simulations are performed on electro-optical routing switches in which light beams enter and exit the device either from free space or from lensed fibers. The active medium is a ~100 nm layer of phase change material (Ge(2)Sb(2)Te(5) or GeTe) that is electrically "triggered" to change its phase, giving "self-holding" behavior in each of two phases. Electrical current is supplied to that film by a pair of transparent highly doped conducting Ge prisms on both sides of the layer. For S-polarized light incident at ~80° on the film, a three-layer Fabry-Perot analysis, including dielectric loss, predicts good 1 x 2 and 2 x 2 switch performance at infrared wavelengths of 1.55, 2.1 and 3.0 μm, although the performance at 1.55 μm is degraded by material loss and prism mismatch. Proposals for in-plane and volumetric 1 x 4 and 4 x 4 switches are also presented. An unpolarized 1 x 2 switch projects good performance at mid infrared.

  15. Homoleptic Diphosphacyclobutadiene Complexes [M(η4-P2C2R2)2]x- (M=Fe, Co; x=0, 1)

    NARCIS (Netherlands)

    Wolf, Robert; Ehlers, A.W.; Khusniyarov, M.M.; Hartl, F.; de Bruin, B.; Long, G.J.; Grandjean, F.; Schappacher, F.M.; Pöttgen, R.; Slootweg, J.C.; Lutz, M.; Spek, A.L.; Lammertsma, K.

    2011-01-01

    The preparation and comprehensive characterization of a series of homoleptic sandwich complexes containing diphosphacyclobutadiene ligands are reported. Compounds [K([18]crown-6)ACHTUNGTRENUNG(thf)2][Fe(η4- P2C2tBu2)2] (K1), [K([18]crown-6)- ACHTUNGTRENUNG(thf)2][Co(h4-P2C2tBu2)2] (K2), and

  16. Homoleptic Diphosphacyclobutadiene Complexes [M(η(4)-P2C2R2)(2]x- (M = Fe, Co; x=0, 1)

    NARCIS (Netherlands)

    Wolf, R.; Ehlers, A.W.; Khusniyarov, M.M.; Hartl, F.; de Bruin, B.; Long, G.J.; Grandjean, F.; Schappacher, F.M.; Pöttgen, R.; Slootweg, J.C.; Lutz, M.; Spek, A.L.; Lammertsma, K.

    2010-01-01

    The preparation and comprehensive characterization of a series of homoleptic sandwich complexes containing diphosphacyclobutadiene ligands are reported. Compounds [K([18]crown-6)(thf)(2)[Fe(η(4)-P(2)C(2)tBu(2))(2)] (K1), [K([18]crown-6)(thf)(2)][Co(η(4)-P(2)C(2)tBu(2))(2)] (K2), and

  17. Different neuraminidase inhibitor susceptibilities of human H1N1, H1N2, and H3N2 influenza A viruses isolated in Germany from 2001 to 2005/2006.

    Science.gov (United States)

    Bauer, Katja; Richter, Martina; Wutzler, Peter; Schmidtke, Michaela

    2009-04-01

    In the flu season 2005/2006 amantadine-resistant human influenza A viruses (FLUAV) of subtype H3N2 circulated in Germany. This raises questions on the neuraminidase inhibitor (NAI) susceptibility of FLUAV. To get an answer, chemiluminescence-based neuraminidase inhibition assays were performed with 51 H1N1, H1N2, and H3N2 FLUAV isolated in Germany from 2001 to 2005/2006. According to the mean IC(50) values (0.38-0.91 nM for oseltamivir and 0.76-1.13 nM for zanamivir) most H1N1 and H3N2 FLUAV were NAI-susceptible. But, about four times higher zanamivir concentrations were necessary to inhibit neuraminidase activity of H1N2 viruses. Two H1N1 isolates were less susceptible to both drugs in NA inhibition as well as virus yield reduction assays. Results from sequence analysis of viral hemagglutinin and neuraminidase genes and evolutionary analysis of N2 gene revealed (i) different subclades for N2 in H1N2 and H3N2 FLUAV that could explain the differences in zanamivir susceptibility among these viruses and (ii) specific amino acid substitutions in the neuraminidase segment of the two less NAI-susceptible H1N1 isolates. One H3N2 was isolate proved to be a mixture of a NA deletion mutant and full-length NA viruses.

  18. MR fingerprinting for rapid quantification of myocardial T1 , T2 , and proton spin density.

    Science.gov (United States)

    Hamilton, Jesse I; Jiang, Yun; Chen, Yong; Ma, Dan; Lo, Wei-Ching; Griswold, Mark; Seiberlich, Nicole

    2017-04-01

    To introduce a two-dimensional MR fingerprinting (MRF) technique for quantification of T 1 , T 2 , and M 0 in myocardium. An electrocardiograph-triggered MRF method is introduced for mapping myocardial T 1 , T 2 , and M 0 during a single breath-hold in as short as four heartbeats. The pulse sequence uses variable flip angles, repetition times, inversion recovery times, and T 2 preparation dephasing times. A dictionary of possible signal evolutions is simulated for each scan that incorporates the subject's unique variations in heart rate. Aspects of the sequence design were explored in simulations, and the accuracy and precision of cardiac MRF were assessed in a phantom study. In vivo imaging was performed at 3 Tesla in 11 volunteers to generate native parametric maps. T 1 and T 2 measurements from the proposed cardiac MRF sequence correlated well with standard spin echo measurements in the phantom study (R 2  > 0.99). A Bland-Altman analysis revealed good agreement for myocardial T 1 measurements between MRF and MOLLI (bias 1 ms, 95% limits of agreement -72 to 72 ms) and T 2 measurements between MRF and T 2 -prepared balanced steady-state free precession (bias, -2.6 ms; 95% limits of agreement, -8.5 to 3.3 ms). MRF can provide quantitative single slice T 1 , T 2 , and M 0 maps in the heart within a single breath-hold. Magn Reson Med 77:1446-1458, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2016 International Society for Magnetic Resonance in Medicine.

  19. Polaronic transport and thermoelectricity in Fe1 -xCoxSb2S4 (x =0 , 0.1, and 0.2)

    Science.gov (United States)

    Liu, Yu; Kang, Chang-Jong; Stavitski, Eli; Du, Qianheng; Attenkofer, Klaus; Kotliar, G.; Petrovic, C.

    2018-04-01

    We report a study of Co-doped berthierite Fe1 -xCoxSb2S4 (x =0 , 0.1, and 0.2). The alloy series of Fe1 -xCoxSb2S4 crystallize in an orthorhombic structure with the Pnma space group, similar to FeSb2, and show semiconducting behavior. The large discrepancy between activation energy for conductivity, Eρ (146 ˜270 meV ), and thermopower, ES (47 ˜108 meV ), indicates the polaronic transport mechanism. Bulk magnetization and heat-capacity measurements of pure FeSb2S4 (x =0 ) exhibit a broad antiferromagnetic transition (TN=46 K ) followed by an additional weak transition (T*=50 K ). Transition temperatures (TN and T*) slightly decrease with increasing Co content x . This is also reflected in the thermal conductivity measurement, indicating strong spin-lattice coupling. Fe1 -xCoxSb2S4 shows relatively high value of thermopower (up to ˜624 μ V K-1 at 300 K) and thermal conductivity much lower when compared to FeSb2, a feature desired for potential applications based on FeSb2 materials.

  20. MR spectroscopy in diagnosis of local recurrence of T3N0M0 of prostate cancer after cryotherapy

    International Nuclear Information System (INIS)

    Liu Ming; Guo Zhi; Si Tongguo; Wang Haitao; Xiao Bohan

    2012-01-01

    Objective: To evaluate the usefulness of magnetic resonance spectroscopic imaging in detecting local recurrence in patients with T 3 N 0 M 0 prostate cancer after cryotherapy. Methods: Sixty-five patients with T 3 N 0 M 0 prostate cancer underwent cryotherapy. The preoperative data of conventional MRI, MRS, transrectal ultrasound (TRUS)-guided prostate biopsy were collected. After cryotherapy, the prostate specific antigen (PSA) of all patients was detected monthly.If PSA >5 μg/L, MRI, MRS, and TRUS-guided prostate biopsy were planned within a week. If PSA was unremarkable, MRI, MRS, and TRUS-guided prostate biopsy were planned 12 months after cryotherapy. The prostate was divided 6 regions and the cancerous and noncancerous were marked. The signal-to-noise ratio (S/N) of choline (Cho), citrate (Cit) and the ratios of Cho + creatine (Cre)/Cit of each regions were measured in pre-operation and postoperation. The patients were divided into non-recurrence and recurrence group according to TRUS-guided biopsy. The S/N of Cho, Cit, and the ratio of Cho + Cre/Cit were compared between the groups before and after cryotherapy by using independent samples t-test. Results: (1) Fifteen patients were confirmed local recurrence 12 months after cryotherapy, including 11 patients with an evaluate PSA level and 4 patients with PSA unremarkable. (2) The S/N of Cho, Cit and the ratios of Cho + Cre/Cit in the cancerous and noncancerous regions before cryotherapy in the sixty-five patients were 25±9, 11±5, and 18±5, and 39 ±12, 2.33±0.60, and 0.53 ± 0.19. There had significant difference between that of two groups (t values were 11.36, 9.81, and 13.39, respectively, P=0.00). (3) In the patients with non-recurrence, The S/N of Cho, Cit in the cancerous and noncancerous regions were 4 ± 2 and 3 ± 2 (t=1.024, P=0.305), and 2±2 and 4 ±3 (t=1.147, P=0.178) and no difference was found. In necrotic area,the ratios of Cho + Cre/Cit could not be calculated because of low level of the

  1. M-shell ionization of heavy elements by 0.1-1.0 MeV/amu 1,2H and 3,4He ions

    International Nuclear Information System (INIS)

    Pajek, M.; Banas, D.; Braziewicz, J.; Czarnota, M.; Bienkowski, A.; Jaskola, M.; Korman, A.; Trautmann, D.; Lapicki, G.

    2006-01-01

    The M-shell ionization in high-Z atoms by low-energy light 1 1 H, 1 2 H, 2 3 He, and 2 4 He ions have been studied systematically in the energy range 0.1-1.0 MeV/amu in order to verify the available theoretical approaches describing the M-shell ionization by charged particles in asymmetric collisions. The present low-energy data, combined with our earlier results reported for M-shell ionization by hydrogen and helium ions for higher energies, form a systematic experimental basis to test the theoretical predictions of M-shell ionization based on the plane-wave Born approximation (PWBA), the semiclassical approximation (SCA), and the binary-encounter approximation (BEA). In the PWBA based approaches the energy loss (E), Coulomb deflection (C), perturbed stationary state (PSS), and relativistic (R) effects were considered within the ECPSSR theory and its recent modification, called the ECUSAR theory, in which a description of the PSS effect was corrected to account for the united- and separated-atom (USA) electron binding energy limits. In the SCA calculations with relativistic wave functions the binding effect was included only in the limiting cases of separated-atom and united-atom limits. Possible contribution of the electron capture, multiple ionization, and recoil ionization to the M-shell vacancy production, which is dominated for light ions impact by direct single ionization process, are also discussed. The universal scaling of measured M-shell x-ray production and ionization cross sections was investigated in detail. Using the present data the isotopic effect has been studied by comparing the measured M-shell ionization cross-section ratios for equal-velocity hydrogen 1 1 H and 1 2 H as well as helium 2 3 He and 2 4 He isotopes. In addition, the ratios of measured ionization cross sections for 1 2 H and 2 4 He were used to investigate the role of the binding effect. The present results are of practical importance for the application of particle-induced x

  2. Three-dimensional contrast-enhanced magnetic-resonance angiography of the renal arteries: Interindividual comparison of 0.2 mmol/kg gadobutrol at 1.5 T and 0.1 mmol/kg gadobenate dimeglumine at 3.0 T

    International Nuclear Information System (INIS)

    Attenberger, Ulrike I.; Wintersperger, Bernd J.; Sourbron, Steven P.; Reiser, Maximilian F.; Michaely, Henrik J.; Schoenberg, Stefan O.; Lodemann, Klaus-Peter

    2008-01-01

    The purpose was to evaluate the image quality of high-spatial resolution MRA of the renal arteries at 1.5 T after contrast-agent injection of 0.2 mmol/kg body weight (BW) in an interindividual comparison to 3.0 T after contrast-agent injection of 0.1 mmol/kg BW contrast agent (CA). After IRB approval and informed consent, 40 consecutive patients (25 men, 15 women; mean age 53.9 years) underwent MRA of the renal arteries either at a 1.5-T MR system with 0.2 mmol/kg BW gadobutrol or at a 3.0-T MR scanner with 0.1 mmol/kg BW gadobenate dimeglumine used as CA in a randomized order. A constant volume of 15 ml of these contrast agents was applied. The spatial resolution of the MRA sequences was 1.0 x 0.8 x 1.0 mm 3 at 1.5 T and 0.9 x 0.8 x 0.9 mm 3 at 3.0 T, which was achieved by using parallel imaging acceleration factors of 2 at 1.5 T and 3 at 3.0 T, respectively. Two radiologists blinded to the administered CA and the field strength assessed the image quality and the venous overlay for the aorta, the proximal and distal renal arteries independently on a four-point Likert-type scale. Phantom measurements were performed for a standardized comparison of SNR at 1.5 T and 3.0 T. There was no significant difference (p > 0.05) between the image quality at 3.0 T with 0.1 mmol/kg BW gadobenate dimeglumine compared to the exams at 1.5 T with 0.2 mmol/kg BW gadobutrol. The median scores were between 3 and 4 (good to excellent vessel visualization) for the aorta (3 at 1.5 T/4 at 3.0 T for reader 1 and 2). For the proximal renal arteries, median scores were 3 for the left and right renal artery at 1.5 T for both readers. At 3.0 T, median scores were 3 (left proximal renal artery) and 4 (right proximal renal artery) for reader 1 and 3 (left/right) for reader 2 at 3.0 T. For the distal renal arteries, median scores were between 2 and 3 at both field strengths (moderate and good) for both readers. The κ values for both field strengths were comparable and ranged between 0

  3. Three-dimensional contrast-enhanced magnetic-resonance angiography of the renal arteries: Interindividual comparison of 0.2 mmol/kg gadobutrol at 1.5 T and 0.1 mmol/kg gadobenate dimeglumine at 3.0 T

    Energy Technology Data Exchange (ETDEWEB)

    Attenberger, Ulrike I.; Wintersperger, Bernd J.; Sourbron, Steven P.; Reiser, Maximilian F. [University Hospitals-Grosshadern, Ludwig-Maximilians-University Munich, Institute of Clinical Radiology, Munich (Germany); Michaely, Henrik J.; Schoenberg, Stefan O. [University Hospital Mannheim, University of Heidelberg, Institute of Clinical Radiology, Mannheim (Germany); Lodemann, Klaus-Peter [Bracco-Altana Pharma, Konstanz (Germany)

    2008-06-15

    The purpose was to evaluate the image quality of high-spatial resolution MRA of the renal arteries at 1.5 T after contrast-agent injection of 0.2 mmol/kg body weight (BW) in an interindividual comparison to 3.0 T after contrast-agent injection of 0.1 mmol/kg BW contrast agent (CA). After IRB approval and informed consent, 40 consecutive patients (25 men, 15 women; mean age 53.9 years) underwent MRA of the renal arteries either at a 1.5-T MR system with 0.2 mmol/kg BW gadobutrol or at a 3.0-T MR scanner with 0.1 mmol/kg BW gadobenate dimeglumine used as CA in a randomized order. A constant volume of 15 ml of these contrast agents was applied. The spatial resolution of the MRA sequences was 1.0 x 0.8 x 1.0 mm{sup 3} at 1.5 T and 0.9 x 0.8 x 0.9 mm{sup 3} at 3.0 T, which was achieved by using parallel imaging acceleration factors of 2 at 1.5 T and 3 at 3.0 T, respectively. Two radiologists blinded to the administered CA and the field strength assessed the image quality and the venous overlay for the aorta, the proximal and distal renal arteries independently on a four-point Likert-type scale. Phantom measurements were performed for a standardized comparison of SNR at 1.5 T and 3.0 T. There was no significant difference (p > 0.05) between the image quality at 3.0 T with 0.1 mmol/kg BW gadobenate dimeglumine compared to the exams at 1.5 T with 0.2 mmol/kg BW gadobutrol. The median scores were between 3 and 4 (good to excellent vessel visualization) for the aorta (3 at 1.5 T/4 at 3.0 T for reader 1 and 2). For the proximal renal arteries, median scores were 3 for the left and right renal artery at 1.5 T for both readers. At 3.0 T, median scores were 3 (left proximal renal artery) and 4 (right proximal renal artery) for reader 1 and 3 (left/right) for reader 2 at 3.0 T. For the distal renal arteries, median scores were between 2 and 3 at both field strengths (moderate and good) for both readers. The {kappa} values for both field strengths were comparable and ranged

  4. Ranked solutions of the matric equation A1X1=A2X2

    Directory of Open Access Journals (Sweden)

    A. Duane Porter

    1980-01-01

    Full Text Available Let GF(pz denote the finite field of pz elements. Let A1 be s×m of rank r1 and A2 be s×n of rank r2 with elements from GF(pz. In this paper, formulas are given for finding the number of X1,X2 over GF(pz which satisfy the matric equation A1X1=A2X2, where X1 is m×t of rank k1, and X2 is n×t of rank k2. These results are then used to find the number of solutions X1,…,Xn, Y1,…,Ym, m,n>1, of the matric equation A1X1…Xn=A2Y1…Ym.

  5. [N,N-Bis(2-aminoethylethane-1,2-diamine](ethane-1,2-diaminenickel(II thiosulfate trihydrate

    Directory of Open Access Journals (Sweden)

    Beatrix Seidlhofer

    2012-02-01

    Full Text Available The title compound, [Ni(C2H8N2(C6H18N4]S2O3·3H2O, was accidentally synthesized under solvothermal conditions applying [Ni(en3]Cl2 (en is ethane-1,2-diamine as the Ni source. The asymmetric unit consists of one discrete [Ni(tren(en]2+ complex [tren is N,N-bis(2-aminoethylethane-1,2-diamine] in which the Ni2+ cation is sixfold coordinated within a slightly distorted octahedron, one thiosulfate anion and three water molecules. In the crystal, the complex cations, anions and water molecules are linked by an intricate hydrogen-bonding network. One C atom of the tren ligand, as well as one O atom of a water molecule, are disordered over two sites and were refined using a split model (occupancy ratios = 0.85:15 and 0.60:0.40, respectively.

  6. VU6010608, a Novel mGlu7 NAM from a Series of N-(2-(1H-1,2,4-Triazol-1-yl)-5-(trifluoromethoxy)phenyl)benzamides.

    Science.gov (United States)

    Reed, Carson W; McGowan, Kevin M; Spearing, Paul K; Stansley, Branden J; Roenfanz, Hanna F; Engers, Darren W; Rodriguez, Alice L; Engelberg, Eileen M; Luscombe, Vincent B; Loch, Matthew T; Remke, Daniel H; Rook, Jerri M; Blobaum, Anna L; Conn, P Jeffrey; Niswender, Colleen M; Lindsley, Craig W

    2017-12-14

    Herein, we report the structure-activity relationships within a series of mGlu 7 NAMs based on an N -(2-(1 H -1,2,4-triazol-1-yl)-5-(trifluoromethoxy)phenyl)benzamide core with excellent CNS penetration ( K p 1.9-5.8 and K p,uu 0.4-1.4). Analogues in this series displayed steep SAR. Of these, VU6010608 ( 11a ) emerged with robust efficacy in blocking high frequency stimulated long-term potentiation in electrophysiology studies.

  7. A detailed study of the dehydration process in synthetic strelkinite, Na[(UO2)(VO4)] . nH2O (n = 0, 1, 2)

    International Nuclear Information System (INIS)

    Suleimanov, Evgeny V.; Somov, Nikolay V.; Chuprunov, Evgeny V.; Mayatskikh, Ekaterina F.; Depmeier, Wulf

    2012-01-01

    Synthetic strelkinite Na[(UO 2 )(VO 4 )] . nH 2 O (n = 0, 1, 2) was systematically investigated by single crystal X-ray diffraction and thermoanalytical methods. The anhydrous form and two hydrates were isolated as single crystals and the structures of these phases solved: Na[(UO 2 )(VO 4 )], monoclinic, P2 1 /c, a = 6.0205(1) Aa, b = 8.3365(1) Aa, c = 10.4164(2) Aa, β = 100.466(2) , V = 514.10(1) Aa 3 , R 1 = 0.0337; Na[(UO 2 )(VO 4 )] . H 2 O, monoclinic, P2 1 /c, a = 7.722(2) Aa, b = 8.512(1) Aa, c = 10.480(4) Aa, β = 113.18(3) , V = 633.3(3) Aa 3 , R 1 = 0.1658; Na[(UO 2 )(VO 4 )] . 2 H 2 O, monoclinic, P2 1 /n, a = 16.2399(5) Aa, b = 8.2844(2) Aa, c = 10.5011(2) Aa, β = 97.644(2) , V = 1400.24(6) Aa 3 , R 1 = 0.0776. A possible mechanism of the structural transformation processes during dehydration is proposed based on the structures of the anhydrous phase and the hydrates. (orig.)

  8. CH3CO + O2 + M (M = He, N2) Reaction Rate Coefficient Measurements and Implications for the OH Radical Product Yield.

    Science.gov (United States)

    Papadimitriou, Vassileios C; Karafas, Emmanuel S; Gierczak, Tomasz; Burkholder, James B

    2015-07-16

    The gas-phase CH3CO + O2 reaction is known to proceed via a chemical activation mechanism leading to the formation of OH and CH3C(O)OO radicals via bimolecular and termolecular reactive channels, respectively. In this work, rate coefficients, k, for the CH3CO + O2 reaction were measured over a range of temperature (241-373 K) and pressure (0.009-600 Torr) with He and N2 as the bath gas and used to characterize the bi- and ter-molecular reaction channels. Three independent experimental methods (pulsed laser photolysis-laser-induced fluorescence (PLP-LIF), pulsed laser photolysis-cavity ring-down spectroscopy (PLP-CRDS), and a very low-pressure reactor (VLPR)) were used to characterize k(T,M). PLP-LIF was the primary method used to measure k(T,M) in the high-pressure regime under pseudo-first-order conditions. CH3CO was produced by PLP, and LIF was used to monitor the OH radical bimolecular channel reaction product. CRDS, a complementary high-pressure method, measured k(295 K,M) over the pressure range 25-600 Torr (He) by monitoring the temporal CH3CO radical absorption following its production via PLP in the presence of excess O2. The VLPR technique was used in a relative rate mode to measure k(296 K,M) in the low-pressure regime (9-32 mTorr) with CH3CO + Cl2 used as the reference reaction. A kinetic mechanism analysis of the combined kinetic data set yielded a zero pressure limit rate coefficient, kint(T), of (6.4 ± 4) × 10(-14) exp((820 ± 150)/T) cm(3) molecule(-1) s(-1) (with kint(296 K) measured to be (9.94 ± 1.3) × 10(-13) cm(3) molecule(-1) s(-1)), k0(T) = (7.39 ± 0.3) × 10(-30) (T/300)(-2.2±0.3) cm(6) molecule(-2) s(-1), and k∞(T) = (4.88 ± 0.05) × 10(-12) (T/300)(-0.85±0.07) cm(3) molecule(-1) s(-1) with Fc = 0.8 and M = N2. A He/N2 collision efficiency ratio of 0.60 ± 0.05 was determined. The phenomenological kinetic results were used to define the pressure and temperature dependence of the OH radical yield in the CH3CO + O2 reaction. The

  9. Structural, thermal, spectroscopic and magnetic studies of the (C2N2H10)0.5[Fe xV1-x(HPO3)2] (x = 0.26, 0.52, 0.74) solid solution

    International Nuclear Information System (INIS)

    Cisneros, Jose L.; Fernandez-Armas, Sergio; Mesa, Jose L.; Pizarro, Jose L.; Arriortua, Maria I.; Rojo, Teofilo

    2006-01-01

    The (C 2 N 2 H 10 ) 0.5 [Fe x V 1-x (HPO 3 ) 2 ] (x = 0.26, 0.52 0.74) compounds have been obtained by mild solvothermal conditions in the form of micro-crystalline powder with brown color. The crystal structures were refined by X-ray powder diffraction data using the Rietveld method. The compounds crystallize in the monoclinic system, space group P2/c with the unit-cell parameters, a = 9.262(5) A, b = 8.823(5) A, c = 9.714(6) A, β = 120.84(3) o ; a = 9.245(1) A, b = 8.823(1) A, c = 9.698(1)A, β = 120.80(1) o and, a = 9.254(4)A, b = 8.822(4)A, c = 9.702(4)A, β = 120.73(3) o for (C 2 N 2 H 10 ) 0.5 [Fe 0.26 V 0.74 (HPO 3 ) 2 ] (1) (C 2 N 2 H 10 ) 0.5 [Fe 0.52 V 0.48 (HPO 3 ) 2 ] (2), and (C 2 N 2 H 10 ) 0.5 [Fe 0.74 V 0.26 (HPO 3 ) 2 ] (3). The compounds show an open crystalline structure with three-dimensional character, whose formula for the anionic inorganic skeleton is [M(HPO 3 ) 2 ] 2- . The inorganic framework is formed by [MO 6 ] octahedra inter-connected by phosphite groups. The structure of the compounds exhibits channels extended along the [1 0 0] and [0 0 1] directions and the ethylendiammonium cations are located inside these channels, linked through hydrogen bonds and ionic interactions. The infrared spectra show the bands corresponding to the stretching (P-H) vibration of the phosphite group and the band corresponding to the deformation mode of the ethylendiammonium cation, δ(NH 3 + ). The thermal and thermodiffractometric behavior show that the compounds are stable up to approximately 300 deg. C, at higher temperatures the decomposition of the crystal structure by calcination of the organic cation starts. The diffuse reflectance spectra show bands of the V 3+ ion (d 2 ), and a band of the Fe 3+ ion (d 5 ), in a slightly distorted octahedral symmetry. The values of the Dq and Racah parameters (B and C) have been calculated for the V(III) cation. Magnetic measurements were performed on a powdered sample from 5 to 300 K at magnetic fields 1000, 500

  10. Feedback stabilization of an l = 0, 1, 2 high-beta stellarator

    International Nuclear Information System (INIS)

    Bartsch, R.R.; Cantrell, E.L.; Gribble, R.F.; Klare, K.A.; Kutac, K.J.; Miller, G.; Quinn, W.E.

    1978-05-01

    Feedback stabilization of the Scyllac 120 0 toroidal sector is reported. The confinement time was increased by 10-20 μs using feedback to a maximum time of 35-45 μs, which is over 10 growth times of the long-wavelength m = 1 instability. These results were obtained after circuits providing flexible waveforms were used to drive auxiliary equilibrium windings. The resultant improved equilibrium agrees well with recent theory. It was observed that normally stable short-wavelength m = 1 modes could be driven unstable by feedback. This instability, caused by local feedback control, increases the feedback system energy consumption. An instability involving direct coupling of the feedback l = 2 field to the plasma l = 1 motion was also observed. The plasma parameters were: temperature, T/sub e/ approximately equal to T 1 approximately equal to 100 eV; density, n/sub e/ approximately equal to 2 x 10 16 cm -8 ; radius, a approximately equal to 1 cm; and β approximately equal to 0.7. Beta decreased significantly in 40 μs, which can be accounted for by classical resistivity and particle loss from the sector ends

  11. Proving the AGT relation for N f = 0, 1, 2 antifundamentals

    Science.gov (United States)

    Hadasz, Leszek; Jaskólski, Zbigniew; Suchanek, Paulina

    2010-06-01

    Using recursive relations satisfied by Nekrasov partition functions and by irregular conformal blocks we prove the AGT correspondence in the case of mathcal{N} = 2 superconformal SU(2) quiver gauge theories with N f = 0, 1, 2 antifundamental hypermultiplets.

  12. Combined glutathione S transferase M1/T1 null genotypes is associated with type 2 diabetes mellitus

    Science.gov (United States)

    POROJAN, MIHAI D.; BALA, CORNELIA; ILIES, ROXANA; CATANA, ANDREEA; POPP, RADU A.; DUMITRASCU, DAN L.

    2015-01-01

    Background Due to new genetic insights, a considerably large number of genes and polymorphic gene variants are screened and linked with the complex pathogenesis of type 2 diabetes (DM). Our study aimed to investigate the association between the two isoforms of the glutathione S-transferase genes (Glutathione S transferase isoemzyme type M1- GSTM1 and Glutathione S transferase isoemzyme type T1-GSTT1) and the prevalence of DM in the Northern Romanian population. Methods We conducted a cross-sectional, randomized, case-control study evaluating the frequency of GSTM1 and GSTT1 null alleles in patients diagnosed with DM. A total of 106 patients diagnosed with DM and 124 healthy controls were included in the study. GSTM1 and GSTT1 null alleles genotyping was carried out using Multiplex PCR amplification of relevant gene fragments, followed by gel electrophoresis analysis of the resulting amplicons. Results Molecular analysis did not reveal an increased frequency of the null GSTM1 and GSTT1 alleles (mutant genotypes) respectively in the DM group compared to controls (p=0.171, OR=1.444 CI=0.852–2.447; p=0.647, OR=0.854, CI=0.436–1.673). Nevertheless, the combined GSTM1/GSTT1 null genotypes were statistically significantly higher in DM patients compared to control subjects (p=0.0021, OR=0.313, CI=0.149–0.655) Conclusions The main finding of our study is that the combined, double GSTM1/GSTT1 null genotypes are to be considered among the polymorphic genetic risk factors for type 2 DM. PMID:26528065

  13. Probing the electronic properties of ternary AnM3n−1B2n (n = 1: A = Ca, Sr; M = Rh, Ir and n = 3: A = Ca, Sr; M = Rh phases: observation of superconductivity

    Directory of Open Access Journals (Sweden)

    Hiroyuki Takeya, Mohammed ElMassalami, Luis A Terrazos, Raul E Rapp, Rodrigo B Capaz, Hiroki Fujii, Yoshihiko Takano, Mathias Doerr and Sergey A Granovsky

    2013-01-01

    Full Text Available We follow the evolution of the electronic properties of the titled homologous series when n as well as the atomic type of A and M are varied where for n = 1, A = Ca, Sr and M = Rh, Ir while for n = 3, A = Ca, Sr and M = Rh. The crystal structure of n = 1 members is known to be CaRh2B2-type (Fddd, while that of n = 3 is Ca3Rh8B6-type (Fmmm; the latter can be visualized as a stacking of structural fragments from AM3B2 (P6/mmm and AM2B2. The metallic properties of the n = 1 and 3 members are distinctly different: on the one hand, the n = 1 members are characterized by a linear coefficient of the electronic specific heat γ ≈ 3 mJ mol−1 K−2, a Debye temperature θD ≈ 300 K, a normal conductivity down to 2 K and a relatively strong linear magnetoresistivity for fields up to 150 kOe. The n = 3 family, on the other hand, exhibits γ ≈ 18 mJ mol−1 K−2, θD ≈ 330 K, a weak linear magnetoresistivity and an onset of superconductivity (for Ca3Rh8B6, Tc = 4.0 K and Hc2 = 14.5 kOe, while for Sr3Rh8 B6, Tc = 3.4 K and Hc2 ≈ 4.0 kOe. These remarkable differences are consistent with the findings of the electronic band structures and density of state (DOS calculations. In particular, satisfactory agreement between the measured and calculated γ was obtained. Furthermore, the Fermi level, EF, of Ca3Rh8B6 lies at almost the top of a pronounced local DOS peak, while that of CaRh2B2 lies at a local valley: this is the main reason behind the differences between the, e.g., superconducting properties. Finally, although all atoms contribute to the DOS at EF, the contribution of the Rh atoms is the strongest.

  14. Probing the electronic properties of ternary AnM3n−1B2n (n = 1: A = Ca, Sr; M = Rh, Ir and n = 3: A = Ca, Sr; M = Rh) phases: observation of superconductivity

    Science.gov (United States)

    Takeya, Hiroyuki; ElMassalami, Mohammed; Terrazos, Luis A; Rapp, Raul E; Capaz, Rodrigo B; Fujii, Hiroki; Takano, Yoshihiko; Doerr, Mathias; Granovsky, Sergey A

    2013-01-01

    We follow the evolution of the electronic properties of the titled homologous series when n as well as the atomic type of A and M are varied where for n = 1, A = Ca, Sr and M = Rh, Ir while for n = 3, A = Ca, Sr and M = Rh. The crystal structure of n = 1 members is known to be CaRh2B2-type (Fddd), while that of n = 3 is Ca3Rh8B6-type (Fmmm); the latter can be visualized as a stacking of structural fragments from AM3B2 (P6/mmm) and AM2B2. The metallic properties of the n = 1 and 3 members are distinctly different: on the one hand, the n = 1 members are characterized by a linear coefficient of the electronic specific heat γ ≈ 3 mJ mol−1 K−2, a Debye temperature θD ≈ 300 K, a normal conductivity down to 2 K and a relatively strong linear magnetoresistivity for fields up to 150 kOe. The n = 3 family, on the other hand, exhibits γ ≈ 18 mJ mol−1 K−2, θD ≈ 330 K, a weak linear magnetoresistivity and an onset of superconductivity (for Ca3Rh8B6, Tc = 4.0 K and Hc2 = 14.5 kOe, while for Sr3Rh8 B6, Tc = 3.4 K and Hc2 ≈ 4.0 kOe). These remarkable differences are consistent with the findings of the electronic band structures and density of state (DOS) calculations. In particular, satisfactory agreement between the measured and calculated γ was obtained. Furthermore, the Fermi level, EF, of Ca3Rh8B6 lies at almost the top of a pronounced local DOS peak, while that of CaRh2B2 lies at a local valley: this is the main reason behind the differences between the, e.g., superconducting properties. Finally, although all atoms contribute to the DOS at EF, the contribution of the Rh atoms is the strongest. PMID:27877576

  15. 7 Tesla quantitative hip MRI: T1, T2 and T2* mapping of hip cartilage in healthy volunteers

    Energy Technology Data Exchange (ETDEWEB)

    Lazik, Andrea; Theysohn, Jens M.; Geis, Christina [University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); Johst, Soeren; Kraff, Oliver [University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany); Ladd, Mark E. [University Hospital Essen, Department of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany); German Cancer Research Center (DKFZ), Medical Physics in Radiology, Heidelberg (Germany); Quick, Harald H. [University of Duisburg-Essen, Erwin L. Hahn Institute for Magnetic Resonance Imaging, Essen (Germany); University Hospital Essen, High Field and Hybrid MR Imaging, Essen (Germany)

    2016-05-15

    To evaluate the technical feasibility and applicability of quantitative MR techniques (delayed gadolinium-enhanced MRI of cartilage (dGEMRIC), T2 mapping, T2* mapping) at 7 T MRI for assessing hip cartilage. Hips of 11 healthy volunteers were examined at 7 T MRI with an 8-channel radiofrequency transmit/receive body coil using multi-echo sequences for T2 and T2* mapping and a dual flip angle gradient-echo sequence before (T1{sub 0}) and after intravenous contrast agent administration (T1{sub Gd}; 0.2 mmol/kg Gd-DTPA{sup 2-} followed by 0.5 h of walking and 0.5 h of rest) for dGEMRIC. Relaxation times of cartilage were measured manually in 10 regions of interest. Pearson's correlations between R1{sub delta} = 1/T1{sub Gd} - 1/T1{sub 0} and T1{sub Gd} and between T2 and T2* were calculated. Image quality and the delineation of acetabular and femoral cartilage in the relaxation time maps were evaluated using discrete rating scales. High correlations were found between R1{sub delta} and T1{sub Gd} and between T2 and T2* relaxation times (all p < 0.01). All techniques delivered diagnostic image quality, with best delineation of femoral and acetabular cartilage in the T2* maps (mean 3.2 out of a maximum of 4 points). T1, T2 and T2* mapping of hip cartilage with diagnostic image quality is feasible at 7 T. To perform dGEMRIC at 7 T, pre-contrast T1 mapping can be omitted. (orig.)

  16. Absolute M1 and E2 Transition Probabilities in 233U

    International Nuclear Information System (INIS)

    Malmskog, S.G.; Hoejeberg, M.

    1967-08-01

    Using the delayed coincidence technique, the following half lives have been determined for different excited states in 233 U: T 1/2 (311.9 keV level) = (1.20 ± 0.15) x 10 -10 sec, T 1/2 (340.5 keV level) = (5.2 ± 1.0) x 10 -11 sec, T 1/2 (398.6 keV level) = (5.5 ± 2.0) x 10 -11 sec and T 1/2 (415.8 keV level) -11 sec. From these half life determinations, together with earlier known electron intensities and conversion coefficients, 22 reduced B(Ml) and B(E2) transition probabilities (including 9 limits) have been deduced. The rotational transitions give information on the parameters δ and (g K - g R ) . The experimental M1 and E2 transition rates between members of different bands have been analysed in terms of the predictions of the Nilsson model, taking also pairing correlations and Coriolis coupling effects into account

  17. Crystal structures of the 2:2 complex of 1,1′-(1,2-phenylenebis(3-m-tolylurea and tetrabutylammonium chloride or bromide

    Directory of Open Access Journals (Sweden)

    Chao Huang

    2017-09-01

    Full Text Available The title compounds, tetrabutylammonium chloride–1,1′-(1,2-phenylenebis(3-m-tolylurea (1/1, C16H36N+·Cl−·C22H22N4O2 or [(n-Bu4N+·Cl−(C22H22N4O2] (I and tetrabutylammonium bromide–1,1′-(1,2-phenylenebis(3-m-tolylurea (1/1, C16H36N+·Br−·C22H22N4O2 or [(n-Bu4N+·Br−(C22H22N4O2] (II, both comprise a tetrabutylammonium cation, a halide anion and an ortho-phenylene bis-urea molecule. Each halide ion shows four N—H...X (X = Cl or Br interactions with two urea receptor sites of different bis-urea moieties. A crystallographic inversion centre leads to the formation of a 2:2 arrangement of two halide anions and two bis-urea molecules. In the crystals, the dihedral angle between the two urea groups of the bis-urea molecule in (I [defined by the four N atoms, 165.4 (2°] is slightly smaller than that in (II [167.4 (2°], which is probably due to the smaller ionic radius of chloride compared to bromide.

  18. Residual pathological stage at radical cystectomy significantly impacts outcomes for initial T2N0 bladder cancer.

    Science.gov (United States)

    Isbarn, Hendrik; Karakiewicz, Pierre I; Shariat, Shahrokh F; Capitanio, Umberto; Palapattu, Ganesh S; Sagalowsky, Arthur I; Lotan, Yair; Schoenberg, Mark P; Amiel, Gilad E; Lerner, Seth P; Sonpavde, Guru

    2009-08-01

    We hypothesized that in patients with T2N0 stage disease at transurethral bladder tumor resection a lower residual cancer stage (P1N0 or less) at radical cystectomy may correlate with improved outcomes relative to those with residual P2N0 disease. We analyzed 208 patients with T2N0 stage disease at transurethral bladder tumor resection whose tumors were organ confined at radical cystectomy (P2 or lower, pN0). None received perioperative chemotherapy. Kaplan-Meier as well as univariable and multivariable Cox regression models addressed the effect of residual pT stage at radical cystectomy on recurrence and cancer specific mortality rates. Covariates consisted of age, gender, grade, lymphovascular invasion, carcinoma in situ, number of lymph nodes removed and year of surgery. Residual pT stage at radical cystectomy was P0 in 24 (11.5%) patients, Pa in 9 (4.3%), PCIS in 22 (10.6%), P1 in 35 (16.8%) and P2 in 118 (56.7%). Median followup of censored patients was 55.7 months for recurrence and 52.1 months for cancer specific mortality analyses. The 5-year recurrence-free survival rates of patients with P0/Pa/PCIS, P1 and P2 stage disease were 100%, 85% and 75%, respectively. The 5-year cancer specific survival rates for the same cohorts were 100%, 93% and 81%, respectively. On multivariable analysis the effect of residual stage P1 or lower at radical cystectomy achieved independent predictor status for recurrence (adjusted HR 0.20, p = 0.002) and cancer specific mortality (adjusted HR 0.24, p = 0.02). Down staging from initial T2N0 bladder cancer at transurethral bladder tumor resection to lower stage at radical cystectomy significantly reduces recurrence and cancer specific mortality. Further validation of this finding is warranted.

  19. Correlation of irreversibility and vortex solid melting for Ti nBa 2Ca 2Cu 3O x (n = 1, 2) thin films

    Science.gov (United States)

    Hyun, O. B.; Suhara, H.; Nabatame, T.; Koike, S.; Hirabayashi, I.

    1995-08-01

    The transport measurements were performed for the Tl nBa 2Ca 2Cu 3O x (n = 1, 2) thin films in magnetic fields. The resistive state could be approximately described by the thermally activated form, ϱ ˜ exp[- {U(H,T)}/{k BT }] , where U(H,T) ∝ (const. + T)H -α with α ≈ 0.5 ˜ 0.6. This form, however, appreciably deviates from the data for low dissipation and high fields. As for the viscosity of the supercooled liquid, the divergence of U well described the behavior, particularly, of the low dissipation state for all fields, implying the presence of the vortex solid. The log(V) - log(I) characteristics revealed the curvature change, which defines the vortex solid (glass) - liquid melting temperature T m. Both the irreversibility line and the melting line showed approximately the same T dependence, H α ˜ T -1, which is from the thermally activated form. This correlation suggests that the irreversibility line appropriately figures the vortex solid (glass) - liquid melting line.

  20. MR imaging findings of diffuse axonal injury: comparison of T2-weighted gradient images and T1- and T2-weighted spin-echo images

    Energy Technology Data Exchange (ETDEWEB)

    Park, Seo Young; Lee, Ghi Jai; Kim, Jeong Seok; Shim, Jae Chan; Kim, Ho Kyun [Inje Univ. College of Medicine, Seoul (Korea, Republic of)

    1998-10-01

    To compare T2-weighted images with spin-echo T1- and turbo spin-echo (TSE) T2-weighted images in patients with diffuse axonal injury(DAI). Using a 1.0T MR unit, SE T1-, TSE T2-, and and FLASH T2-weighted images were obtained from 69 patients with a history of head trauma. In 18MR images of 17 patients with imaging findings of DAI, T2-weighted images were retrospectively compared with SE T1- and TSE T2-weighted images. The interval between trauma and MR scan varied from 5 days to 24(mean, 11) months. Focusing on the number of lesions, and their location and signal intensity, as weel as associated findings, three images were simultaueously evaluated. In 18 MR images of 17 patients with MR imaging findings of DAI, 21 lesions were detected on T1-weighted images, 28 on TSE T2-weighted images, and 70 on T2-weighted images;the last of these revealed all lesions detected on the other two. Most lesions were hypointense on T1-weighted images(17/21), hyperintense on TSE T2-weighted (21/28), and hypointense on T2-weighted (63/70). Common locations for DAI were the frontal lobe (n=3D35) and corpus callosum (n=3D22). Associated brain injuries were cortical contusion (n=3D5), brainstem injury (n=3D3), deep gray matter injury (n=3D2), and subdural hematoma(n=3D1). In patients with DAI. T2-weighted images can detect more lesions and associated petechial hemorrhage than can TSE T2-weighted images. This modality is thus useful for the evaluation of patients with head trauma.=20.

  1. Transistor properties of exfoliated single crystals of 2 H -Mo (Se1-xT ex ) 2(0 ≤x ≤1 )

    Science.gov (United States)

    Uesugi, Eri; Miao, Xiao; Ota, Hiromi; Goto, Hidenori; Kubozono, Yoshihiro

    2017-06-01

    Field-effect transistors (FETs) were fabricated using exfoliated single crystals of Mo (Se1-xT ex) 2 with an x range of 0 to 1, and the transistor properties fully investigated at 295 K in four-terminal measurement mode. The chemical composition and crystal structure of exfoliated single crystals were identified by energy-dispersive x-ray spectroscopy (EDX), single-crystal x-ray diffraction, and Raman scattering, suggesting the 2 H - structure in all Mo (Se1-xT ex) 2 . The lattice constants of a and c increase monotonically with increasing x , indicating the substitution of Se by Te. When x 0.4 . In contrast, the polarity of a thick single-crystal Mo (Se1-xT ex) 2 FET did not change despite an increase in x . The change of polarity in a thin single-crystal FET was well explained by the variation of electronic structure. The absence of such change in the thick single-crystal FET can be reasonably interpreted based on the large bulk conduction due to naturally accumulated electrons. The μ value in the thin single-crystal FET showed a parabolic variation, with a minimum μ at around x =0.4 , which probably originates from the disorder of the single crystal caused by the partial replacement of Se by Te, i.e., a disorder that may be due to ionic size difference of Se and Te.

  2. Ethanol oxidation reactions catalyzed by water molecules: CH3CH2OH+n H2O→ CH3CHO+ H2+n H2O (n=0,1,2)

    Science.gov (United States)

    Takahashi, H.; Hisaoka, S.; Nitta, T.

    2002-09-01

    Ab initio density functional theory calculations have been performed to investigate the catalytic role of water molecules in the oxidation reaction of ethanol: CH3CH2OH+n H2O→ CH3CHO+ H2+n H2O (n=0,1,2) . The results show that the potential energy barrier for the reaction is 88.0 kcal/mol in case of n=0, while it is reduced by ˜34 kcal/mol when two water molecules are involved ( n=2) in the reaction. As a result, the rate constant increases to 3.31×10 -4 s-1, which shows a significant catalytic role of water molecules in the ethanol oxidation reactions.

  3. Can T1 w/T2 w ratio be used as a myelin-specific measure in subcortical structures? Comparisons between FSE-based T1 w/T2 w ratios, GRASE-based T1 w/T2 w ratios and multi-echo GRASE-based myelin water fractions.

    Science.gov (United States)

    Uddin, Md Nasir; Figley, Teresa D; Marrie, Ruth Ann; Figley, Chase R

    2018-03-01

    Given the growing popularity of T 1 -weighted/T 2 -weighted (T 1 w/T 2 w) ratio measurements, the objective of the current study was to evaluate the concordance between T 1 w/T 2 w ratios obtained using conventional fast spin echo (FSE) versus combined gradient and spin echo (GRASE) sequences for T 2 w image acquisition, and to compare the resulting T 1 w/T 2 w ratios with histologically validated myelin water fraction (MWF) measurements in several subcortical brain structures. In order to compare these measurements across a relatively wide range of myelin concentrations, whole-brain T 1 w magnetization prepared rapid acquisition gradient echo (MPRAGE), T 2 w FSE and three-dimensional multi-echo GRASE data were acquired from 10 participants with multiple sclerosis at 3 T. Then, after high-dimensional, non-linear warping, region of interest (ROI) analyses were performed to compare T 1 w/T 2 w ratios and MWF estimates (across participants and brain regions) in 11 bilateral white matter (WM) and four bilateral subcortical grey matter (SGM) structures extracted from the JHU_MNI_SS 'Eve' atlas. Although the GRASE sequence systematically underestimated T 1 w/T 2 w values compared to the FSE sequence (revealed by Bland-Altman and mountain plots), linear regressions across participants and ROIs revealed consistently high correlations between the two methods (r 2 = 0.62 for all ROIs, r 2 = 0.62 for WM structures and r 2 = 0.73 for SGM structures). However, correlations between either FSE-based or GRASE-based T 1 w/T 2 w ratios and MWFs were extremely low in WM structures (FSE-based, r 2 = 0.000020; GRASE-based, r 2 = 0.0014), low across all ROIs (FSE-based, r 2 = 0.053; GRASE-based, r 2 = 0.029) and moderate in SGM structures (FSE-based, r 2 = 0.20; GRASE-based, r 2 = 0.17). Overall, our findings indicated a high degree of correlation (but not equivalence) between FSE-based and GRASE-based T 1 w/T 2 w ratios, and low correlations between T 1 w/T 2 w ratios and MWFs. This

  4. Association between US features of primary tumor and axillary lymph node metastasis in patients with clinical T1-T2N0 breast cancer.

    Science.gov (United States)

    Bae, Min Sun; Shin, Sung Ui; Song, Sung Eun; Ryu, Han Suk; Han, Wonshik; Moon, Woo Kyung

    2018-04-01

    Background Most patients with early-stage breast cancer have clinically negative lymph nodes (LNs). However, 15-20% of patients have axillary nodal metastasis based on the sentinel LN biopsy. Purpose To assess whether ultrasound (US) features of a primary tumor are associated with axillary LN metastasis in patients with clinical T1-T2N0 breast cancer. Material and Methods This retrospective study included 138 consecutive patients (median age = 51 years; age range = 27-78 years) who underwent breast surgery with axillary LN evaluation for clinically node-negative T1-T2 breast cancer. Three radiologists blinded to the axillary surgery results independently reviewed the US images. Tumor distance from the skin and distance from the nipple were determined based on the US report. Association between US features of a breast tumor and axillary LN metastasis was assessed using a multivariate logistic regression model after controlling for clinicopathologic variables. Results Of the 138 patients, 28 (20.3%) had nodal metastasis. At univariate analysis, tumor distance from the skin ( P = 0.019), tumor size on US ( P = 0.023), calcifications ( P = 0.036), architectural distortion ( P = 0.001), and lymphovascular invasion ( P = 0.049) were associated with axillary LN metastasis. At multivariate analysis, shorter skin-to-tumor distance (odds ratio [OR] = 4.15; 95% confidence interval [CI] = 1.01-16.19; P = 0.040) and masses with associated architectural distortion (OR = 3.80; 95% CI = 1.57-9.19; P = 0.003) were independent predictors of axillary LN metastasis. Conclusion US features of breast cancer can be promising factors associated with axillary LN metastasis in patients with clinically node-negative early-stage breast cancer.

  5. Bi∼3.785Cd∼3.575Cu∼1.5(PO4)3.5O5.5, a new arrangement of double (n=2) and triple (n=3) [M4Bi2n-2O2n]x+ polycationic ribbons in the bismuth-transition metal oxy-phosphate series

    International Nuclear Information System (INIS)

    Colmont, Marie; Huve, Marielle; Abraham, Francis; Mentre, Olivier

    2004-01-01

    This work is dedicated to investigation of new disordered bismuth-containing oxy-phosphates compounds with an original structure type. As previously observed in this series, they are formed of [M 4 Bi 2n-2 O 2n ] x+ polycationic ribbons of width n O(Bi,M) 4 tetrahedra, surrounded by PO 4 groups. In the new crystal structure type, double (=D), triple (=T) and tunnels (=t) alternate along a common axis obeying the TtDtTtDt/TTtTTt sequence in respect to a nomenclature previously described and recalled in this work. The existence this new polymorph has first been detected by electron diffraction in a multi-phased sample. Then, the crystal structure type, i.e., the TtDtTtDt/TTtTTt sequence, has been deduced from HREM images help to a contrast-interpreting code available for these series of polycations-formed compounds. The subsequent compounds formulation leads to a number of new materials that verify the general formula: [Bi 2 (Bi,M) 4 O 4 ] 2 [Bi 4 (Bi,M) 4 O 6 ] 6 (PO 4 ) 28 M x , with x= 2+ , Cd 2+ cations. Single crystals of the nominal [O6Bi 4.57 Cd 3.43 ] 4 +8.57 [O 6 Bi 4 Cd 4 ] 2 +8 [O 4 Bi 2 Cd 3.56 Cu 0.44 ] 2 +6 (PO 4 ) 28 Cu 10.86 have been prepared in a further stage and confirms the predicted crystal structure, Bi ∼3.785 Cd ∼3.575 Cu ∼1.5 (PO 4 ) 3.5 O 5.5 , a=11.506(8)A, b=5.416(4)A, c=53.94 (4)A, β=90.10(1) o , RF=0.0835, RwF=0.0993, SG=A2/m, Z=8. As already observed for other elements of this family such as Bi ∼1.2 M1.2 O 1.5 (PO 4 ), Bi ∼6.2 Cu ∼6.2 O 8 (PO 4 ) 5 or Bi ∼3 Cd ∼3.72 M1.28 O 5 (PO 4 ) 3 (M=Cu, Co, Zn), this compound shows an additional example of PO 4 disorder due to the presence of mixed Bi 3+ /M 2+ sites at the edges of ribbons. The origin and consequence of this so-called disorder mostly occurring on PO 4 configurations is intensively discussed and has been characterized by infrared spectroscopy and by neutron diffraction on similar compounds. It is noticeable that the great number of antagonist PO 4

  6. Study of the quasi-free scattering at the reaction 2H(p,2p)n at Esub(p)0 = 14.1 MeV

    International Nuclear Information System (INIS)

    Helten, H.J.

    1980-01-01

    The breakup reaction 2 H(p,2p)n was studied at Ep = 14.1 MeV in complete coincidence experiments on quasifree pp scattering in a systematic range of cinematic situations of the pp-subsystem for c.m. production angles between 90 0 and 140 0 and different violation of the quasifree condition as well on interferences with final-state interaction processes. The absolute differential breakup cross section was compared with approximate solutions of the Faddeev equations with separable s-wave potentials without explicite Coulomb interaction according to Ebenhoeh. The agreement is generally good referring to the form of the spectra, but the theoretical amplitude is in the mean 20% to high. The permanent independence of the quasifree breakup from the scattering parameter asub(pp) doesn't suggest to use this process for the determination of nn-scattering lengths from the mirror reaction 2 H(n,2n)p. (orig.)

  7. Precise Extraction of the Neutron Magnetic Form Factor from Quasi-elastic 3He(pol)(e(pol),e') at Q2 = 0.1-0.6 (GeV/c)2

    International Nuclear Information System (INIS)

    Jens-ole Hansen; Brian Anderson; Leonard Auerbach; Todd Averett; William Bertozzi; Tim Black; John Calarco; Lawrence Cardman; Gordon Cates; Zhengwei Chai; Jiang-Ping Chen; Seonho Choi; Eugene Chudakov; Steve Churchwell; G Corrado; Christopher Crawford; Daniel Dale; Alexandre Deur; Pibero Djawotho; Dipangkar Dutta; John Finn; Haiyan Gao; Ronald Gilman; Oleksandr Glamazdin; Charles Glashausser; Walter Gloeckle; Jacek Golak; Javier Gomez; Viktor Gorbenko; F. Hersman; Douglas Higinbotham; Richard Holmes; Calvin Howell; Emlyn Hughes; Thomas Humensky; Sebastien Incerti; Piotr Zolnierczuk; Cornelis De Jager; John Jensen; Xiaodong Jiang; Cathleen Jones; Mark Jones; R Kahl; H Kamada; A Kievsky; Ioannis Kominis; Wolfgang Korsch; Kevin Kramer; Gerfried Kumbartzki; Michael Kuss; Enkeleida Lakuriqi; Meihua Liang; Nilanga Liyanage; John LeRose; Sergey Malov; Demetrius Margaziotis; Jeffery Martin; Kathy McCormick; Robert McKeown; Kevin McIlhany; Zein-Eddine Meziani; Robert Michaels; Greg Miller; Joseph Mitchell; Sirish Nanda; Emanuele Pace; Tina Pavlin; Gerassimos Petratos; Roman Pomatsalyuk; David Pripstein; David Prout; Ronald Ransome; Yves Roblin; Marat Rvachev; Giovanni Salme; Michael Schnee; Charles Seely; Taeksu Shin; Karl Slifer; Paul Souder; Steffen Strauch; Riad Suleiman; Mark Sutter; Bryan Tipton; Luminita Todor; M Viviani; Branislav Vlahovic; John Watson; Claude Williamson; H Witala; Bogdan Wojtsekhowski; Feng Xiong; Wang Xu; Jen-chuan Yeh

    2006-01-01

    We have measured the transverse asymmetry A T' in the quasi-elastic 3 /rvec He/(/rvec e/,e') process with high precision at Q 2 -values from 0.1 to 0.6 (GeV/c) 2 . The neutron magnetic form factor G M n was extracted at Q 2 -values of 0.1 and 0.2 (GeV/c) 2 using a non-relativistic Faddeev calculation which includes both final-state interactions (FSI) and meson-exchange currents (MEC). Theoretical uncertainties due to the FSI and MEC effects were constrained with a precision measurement of the spin-dependent asymmetry in the threshold region of 3 /rvec He/(/rvec e/,e'). We also extracted the neutron magnetic form factor G M n at Q 2 -values of 0.3 to 0.6 (GeV/c) 2 based on Plane Wave Impulse Approximation calculations

  8. The B(E2;4^+1->2^+1) / B(E2;2^+1->0^+1) Ratio in Even-Even Nuclei

    Science.gov (United States)

    Loelius, C.; Sharon, Y. Y.; Zamick, L.; G"Urdal, G.

    2009-10-01

    We considered 207 even-even nuclei throughout the chart of nuclides for which the NNDC Tables had data on the energies and lifetimes of the 2^+1 and 4^+1 states. Using these data we calculated for each nucleus the electric quadrupole transition strengths B(E2;4^+1->2^+1) and B(E2;2^+1->0^+1), as well as their ratio. The internal conversion coefficients were obtained by using the NNDC HSICC calculator. For each nucleus we plotted the B(E2) ratio against A, N, and Z. We found that for close to 90% of the nuclei considered the ratio had values between 0.5 and 2.5. Most of the outliers had magic numbers of protons or neutrons. Our ratio results were compared with the theoretical predictions for this ratio by different models--10/7 in the rotational model and 2 in the simplest vibrational model. In the rotational regions (for 150 220) the ratios were indeed close to 10/7. For the few nuclei thought to be vibrational the ratios were usually less than 2. Otherwise, we got a wide scatter of ratio values. Hence other models, including the NpNn scheme, must be considered in interpreting these results.

  9. Laser surgery combined with radiotherapy for T1/T2 hypopharyngeal squamous cell carcinomas

    International Nuclear Information System (INIS)

    Sakamoto, Kikuo; Nakashima, Tadashi

    2006-01-01

    We analyzed the results and clinical features of 41 patients with T1 or T2 squamous cell carcinoma of the hypopharynx who received the treatment of laser surgery combined with radiotherapy at the Kurume University Hospital between 1989 and 2003. The patients consisted of 38 males and 3 females (mean age: 64 years); T classification was 8 T1 cases and 33 T2 cases. N classification of the patients was 20 N0 cases, 9 N1 cases, 10 N2 cases, and 2 N3 cases. Three were stage I, 17 were stage II, 9 were stage III, and 12 were stage IV. Sub-sites of the tumor were 33 of piriform sinus type, 6 of post-cricoid type and 2 of poterior wall type. The primary disease was treated by laser debulking surgery combined with radiotherapy. Local recurrence was recognized in 4 cases and laryngectomy was performed in 3 cases. As a result, 38 (92.6%) cases were treated by preserving the larynx. All patients could eat a meal from the day following the operation. Tracheostomy was performed in six cases, but the tracheal stoma could be closed in five. The disease-specific 5-year survival rate was 87.7%. The 5-year local control rate was 90.2%. The overall 5-year survival rate was 49.2%. Four patients died of the primary disease (lymph node death: 3, distant metastasis death: 1). This retrospective review indicates that laser debulking surgery combined with radiotherapy is a successful treatment for T1/T2 hypopharyngeal carcinoma. (author)

  10. Incidence and outcome for patients with occult lymph node involvement in T1 and T2 oral squamous cell carcinoma: a prospective study

    International Nuclear Information System (INIS)

    Mücke, Thomas; Mitchell, David A; Wagenpfeil, Stefan; Ritschl, Lucas M; Wolff, Klaus-Dietrich; Kanatas, Anastasios

    2014-01-01

    The evidence base to inform the decision making process in patients with early stage oral cancer and a clinical and radiological N0 neck remains insufficient to answer the question when it is safe to “watch and wait” and when to proceed with a selective neck dissection. A total of 327 consecutive cases of histopathologically staged T 12 , N 01 and M 0 , but clinically N 0, squamous cell carcinoma of the tongue were prospectively analysed. Univariate and multivariate analyses were used for statistical analysis and are represented as Kaplan-Meier analyses or Cox proportional hazard regression analysis. In 61 patients (18.65%) lymph node involvement was found in the histopathological processing. The mean survival of all patients was 73.3 ± 48.6 months. The 2-year and 5-year overall survival rates of all patients were 87.5% and 68.4%, respectively. The 2-year and 5-year survival rates for stage N 0 were 89.1% and 70.7% compared to 83.3% and 62.9% in N 1 situations. The 2-year and 5-year survival rates for stage T 1 were 87.9% and 73.6% compared to 87.2% and 65.3% in stage T 2 , respectively . The time to recurrence in stage N 0 was 35.1 ± 30.5 months compared to 25.63 ± 24.6 months in cases with N 1 disease. Stage T 1 was associated with a time to recurrence of 38.1 ± 33.9 months compared with 27.2 ± 22.7 months in patients classified T 2 . Variables found to be strongly associated with survival in the univariate analysis included older age, higher tumour and N stage, and grading. Age, tumour stage (p = 0.011, 95% CI, 1.09 to 2.0), nodal stage (p = 0.038, 95% CI, 1.02 to 2.07), and recurrence were independently and significantly associated with survival in the multivariate analysis. This confirms a high overall disease free survival for patients with T1 and N0 treated with single modality surgery and in common with the literature confirms the poor impact on prognosis of the N positive neck

  11. Repercussão da imunoterapia específica na população T1 e T2 de linfócitos periféricos em doentes atópicos Specific immunotherapy effect on peripheral blood T1/T2 lymphocytes in atopic patients

    Directory of Open Access Journals (Sweden)

    Manuela Rebordão

    2006-03-01

    Full Text Available A coordenação das características humorais e celulares da resposta alérgica, sabe-se hoje, está dependente da regulação por linfócitos T. As vacinas de alergénios são uma terapêutica que consegue modular a resposta das células T, e cujos mecanismos imunológicos permanecem incompletamente esclarecidos. Objectivo: Avaliar o efeito da imunoterapia, após um ano de tratamento, na expressão de citocinas de perfil T1 e T2 em linfócitos de sangue periférico de doentes atópicos. Material e métodos: Estudaram-se dez doentes atópicos sensibilizados a aeroalergénios comuns a fazerem vacinas de alergénios num período médio de um ano. Dentre estes, seis foram estudados antes e após a vacina. Como controlo estudou-se um grupo atópico sem imunoterapia constituído por 14 doentes também sensibilizados a aeroalergénios comuns e um grupo de indivíduos não atópicos, saudáveis, constituído por 7 elementos. A activação dos linfócitos T fez-se com PMA, ionomicina e brefeldina e estudaram-se as citocinas intracitoplasmáticas IFN-g, IL-4, IL-5 e IL-10 por citometria de fluxo. Procedeu-se a análise estatística por testes não paramétricos (Teste de Mann-Whitney U e Wilcoxon, considerando-se significativo p£0,05. Resultados: A expressão de IL-4 e IL-5 nas células T, caracteristicamente aumentada nos doentes atópicos, respectivamente 13,8 (3,1-31,8 e 6,7% (1,0-20,4, é significativamente mais baixa no grupo que realizou a imunoterapia [5,4 (2,9-15,6 p= 0,007 e 2,1% (0,6-4,8 p=0,035] não diferindo do grupo controlo não atópico [5,1 (4,1-6,9 e 1,0 (0,4-2,1]. Os níveis de IFN-g não variaram significativamente entre os três grupos estudados, mas a razão IFN-g//IL-4 nos linfócitos T CD4 aumentou significativamente nos doentes submetidos a imunoterapia. Por outro lado, houve um aumento da expressão de IL-10 nas células T circulantes do grupo sob imunoterapia, comparativamente a controlos não atópicos [1,9 (1,0-4,9 versus 1

  12. Ab initio calculations on the X (2)B1 and A (2)A1 states of AsH2, and Franck-Condon simulation, including anharmonicity, of the A(0,0,0)-X single vibronic level emission spectrum of AsH2.

    Science.gov (United States)

    Lee, Edmond P F; Mok, Daniel K W; Chau, Foo-Tim; Dyke, John M

    2010-06-21

    Restricted-spin coupled-cluster single-double plus perturbative triple excitation {RCCSD(T)} calculations were carried out on the X (2)B(1) and A (2)A(1) states of AsH(2) employing the fully relativistic small-core effective core potential (ECP10MDF) for As and basis sets of up to the augmented correlation-consistent polarized valence quintuple-zeta (aug-cc-pV5Z) quality. Minimum-energy geometrical parameters and relative electronic energies were evaluated, including contributions from extrapolation to the complete basis set limit and from outer core correlation of the As 3d(10) electrons employing additional tight 4d3f2g2h functions designed for As. In addition, simplified, explicitly correlated CCSD(T)-F12 calculations were also performed employing different atomic orbital basis sets of up to aug-cc-pVQZ quality, and associated complementary auxiliary and density-fitting basis sets. The best theoretical estimate of the relative electronic energy of the A (2)A(1) state of AsH(2) relative to the X (2)B(1) state including zero-point energy correction (T(0)) is 19,954(32) cm(-1), which agrees very well with available experimental T(0) values of 19,909.4531(18) and 19,909.4910(17) cm(-1) obtained from recent laser induced fluorescence and cavity ringdown absorption spectroscopic studies. In addition, potential energy functions (PEFs) of the X (2)B(1) and A (2)A(1) states of AsH(2) were computed at different RCCSD(T) and CCSD(T)-F12 levels. These PEFs were used in variational calculations of anharmonic vibrational wave functions, which were then utilized to calculate Franck-Condon factors (FCFs) between these two states, using a method which includes allowance for anharmonicity and Duschinsky rotation. The A(0,0,0)-X single vibronic level (SVL) emission spectrum of AsH(2) was simulated using these computed FCFs. Comparison between simulated and available experimental vibrationally resolved spectra of the A(0,0,0)-X SVL emission of AsH(2), which consist essentially of

  13. Study of hypercharge exchange processes 0{sup -}1/2+{yields}1{sup -} 1/2+; Estudio de procesos 0-1/2+{yields}1-1/2+ con intercambio de hipercarga

    Energy Technology Data Exchange (ETDEWEB)

    Albajar Molera, M c; Aguilar Beniter de Lugo, M.

    1981-07-01

    In this work we present a formalism for the reconstruction of the transitivity amplitudes governing the processes of the type 0-1/2+{yields}1-1/2+. The formalism uses the information contained in the decay angular correlations and takes into account the existence of mixed spin configurations in the final state 0-1/2+{yields}(0{down_arrow}, 1-)1/2+ (Author) 10 refs.

  14. N,N'-di-(m-methylphenyi)-3,6-dimethyl-1,4-dihydro-1,2,4,5-tetrazine-1,4-dicarboamide (ZGDHu-1) suppresses the proliferation of PANC-1 pancreatic cancer cells via apoptosis and G2/M cell cycle arrest.

    Science.gov (United States)

    Chen, Su-Feng; Xia, Jun; Lv, Ya-Ping; Liu, Jin-Lin; Li, Wan-Xiang; Yu, Xi-Ping; Hu, Wei-Xiao; Zhou, Yong-Lie

    2015-04-01

    Pancreatic cancer is one of the human gastrointestinal malignancies with a high mortality and poor prognosis. Approximately eighty percent of patients are diagnosed with unresectable or metastatic disease. Thus, development of novel chemicals in the treatment of pancreatic cancer is imperative. This study aimed to investigate the anticancer effects of N,N'-di-(m-methylphenyi)-3,6-dimethyl-1,4-dihydro-1,2,4,5-tetrazine-1,4-dicarboamide (ZGDHu-1), a new tetrazine derivative, on the PANC-1 pancreatic cancer cell line and clarify the underlying molecular mechanism. Using an MTT assay, we found that ZGDHu-1 significantly suppressed the proliferation of PANC-1 cells in a time- and dose-dependent manner. Moreover, according to the morphological and flow cytometric analysis, the results indicated that ZGDHu-1 induced PANC-1 cell apoptosis and G2/M cell cycle arrest in a dose-dependent manner. In the western blot analysis, expression of the pro-apoptotic Bax gene was upregulated while the anti-apoptotic Bcl-2 gene was downregulated following treatment with ZGDHu-1. ZGDHu-1 also activated pro-caspase-3 and PARP and increased the expression of NF-κB inhibitor IκB. Furthermore, the expression levels of G2/M regulatory molecules such as cyclin B1 and cdc2 were decreased while that of Chk1 was increased. These results suggested that ZGDHu-1 suppressed the proliferation of pancreatic cancer cells, rendering it a potential therapeutic drug for the treatment of pancreatic cancer.

  15. Phase III Randomized Study of 4 Weeks of High-Dose Interferon-α-2b in Stage T2bNO, T3a-bNO, T4a-bNO, and T1-4N1a-2a (microscopic) Melanoma: A Trial of the Eastern Cooperative Oncology Group-American College of Radiology Imaging Network Cancer Research Group (E1697).

    Science.gov (United States)

    Agarwala, Sanjiv S; Lee, Sandra J; Yip, Waiki; Rao, Uma N; Tarhini, Ahmad A; Cohen, Gary I; Reintgen, Douglas S; Evans, Terry L; Brell, Joanna M; Albertini, Mark R; Atkins, Michael B; Dakhil, Shaker R; Conry, Robert M; Sosman, Jeffrey A; Flaherty, Lawrence E; Sondak, Vernon K; Carson, William E; Smylie, Michael G; Pappo, Alberto S; Kefford, Richard F; Kirkwood, John M

    2017-03-10

    Purpose To test the efficacy of 4 weeks of intravenous (IV) induction with high-dose interferon (IFN) as part of the Eastern Cooperative Oncology Group regimen compared with observation (OBS) in patients with surgically resected intermediate-risk melanoma. Patients and Methods In this intergroup international trial, eligible patients had surgically resected cutaneous melanoma in the following categories: (1) T2bN0, (2) T3a-bN0, (3) T4a-bN0, and (4) T1-4N1a-2a (microscopic). Patients were randomly assigned to receive IFN α-2b at 20 MU/m 2 /d IV for 5 days (Monday to Friday) every week for 4 weeks (IFN) or OBS. Stratification factors were pathologic lymph node status, lymph node staging procedure, Breslow depth, ulceration of the primary lesion, and disease stage. The primary end point was relapse-free survival. Secondary end points included overall survival, toxicity, and quality of life. Results A total of 1,150 patients were randomly assigned. At a median follow-up of 7 years, the 5-year relapse-free survival rate was 0.70 (95% CI, 0.66 to 0.74) for OBS and 0.70, (95% CI, 0.66 to 0.74) for IFN ( P = .964). The 5-year overall survival rate was 0.83 (95% CI, 0.79 to 0.86) for OBS and 0.83 (95% CI, 0.80 to 0.86) for IFN ( P = .558). Treatment-related grade 3 and higher toxicity was 4.6% versus 57.9% for OBS and IFN, respectively ( P weeks of IV induction as part of the Eastern Cooperative Oncology Group high-dose IFN regimen is not better than OBS alone for patients with intermediate-risk melanoma as defined in this trial.

  16. Poly[[μ2-2,2′-diethyl-1,1′-(butane-1,4-diyldiimidazole-κ2N3:N3′](μ2-5-hydroxyisophthalato-κ2O1:O3zinc

    Directory of Open Access Journals (Sweden)

    Ying-Ying Liu

    2011-11-01

    Full Text Available In the title coordination polymer, [Zn(C8H4O5(C14H22N4]n, the ZnII cation is coordinated by an O2N2 donor set in a distorted tetrahedral geometry. The ZnII ions are linked by μ2-OH-bdc (OH-H2bdc = 5-hydroxyisophthalic acid and bbie ligands [bbie = 2,2′-diethyl-1,1′-(butane-1,4-diyldiimidazole], forming a two-dimensional layer parallel to the ab plane. The layers are further connected through intermolecular C—H...O and O—H...O hydrogen bonds, forming a three-dimensional supramolecular structure. In the bbie ligand, the two C atoms in the ethyl group are each disordered over two positions with a site-occupancy ratio of 0.69:0.31.

  17. La0⋅ 9Sr01Ga0⋅ 8M02O3–δ (M= Mn, Co, Ni, Cu or Zn ...

    Indian Academy of Sciences (India)

    Perovskite oxides of the general formula, La0.9Sr0.1Ga0.8M0.2O3– for M = Mn, Co, Ni, Cu and Zn, have been prepared and investigated. All the oxides exhibit high electrical conductivities ( ∼ 10–2 S/cm at 800°C) comparable to that of the best perovskite oxide ion conductor, La0.9Sr0.1Ga0.8Mg0.2O2.85 (LSGM) ( ...

  18. J e (4.2?K, 31.2 T) beyond 1?kA/mm2 of a ~3.2??m thick, 20?mol% Zr-added MOCVD REBCO coated conductor

    OpenAIRE

    Xu, A.; Zhang, Y.; Gharahcheshmeh, M. Heydari; Yao, Y.; Galstyan, E.; Abraimov, D.; Kametani, F.; Polyanskii, A.; Jaroszynski, J.; Griffin, V.; Majkic, G.; Larbalestier, D. C.; Selvamanickam, V.

    2017-01-01

    A main challenge that significantly impedes REBa2Cu3Ox (RE?=?rare earth) coated conductor applications is the low engineering critical current density J e because of the low superconductor fill factor in a complicated layered structure that is crucial for REBa2Cu3Ox to carry supercurrent. Recently, we have successfully achieved engineering critical current density beyond 2.0?kA/mm2 at 4.2?K and 16 T, by growing thick REBa2Cu3Ox layer, from ?1.0??m up to ?3.2??m, as well as controlling the pin...

  19. (C2N2H10)[Fe xV1-x(HPO3)F3] (x = 0.44, 0.72): Two new organically templated phosphites

    International Nuclear Information System (INIS)

    Cisneros, Jose L.; Fernandez-Armas, Sergio; Mesa, Jose L.; Pizarro, Jose L.; Arriortua, Maria I.; Rojo, Teofilo

    2006-01-01

    (C 2 N 2 H 10 )[Fe x V 1-x (HPO 3 )F 3 ] (x = 0.44, 0.72) have been synthesized using mild solvothermal conditions under autogenous pressure and the ethylenediamine molecule as templating agent. The crystal structures have been determined from X-ray single-crystal diffraction data. The compounds crystallize in the orthorhombic P2 1 2 1 2 1 space group with Z = 4 and unit-cell parameters a = 12.8494(9), b = 9.5430(6), c = 6.4372(5) A, and a = 12.8578(1), b = 9.5342(1), c = 6.4370(7) A for (C 2 N 2 H 10 )[Fe 0.44 V 0.56 (HPO 3 )F 3 ] and (C 2 N 2 H 10 )[Fe 0.72 V 0.28 (HPO 3 )F 3 ] (1) and (2), respectively. These isostructural compounds exhibit a monodimensional crystal structure formed by pillared double anionic chains with the formula [M(HPO 3 )F 3 ] 2- , extended along the [0 0 1] direction. These doubled ionic chains are the result of the linking of two simple chains in which there are alternating octahedral [MO 3 F 3 ] and tetrahedral groups [HPO 3 ]. The ethylendiammonium cations are placed in the space delimited by three different chains. The metallic ions are interconnected by the pseudo-pyramidal (HPO 3 ) 2- phosphite oxoanions, adopting a slightly distorted octahedral geometry. The IR spectra show bands corresponding to the phosphite oxoanion and the ethylendiamonium cation at 2400 and 1600 cm -1 , respectively. The thermogravimetric analyses show that these phases are stable up to ca. 280 deg. C, at higher temperatures, the decomposition of the crystal structure begins by calcination of the organic cation and the elimination of the fluoride anions. The diffuse reflectance spectra show bands of the V 3+ ion (d 2 ) in octahedral symmetry. The values of the Dq (1540, 1540 cm -1 ), and Racah parameters, B (560, 535 cm -1 ) and C (3055, 3140 cm -1 ) for (1) and (2), respectively, correspond with those usually found for octahedrically coordinated V(III) compounds. Magnetic measurements, performed on a powered sample from 5.0 to 300 K at 1000 G, in the ZFC and

  20. Study of Stark Effect in n-doped 1.55 μm InN0.92yP1-1.92yBiy/InP MQWs

    Science.gov (United States)

    Bilel, C.; Chakir, K.; Rebey, A.; Alrowaili, Z. A.

    2018-05-01

    The effect of an applied electric field on electronic band structure and optical absorption properties of n-doped InN0.92y P1-1.92y Bi y /InP multiple quantum wells (MQWs) was theoretically studied using a self-consistent calculation combined with the 16-band anti-crossing model. The incorporation of N and Bi atoms into an InP host matrix leads to rapid reduction of the band gap energy covering a large infrared range. The optimization of the well parameters, such as the well/barrier widths, N/Bi compositions and doping density, allowed us to obtain InN0.92y P1-1.92y Bi y /InP MQWs operating at the wavelength 1.55 μm. Application of the electric field causes a red-shift of the fundamental transition energy T 1 accompanied by a significant change in the spatial distribution of confined electron density. The Stark effect on the absorption coefficient of n-doped InN0.92y P1-1.92y Bi y /InP MQWs was investigated. The Bi composition of these MQWs was adjusted for each electric field value in order to maintain the wavelength emission at 1.55 μm.

  1. Bioaccumulation of "2"1"0Po and "2"1"0Pb in the crustaceans of Pichavaram mangrove ecosystem, Tamil nadu, India

    International Nuclear Information System (INIS)

    Raja, P.; Shahul Hameed, P.

    2017-01-01

    It was observed that the concentrations of "2"1"0Po in water and sediment were 1.64mBq/l and 5.92 Bq/kg and "2"1"0Pb in water and sediment samples 3.10 mBq/l and 2.45 Bq/kg respectively. The muscle of crabs registered a higher level of "2"1"0Po (152 Bq/kg) than that of prawns (71.87 Bq/kg) and lobster (49.3Bq/kg). Conversely the exoskeleton of crustacean species analyzed, accumulated a higher level of "2"1"0Pb (range 5.7-9.11 Bq/kg) as compared to level of accumulated "2"1"0Pb in muscle (range 1.62-2.54 Bq/kg). The study reveals the base line data on the levels of naturally occurring radionuclides such as "2"1"0Po and "2"1"0Pb in the prestart environment of Pichavaram Mangrove Ecosystem with special reference to the crustaceans. (author)

  2. Study of hypercharge exchange processes 0-1/2+→1- 1/2+

    International Nuclear Information System (INIS)

    Albajar Molera, M. c.; Aguilar Beniter de Lugo, M.

    1981-01-01

    In this work we present a formalism for the reconstruction of the transitivity amplitudes governing the processes of the type 0-1/2+→1-1/2+. The formalism uses the information contained in the decay angular correlations and takes into account the existence of mixed spin configurations in the final state 0-1/2+→(0↓, 1-)1/2+ (Author) 10 refs

  3. CaV 3.1 and CaV 3.3 account for T-type Ca2+ current in GH3 cells

    Directory of Open Access Journals (Sweden)

    M.A. Mudado

    2004-06-01

    Full Text Available T-type Ca2+ channels are important for cell signaling by a variety of cells. We report here the electrophysiological and molecular characteristics of the whole-cell Ca2+ current in GH3 clonal pituitary cells. The current inactivation at 0 mV was described by a single exponential function with a time constant of 18.32 ± 1.87 ms (N = 16. The I-V relationship measured with Ca2+ as a charge carrier was shifted to the left when we applied a conditioning pre-pulse of up to -120 mV, indicating that a low voltage-activated current may be present in GH3 cells. Transient currents were first activated at -50 mV and peaked around -20 mV. The half-maximal voltage activation and the slope factors for the two conditions are -35.02 ± 2.4 and 6.7 ± 0.3 mV (pre-pulse of -120 mV, N = 15, and -27.0 ± 0.97 and 7.5 ± 0.7 mV (pre-pulse of -40 mV, N = 9. The 8-mV shift in the activation mid-point was statistically significant (P < 0.05. The tail currents decayed bi-exponentially suggesting two different T-type Ca2+ channel populations. RT-PCR revealed the presence of a1G (CaV3.1 and a1I (CaV3.3 T-type Ca2+ channel mRNA transcripts.

  4. USPIO-labeling in M1 and M2-polarized macrophages: An in vitro study using a clinical magnetic resonance scanner.

    Science.gov (United States)

    Zini, Chiara; Venneri, Mary A; Miglietta, Selenia; Caruso, Damiano; Porta, Natale; Isidori, Andrea M; Fiore, Daniela; Gianfrilli, Daniele; Petrozza, Vincenzo; Laghi, Andrea

    2018-08-01

    Aim of the study was to evaluate USPIO labeling in different macrophage populations using a clinical 3.0T MR unit with optical and electron microscopy as the gold standard. Human monocytic cell line THP-1 cells were differentiated into macrophages. Afterwards, M0 macrophages were incubated with IL-4 and IL-13 in order to obtain M2 polarized macrophages or with IFN-gamma and LPS for classical macrophage activation (M1). These groups were incubated with USPIO-MR contrast agent (P904) for 36 hr; M0, M0 + P904, M1 +  P904, and M2 + P904 were analyzed in gel phantoms with a 3.0T MR scanner. m-RNA of M1 and M2 markers confirmed the polarization of THP-1-derived macrophages. M2 + P904 showed a much higher T1 signal (p <  0.0001), a significantly lower (p < 0.0001) T2* signal, and significantly higher R* (p < 0.0001) compared to the other populations. Hystological analysis confirmed higher iron content in the M2-polarized population compared to both M1-polarized (p = 0.04) and M0-P904 (p = 0.003). Ultrastructure analysis demonstrated ubiquitous localization of P904 within the cellular compartments. Our results demonstrate that a selective USPIO-labeling of different macrophage populations can be detected in vitro using the 3.0T clinical scanner. © 2017 Wiley Periodicals, Inc.

  5. Bis[1,3-bis(2,4,6-trimethylphenyl-2,3-dihydro-1H-imidazol-2-ylidene]dinitrosyl(tetrahydroborato-κ2H,H′tungsten(0

    Directory of Open Access Journals (Sweden)

    Heinz Berke

    2011-01-01

    Full Text Available In the title paramagnetic 19-electron neutral complex, [W(BH4(C21H24N22(NO2], the W(0 atom is coordinated by two 1,3-bis(2,4,6-trimethylphenylimidazol-2-ylidene (IMes carbene ligands, two NO groups and two H atoms of an η2-tetrahydroborate ligand. Depending on the number of coordination sites (n assigned to the BH4− ligand, the coordination geometry of the W atom may either be described as approximately trigonal–bipyramidal (n = 1 or as very distorted octahedral with the bridging H atoms filling two coordination positions (n = 2. In the latter case, the coplanar NO groups and bridging H atoms (r.m.s. deviation = 0.032 Å form one octahedral plane, with mutually trans-oriented carbene ligands. In the crystal, molecules are connected via C—H...O interactions.

  6. Identification of swine H1N2/pandemic H1N1 reassortant influenza virus in pigs, United States.

    Science.gov (United States)

    Ali, Ahmed; Khatri, Mahesh; Wang, Leyi; Saif, Yehia M; Lee, Chang-Won

    2012-07-06

    In October and November 2010, novel H1N2 reassortant influenza viruses were identified from pigs showing mild respiratory signs that included cough and depression. Sequence and phylogenetic analysis showed that the novel H1N2 reassortants possesses HA and NA genes derived from recent H1N2 swine isolates similar to those isolated from Midwest. Compared to the majority of reported reassortants, both viruses preserved human-like host restrictive and putative antigenic sites in their HA and NA genes. The four internal genes, PB2, PB1, PA, and NS were similar to the contemporary swine triple reassortant viruses' internal genes (TRIG). Interestingly, NP and M genes of the novel reassortants were derived from the 2009 pandemic H1N1. The NP and M proteins of the two isolates demonstrated one (E16G) and four (G34A, D53E, I109T, and V313I) amino acid changes in the M2 and NP proteins, respectively. Similar amino acid changes were also noticed upon incorporation of the 2009 pandemic H1N1 NP in other reassortant viruses reported in the U.S. Thus the role of those amino acids in relation to host adaptation need to be further investigated. The reassortments of pandemic H1N1 with swine influenza viruses and the potential of interspecies transmission of these reassortants from swine to other species including human indicate the importance of systematic surveillance of swine population to determine the origin, the prevalence of similar reassortants in the U.S. and their impact on both swine production and public health. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. Metallic 1T-LixMoS2 Cocatalyst Significantly Enhanced the Photocatalytic H2 Evolution over Cd0.5Zn0.5S Nanocrystals under Visible Light Irradiation.

    Science.gov (United States)

    Du, Hong; Guo, Hong-Li; Liu, Ya-Nan; Xie, Xiao; Liang, Kuang; Zhou, Xiao; Wang, Xin; Xu, An-Wu

    2016-02-17

    In the present work, metallic 1T-LixMoS2 is utilized as a novel cocatalyst for Cd0.5Zn0.5S photocatalyst. The obtained LixMoS2/Cd0.5Zn0.5S hybrids show excellent photocatalytic performance for H2 generation from aqueous solution containing Na2S and Na2SO3 under splitting visible light illumination (λ ≥ 420 nm) without precious metal cocatalysts. It turns out that a certain amount of intercalating Li(+) ions ultimately drives the transition of MoS2 crystal from semiconductor triagonal phase (2H phase) to metallic phase (1T phase). The distinct properties of 1T-LixMoS2 promote the efficient separation of photoexcited electrons and holes when used as cocatalyst for Cd0.5Zn0.5S photocatalyst. As compared to 2H-MoS2 nanosheets only having edge active sites, photoinduced electrons not only transfer to the edge sites of 1T-LixMoS2, but also to the plane active sites of 1T-LixMoS2 nanosheets. The content of LixMoS2 in hybrid photocatalysts influences the photocatalytic activity. The optimal 1T-LixMoS2 (1.0 wt %)/Cd0.5Zn0.5S nanojunctions display the best activity for hydrogen production, achieving a hydrogen evolution rate of 769.9 μmol h(-1), with no use of noble metal loading, which is about 3.5 times higher than that of sole Cd0.5Zn0.5S, and 2 times higher than that of 2H-MoS2 (1.0 wt %)/Cd0.5Zn0.5S samples. Our results demonstrate that Li(+)-intercalated MoS2 nanosheets with high conductivity, high densities of active sites, low cost, and environmental friendliness are a prominent H2 evolution cocatalyst that might substitute for noble metal for potential hydrogen energy applications.

  8. Magnetic properties and superconducting-fluctuation diamagnetism above Tc in Bi2-xPbxSr2CaCu2O8+δ (x=0.0, 0.1, 0.2, 0.3, 0.5) and

    International Nuclear Information System (INIS)

    Lee, W.C.; Cho, J.H.; Johnston, D.C.

    1991-01-01

    The magnetic susceptibilities χ(T) of the title compounds above and below T c are reported. For the Bi 2-x Pb x Sr 2 CaCu 2 O 8+δ (Bi 2:2:1:2) system, optimization of the phase purity and superconducting properties is found between x=0.2 and 0.3. The χ(T) data for these Bi 2:2:1:2 and for the two Bi 2:2:2:3 samples increase monotonically with temperature from T c up to at least 400 K, exhibiting strong negative curvature below ∼200 K. From theoretical fits to the data in the two-dimensional regime above T c using the static Lawrence-Doniach model as modified by Klemm, we conclude that the negative curvature in χ(T) for each sample arises from superconducting-fluctuation diamagnetism (SFD). The data are thus consistent with a superconducting order parameter of s-wave symmetry. From the fits to the data, the Ginzburg-Landau coherence lengths in the CuO 2 planes were obtained and found to be ξ ab (0)=20.4(2) A for Bi 2:2:1:2 and 11.8(4) A for Bi 2:2:2:3. The value for Bi 2:2:1:2 is comparable to those calculated from upper critical magnetic-field data for this compound (23.5--27.1 A). Our ξ ab (0) values for Bi 2:2:1:2 and Bi 2:2:2:3 are also comparable with that (13.6 A) found from our previous similar analysis of the SFD in YBa 2 Cu 3 O 7 . The possible role of the bridging oxygens out of the CuO 2 plane in Bi 2:2:2:3 and the influence of the dynamics in the fits to the SFD in the Bi-based compounds remain to be addressed

  9. Comportamiento dinámico de la conductividad térmica de material cerámico de estructura (Al2O3(ZnO/SnO2+Ti0,1O2

    Directory of Open Access Journals (Sweden)

    Omar, Rodríguez P.

    2013-06-01

    Full Text Available Not availableEn este trabajo, se presentan los resultados del comportamiento simulado y la medición experimental de la conductividad térmica σT de material cerámico crudo de fases (Al2O3(ZnO/SnO2+Ti0,1O2, utilizado en la fabricación de sensores de radiación térmica para el control de procesos industriales. Los resultados anteriores se obtuvieron teniendo en cuenta la aplicación de un modelo matemático de radiación de cuerpo negro, como una función no lineal dependiente de: la temperatura, permitividad eléctrica relativa y variables como humedad relativa y voltaje medidos con un dispositivo electrónico desarrollado por el grupo ESSOPTO de la Universidad Central. Por otro lado, se calculó y se simuló el comportamiento térmico del potencial químico responsable de la propagación de la energía en la estructura del compuesto (Al2O3(ZnO/SnO2+Ti0,1O2, dependiendo del tipo de distribución del tipo de portador (n y (p del material.

  10. XMCD study of the Ruddlesden-Popper phase La1.2Nd0.2Sr1.6Mn2O7

    International Nuclear Information System (INIS)

    Weigand, F.; Goering, E.; Geissler, J.; Justen, M.; Ruck, K.; Schuetz, G.; Doerr, K.

    2001-01-01

    X-ray Magnetic Circular Dichroism (XMCD) measurements of the Ruddlesden-Popper Phase La 1.2 Nd 0.2 Sr 1.6 Mn 2 O 7 are reported. The Mn K, La and Nd L 2 , 3 edges have been measured on a powder sample at two different magnetic fields at low temperature. The analysis of the spectra at B = 1T indicates a large orbital moment of the Nd 5d-states and a significant spin-polarization of the La 5d-band. Furthermore at the Mn Κ-edge a XMCD-signal is observed, showing a polarization of the Mn 4p-band. At lower field (0.2T) all XMCD-signals are about two times smaller corresponding to the lower total magnetization. The signal at the Nd L 2 edge vanishes completely at 0.2T. (au)

  11. Are prostate carcinoma clinical stages T1C and T2 similar?

    Directory of Open Access Journals (Sweden)

    Athanase Billis

    2006-04-01

    Full Text Available PURPOSE: A recent study has found that PSA recurrence rate for clinical T1c tumors is similar to T2 tumors, indicating a need for further refinement of clinical staging system. To test this finding we compared clinicopathologic characteristics and the time to PSA progression following radical retropubic prostatectomy of patients with clinical stage T1c tumors to those with stage T2, T2a or T2b tumors. MATERIALS AND METHODS: From a total of 186 consecutive patients submitted to prostatectomy, 33.52% had clinical stage T1c tumors, 45.45% stage T2a tumors and 21.02% stage T2b tumors. The variables studied were age, preoperative PSA, prostate weight, Gleason score, tumor extent, positive surgical margins, extraprostatic extension (pT3a, seminal vesicle invasion (pT3b, and time to PSA progression. Tumor extent was evaluated by a point-count method. RESULTS: Patients with clinical stage T1c were younger and had the lowest mean preoperative PSA. In the surgical specimen, they had higher frequency of Gleason score < 7 and more organ confined cancer. In 40.54% of the patients with clinical stage T2b tumors, there was extraprostatic extension (pT3a. During the study period, 54 patients (30.68% developed a biochemical progression. Kaplan-Meier product-limit analysis revealed no significant difference in the time to PSA progression between men with clinical stage T1c versus clinical stage T2 (p = 0.7959, T2a (p = 0.6060 or T2b (p = 0.2941 as well as between men with clinical stage T2a versus stage T2b (p = 0.0994. CONCLUSION: Clinicopathological features are not similar considering clinical stage T1c versus clinical stages T2, T2a or T2b.

  12. Preoperative chemoradiotherapy followed by local excision in clinical T2N0 rectal cancer

    Energy Technology Data Exchange (ETDEWEB)

    Shin, Young Seob; Park, Jin Hong; Ahn, Seung Do [Dept. of Radiation Oncology, Asan Medical Center, University of Ulsan College of Medicine, Seoul (Korea, Republic of); and others

    2016-09-15

    To investigate whether preoperative chemoradiotherapy (PCRT) followed by local excision (LE) is feasible approach in clinical T2N0 rectal cancer patients. Patients who received PCRT and LE because of clinical T2 rectal cancer within 7 cm from anal verge between January 2006 and June 2014 were retrospectively analyzed. LE was performed in case of a good clinical response after PCRT. Patients' characteristics, treatment record, tumor recurrence, and treatment-related complications were reviewed at a median follow-up of 49 months. All patients received transanal excision or transanal minimally invasive surgery. Of 34 patients, 19 patients (55.9%) presented pathologic complete response (pCR). The 3-year local recurrence-free survival and disease free-survival were 100.0% and 97.1%, respectively. There was no recurrence among the patients with pCR. Except for 1 case of grade 4 enterovesical fistula, all other late complications were mild and self-limiting. PCRT followed by an LE might be feasible as an alternative to total mesorectal excision in good responders with clinical T2N0 distal rectal cancer.

  13. Preoperative chemoradiotherapy followed by local excision in clinical T2N0 rectal cancer

    International Nuclear Information System (INIS)

    Shin, Young Seob; Park, Jin Hong; Ahn, Seung Do

    2016-01-01

    To investigate whether preoperative chemoradiotherapy (PCRT) followed by local excision (LE) is feasible approach in clinical T2N0 rectal cancer patients. Patients who received PCRT and LE because of clinical T2 rectal cancer within 7 cm from anal verge between January 2006 and June 2014 were retrospectively analyzed. LE was performed in case of a good clinical response after PCRT. Patients' characteristics, treatment record, tumor recurrence, and treatment-related complications were reviewed at a median follow-up of 49 months. All patients received transanal excision or transanal minimally invasive surgery. Of 34 patients, 19 patients (55.9%) presented pathologic complete response (pCR). The 3-year local recurrence-free survival and disease free-survival were 100.0% and 97.1%, respectively. There was no recurrence among the patients with pCR. Except for 1 case of grade 4 enterovesical fistula, all other late complications were mild and self-limiting. PCRT followed by an LE might be feasible as an alternative to total mesorectal excision in good responders with clinical T2N0 distal rectal cancer

  14. Optical measurements of the ω0/2 and 3/2ω0 light from 1.064 μm-irradiated plasmas

    International Nuclear Information System (INIS)

    Phillion, D.W.; Turner, R.E.; Campbell, M.

    1981-01-01

    The spectrum and absolute level of both the ω 0 /2 and 3/2ω 0 light have been measured at Argus over a wide range of intensities, spot sizes and energies (3 to 500 joules at 700ps). We will also present measurements at Shiva in which the spectrum, time dependence, and angular distribution of the Raman-scattered light have been measured. As much as several percent in some of these experiments. A particularly interesting experiment was performed at Argus in which a 500A thick Formvar (CH) foil was irradiated with 90 joules in 700ps. The spot size was 200 μm with a diverging f/2 beam. A calorimeter measured 0.1 J/sr in Raman light in the backwards direction. Discrete InAs detectors looking at the amount of Raman light at 1.9 and 2.0 μm detected about as much in the forward direction as the backward direction

  15. Does T1, N0-1 vulvar cancer treated by vulvectomy but not lymphadenectomy need inguinofemoral radiation?

    International Nuclear Information System (INIS)

    Manavi, Mahmood; Berger, Andreas; Kucera, Elisabeth; Vavra, Norbert; Kucera, Herwig

    1997-01-01

    Purpose: The objective of our study was to demonstrate differences in relapse rates, total survival times, and complication rates between inguinofemoral radiation and its absence in cases of invasive vulvar carcinoma without lymph node involvement (FIGO Stages T1, N0-1). Methods and Materials: From 1974 to 1990, 135 patients with invasive vulvar carcinoma in Stage T1 without clinical evidence of inguinal lymph node involvement underwent simple vulvectomy performed by hot-knife resection without lymphadenectomy. Although 65 patients (Group 1) received postoperative inguinofemoral radiation therapy, 70 patients (Group 2) did not, and none received local vulva irradiation. Results: The 5-year survival rates were 93.7% in Group 1 and 91.4% in Group 2 (p = NS). Although clitoris involvement was significantly more prevalent in the irradiation group (p = 0.04), inguinal relapse was found less frequently in Group 1 (4.6% or 3 out of 65 patients) than in group 2 (10% or 7 out of 70 patients) (p = 0.32). The complication rates were, 7.7% in Group 1 and 2.9% in Group 2, 2.7% for vaginal stenosis (two patients in each group), 1.5% for inguinal pain (one patient in Group 1), 1.5% for recto vaginal fistula (one patient in Group 1), 1.5% for vulvar infection (one patient in Group 1). Conclusion: No statistically significant differences in the relapse rates and survival times were found. Risk factors were equally distributed in both study groups except for clitoris involvement. The 5-year survival rates in both groups were similar to those reported in the literature for radical vulvectomy and inguinal lymph-node dissection (83-96%). Morbidity in our study was low. Although our data showed similar results in both groups, we are not recommending at this time to omit groin radiation in general, but it may be justified in low-risk cases

  16. Uniport versus multiport video-assisted thoracoscopic surgery in the perioperative treatment of patients with T1-3N0M0 non-small cell lung cancer: a systematic review and meta-analysis.

    Science.gov (United States)

    Yang, Xinyu; Li, Ming; Yang, Xiaodong; Zhao, Mengnan; Huang, Yiwei; Dai, Xiyu; Jiang, Tian; Feng, Mingxiang; Zhan, Cheng; Wang, Qun

    2018-04-01

    Uniport video-assisted thoracoscopic surgery (VATS) has emerged as a less invasive approach for the treatment of non-small cell lung cancer (NSCLC). However, whether uniport VATS has more potential advantages over multiport VATS remains controversial. This meta-analysis aimed to compare the perioperative efficacy of uniport and multiport VATS for T1-3N0M0 NSCLC. An electronic and manual search of literature published before 1st October 2017 was conducted using PubMed, Embase, Web of Science, and the Wiley Online library. The effective values of dichotomous variables or continuous variables were estimated by odds ratios (OR) or by standardized mean differences (SMD) with 95% confidence intervals (CIs) respectively. Eleven relevant observational studies were included for meta-analysis. Results demonstrated that patients in the uniport group had a significant reduction in the duration of postoperative drainage (uniport: 4.39±2.48 vs. multiport: 4.99±3.24 days; P=0.003), bleeding volume (97.7±60.0 vs. 116.7±99.7 mL; P=0.006), length of hospital stay (6.3±2.4 vs. 7.0±3.6 days; Prate of complications (14.5% vs. 17.5%; P=0.008). There were no significant differences between the two treatment groups with regards to mortality, operative time, the number of dissected lymph nodes or the conversion rate. Uniport VATS might have represent a preferable option for the treatment of T1-3N0M0 NSCLC, due to its superior perioperative efficacy.

  17. Ammonothermal synthesis of alkali-alkaline earth metal and alkali-rare earth metal carbodiimides. K{sub 5-x}M{sub x}(CN{sub 2}){sub 2+x}(HCN{sub 2}){sub 1-x} (M = Sr, Eu) and Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}

    Energy Technology Data Exchange (ETDEWEB)

    Mallmann, Mathias; Haeusler, Jonas; Cordes, Niklas; Schnick, Wolfgang [Department of Chemistry, University of Munich (LMU) (Germany)

    2017-12-13

    Alkali-alkaline earth metal and alkali-rare earth metal carbodiimides, namely K{sub 5-x}M{sub x}(CN{sub 2}){sub 2+x}(HCN{sub 2}){sub 1-x} (x = 0 - 1) (M = Sr, Eu) and Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}, were synthesized under ammonothermal conditions in high-pressure autoclaves. The structures of the three compounds can be derived from homeotypic K{sub 5}H(CN{sub 2}){sub 3} and Na{sub 5}H(CN{sub 2}){sub 3} by partial substitution of K{sup +} or Na{sup +}by Sr{sup 2+} or Eu{sup 2+}. The reactions were carried out in two step syntheses (T{sub 1} = 673 K, T{sub 2} = 823 K) starting from sodium or potassium azide, dicyandiamide and strontium or Eu(NH{sub 2}){sub 2}, respectively. The crystal structures were solved and refined from single-crystal X-ray diffraction data [K{sub 4.16}Sr{sub 0.84}(CN{sub 2}){sub 2.84}(HCN{sub 2}){sub 0.16}: space group Im3m (no. 229), a = 7.8304(5) Aa, Z = 2, R{sub 1} = 0.024, wR{sub 2} = 0.052; K{sub 4.40}Eu{sub 0.60}(CN{sub 2}){sub 2.60}(HCN{sub 2}){sub 0.40}: space group Im anti 3m (no. 229), a = 7.8502(6) Aa, Z = 2, R{sub 1} = 0.022, wR{sub 2} = 0.049]. In contrast to the potassium carbodiimides, the sodium-strontium carbodiimide was only synthesized as microcrystalline powder. The crystal structure was determined by powder X-ray diffraction and refined by the Rietveld method [Na{sub 4.32}Sr{sub 0.68}(CN{sub 2}){sub 2.68}(HCN{sub 2}){sub 0.32}: space group Im3m (no. 229), a = 7.2412(1) Aa, Z = 2, R{sub wp} = 0.050]. The presence of hydrogencyanamide units ([HNCN]{sup -}) next to carbodiimide units ([CN{sub 2}]{sup 2-}) in all compounds was confirmed by FT-IR spectroscopy. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. [(Nitrato-κ2 O,O′)(nitrito-κ2 O,O′)(0.25/1.75)]bis­(1,10-phenanthroline-κ2 N,N′)cadmium(II)

    Science.gov (United States)

    Najafi, Ezzatollah; Amini, Mostafa M.; Ng, Seik Weng

    2011-01-01

    The reaction of cadmium nitrate and sodium nitrite in the presence of 1,10-phenanthroline yields the mixed nitrate–nitrite title complex, [Cd(NO2)1.75(NO3)0.25(C12H8N2)2]. The metal ion is bis-chelated by two N-heterocycles as well as by the nitrate/nitrite ions in a distorted dodeca­hedral CdN4O4 coordination environment. One nitrite group is ordered; the other is disordered with respect to a nitrate group (ratio 0.75:0.25) concerning the O atom that is not involved in bonding to the metal ion. PMID:21522904

  19. Thermal conductivities of (ZrxPu(1-x)/2Am(1-x)/2)N solid solutions

    International Nuclear Information System (INIS)

    Nishi, Tsuyoshi; Takano, Masahide; Akabori, Mitsuo; Arai, Yasuo

    2011-01-01

    The thermal conductivity of Zr-based transuranium (TRU) nitride solid solutions is important for designing subcritical cores in nitride-fueled ADS. Some results have been reported concerning the thermal conductivities of (Zr,Pu)N. However, there have been no experimental data on the thermal conductivities of Zr-based nitride solid solutions containing MA. In this study, the authors prepared sintered samples of (Zr x Pu (1-x)/2 Am (1-x)/2) N (x=0.0, 0.58, 0.80) solid solutions. The thermal diffusivity and heat capacity of (Zr x Pu (1-x)/2 Am (1-x)/2) N solid solutions were measured using a laser flash method and drop calorimetry, respectively. Thermal conductivities were determined from the measured thermal diffusivities, heat capacities and bulk densities over a temperature range of 473 to 1473 K. The thermal conductivities of (Zr 0.58 Pu 0.21 Am 0.21 )N and (Zr 0.80 Pu 0.10 Am 0.10 )N solid solutions were found to be higher than that of (Pu 0.5 Am 0.5 )N due to the high thermal conductivity of ZrN as the principal component, although they were lower than that of ZrN due to the impurifying effect of the transuranium elements. Thus, the thermal conductivities of (Zr x Pu (1-x)/2 Am (1-x)/2) N solid solutions increased with increasing ZrN concentration. Moreover, in order to help to promote the design study of nitride-fueled ADS, the thermal conductivity of the (Zr x Pu (1-x)/2 Am (1-x)/2) N solid solutions were fitted to an equation using the least squares method. (author)

  20. Non-isothermal decomposition kinetics, heat capacity and thermal safety of 37.2/44/16/2.2/0.2/0.4-GAP/CL-20/Al/N-100/PCA/auxiliaries mixture

    International Nuclear Information System (INIS)

    Zhang, Jiao-Qiang; Gao, Hong-Xu; Ji, Tie-Zheng; Xu, Kang-Zhen; Hu, Rong-Zu

    2011-01-01

    Highlights: → Non-isothermal decomposition kinetics, heat capacity and thermal safety on 37.2/44/16/2.2/0.2/0.4-GAP/CL-20/Al/N-100/PCA/auxiliaries mixture. → Apparent activation energy and pre-exponential constant obtained. → Thermal explosion temperature, adiabatic time-to-explosion, 50% drop height of impact sensitivity, and critical temperature of hot-spot initiation calculated. - Abstract: The specific heat capacity (C p ) of 37.2/44/16/2.2/0.2/0.4-GAP/CL-20/Al/N-100/PCA/auxiliaries mixture was determined with the continuous C p mode of microcalorimeter. The equation of C p with temperature was obtained. The standard molar heat capacity of GAP/CL-20/Al/N-100/PCA/auxiliaries mixture was 1.225 J mol -1 K -1 at 298.15 K. With the help of the peak temperature (T p ) from the non-isothermal DTG curves of the mixture at different heating rates (β), the apparent activation energy (E k and E o ) and pre-exponential constant (A K ) of thermal decomposition reaction obtained by Kissinger's method and Ozawa's method. Using density (ρ) and thermal conductivity (λ), the decomposition heat (Q d , taking half-explosion heat), Zhang-Hu-Xie-Li's formula, the values (T e0 and T p0 ) of T e and T p corresponding to β → 0, thermal explosion temperature (T be and T bp ), adiabatic time-to-explosion (t TIad ), 50% drop height (H 50 ) of impact sensitivity, and critical temperature of hot-spot initiation (T cr,hotspot ) of thermal explosion of the mixture were calculated. The following results of evaluating the thermal safety of the mixture were obtained: T be = 441.64 K, T bp = 461.66 K, t Tlad = 78.0 s (n = 2), t Tlad = 74.87s (n = 1), t Tlad = 71.85 s (n = 0), H 50 = 21.33 cm.

  1. Bond Energies and Thermochemical Properties of Ring-Opened Diradicals and Carbenes of exo-Tricyclo[5.2.1.0(2,6)]decane.

    Science.gov (United States)

    Hudzik, Jason M; Castillo, Álvaro; Bozzelli, Joseph W

    2015-09-24

    Exo-tricyclo[5.2.1.0(2,6)]decane (TCD) or exo-tetrahydrodicyclopentadiene is an interesting strained ring compound and the single-component high-energy density hydrocarbon fuel known as JP-10. Important initial reactions of TCD at high temperatures could cleave a strained carbon-carbon (C-C) bond in the ring system creating diradicals also constrained by the remaining ring system. This study determines the thermochemical properties of these diradicals (TCD-H2 mJ-nJ where m and n correspond to the cleaved carbons sites) including the carbon-carbon bond dissociation energy (C-C BDE) corresponding to the cleaved TCD site. Thermochemical properties including enthalpies (ΔH°f298), entropies (S(T)), heat capacities (Cp(T)), and C-H and C-C BDEs for the parent (TCD-H2 m-n), radical (TCD-H2 mJ-n and m-nJ), diradical (TCD-H2 mJ-nJ), and carbene (TCD-H2 mJJ-n and m-nJJ) species are determined. Structures, vibrational frequencies, moments of inertia, and internal rotor potentials are calculated at the B3LYP/6-31G(d,p) level of theory. Standard enthalpies of formation in the gas phase for the TCD-H2 m-n parent and radical species are determined using the B3LYP density functional theory and the higher level G3MP2B3 and CBS-QB3 composite methods. For singlet and triplet TCD diradicals and carbenes, M06-2X, ωB97X-D, and CCSD(T) methods are included in the analysis to determine ΔH°f298 values. The C-C BDEs are further calculated using CASMP2(2,2)/aug-cc-pvtz//CASSCF(2,2)/cc-pvtz and with the CASMP2 energies extrapolated to the complete basis set limit. The bond energies calculated with these methods are shown to be comparable to the other calculation methods. Isodesmic work reactions are used for enthalpy analysis of these compounds for effective cancelation of systematic errors arising from ring strain. C-C BDEs range from 77.4 to 84.6 kcal mol(-1) for TCD diradical singlet species. C-H BDEs for the parent TCD-H2 m-n carbon sites range from 93 to 101 kcal mol(-1) with a

  2. Origin of the -|A | T1 /2 term in the resistivity of disordered ZrAs1.58Se0.39

    Science.gov (United States)

    Gnida, Daniel

    2018-04-01

    Recently, Cichorek et al. have analyzed the magnetic-field-independent -|A | T1 /2 term in the resistivity of disordered ZrAs1.58Se0.39 within the Altshuler-Arononv model of electron-electron interaction in the presence of disorder [Phys. Rev. Lett. 117, 106601 (2016), 10.1103/PhysRevLett.117.106601]. Making the assumption that diffusion of conduction electrons in this compound is isotropic, they could not get quantitative agreement between the considered model and the experimental results. This led the authors to conclude that the singular T1 /2 contribution to the resistivity of ZrAs1.58Se0.39 could not be caused by electron-electron interaction but could only be explained by a two-channel Kondo effect. Here, we perform a detailed analysis of the -|A | T1 /2 correction to the resistivity of disordered ZrAs1.58Se0.39 using analogous Altshuler-Aronov relation but taking into account that the diffusion coefficient in the tetragonal ZrAs1.58Se0.39 is anisotropic. For the considered resistivity anisotropy, we found that the calculated values of the A coefficient are in very good agreement with those derived from the resistivity measurements. Moreover, analysis indicates that the values of the screening parameter λ(j =1 ) are close to zero, which satisfies the condition that the A coefficient does not depend on magnetic field. This shows that the magnetic-field-independent -|A | T1 /2 correction to the resistivity of disordered ZrAs1.58Se0.39 can be explained within the electron-electron interaction scenario in disordered metallic systems.

  3. Standard molar enthalpies of formation of 1-methyl-2-piperidinemethanol, 1-piperidineethanol, and 2-piperidineethanol

    International Nuclear Information System (INIS)

    Ribeiro da Silva, Manuel A.V.; Cabral, Joana I.T.A.

    2006-01-01

    The standard (p o =0.1MPa) molar enthalpies of combustion, Δ c H m o , for the liquid compounds 1-methyl-2-piperidinemethanol, 1-piperidineethanol, and 2-piperidineethanol, were measured by static bomb calorimetry, in oxygen, at T=298.15K. The standard molar enthalpies of vaporization, at T=298.15K, of these three liquid compounds were determined by Calvet microcalorimetry. -Δ c H m o (l)/(kJ.mol -1 )Δ l g H m o /(kJ.mol -1 )1-Methyl-2-piperidinemethanol4598.3+/-1.868. 22+/-0.711-Piperidineethanol4595.2+/-1.764.18+/-0.812 -Piperidineethanol4566.2+/-1.375.24+/-0.52 These values, were used to derive the standard molar enthalpies of formation of the compounds, at T=298.15K, in their liquid and gaseous phase, respectively. The derived standard molar enthalpies of formation, in the gaseous state, are analyzed in terms of enthalpic increments and interpreted in terms of molecular structure.

  4. N = (2,0) self-dual non-Abelian tensor multiplet in D = 3 + 3 generates N = (1,1) self-dual systems in D = 2 + 2

    Science.gov (United States)

    Nishino, Hitoshi; Rajpoot, Subhash

    2018-03-01

    We formulate an N = (2 , 0) system in D = 3 + 3 dimensions consisting of a Yang-Mills (YM)-multiplet (ˆ μ ˆ IA, λˆI), a self-dual non-Abelian tensor multiplet (ˆ μ ˆ ν ˆ IB, χˆI ,φˆI), and an extra vector multiplet (C ˆ μ ˆ IC, ρˆI). We next perform the dimensional reductions of this system into D = 2 + 2, and obtain N = (1 , 1) systems with a self-dual YM-multiplet (AIμ ,λI), a self-dual tensor multiplet (BIμν , χI , φI), and an extra vector multiplet (CIμ , ρI). In D = 2 + 2, we reach two distinct theories: 'Theory-I' and 'Theory-II'. The former has the self-dual field-strength Hμν(+)I of CIμ already presented in our recent paper, while the latter has anti-self-dual field strength Hμν(-)I. As an application, we show that Theory-II actually generates supersymmetric-KdV equations in D = 1 + 1. Our result leads to a new conclusion that the D = 3 + 3 theory with non-Abelian tensor multiplet can be a 'Grand Master Theory' for self-dual multiplet and self-dual YM-multiplet in D = 2 + 2, that in turn has been conjectured to be the 'Master Theory' for all supersymmetric integrable theories in D ≤ 3.

  5. Crystal structure study of dielectric oxynitride perovskites La{sub 1−x}Sr{sub x}TiO{sub 2+x}N{sub 1−x} (x=0, 0.2)

    Energy Technology Data Exchange (ETDEWEB)

    Habu, Daiki; Masubuchi, Yuji [Faculty of Engineering, Hokkaido University, N13W8, Kita-ku, Sapporo 060-8628 (Japan); Torii, Shuki [Institute of Materials Structure Science, High Energy Accelerator Organization, 203-1, Shirakata, Tokai-Mura, Naka-gun, Ibaraki 319-1106 (Japan); Kamiyama, Takashi [Institute of Materials Structure Science, High Energy Accelerator Organization, 203-1, Shirakata, Tokai-Mura, Naka-gun, Ibaraki 319-1106 (Japan); School of High Energy Accelerator Science, Sokendai (The Graduate University for Advanced Studies), Tokai 319-1106 (Japan); Kikkawa, Shinichi, E-mail: kikkawa@eng.hokudai.ac.jp [Faculty of Engineering, Hokkaido University, N13W8, Kita-ku, Sapporo 060-8628 (Japan)

    2016-05-15

    As is the case with SrTaO{sub 2}N, both cis-ordering of nitride anions and octahedral titling are also preferable in La{sub 1−x}Sr{sub x}TiO{sub 2+x}N{sub 1−x} (x=0, 0.2) oxynitride perovskites. A larger dielectric constant of ε{sub r}≈5.0×10{sup 3} was estimated for the pure oxynitride with x=0.2, compared with ε{sub r}≈750 for the product with x=0, by extrapolating the ε{sub r} values obtained from powders mixed with paraffin at various mixing ratios. The crystal structure of x=0.2 with larger tolerance factor than x=0 increased the octahedral tilting, which contributes to the increased dielectric constant. The increased dielectric constant supports the exchange mechanism for the dielectric property between two kinds of –Ti–N– helical coils (clockwise and anticlockwise) derived from the above cis-ordering of nitride anions. - Graphical abstract: Very large dielectric constant values were estimated for La{sub 1−x}Sr{sub x}TiO{sub 2+x}N{sub 1−x}; ε{sub r}≈5.0×10{sup 3} in x=0.2 and ε{sub r}≈750 in x=0. - Highlights: • Cis-configuration of nitride anions was confirmed in La{sub 1−x}Sr{sub x}TiO{sub 2+x}N{sub 1−x} (x=0, 0.2). • Dielectric constant values were estimated to be 750 for x=0 and 5.0×10{sup 3} for x=0.2, respectively. • The large dielectric property is to the exchange mechanism between clockwise and anticlockwise –Ti–N– coil motifs.

  6. Theoretical descriptions of novel triplet germylenes M1-Ge-M2-M3 (M1 = H, Li, Na, K; M2 = Be, Mg, Ca; M3 = H, F, Cl, Br).

    Science.gov (United States)

    Kassaee, Mohamad Zaman; Ashenagar, Samaneh

    2018-02-06

    In a quest to identify new ground-state triplet germylenes, the stabilities (singlet-triplet energy differences, ΔE S-T ) of 96 singlet (s) and triplet (t) M 1 -Ge-M 2 -M 3 species were compared and contrasted at the B3LYP/6-311++G**, QCISD(T)/6-311++G**, and CCSD(T)/6-311++G** levels of theory (M 1  = H, Li, Na, K; M 2  = Be, Mg, Ca; M 3  = H, F, Cl, Br). Interestingly, F-substituent triplet germylenes (M 3  = F) appear to be more stable and linear than the corresponding Cl- or Br-substituent triplet germylenes (M 3  = Cl or Br). Triplets with M 1  = K (i.e., the K-Ge-M 2 -M 3 series) seem to be more stable than the corresponding triplets with M 1  = H, Li, or Na. This can be attributed to the higher electropositivity of potassium. Triplet species with M 3  = Cl behave similarly to those with M 3  = Br. Conversely, triplets with M 3  = H show similar stabilities and linearities to those with M 3  = F. Singlet species of formulae K-Ge-Ca-Cl and K-Ge-Ca-Br form unexpected cyclic structures. Finally, the triplet germylenes M 1 -Ge-M 2 -M 3 become more stable as the electropositivities of the α-substituents (M 1 and M 2 ) and the electronegativity of the β-substituent (M 3 ) increase.

  7. N-(2-Methylphenyl-1,2-benzoselenazol-3(2H-one

    Directory of Open Access Journals (Sweden)

    Xu Zhu

    2013-10-01

    Full Text Available In the title Ebselen [systematic name: (2-phenyl-1,2-benzoisoselenazol-3-(2H-one] analogue, C14H11NOSe, the benzisoselenazolyl moiety (r.m.s. deviation = 0.0209 Å is nearly perpendicular to the N-arenyl ring, making a dihedral angle of 78.15 (11°. In the crystal, molecules are linked by C—H...O and Se...O interactions into chains along the c-axis direction. The Se...O distance [2.733 (3 Å] is longer than that in Ebselen (2.571 (3 Å].

  8. Computer Assisted Medical Diagnosis (CAMD) System Version 1.0 Technical Manual.

    Science.gov (United States)

    1992-10-01

    Asaasasa S " "ft Mo Q0r "Ma.. @ ffM0e= 1aw- 0ý K. O - ^0e’O.t-,ý 4V .4 0;P S&. co *;:c Olt 0-oZo6.06-c v- f ’*-IA S0 . N Ml t* Q.0. L . ii a ,I...M& N.-2 1NNNNa N1ý*m N NN NNNNNN NN-NNNNNNN W.9 co 2 ;:N 2 .0 al .0-w -lI -, a? S -J w a a ( ( acca (a *. (a m. a a *.mo i-W - U - - - - U - 4--’- a-W

  9. Synthesis of [2-13C, 2-14C] 2-aminoethanol, [1-13C, 1-14C] 2-chloroethylamine, N,N'-bis([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(BCNU) and N-([1-13C, 1-14C] 2-chloroethyl)-N-nitrosourea(CNU)

    International Nuclear Information System (INIS)

    Narayan, R.; Chang, C-j.

    1982-01-01

    [2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)

  10. Evaluation of the reliability of clinical staging of T2 N0 esophageal cancer: a review of the Society of Thoracic Surgeons database.

    Science.gov (United States)

    Crabtree, Traves D; Kosinski, Andrzej S; Puri, Varun; Burfeind, William; Bharat, Ankit; Patterson, G Alexander; Hofstetter, Wayne; Meyers, Bryan F

    2013-08-01

    Clinical staging of esophageal cancer has improved with positron-emission tomography/computed tomography and endoscopic ultrasound imaging. Despite such progress, small single-center studies have questioned the reliability of clinical staging of T2 N0 esophageal cancer. This study broadly examines the adequacy of clinical staging of T2 N0 disease using The Society of Thoracic Surgeons database. We retrospectively studied 810 clinical stage T2 N0 patients from 2002 to 2011, with 58 excluded because of incomplete pathologic staging data. Clinical stage, pathologic stage, and preoperative characteristics were recorded. Logistic regression analysis was used to identify factors associated with upstaging at the time of surgical intervention. Among 752 clinical stage T2 N0 patients, 270 (35.9%) received induction therapy before the operation. Of 482 patients who went directly to surgical intervention, 132 (27.4%) were confirmed as pathologic T2 N0, 125 (25.9%) were downstaged (ie, T0-1 N0), and 225 (46.7%) were upstaged at the operation (T3-4 N0 or Tany N1-3). Exclusive tumor upstaging (ie, pathologic T3-4 N0) accounted for 41 patients (18.2%), whereas exclusive nodal upstaging (ie, pathological T1-2 N1-3) accounted for 100 (44.5%). Combined tumor and nodal upstaging (ie, pathological T3-4 N1-3) accounted for 84 patients (37.3%). Among patients who received induction therapy, 103 (38.1%) were upstaged vs 225 (46.7%) without induction therapy (p = 0.026). Comparing the induction therapy group and the primary surgical group, postoperative 30-day mortality (3.7% vs 3.7%, p > 0.99) and morbidity (46.3% vs 45%, p = 0.76) were similar. Despite advances in staging techniques, clinical staging of T2 N0 esophageal cancer remains unreliable. Recognizing T2 N0 as a threshold for induction therapy in esophageal cancer, many surgeons have opted to treat T2 N0 disease with induction therapy, even though one-quarter of these patients will be pathologic T1 N0. Although this study

  11. Specific heat and thermodynamic functions of uranovanadates of the M2+(VUO6)2 · nH2O series (M2+ = Mg, Ca, Sr, Ba, Pb)

    International Nuclear Information System (INIS)

    Karyakin, N.V.; Chernorukov, N.G.; Sulejmanov, E.V.; Trostin, V.L.; Alimzhanov, M.I.; Razuvaeva, E.A.

    1999-01-01

    Isobaric specific heat of crystal uranovanadates Ca(VUO 6 ) 2 · 8H 2 O, Ba(VUO 6 ) 2 · 4H 2 O in the temperature range of 10 - 300 K and of M 1 (VUO 6 ) 2 · 5H 2 O, (M 1 = Mg, Ca, Sr, Pb) at 80 -300 K are measured by the method of adiabatic vacuum calorimetry. The functions H 0 (T) - H 0 (0), S 0 (T), G 0 (T) - H 0 (T) for all the above-mentioned compounds in the range of 0 - 300 K have been calculated, the standard entropies and Gibbs functions of uranovanadates formation at 298.15 K being calculated as well [ru

  12. Calculation of the energy of particles emitted by the reactions {sup 3}{sub 1}T (d,n) {sup 4}{sub 2}He, D (d,n) {sup 3}{sub 2}He and D (d,p) T; Calcul de l'energie des particules emises par les reactions {sup 3}{sub 1}T (d,n) {sup 4}{sub 2}He, D (d,n) {sup 3}{sub 2}He et D (d,p) T

    Energy Technology Data Exchange (ETDEWEB)

    Oria, M; Sorriaux, A [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1965-07-01

    With a view to ease the work of research workers using 150 kV electrostatic accelerators, we have calculated the energy and the emission angle of particles emitted during the reactions {sub 1}{sup 3}T(d,n){sub 2}{sup 4}He, {sub 1}{sup 2}D(d,n){sub 2}{sup 3}He and {sub 1}{sup 2}D(d,p){sub 1}{sup 3}T. The results are classified in tables and arranged according to the acceleration energy of the deuterons. Since the energies considered are relatively low we have limited our study to the non-relativistic domain; this simplification results in a maximum energy variation with respect to the real energy values of 1 per cent. We give also two curves representing the variations in the total cross-sections for the reactions T (d,n){sub 2}{sup 4}He and D (d,n){sub 2}{sup 3}He. (authors) [French] De facon a faciliter la tache des experimentateurs utilisant des accelerateurs electrostatiques de 150 kV, nous avons calcule l'energie et l'angle d'emission des particules emises lors des reactions {sub 1}{sup 3}T(d,n){sub 2}{sup 4}He, {sub 1}{sup 2}D(d,n){sub 2}{sup 3}He and {sub 1}{sup 2}D(d,p){sub 1}{sup 3}T. Les resultats ont ete classes dans des tableaux, et ordonnes en fonction de l'energie d'acceleration des deuterons. Les energies considerees etant relativement peu elevees, nous avons limite notre etude au domaine non relativiste, cette simplification n'entraine qu'une variation maximale de 1 pour cent sur les valeurs reelles des energies. Nous avons joint a ce calcul deux courbes representant la variation des sections efficaces totales des reactions T (d,n){sub 2}{sup 4}He et D (d,n){sub 2}{sup 3}He. (auteurs)

  13. Study of K-p→0-1/2+ and K-p→0-3/2+ reactions

    International Nuclear Information System (INIS)

    Chaurand, B.M.G.

    1976-01-01

    With 1.3x10 6 photos taken with the CERN two meters hydrogen bubble chamber, interactions of the type K - p→0 - 1/2 + (3/2 + ) at 14.3GeV/c were studied. Experimental data are given as well as the amplitudes which describe these reactions, and show how they are connected with the measurable quantities; these are determined in each of the reactions whenever it is possible (sigma sub(T), dsigma/dt, polarization of Λ and Σ + , density matrix element of Σ + (1385)). The results are compared with those obtained at other energies and with some predictions of SU 3 . Finally, it is explained how the results have contributed to the analysis of the amplitudes of the reactions 0 - 1/2 + →0 - 1/2 + (3/2 + ) [fr

  14. Asymptotic behavior of the nonlinear diffusion equation n/sub t/ = (n-1n/sub x/)/sub x/

    International Nuclear Information System (INIS)

    Berryman, J.G.; Holland, C.J.

    1982-01-01

    The asymptotic behavior of the equation n/sub t/ = (ln n)/sub x/x is studied on the finite interval 0 0 and initial data n(x,0)> or =n 0 . We prove that asymptotically ln[n(x,t)/n 0 ]→A exp(-π 2 t/n 0 )2/sup 1/2/ sin πx and also provide rigorous upper and lower bounds on the asymptotic amplitude A in terms of integrals of nonlinear functions of the initial data. The rigorous bounds are compared to values of A obtained from computer experiments. The lower bound L = (2/sup 3/2//π)exp[li(1+Q)-γ], where li is the logarithmic integral, γ is Euler's constant, and Q = (π/2)∫[n(x,0)/n 0 -1]sin πx dx, is found to be the best known estimate of A

  15. High sensitivity cavity ring down spectroscopy of N_2O near 1.22 µm: (II) "1"4N_2"1"6O line intensity modeling and global fit of "1"4N_2"1"8O line positions

    International Nuclear Information System (INIS)

    Tashkun, S.A.; Perevalov, V.I.; Karlovets, E.V.; Kassi, S.; Campargue, A.

    2016-01-01

    In a recent work (Karlovets et al., 2016 [1]), we reported the measurement and rovibrational assignments of more than 3300 transitions belonging to 64 bands of five nitrous oxide isotopologues ("1"4N_2"1"6O, "1"4N"1"5N"1"6O, "1"5N"1"4N"1"6O, "1"4N_2"1"8O and "1"4N_2"1"7O) in the high sensitivity CRDS spectrum recorded in the 7915–8334 cm"−"1 spectral range. The assignments were performed by comparison with predictions of the effective Hamiltonian models developed for each isotopologue. In the present paper, the large amount of measurements from our previous work mentioned above and literature are gathered to refine the modeling of the nitrous oxide spectrum in two ways: (i) improvement of the intensity modeling for the principal isotopologue, "1"4N_2"1"6O, near 8000 cm"−"1 from a new fit of the relevant effective dipole moment parameters, (ii) global modeling of "1"4N_2"1"8O line positions from a new fit of the parameters of the global effective Hamiltonian using an exhaustive input dataset collected in the literature in the 12–8231 cm"−"1 region. The fitted set of 81 parameters allowed reproducing near 5800 measured line positions with an RMS deviation of 0.0016 cm"−"1. The dimensionless weighted standard deviation of the fit is 1.22. As an illustration of the improvement of the predictive capabilities of the obtained effective Hamiltonian, two new "1"4N_2"1"8O bands could be assigned in the CRDS spectrum in the 7915–8334 cm"−"1 spectral range. A line list at 296 K has been generated in the 0–10,700 cm"−"1 range for "1"4N_2"1"8O in natural abundance with a 10"−"3"0 cm/molecule intensity cutoff. - Highlights: • Line parameters of two new "1"4N_2"1"8O bands centered at 7966 cm"−"1 and at 8214 cm"−"1. • Refined sets of the "1"4N_2"1"6O effective dipole moment parameters for ΔP=13,14 series. • Global modeling of "1"4N_2"1"8O line positions and intensities in the 12–8231 cm"−"1 range. • 5800 observed of "1"4N_2"1"8O line positions

  16. DFT study of small fullerene dimer complexes C_2_0-N_m@C_n (m = 1-6 and n = 24, 28, 32, 36 and 40)

    International Nuclear Information System (INIS)

    Kaur, Sandeep; Sharma, Amrish; Mudahar, Isha

    2016-01-01

    First principle calculations based on density functional theory were performed to calculate the structural and electronic properties of C_2_0-N_m@C_n dimer complexes. The calculated binding energies of the complexes formed are comparable to C_6_0 dimer which ensures their stability. The bond lengths of these dimer complexes were found to be nearly same as pure complexes C_2_0-C_n. Further, nitrogen (N) atoms were encapsulated inside the secondary cage (C_n) of dimer complexes and the number of N atoms depends on diameter of the cage. The HOMO-LUMO gaps of new proposed complexes indicate the increase in gap as compared to pure complexes. Mulliken charge analysis of these complexes has been studied which shows the significant charge transfer from the N atoms to the secondary cage of these complexes. The study propose the formation of the new dimer complexes which are stable and are able to encapsulate atoms which are otherwise reactive in free space.

  17. Changing structural properties of mixed crystals [N(CH{sub 3}){sub 4}]{sub 2}Zn{sub 1-x}Co{sub x}Cl{sub 4} (x = 0, 0.5, 0.7, 0.9, and 1) by magic angle spinning nuclear magnetic resonance

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Ae Ran, E-mail: aeranlim@hanmail.net [Department of Science Education, Jeonju University, Jeonju 560-759 (Korea, Republic of); Department of Carbon Fusion Engineering, Jeonju University, Jeonju 560-759 (Korea, Republic of)

    2016-03-01

    Temperature dependences of the chemical shift and spin-lattice relaxation time in the rotating frame T{sub 1ρ} were measured for {sup 1}H and {sup 13}C nuclei in mixed crystals of the form [N(CH{sub 3}){sub 4}]{sub 2}Zn{sub 1-x} Co{sub x}Cl{sub 4} (x = 0, 0.5, 0.7, 0.9, and 1). The mixed crystals varied in color according to the amount of Co{sup 2+} ions, whereas the phase transition temperatures remained nearly unchanged. [N(CH{sub 3}){sub 4}]{sub 2}ZnCl{sub 4} and [N(CH{sub 3}){sub 4}]{sub 2}CoCl{sub 4} crystals contain two nonequivalent types of a-N(CH{sub 3}){sub 4} and b-N(CH{sub 3}){sub 4}. The two crystallographically different ions a-N(CH{sub 3}){sub 4} and b-N(CH{sub 3}){sub 4} were distinguished using {sup 13}C CP/MAS NMR spectroscopy. The NMR spectrum and T{sub 1ρ} for {sup 1}H and {sup 13}C in case of x = 0.5 and x = 0.7 were similar to those for [N(CH{sub 3}){sub 4}]{sub 2}ZnCl{sub 4}, whereas those for x = 0.9 were absolutely different. Additionally, [N(CH{sub 3}){sub 4}]{sub 2}Zn{sub 0.1}Co{sub 0.9}Cl{sub 4} exhibited the structural properties of both [N(CH{sub 3}){sub 4}]{sub 2}ZnCl{sub 4} and [N(CH{sub 3}){sub 4}]{sub 2}CoCl{sub 4}. - Highlights: • Chemical shift and spin-lattice relaxation time in rotating frame. • Two crystallographically different ions a-N(CH{sub 3}){sub 4} and b-N(CH{sub 3}){sub 4}. • Structural properties of mixed crystals.

  18. [μ-N,N′-Bis(2-aminoethylethane-1,2-diamine-κ4N1,N1′:N2,N2′]bis{[N,N′-bis(2-aminoethylethane-1,2-diamine-κ4N,N′,N′′,N′′′]cadmium} tetrakis(perchlorate

    Directory of Open Access Journals (Sweden)

    Hamid Goudarziafshar

    2012-09-01

    Full Text Available The centrosymmetric dinuclear cadmium title complex, [Cd2(C6H18N43](ClO44, was obtained by the reaction of N,N′-bis(2-aminoethylethane-1,2-diamine (trien with Cd(NO32·4H2O and sodium perchlorate in methanol. The CdII cation is coordinated by four N atoms of a non-bridging trien ligand and by two N atoms of a bridging trien ligand in a slightly distorted octahedral coordination geometry. The bridging ligand shares another two N atoms with a neighboring symmetry-equivalent CdII cation. The structure displays C—H...O and N—H...O hydrogen bonding. The perchlorate anion is disordered over two sets of sites in a 0.854 (7: 0.146 (7 ratio.

  19. Brachytherapy for T1-T2 floor-of-the-mouth cancers: the Gustave-Roussy Institute experience

    International Nuclear Information System (INIS)

    Marsiglia, Hugo; Haie-Meder, Christine; Sasso, Giuseppe; Mamelle, Gerard; Gerbaulet, Alain

    2002-01-01

    Purpose: In a retrospective analysis, we evaluated the Gustave-Roussy Institute's experience of locoregional control, survival, and complications of low-dose rate brachytherapy for carcinoma of the floor of the mouth. Methods and Materials: Between 1970 and 1985, 160 patients with previously untreated carcinoma of the floor of the mouth received interstitial brachytherapy as definitive treatment. Of the 160 patients, 79 (49%) had T1 and 81 (51%) had T2 lesions, and 127 (79%) had N0 and 33 (21%) had N1; 84% of tumors arose from the anterior floor of the mouth. Brachytherapy was performed with 192 Ir wires, according to the Paris system rules, followed by neck dissection (T2 or N1) or follow-up (T1N0). Results: With a follow-up period of 9-19 years, the observed survival rates were 89% at 2 years and 76% at 5 years, and the local control rates were 93% in T1 and 88% in T2 tumors. A low rate of distant metastases was noticed (5%); 31% of patients developed a second primary cancer. Severe mucosal necrosis was observed in <10% of patients. Any grade of bone necrosis was seen in 18% of cases (only 2.5% had G3 necrosis). This complication occurred more frequently in patients with poor dental status and in those treated without dental protection during implantation (p <0.001). Conclusion: Radical brachytherapy offers excellent local control (89%) and an acceptable rate of complications (<10% severe necrosis) that may be significantly decreased with dental care and the use of protective devices. The high incidence of second malignancies remains a major concern in these patients

  20. III-nitride disk-in-nanowire 1.2 μm monolithic diode laser on (001)silicon

    KAUST Repository

    Hazari, Arnab

    2015-11-12

    III-nitride nanowirediodeheterostructures with multiple In0.85Ga0.15N disks and graded InGaN mode confining regions were grown by molecular beam epitaxy on (001)Si substrates. The aerial density of the 60 nm nanowires is ∼3 × 1010 cm−2. A radiative recombination lifetime of 1.84 ns in the disks is measured by time-resolved luminescence measurements. Edge-emitting nanowire lasers have been fabricated and characterized. Measured values of Jth, T0, and dg/dn in these devices are 1.24 kA/cm2, 242 K, and 5.6 × 10−17 cm2, respectively. The peak emission is observed at ∼1.2 μm.

  1. Simultaneous acquisition for T2 -T2 Exchange and T1 -T2 correlation NMR experiments

    Science.gov (United States)

    Montrazi, Elton T.; Lucas-Oliveira, Everton; Araujo-Ferreira, Arthur G.; Barsi-Andreeta, Mariane; Bonagamba, Tito J.

    2018-04-01

    The NMR measurements of longitudinal and transverse relaxation times and its multidimensional correlations provide useful information about molecular dynamics. However, these experiments are very time-consuming, and many researchers proposed faster experiments to reduce this issue. This paper presents a new way to simultaneously perform T2 -T2 Exchange and T1 -T2 correlation experiments by taking the advantage of the storage time and the two steps phase cycling used for running the relaxation exchange experiment. The data corresponding to each step is either summed or subtracted to produce the T2 -T2 and T1 -T2 data, enhancing the information obtained while maintaining the experiment duration. Comparing the results from this technique with traditional NMR experiments it was possible to validate the method.

  2. Polarity driven morphology of CeO2(1 0 0) islands on Cu(1 1 1)

    International Nuclear Information System (INIS)

    Stetsovych, O.; Beran, J.; Dvořák, F.; Mašek, K.; Mysliveček, J.; Matolín, V.

    2013-01-01

    Thin ceria films supported by metal substrates represent important model systems for reactivity studies in heterogeneous catalysis. Here we report the growth study of the polar CeO 2 (1 0 0) phase as part of a mixed CeO 2 (1 1 1)–CeO 2 (1 0 0) thin film supported by Cu(1 1 1). The two ceria phases grow on different areas of the substrate, what allows a reliable growth characterization of the CeO 2 (1 0 0) islands on Cu(1 1 1). Scanning tunneling microscopy measurements reveal CeO 2 (1 0 0) to grow in the form of highly dispersed three dimensional (3D) islands on a CeO 2 (1 0 0) interfacial layer. The CeO 2 (1 0 0) islands exhibit a 2 × 2 surface reconstruction. The presence of the surface reconstruction together with the highly dispersed growth of CeO 2 (1 0 0) islands corresponds to the requirement for compensation of the surface dipole moment on the CeO 2 (1 0 0). CeO 2 (1 0 0) islands are further characterized by reflection high energy electron diffraction yielding their epitaxial relations with respect to the Cu(1 1 1) substrate. The growth of well characterized CeO 2 (1 0 0) islands supported by Cu(1 1 1) represents a starting point for developing a novel template for structure-related reactivity studies of ceria based model catalysts.

  3. Reexamination of M2,3 atomic level widths and L1M2,3 transition energies of elements 69≤Z≤95

    Science.gov (United States)

    Fennane, K.; Berset, M.; Dousse, J.-Cl.; Hoszowska, J.; Raboud, P.-A.; Campbell, J. L.

    2013-11-01

    We report on high-resolution measurements of the photoinduced L1M2 and L1M3 x-ray emission lines of 69Tm, 70Yb, 71Lu, 73Ta, 74W, 75Re, 77Ir, 81Tl, 83Bi, and 95Am. From the linewidths of the measured transitions an accurate set of M2 and M3 level widths is determined assuming for the L1 level widths the values reported by Raboud [P.-A. Raboud et al., Phys. Rev. APLRAAN1050-294710.1103/PhysRevA.65.022512 65, 022512 (2002)]. Furthermore, the present experimental M2,3 data set is extended to 80Hg, 90Th, and 92U, using former L1M2,3 high-resolution x-ray emission spectroscopy measurements performed by our group. A detailed comparison of the M2 and M3 level widths determined in the present work with those recommended by Campbell and Papp [J. L. Campbell and T. Papp, At. Data Nucl. Data TablesADNDAT0092-640X10.1006/adnd.2000.0848 77, 1 (2001)] and other available experimental data as well as theoretical predictions is done. The observed abrupt changes of the M2,3 level widths versus atomic number Z can be explained satisfactorily by the cutoffs and onsets of the M2M4N1, respectively M3M4N3,4,5 and M3M5N2,3 Coster-Kronig transitions deduced from the semiempirical (Z+1) approximation. As a spin-off result of this study, precise L1M2 and L1M3 transition energies are obtained for the investigated elements. A very good agreement with transition energies calculated within the many-body perturbation theory is found.

  4. Corrosion characteristics of the Sm2(Fe0.9Co0.1)17N2.9 magnets stabilized by zinc-coating

    International Nuclear Information System (INIS)

    Arlot, R.; Machida, K.; Adachi, G.; Rango, P. de; Fruchart, D.

    1998-01-01

    The effect of powder particle size and of zinc coatings ( 2 (Fe 0.9 Co 0.1 ) 17 N 2.9 magnets has been investigated and compared to those obtained for Sm 2 Fe 17 N 3 and Nd 2 Fe 14 B magnets. Potentiokinetic polarisation behaviour in 0.5 N H 2 SO 4 and in Ringer's solution was studied. It was found that in 0.5 N H 2 SO 4 solution, the corrosion resistance is very weak, whereas in Ringer's solution, Zn coating and epoxy embedding provided a very efficient protection to the magnet. This result is quite unexpected as regarding the very weak amount of Zn (0.73 wt%) and epoxy (2.5-5 wt%) used to stabilize those very reactive ground powders which easily burn in air. Also, we characterized the magnetic properties of severely corroded magnets. (orig.)

  5. Single crystal growth of high-temperature superconductor Bi2.1Sr1.9Ca1.0Cu2.0AlyOx

    International Nuclear Information System (INIS)

    Gu, G.D.; Lin, Z.W.

    2000-01-01

    The effect of Al doping on the crystal growth of Bi-2212 was studied by a floating zone method. The results show that the planar solid-liquid interface breaks down into a cellular growth front while increasing Al doping in the rods of Bi 2.1 Sr 1.9 Ca 1.0 Cu 2.0 Al y O x . The size of the single crystals decreases with the increase in Al doping. The solubility limit for Al or the maximum Cu-site substitution by Al in the Bi-2212 crystals is less than y = 0.01. The majority of nominal Al doping in the rods forms an Al-rich phase in the grain boundaries of the single crystals. The superconductivity of as-grown Al-doped crystals decreases progressively with increasing Al doping in the rods, however, the T c for annealed Al-doped crystals does not change with increasing Al doping in the rods. The unchanged T c for annealed Al-doped Bi-2212 crystals either suggests that a small amount of Al substitution in the Cu site does not cause T c to drop significantly, or indicates that Al only enters the Bi-2212 crystals as an impurity, but does not substitute at the Cu site in the Bi-2212 crystals. (author)

  6. Antigenic variation of H1N1, H1N2 and H3N2 swine influenza viruses in Japan and Vietnam.

    Science.gov (United States)

    Takemae, Nobuhiro; Nguyen, Tung; Ngo, Long Thanh; Hiromoto, Yasuaki; Uchida, Yuko; Pham, Vu Phong; Kageyama, Tsutomu; Kasuo, Shizuko; Shimada, Shinichi; Yamashita, Yasutaka; Goto, Kaoru; Kubo, Hideyuki; Le, Vu Tri; Van Vo, Hung; Do, Hoa Thi; Nguyen, Dang Hoang; Hayashi, Tsuyoshi; Matsuu, Aya; Saito, Takehiko

    2013-04-01

    The antigenicity of the influenza A virus hemagglutinin is responsible for vaccine efficacy in protecting pigs against swine influenza virus (SIV) infection. However, the antigenicity of SIV strains currently circulating in Japan and Vietnam has not been well characterized. We examined the antigenicity of classical H1 SIVs, pandemic A(H1N1)2009 (A(H1N1)pdm09) viruses, and seasonal human-lineage SIVs isolated in Japan and Vietnam. A hemagglutination inhibition (HI) assay was used to determine antigenic differences that differentiate the recent Japanese H1N2 and H3N2 SIVs from the H1N1 and H3N2 domestic vaccine strains. Minor antigenic variation between pig A(H1N1)pdm09 viruses was evident by HI assay using 13 mAbs raised against homologous virus. A Vietnamese H1N2 SIV, whose H1 gene originated from a human strain in the mid-2000s, reacted poorly with post-infection ferret serum against human vaccine strains from 2000-2010. These results provide useful information for selection of optimal strains for SIV vaccine production.

  7. Scanning tunneling microscopy of atoms and charge density waves in 1T-TaS2, 1T-TaSe2 and 1T-VSe2

    International Nuclear Information System (INIS)

    Slough, G.; Giambattista, B.; Johnson, A.; McNairy, W.W.; Coleman, R.V.

    1988-01-01

    The layer structure dichalcogenide materials TaS 2 and TaSe 2 grow in several different phases depending on the coordination between the Ta and chalcogenide atoms and the number of three layer sandwiches per unit cell. The 1T phase has octahedral coordination between the Ta and chalcogenide atoms and has one three layer sandwich per unit cell. The high temperature Fermi surfaces (FSs) of the 1T phase Ta based materials exhibit a favorable nesting condition and undergo a charge-density-wave (CDW) transition at temperatures well above room temperature. At low temperatures the CDWs form a √13 /ovr string/a /times/ √13 a commensurate superlattice. STM scans on the 1T phases confirm the presence of an extremely strong CDW modulation inducing z-deflections in the constant current mode of anomalously large values. 1T-VSe 2 is also a member of the VB layer structure dichalcogenide group and band structure calculations show the high temperatures FS to be similar to that of 1T-TaSe 2 . However, sufficient differences exist such that the CDW formation is quite different. The CDW superlattice is observed to form only below room temperature and locks into a 4/ovr string/a /times/ 4/ovr string/a superlattice below /approximately/80K rather than the √13 /ovr string/a /times/ √13 /ovr string/a one observed in 1T-TaSe 2 . Based on electron and neutron diffraction results on stoichiometric 1T-VSe 2 two phase transitions are detected, a second order transition at 110K and a first order transition at /approximately/80K. 20 figs

  8. Complete Suppression of the m=2/n=1 NTM Using ECCD on DIII-D

    International Nuclear Information System (INIS)

    Petty, C.C.; La Haye, R.J.; Luce, T.C.; Humphreys, D.A.; Lohr, J.; Prater, R.; Austin, M.E.; Harvey, R.W.; Wade, M.R.

    2003-01-01

    Complete suppression of the m=2/n=1 neoclassical tearing mode (NTM) is reported for the first time using electron cyclotron current drive (ECCD) to noninductively generate current at the radius of the island O-point. Experiments on the DIII-D tokamak show that the maximum shrinkage of the m=2/n=1 island amplitude occurs when the ECCD location coincides with the q=2 surface. Estimates of the ECCD radial profile width from the island shrinkage are consistent with ray tracing calculations but may allow for a factor-of-1.5 broadening from electron radial transport

  9. Measured Hugoniot states of a two-element fluid, O2 + N2, near 2 Mg/m3

    International Nuclear Information System (INIS)

    Schott, G.L.

    1983-01-01

    Measured single-shock Hugoniot quantities are reported for a 1:1 atomic mixture of the elements oxygen and nitrogen in each of two liquid initial states. One of these is the inert equimolar solution O 2 + N 2 , at T approx. = 85K, v approx. = 1.06 m 3 /Mg; the other is the pure explosive compound nitric oxide, NO, at T approx. = 122K, v approx. = 0.79 m 3 /Mg. First-shock pressures are in the range 10 to 30 GPa. The two Hugoniots have common values of specific volumes and energies near 20 GPa; that is, they intersect. This permits a novel test of attainment of steady waves with equilibrium composition, such that a single equation of state may describe the shocked reactive fluid. 5 figures

  10. Crystal structure of meso-di-μ-chlorido-bis[bis(2,2′-bipyridinecadmium] bis(1,1,3,3-tetracyano-2-ethoxypropenide 0.81-hydrate

    Directory of Open Access Journals (Sweden)

    Fatima Setifi

    2017-01-01

    Full Text Available The hydrated title salt, [Cd2Cl2(C10H8N24](C9H5N4O2·0.81H2O, was obtained from the hydrothermal reaction between 2,2′-bipyridine, cadmium(II chloride and potassium 1,1,3,3-tetracyano-2-ethoxypropenide. The binuclear cation lies across a centre of inversion in the space group P21/c, with the other components in general positions. The cation has approximate, but non-crystallographic 2/m symmetry and each of the CdII atoms is a stereogenic centre, one having the Δ configuration and the other the Λ configuration. In the anion, one of the C(CN2 units is disordered over two sets of atomic sites having occupancies 0.75 (2 and 0.25 (2. The cations are linked by two independent C—H...Cl hydrogen bonds to form a sheet of R22(14 and R42(24 rings.

  11. Hybridized 1T/2H MoS2 Having Controlled 1T Concentrations and its use in Supercapacitors.

    Science.gov (United States)

    Thi Xuyen, Nguyen; Ting, Jyh-Ming

    2017-12-06

    Molybdenum disulfide (MoS 2 ) nanoflowers consisting of hybridized 1T/2H phases have been synthesized by using a microwave-assisted hydrothermal (MTH) method. The concentration of the 1T phase, ranging from 40 % to 73 %, is controlled by simply adjusting the ratio of the Mo and S precursors. By using the hybridized 1T/2H MoS 2 as an electrode material, it was demonstrated that the resulting supercapacitor performance is dominated by the 1T phase concentration. It was found that a supercapacitor with 73 % 1T phase exhibits excellent capacitance of 259 F g -1 and great cyclic stability after 1000 cycles. The formation mechanism of the MHT-synthesized hybridized 1T/2H MoS 2 is also reported. More importantly, the mechanism also explains the observed relationship between the 1T phase concentration and the ratio of the Mo and S precursors. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Synthesis and characterization of perovskite-type Sr{sub x}Y{sub 1−x}FeO{sub 3−δ} (0.63≤x<1.0) and Sr{sub 0.75}Y{sub 0.25}Fe{sub 1−y}M{sub y}O{sub 3−δ} (M=Cr, Mn, Ni), (y=0.2, 0.33, 0.5)

    Energy Technology Data Exchange (ETDEWEB)

    Biendicho, J.J. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); The ISIS Facility, STFC Rutherford Appleton Laboratory, Didcot, OX11 0QX Oxfordshire (United Kingdom); Shafeie, S. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); Frenck, L. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); Université Pierre et Marie Curie, 75005 Paris (France); Gavrilova, D. [M.V. Lomonosov Moscow State University, 119991 Moscow (Russian Federation); Böhme, S. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); Technische Universität Chemnitz, Institut für Chemie, Straße der Nationen 62, D-09111 Chemnitz (Germany); Bettanini, A.M. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); Department of Molecular Sciences and Nanosystems, University Ca’ Foscari of Venice, 30123 Venice (Italy); Svedlindh, P. [Department of Engineering Sciences, Uppsala University, Box 534, SE-751 21 Uppsala (Sweden); Hull, S. [The ISIS Facility, STFC Rutherford Appleton Laboratory, Didcot, OX11 0QX Oxfordshire (United Kingdom); Zhao, Z. [School of Industrial Engineering and Management, Royal Institute of Technology, SE-100 44 Stockholm (Sweden); Istomin, S.Ya., E-mail: istomin@icr.chem.msu.ru [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden); M.V. Lomonosov Moscow State University, 119991 Moscow (Russian Federation); Grins, J.; Svensson, G. [Department of Materials and Environmental Chemistry, Stockholm University, S-106 91 Stockholm (Sweden)

    2013-04-15

    Oxygen-deficient ferrates with the cubic perovskite structure Sr{sub x}Y{sub 1−x}FeO{sub 3−δ} were prepared in air (0.71≤x≤0.91) as well as in N{sub 2} (x=0.75 and 0.79) at 1573 K. The oxygen content of the compounds prepared in air increases with increasing strontium content from 3−δ=2.79(2) for x=0.75 to 3−δ=2.83(2) for x=0.91. Refinement of the crystal structure of Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79} using TOF neutron powder diffraction (NPD) data shows high anisotropic atomic displacement parameter (ADP) for the oxygen atom resulting from a substantial cation and anion disorder. Electron diffraction (ED) and high-resolution electron microscopy (HREM) studies of Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79} reveal a modulation along 〈1 0 0〉{sub p} with G± ∼0.4〈1 0 0〉{sub p} indicating a local ordering of oxygen vacancies. Magnetic susceptibility measurements at 5–390 K show spin-glass behaviour with dominating antiferromagnetic coupling between the magnetic moments of Fe cations. Among the studied compositions, Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79} shows the lowest thermal expansion coefficient (TEC) of 10.5 ppm/K in air at 298–673 K. At 773–1173 K TEC increases up to 17.2 ppm/K due to substantial reduction of oxygen content. The latter also results in a dramatic decrease of the electrical conductivity in air above 673 K. Partial substitution of Fe by Cr, Mn and Ni according to the formula Sr{sub 0.75}Y{sub 0.25}Fe{sub 1−y}M{sub y}O{sub 3−δ} (y=0.2, 0.33, 0.5) leads to cubic perovskites for all substituents with y=0.2. Their TECs are higher in comparison with un-doped Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79}. Only M=Ni has increased electrical conductivity compared to un-doped Sr{sub 0.75}Y{sub 0.25}FeO{sub 2.79}. - Graphical abstract: Oxygen-deficient ferrates with the cubic perovskite structure Sr{sub x}Y{sub 1−x}FeO{sub 3−δ} were prepared both in air (0.71≤x≤0.91) and N{sub 2} (x=0.75 and 0.79) at 1573 K. Refinement of the

  13. Detección de virus influenza A, B y subtipos A (H1N1 pdm09, A (H3N2 por múltiple RT-PCR en muestras clínicas

    Directory of Open Access Journals (Sweden)

    Pool Marcos

    Full Text Available Objetivos. Estandarizar la técnica de reacción en cadena de la polimerasa en tiempo real (RT-PCR múltiple para la detección de virus influenza A, B y tipificación de subtipos A (H1N1 pdm09, A (H3N2 en muestras clínicas. Materiales y métodos. Se analizaron 300 muestras de hisopado nasofaríngeo. Esta metodología fue estandarizada en dos pasos: la primera reacción detectó el gen de la matriz del virus de influenza A, gen de la nucleoproteína del virus influenza B y el gen GAPDH de las células huésped. La segunda reacción detectó el gen de la hemaglutinina de los subtipos A (H1N1 pandémico (pdm09 y A (H3N2. Resultados. Se identificaron 109 muestras positivas a influenza A y B, de las cuales 72 fueron positivas a influenza A (36 positivas a influenza A (H1N1 pdm09 y 36 positivos a influenza A (H3N2 y 37 muestras positivas a influenza B. 191 fueron negativas a ambos virus mediante RT-PCR en tiempo real multiplex. Se encontró una sensibilidad y especificidad del 100% al analizar los resultados de ambas reacciones. El límite de detección viral fue del rango de 7 a 9 copias/µL por virus. Los resultados no mostraron ninguna reacción cruzada con otros virus tales como adenovirus, virus sincitial respiratorio, parainfluenza (1,2 y 3, metapneumovirus, subtipos A (H1N1 estacional, A (H5N2 y VIH. Conclusiones. La RT-PCR múltiple demostró ser una prueba muy sensible y específica para la detección de virus influenza A, B y subtipos A (H1N1, H3N2 y su uso puede ser conveniente en brotes estacionales.

  14. Abandoned Well Program. Version 2.0. Volume 1

    Science.gov (United States)

    1988-09-01

    Sec 26 222 2 26A01 SW NW Sec 26 27 8 26A02 NE NW Sec 26 700 36 26A03 NW NE Sec 26 48 36 Section 27 27001 NW NW Sec 27 53 4 27008 NW NW Sec 27 44 2...5-0 4 132 "_5 140-s 11 5 05 12-! 0(35 1 45 14 032170 06 111 .43 144 06 2 0 15 oso I 03 15, 04146•-,T. -- ISO I5 f 4156 37 313 154 0S 311172 1 1 317...1 4 54 36 210 0 017- 20- 423 331-200-1 0 -0 -06 -00 -64 -06 -11 210 - ? -! I’’ I 9’I It I.8 I _ -10 -16 -161 - iso -157 -166 -150 -137 -140 -104 -123

  15. Influence of elemental diffusion on low temperature formation of MgH2 in TiMn1.3T0.2-Mg (T = 3d-transition elements)

    International Nuclear Information System (INIS)

    Yamamoto, K.; Tanioka, S.; Tsushio, Y.; Shimizu, T.; Morishita, T.; Orimo, S.; Fujii, H.

    1996-01-01

    In order to examine the influence of the elemental diffusion from the host compound into the Mg region on low temperature formation of MgH 2 , we have investigated the hydriding properties and the microstructures of the composite materials TiMn 1.3 T 0.2 -Mg (T = V, Cr, Mn, Fe, Co, Ni and Cu). MgH 2 is formed at 353 K in all composite materials. Of all the substitutions, the amount of MgH 2 is the largest in the case of the Cu substitution, which originates from the existence of the Mg-Mg 2 Cu eutectic formed by Cu diffusion from the host compound TiMn 1.3 Cu 0.2 into the Mg region during the liquid phase sintering. In addition, the hydrogen capacity of TiMn 1.3 Cu 0.2 -Mg (that is TiMn 1.3 Cu 0.1 -(Mg+Mg 2 Cu) after the sintering) easily saturates in comparison with TiMn 1.5 -(Mg+Mg 2 Cu) without Cu diffusion. It is concluded that Cu diffusion promotes the mobility of hydrogen atoms at the complex interface between the host compound and the Mg region. (orig.)

  16. Energy, fine structure, and hyperfine structure of the core-excited states 1s2s2pnp 5P (n = 2-5) and 1s2p2mp 5S (m = 2-5) for Li- ion

    International Nuclear Information System (INIS)

    Wang, Z.B.; Gou, B.C.; Chen, F.

    2006-01-01

    The relativistic energies, the oscillator strength, and the lifetimes of high-lying core-excited states 1s2s2pnp 5 P (n=2-5) and 1s2p 2 mp 5 S 0 (m=2-5) of Li - ion are calculated with the saddle-point variational method and restricted variation method. The fine structure and the hyperfine structure of the core-excited states for this system are also explored. The results are compared with other theoretical and experimental data in the literature. The energy obtained in this work are much lower than the others previously published whereas the wavelengths and radiative life-times are in agreement

  17. Magnetocaloric response of La 0.70 Ca 0.1 Sr 0.2 Fe 0.1 Mn 0.9 O 3 ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 38; Issue 1. Magnetocaloric response of La0.70Ca0.1Sr0.2Fe0.1Mn0.9O3 pervoskite for magnetic refrigeration. M S Anwar Faheem Ahmed Bon Heun Koo. Volume 38 Issue 1 February 2015 pp 101-104 ...

  18. Calorimetric study of alternating copolymer of bicyclo[2,2,1]-hepta-2,5-diene and carbon monoxide in the range from T->0 to 510K

    International Nuclear Information System (INIS)

    Smirnova, N.N.; Nikishchenkova, L.V.; Bykova, T.A.; Kulagina, T.G.; Belov, G.P.; Novikova, E.V.

    2006-01-01

    By adiabatic vacuum and dynamic calorimetry, the temperature dependence of heat capacity for alternating copolymer of bicyclo[2,2,1]-hepta-2,5-diene and carbon monoxide has been determined over the 6-510K range with an uncertainty of 0.2-0.5% between 6 and 350K and 0.5-1.5% from 330 to 510K. In the above temperature ranges, the physical transformations of the copolymer have been detected and their thermodynamic characteristics have been estimated. In a calorimeter with a static bomb and an isothermal shield, the energy of combustion of the copolymer has been measured at 298.15K. Based on the experimental data, the thermodynamic functions of the copolymer, namely, the heat capacity C p - bar (T), enthalpy H o (T)-H o (0), entropy S o (T)-S o (0) and Gibbs function G o (T)-H o (0) have been determined for the range from T->0 to 400K. The enthalpy of combustion Δ c H o and the thermodynamic parameters Δ f H o , Δ f S o , Δ f G o and lnK f - bar of reaction of formation of the copolymer from simple substances at T=298.15K and p=0.1MPa have been calculated. The data cited in the present work and literature data were used to calculate the thermodynamic characteristics of the alternating copolymerization in bulk of bicyclo[2,2,1]-hepta-2,5-diene and CO in the 0-340K range at standard pressure as well as to compare them with the thermodynamic characteristics of the synthesis of isomeric polyketone

  19. Why is the neutrino oscillation formula expanded in Δm_2_1"2m_3_1"2 still accurate near the solar resonance in matter?

    International Nuclear Information System (INIS)

    Xu, Xun-Jie

    2015-01-01

    The conventional approximate formula for neutrino oscillation in matter which is obtained from the expansion in terms of the ratio of mass square differences α=Δm_2_1"2m_3_1"20.03, first proposed by Cervera, et al. and Freund, turns out to be an accurate formula for accelerator neutrino experiments. Originally it required the neutrino energy to be well above the solar resonance to validate the expansion but it is found to be still very accurate when the formula is extrapolated to the resonance, which is practically important for the T2K experiment. This paper shows that the accuracy is guaranteed by cancellations of branch cut singularities and also, for the first time, analytically computes the actual error of the formula. The actual error implies that the original requirement can be safely removed in current experiments.

  20. Thermophysical properties of ionic liquid, 1-hexyl-3-methylimidazolum bromide + N-N′bis(2-pyridylmethylidene)-1,2-diiminoethane (BPIE) Schiff base + N,N-dimethylformamide solutions

    International Nuclear Information System (INIS)

    Shekaari, Hemayat; Bezaatpour, Abolfazl; Khoshalhan, Maryam

    2012-01-01

    Highlights: ► Thermodynamic properties of ionic liquids + BPIE Schiff base + DMF were studied. ► There are preferential interactions between ionic liquid and BPIE molecules. ► The nonpolar–nonpolar interactions are dominant interactions between BPIE and ionic liquid. - Abstract: Effect of N-N′bis(2-pyridylmethylidene)-1,2-diiminoethane (BPIE) Schiff base on thermodynamic properties of ionic liquid, 1-hexyl-3-methylimidazolium bromide ([HMIm]Br) in N,N-dimethylformamide (DMF) solutions were determined at T = 298.15–313.15 K. The standard partial molar volumes, V φ 0 , partial molar volumes of transfer, Δ tr V φ 0 have been calculated using the measured density data. The cosphere overlap model was used to interpretate the partial molar volumes of transfer, Δ tr V φ 0 . The calculated Hepler's constants, ∂ 2 V φ 0 /∂ 2 T, indicate that the BPIE and ionic liquid have structure-breaking (chaotropic) tendency. Ion association constants, K a , and limiting molar conductivities, Λ 0 , viscosity B-coefficients and molar refractions, R D , have been used to confirm the conclusions obtained from the volumetric properties. The results were interpreted in terms of various solute–solvent interactions occuring in the investigated solutions and indicating an enhancement in the nonpolar–nonpolar interactions between the BPIE Schiff base and the ionic liquid with increasing BPIE concentration.

  1. A 0.8-2.4 μm Transmission spectrum of the hot Jupiter CoRoT-1b

    Energy Technology Data Exchange (ETDEWEB)

    Schlawin, E.; Herter, T. [Astronomy Department, Cornell University, Ithaca, NY 14853 (United States); Zhao, M. [Department of Astronomy, Pennsylvania State University, University Park, PA 16802 (United States); Teske, J. K. [Astronomy Department, The University of Arizona, Tucson, AZ 85721 (United States)

    2014-03-01

    Hot Jupiters with brightness temperatures ≳2000 K can have TiO and VO molecules as gaseous species in their atmospheres. The TiO and VO molecules can potentially induce temperature inversions in hot Jupiter atmospheres and also have an observable signature of large optical to infrared transit depth ratios. Previous transmission spectra of very hot Jupiters have shown a lack of TiO and VO, but only in planets that also appear to lack temperature inversions. We measure the transmission spectrum of CoRoT-1b, a hot Jupiter that was predicted to have a temperature inversion potentially due to significant TiO and VO in its atmosphere. We employ the multi-object spectroscopy method using the SpeX and MORIS instruments on the Infrared Telescope Facility (IRTF) and the Gaussian process method to model red noise. By using a simultaneous reference star on the slit for calibration and a wide slit to minimize slit losses, we achieve transit depth precision of 0.03%-0.09%, comparable to the atmospheric scale height but detect no statistically significant molecular features. We combine our IRTF data with optical CoRoT transmission measurements to search for differences in the optical and near-infrared absorption that would arise from TiO/VO. Our IRTF spectrum and the CoRoT photometry disfavor a TiO/VO-rich spectrum for CoRoT-1b, suggesting that the atmosphere has another absorber that could create a temperature inversion or that the blackbody-like emission from the planet is due to a spectroscopically flat cloud, dust, or haze layer that smoothes out molecular features in both CoRoT-1b's emission and transmission spectra. This system represents the faintest planet hosting star (K = 12.2) with a measured planetary transmission spectrum.

  2. Longitudinal evaluation of T1ρ and T2 spatial distribution in osteoarthritic and healthy medial knee cartilage.

    Science.gov (United States)

    Schooler, J; Kumar, D; Nardo, L; McCulloch, C; Li, X; Link, T M; Majumdar, S

    2014-01-01

    To investigate longitudinal changes in laminar and spatial distribution of knee articular cartilage magnetic resonance imaging (MRI) T1ρ and T2 relaxation times, in individuals with and without medial compartment cartilage defects. All subjects (at baseline n = 88, >18 years old) underwent 3-Tesla knee MRI at baseline and annually thereafter for 3 years. The MR studies were evaluated for presence of cartilage defects (modified Whole-Organ Magnetic Resonance Imaging Scoring - mWORMS), and quantitative T1ρ and T2 relaxation time maps. Subjects were segregated into those with (mWORMS ≥2) and without (mWORMS ≤1) cartilage lesions at the medial tibia (MT) or medial femur (MF) at each time point. Laminar (bone and articular layer) and spatial (gray level co-occurrence matrix - GLCM) distribution of the T1ρ and T2 relaxation time maps were calculated. Linear regression models (cross-sectional) and Generalized Estimating Equations (GEEs) (longitudinal) were used. Global T1ρ, global T2 and articular layer T2 relaxation times at the MF, and global and articular layer T2 relaxation times at the MT, were higher in subjects with cartilage lesions compared to those without lesions. At the MT global T1ρ relaxation times were higher at each time point in subjects with lesions. MT T1ρ and T2 became progressively more heterogeneous than control compartments over the course of the study. Spatial distribution of T1ρ and T2 relaxation time maps in medial knee OA using GLCM technique may be a sensitive indicator of cartilage deterioration, in addition to whole-compartment relaxation time data. Copyright © 2013 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  3. T1 and T2 squamous cell carcinomas of the floor of the mouth: results of brachytherapy mainly using 198Au grains

    International Nuclear Information System (INIS)

    Matsumoto, Satoru; Takeda, Masamune; Shibuya, Hitoshi; Suzuki, Soji

    1996-01-01

    Purpose: To investigate the effectiveness of brachytherapy provided by this institution over a 25-year period, and to specifically verify the efficacy of 198 Au grain therapy, this study evaluated the outcomes in patients given brachytherapy for T1 and T2 squamous cell carcinomas (SCCs) of the floor of the mouth. Methods and Materials: A retrospective analysis of data from 90 patients with T1 and T2 SCCs of the floor of the mouth who underwent brachytherapy between 1965 and 1989. Therapy mainly consisted of 198 Au grain implants with or without external irradiation. As for the brachytherapeutic source, 15 patients were treated with radon seeds, 60 with 198 Au grains, 10 with radium needles, 3 with cobalt needles, and 2 with iridium hairpins. Based on the 1987 International Union Against Cancer (UICC) classification, the SCC stagings and number of cases per staging follow: Stage I (T1N0), 21 cases; Stage II (T2N0), 55 cases; and Stage III-IV (T1-2N1-2), 14 cases. The minimum follow-up time was 3 years. Results: The local control rates of these SCCs, based on tumor size, were 89% for T1 lesions, 76% for T2a (≤ 3 cm) lesions, and 56% for T2b (> 3 cm) lesions, and 82% for T1-2 lesions without a gingival involvement, in contrast to 55% for lesions with a gingival involvement (p 198 Au grain brachytherapy, local control was achieved in 93% of the T1 lesions, 79% of the T2a lesions, and in 56% of the T2b lesions. Further, the incidence of severe complications requiring surgery was low (5%). Conclusion: For T1N0 and T2aN0 SCCs of the floor of the mouth, excluding lesions with a gingival involvement, 198 Au grain brachytherapy alone or in combination with external radiotherapy was found to be efficacious

  4. Seroprevalence of H1N1, H3N2 and H1N2 influenza viruses in pigs in seven European countries in 2002-2003.

    Science.gov (United States)

    Van Reeth, Kristien; Brown, Ian H; Dürrwald, Ralf; Foni, Emanuela; Labarque, Geoffrey; Lenihan, Patrick; Maldonado, Jaime; Markowska-Daniel, Iwona; Pensaert, Maurice; Pospisil, Zdenek; Koch, Guus

    2008-05-01

    Avian-like H1N1 and human-like H3N2 swine influenza viruses (SIV) have been considered widespread among pigs in Western Europe since the 1980s, and a novel H1N2 reassortant with a human-like H1 emerged in the mid 1990s. This study, which was part of the EC-funded 'European Surveillance Network for Influenza in Pigs 1', aimed to determine the seroprevalence of the H1N2 virus in different European regions and to compare the relative prevalences of each SIV between regions. Laboratories from Belgium, the Czech Republic, Germany, Italy, Ireland, Poland and Spain participated in an international serosurvey. A total of 4190 sow sera from 651 farms were collected in 2002-2003 and examined in haemagglutination inhibition tests against H1N1, H3N2 and H1N2. In Belgium, Germany, Italy and Spain seroprevalence rates to each of the three SIV subtypes were high (> or =30% of the sows seropositive) to very high (> or =50%), except for a lower H1N2 seroprevalence rate in Italy (13.8%). Most sows in these countries with high pig populations had antibodies to two or three subtypes. In Ireland, the Czech Republic and Poland, where swine farming is less intensive, H1N1 was the dominant subtype (8.0-11.7% seropositives) and H1N2 and H3N2 antibodies were rare (0-4.2% seropositives). Thus, SIV of H1N1, H3N2 and H1N2 subtype are enzootic in swine producing regions of Western Europe. In Central Europe, SIV activity is low and the circulation of H3N2 and H1N2 remains to be confirmed. The evolution and epidemiology of SIV throughout Europe is being further monitored through a second 'European Surveillance Network for Influenza in Pigs'.

  5. Polarity driven morphology of CeO{sub 2}(1 0 0) islands on Cu(1 1 1)

    Energy Technology Data Exchange (ETDEWEB)

    Stetsovych, O., E-mail: stetsovycholeksandr@gmail.com; Beran, J.; Dvořák, F.; Mašek, K.; Mysliveček, J., E-mail: Josef.Myslivecek@mff.cuni.cz; Matolín, V.

    2013-11-15

    Thin ceria films supported by metal substrates represent important model systems for reactivity studies in heterogeneous catalysis. Here we report the growth study of the polar CeO{sub 2}(1 0 0) phase as part of a mixed CeO{sub 2}(1 1 1)–CeO{sub 2}(1 0 0) thin film supported by Cu(1 1 1). The two ceria phases grow on different areas of the substrate, what allows a reliable growth characterization of the CeO{sub 2}(1 0 0) islands on Cu(1 1 1). Scanning tunneling microscopy measurements reveal CeO{sub 2}(1 0 0) to grow in the form of highly dispersed three dimensional (3D) islands on a CeO{sub 2}(1 0 0) interfacial layer. The CeO{sub 2}(1 0 0) islands exhibit a 2 × 2 surface reconstruction. The presence of the surface reconstruction together with the highly dispersed growth of CeO{sub 2}(1 0 0) islands corresponds to the requirement for compensation of the surface dipole moment on the CeO{sub 2}(1 0 0). CeO{sub 2}(1 0 0) islands are further characterized by reflection high energy electron diffraction yielding their epitaxial relations with respect to the Cu(1 1 1) substrate. The growth of well characterized CeO{sub 2}(1 0 0) islands supported by Cu(1 1 1) represents a starting point for developing a novel template for structure-related reactivity studies of ceria based model catalysts.

  6. III-nitride disk-in-nanowire 1.2 μm monolithic diode laser on (001)silicon

    Energy Technology Data Exchange (ETDEWEB)

    Hazari, Arnab; Aiello, Anthony; Bhattacharya, Pallab [Center for Photonics and Multiscale Nanomaterials, Department of Electrical Engineering and Computer Science, University of Michigan, Ann Arbor, Michigan 48109 (United States); Ng, Tien-Khee; Ooi, Boon S. [Division of Computer, Electrical and Mathematical Sciences and Engineering, King Abdullah University of Science and Technology (KAUST), Thuwal 23955-6900 (Saudi Arabia)

    2015-11-09

    III-nitride nanowire diode heterostructures with multiple In{sub 0.85}Ga{sub 0.15}N disks and graded InGaN mode confining regions were grown by molecular beam epitaxy on (001)Si substrates. The aerial density of the 60 nm nanowires is ∼3 × 10{sup 10} cm{sup −2}. A radiative recombination lifetime of 1.84 ns in the disks is measured by time-resolved luminescence measurements. Edge-emitting nanowire lasers have been fabricated and characterized. Measured values of J{sub th}, T{sub 0}, and dg/dn in these devices are 1.24 kA/cm{sup 2}, 242 K, and 5.6 × 10{sup −17} cm{sup 2}, respectively. The peak emission is observed at ∼1.2 μm.

  7. Pulsed laser deposition of {CeO_2} and {Ce_{1-x}M_xO_2} (M = La, Zr): Application to insulating barrier in cuprate heterostructures

    Science.gov (United States)

    Berger, S.; Contour, J.-P.; Drouet, M.; Durand, O.; Khodan, A.; Michel, D.; Régi, F.-X.

    1998-03-01

    SrTiO_3 had been often tentatively used as an insulating barrier for HT superconductor/insulator heterostructures. Unfortunately, the deposition of SrTiO_3 on the YBa_2Cu_3O_7 inverse interface results in a poor epitaxial regrowth producing a high roughness dislocated titanate layer. Taking into account the good matching with YBa_2Cu_3O_7 and LaAlO_3, CeO_2 and Ce_{1-x}M_xO_2 (M = La, Zr), epitaxial layers were grown by pulsed laser deposition on LaAlO_3 substrates and introduced into YBa_2Cu_3O_7 based heterostructures as insulating barrier. After adjusting the growth parameters from RHEED oscillations, epitaxial growth is achieved, the oxide crystal axes being rotated by 45^circ from those of the substrate. The surface roughness of 250 nm thick films is very low with a rms value lower than 0.5 nm over 1m^2. The YBa_2Cu_3O_7 layers of a YBa_2Cu_3O_7/CeO_2 /YBa_2Cu_3O_7 heterostructures grown using these optimized parameters show an independent resistive transition, when the thickness is larger than 25 nm, respectively at T_c_1 = 89.6;K and T_c_2 = 91.4;{K}. SrTiO3 est souvent utilisé comme barrière isolante dans des hétérostructures SIS de cuprates supraconducteurs, cependant les défauts générés lors de la croissance de ce titanate sur l'interface inverse de YBa2Cu3O7 conduisent à un matériau dont la qualité cristalline et les propriétés physiques sont médiocres. L'oxyde de cérium CeO2 est également une barrière isolante potentielle intéressante pour ces structures SIS basées sur YBa2Cu3O7 car cet oxyde cubique (a = 0,5411 nm, asqrt{2}/2 = 0,3825 nm) qui est peu désaccordé par rapport au plan ab du cuprate (Δ a/a = - 0,18 %, Δ b/a = 1,6 %) présente de plus un coefficient de dilatation thermique (10,6 × 10^{-6 circ}C^{-1}) très voisin de celui de YBa2Cu3O7 (13 × 10^{-6 circ}C^{-1}). Nous avons donc étudié l'épitaxie de CeO2 et des oxydes de type Ce{1-x}MxO2 (M = La, Zr) en ablation laser pulsée afin de définir des conditions de

  8. Effect of thymosin alpha-1 on subpopulations of Th1, Th2, Th17, and regulatory T cells (Tregs) in vitro

    International Nuclear Information System (INIS)

    Yang, Xia; Qian, Feng; He, Hai-Yang; Liu, Kai-Jun; Lan, Yuan-Zhi; Ni, Bing; Tian, Yi; Fu, Xiao-Lan; Zhang, Ji; Shen, Zi-Gang; Li, Jian; Yin, Yi; Li, Jin-Tao; Wu, Yu-Zhang

    2011-01-01

    Thymosin alpha 1 (Tα1) has been shown to have beneficial effects on numerous immune system parameters, but little is known about the effects of Tα1 on patients with gastric carcinoma. The objective of this study was to determine the effect of Tα1 on subpopulations of Th1, Th2, Th17, and regulatory T cells (Tregs) in vitro, and to evaluate its efficacy as an immunoregulatory factor in patients with gastric carcinoma. We compared the effect of Tα1 on the frequency of CD4 + and CD8 + T cells, especially the CD4 + CD25 + Foxp3 + Tregs in peripheral blood mononuclear cells (PBMCs) from gastric carcinoma patients (N = 35) and healthy donors (N = 22). We also analyzed the changes in the proliferation of PBMCs in response to treatment with Tα1, and examined the production of Th1, Th2, and Th17 cytokines by PBMCs and tumor-infiltrating lymphocytes. The treatment of PBMCs from gastric cancer patients, with Tα1 (50 µg/mL) alone increased the percentage of CD4+CD25+Foxp3+ (suppressive antitumor-specific Tregs) from 1.68 ± 0.697 to 2.19 ± 0.795% (P < 0.05). Our results indicate that Tα1 increases the percentage of Tregs and IL-1β, TNF-α, and IL-6 in vitro

  9. Effect of thymosin alpha-1 on subpopulations of Th1, Th2, Th17, and regulatory T cells (Tregs) in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Xia [Institute of Immunology,Third Military Medical University, Chongqing (China); Qian, Feng [Department of General Surgery, Southwest Hospital, Third Military Medical University, Chongqing (China); He, Hai-Yang; Liu, Kai-Jun [Institute of Immunology,Third Military Medical University, Chongqing (China); Lan, Yuan-Zhi [Department of General Surgery, Southwest Hospital, Third Military Medical University, Chongqing (China); Ni, Bing; Tian, Yi; Fu, Xiao-Lan; Zhang, Ji; Shen, Zi-Gang; Li, Jian; Yin, Yi; Li, Jin-Tao; Wu, Yu-Zhang [Institute of Immunology,Third Military Medical University, Chongqing (China)

    2011-12-02

    Thymosin alpha 1 (Tα1) has been shown to have beneficial effects on numerous immune system parameters, but little is known about the effects of Tα1 on patients with gastric carcinoma. The objective of this study was to determine the effect of Tα1 on subpopulations of Th1, Th2, Th17, and regulatory T cells (Tregs) in vitro, and to evaluate its efficacy as an immunoregulatory factor in patients with gastric carcinoma. We compared the effect of Tα1 on the frequency of CD4{sup +} and CD8{sup +} T cells, especially the CD4{sup +}CD25{sup +}Foxp3{sup +} Tregs in peripheral blood mononuclear cells (PBMCs) from gastric carcinoma patients (N = 35) and healthy donors (N = 22). We also analyzed the changes in the proliferation of PBMCs in response to treatment with Tα1, and examined the production of Th1, Th2, and Th17 cytokines by PBMCs and tumor-infiltrating lymphocytes. The treatment of PBMCs from gastric cancer patients, with Tα1 (50 µg/mL) alone increased the percentage of CD4+CD25+Foxp3+ (suppressive antitumor-specific Tregs) from 1.68 ± 0.697 to 2.19 ± 0.795% (P < 0.05). Our results indicate that Tα1 increases the percentage of Tregs and IL-1β, TNF-α, and IL-6 in vitro.

  10. Cesium adsorption on In0.53Ga0.47As (1 0 0) β2 (2 × 4) surface: A first-principles research

    International Nuclear Information System (INIS)

    Guo, Jing; Chang, Benkang; Jin, Muchun; Wang, Honggang; Wang, MeiShan

    2015-01-01

    Highlights: • Eight different cesium adsorption In 0.53 Ga 0.47 As (1 0 0) β 2 (2 × 4) surface models have been built. • Surface characteristics of the cesium adsorption In 0.53 Ga 0.47 As (1 0 0) β 2 (2 × 4) surfaces are investigated based on the first principle. • New energy bands appear and band gap is narrowed after adsorption. • The cesium adsorption enhances the surface ionization. • T 2 and T 3 are the reasonable adsorption sites relatively. - Abstract: In 0.53 Ga 0.47 As is a perfect III–V compound semiconductor for the photoemissive layer of the infrared-extension negative electron affinity photocathode. It is the key step for the formation of negative electron affinity that the cesium atoms and oxygen atoms activate the photocathode surface alternately. Geometry optimizations based on the first principles have been carried out for the In 0.53 Ga 0.47 As (1 0 0) β 2 (2 × 4) surfaces with a cesium atom adsorbed on 8 different possible sites named as D, D′, T 2 , T 2 ′, T 3 , T 3 ′, T 4 and T 4 ′. The surfaces characteristics have been investigated before and after adsorption from the point of negative electron affinity formation. Meanwhile, the surface atom structure, the adsorption energy, work function, surface energy bands, charge transfer and the dipole generation of the 8 different adsorption surfaces have been compared to each other. The work function and the surface energy bands have been analyzed in detail, which are closely related with the photoelectrons escaping from the surface. The surface work functions are all decreased in varying degrees and energy band bends all appear at the 8 different adsorption sites due to the surface charge transfer and the dipole formation. In conclusion, T 2 and T 3 are the favorable adsorption sites relatively. The surfaces with a cesium atom adsorbed on these two sites are most stable and have much lower work functions, which generates reasonable energy band bend and is benefit for the

  11. Calorimetric study of alternating copolymer of bicyclo[2,2,1]-hepta-2,5-diene and carbon monoxide in the range from T->0 to 510K

    Energy Technology Data Exchange (ETDEWEB)

    Smirnova, N.N. [Research Institute of Chemistry, Nizhny Novgorod University, Gagarin Prospekt 23/5, 603950 Nizhny Novgorod (Russian Federation)]. E-mail: smirnova@ichem.unn.runnet.ru; Nikishchenkova, L.V. [Research Institute of Chemistry, Nizhny Novgorod University, Gagarin Prospekt 23/5, 603950 Nizhny Novgorod (Russian Federation); Bykova, T.A. [Research Institute of Chemistry, Nizhny Novgorod University, Gagarin Prospekt 23/5, 603950 Nizhny Novgorod (Russian Federation); Kulagina, T.G. [Research Institute of Chemistry, Nizhny Novgorod University, Gagarin Prospekt 23/5, 603950 Nizhny Novgorod (Russian Federation); Belov, G.P. [Institute of Problems of Chemical Physics of Russian Academy Sciences, 142432 Chernogolovka, Moscow Region (Russian Federation); Novikova, E.V. [Institute of Problems of Chemical Physics of Russian Academy Sciences, 142432 Chernogolovka, Moscow Region (Russian Federation)

    2006-12-01

    By adiabatic vacuum and dynamic calorimetry, the temperature dependence of heat capacity for alternating copolymer of bicyclo[2,2,1]-hepta-2,5-diene and carbon monoxide has been determined over the 6-510K range with an uncertainty of 0.2-0.5% between 6 and 350K and 0.5-1.5% from 330 to 510K. In the above temperature ranges, the physical transformations of the copolymer have been detected and their thermodynamic characteristics have been estimated. In a calorimeter with a static bomb and an isothermal shield, the energy of combustion of the copolymer has been measured at 298.15K. Based on the experimental data, the thermodynamic functions of the copolymer, namely, the heat capacity C{sub p}{sup -}bar (T), enthalpy H{sup o}(T)-H{sup o}(0), entropy S{sup o}(T)-S{sup o}(0) and Gibbs function G{sup o}(T)-H{sup o}(0) have been determined for the range from T->0 to 400K. The enthalpy of combustion {delta}{sub c}H{sup o} and the thermodynamic parameters {delta}{sub f}H{sup o}, {delta}{sub f}S{sup o}, {delta}{sub f}G{sup o} and lnK{sub f}{sup -}bar of reaction of formation of the copolymer from simple substances at T=298.15K and p=0.1MPa have been calculated. The data cited in the present work and literature data were used to calculate the thermodynamic characteristics of the alternating copolymerization in bulk of bicyclo[2,2,1]-hepta-2,5-diene and CO in the 0-340K range at standard pressure as well as to compare them with the thermodynamic characteristics of the synthesis of isomeric polyketone.

  12. Water vapor self-continuum absorption measurements in the 4.0 and 2.1 μm transparency windows

    Science.gov (United States)

    Richard, L.; Vasilchenko, S.; Mondelain, D.; Ventrillard, I.; Romanini, D.; Campargue, A.

    2017-11-01

    In a recent contribution [A. Campargue, S. Kassi, D. Mondelain, S. Vasilchenko, D. Romanini, Accurate laboratory determination of the near infrared water vapor self-continuum: A test of the MT_CKD model. J. Geophys. Res. Atmos., 121,13,180-13,203, doi:10.1002/2016JD025531], we reported accurate water vapor absorption continuum measurements by Cavity Ring-down Spectroscopy (CRDS) and Optical-Feedback-Cavity Enhanced Absorption Spectroscopy (OF-CEAS) at selected spectral points of 4 near infrared transparency windows. In the present work, the self-continuum cross-sections, CS, are determined for two new spectral points. The 2491 cm-1 spectral point in the region of maximum transparency of the 4.0 μm window was measured by OF-CEAS in the 23-52 °C temperature range. The 4435 cm-1 spectral point of the 2.1 μm window was measured by CRDS at room temperature. The self-continuum cross-sections were determined from the pressure squared dependence of the continuum absorption. Comparison to the literature shows a reasonable agreement with 1970 s and 1980 s measurements using a grating spectrograph in the 4.0 μm window and a very good consistency with our previous laser measurements in the 2.1 μm window. For both studied spectral points, our values are much smaller than previous room temperature measurements by Fourier Transform Spectroscopy. Significant deviations (up to about a factor 4) are noted compared to the widely used semi empirical MT_CKD model of the absorption continuum. The measured temperature dependence at 2491 cm-1 is consistent with previous high temperature measurements in the 4.0 μm window and follows an exp(D0/kT) law, D0 being the dissociation energy of the water dimer.

  13. Multiple anion...π interactions in tris(1,10-phenanthroline-κ(2)N,N')iron(II) bis[1,1,3,3-tetracyano-2-(2-hydroxyethyl)propenide] monohydrate.

    Science.gov (United States)

    Setifi, Zouaoui; Domasevitch, Konstantin V; Setifi, Fatima; Mach, Pavel; Ng, Seik Weng; Petříček, Vaclav; Dušek, Michal

    2013-11-01

    In the ionic structure of the title compound, [Fe(C12H8N2)3](C9H5N4O2)2·H2O, the octahedral tris-chelate [Fe(phen)3](2+) dications [Fe-N = 1.9647 (14)-1.9769 (14) Å; phen is 1,10-phenathroline] afford one-dimensional chains by a series of slipped π-π stacking interactions [centroid-to-centroid distances = 3.792 (3) and 3.939 (3) Å]. The 1,1,3,3-tetracyano-2-(2-hydroxyethyl)propenide anions, denoted tcnoetOH(-), reveal an appreciable delocalization of π-electron density, involving the central propenide [C-C = 1.383 (3)-1.401 (2) Å] fragment and four nitrile groups, and this is also supported by density functional theory (DFT) calculations at the B97D/6-311+G(2d,2p) level. Primary noncovalent inter-moiety interactions comprise conventional O-H...O(N) and weak C-H...O(N) hydrogen bonding [O...O(N) = 2.833 (2)-3.289 (5) Å and C...O(N) = 3.132 (2)-3.439 (2) Å]. The double anion...π interaction involving a nitrile group of tcnoetOH(-) and two cis-positioned pyridine rings (`π-pocket') of [Fe(phen)3](2+) [N...centroid = 3.212 (2) and 3.418 (2) Å] suggest the relevance of anion...π stackings for charge-diffuse polycyanoanions and common M-chelate species.

  14. Diaqua[N,N′-bis(2-pyridylmethylenepropane-1,3-diamine]manganese(II dibromide–aquabromido[N,N′-bis(2-pyridylmethylenepropane-1,3-diamine]manganese(II bromide–dibromido[N,N′-bis(2-pyridylmethylenepropane-1,3-diamine]manganese(II (1/2/1

    Directory of Open Access Journals (Sweden)

    In-Chul Hwang

    2009-01-01

    Full Text Available There are three different MnII complexes in the asymmetric unit of the title compound, [Mn(C15H16N4(H2O2]Br2·2{[MnBr(C15H16N4(H2O]Br}·[MnBr2(C15H16N4]. In the neutral complex, the Mn2+ ion is six-coordinated in a distorted octahedral environment by four N atoms of the tetradentate ligand N,N′-bis(2-pyridylmethylenepropane-1,3-diamine (bppd and two bromide ligands. In the two cationic complexes, the Mn2+ ions are also six-coordinated in similar environments, but one Mn ion is coordinated by four N atoms of bppd, one Br atom and one O atom of a coordinating water molecule, whereas the other Mn ion is coordinated by four N atoms of bppd and two O atoms of water ligands. The complexes with two coordinated Br atoms or two H2O ligands are disposed about a twofold axis through Mn and C atoms with the special positions ({script{1over 2}}, y, 0 and (0, y, {script{1over 2}}, respectively. The compound displays intermolecular O—H...Br hydrogen bonding. There are intermolecular π–π interactions between adjacent pyridine rings, with centroid–centroid distances of 3.822 and 3.833 Å, and a C—H...O interaction is also present.

  15. 4-(2-Chloro-4-methoxy-5-methylphenyl)-N-[(1S)-2-cyclopropyl-1-(3-fluoro-4-methylphenyl)ethyl]5-methyl-N-(2-propynyl)-1,3-thiazol-2-amine hydrochloride (SSR125543A): a potent and selective corticotrophin-releasing factor(1) receptor antagonist. I. Biochemical and pharmacological characterization.

    Science.gov (United States)

    Gully, Danielle; Geslin, Michel; Serva, Laurence; Fontaine, Evelyne; Roger, Pierre; Lair, Christine; Darre, Valerie; Marcy, Claudine; Rouby, Pierre-Eric; Simiand, Jacques; Guitard, Josette; Gout, Georgette; Steinberg, Regis; Rodier, Daniel; Griebel, Guy; Soubrie, Philippe; Pascal, Marc; Pruss, Rebecca; Scatton, Bernard; Maffrand, Jean-Pierre; Le Fur, Gerard

    2002-04-01

    4-(2-Chloro-4-methoxy-5-methylphenyl)-N-[(1S)-2-cyclopropyl-1- (3-fluoro-4-methylphenyl)ethyl]5-methyl-N-(2-propynyl)-1,3-thiazol-2-amine hydrochloride (SSR125543A), a new 2-aminothiazole derivative, shows nanomolar affinity for human cloned or native corticotrophin-releasing factor (CRF)(1) receptors (pK(i) values of 8.73 and 9.08, respectively), and a 1000-fold selectivity for CRF(1) versus CRF(2 alpha) receptor and CRF binding protein. SSR125543A antagonizes CRF-induced stimulation of cAMP synthesis in human retinoblastoma Y 79 cells (IC(50) = 3.0 +/- 0.4 nM) and adrenocorticotropin hormone (ACTH) secretion in mouse pituitary tumor AtT-20 cells. SSR125543A is devoid of agonist activity in these models. Its brain penetration was demonstrated in rats by using an ex vivo [(125)I-Tyr(0)] ovine CRF binding assay. SSR125543A displaced radioligand binding to the CRF(1) receptor in the brain with an ID(50) of 6.5 mg/kg p.o. (duration of action >24 h). SSR125543A also inhibited the increase in plasma ACTH levels elicited in rats by i.v. CRF (4 microg/kg) injection (ID(50) = 1, 5, or 5 mg/kg i.v., i.p., and p.o., respectively); this effect lasted for more than 6 h when the drug was given orally at a dose of 30 mg/kg. SSR125543A (10 mg/kg p.o.) reduced by 73% the increase in plasma ACTH levels elicited by a 15-min restraint stress in rats. Moreover, SSR125543A (20 mg/kg i.p.) also antagonized the increase of hippocampal acetylcholine release induced by i.c.v. injection of 1 microg of CRF in rats. Finally, SSR125543A reduced forepaw treading induced by i.c.v. injection of 1 microg of CRF in gerbils (ID(50) = approximately 10 mg/kg p.o.). Altogether, these data indicate that SSR125543A is a potent, selective, and orally active CRF(1) receptor antagonist.

  16. Cn(1), Dn(1) and A2n-1(2) reflection K-matrices

    International Nuclear Information System (INIS)

    Lima-Santos, A.; Malara, R.

    2003-01-01

    We investigate the possible regular solutions of the boundary Yang-Baxter equation for the vertex models associated with the C n (1) , D n (1) and A 2n-1 (2) affine Lie algebras. We find three types of solutions with n, n-1 and 1 free parameters, respectively. Special cases and all diagonal solutions are presented separately

  17. Glutathione S-transferase M1 and T1, CYP1A2-2467T/delT ...

    African Journals Online (AJOL)

    The present study investigated the impact of metabolic gene polymorphisms in modulating lung cancer risk susceptibility. Gene polymorphisms encoding Cytochrome 1A2 (CYP1A2) and Glutathione-S-transferases (GSTT1 and GSTM1) are involved in the bioactivation and detoxification of tobacco carcinogens and may ...

  18. Thermal, spectroscopic and magnetic properties of the Co xNi1-x(SeO3).2H2O (x = 0, 0.4, 1) phases

    International Nuclear Information System (INIS)

    Larranaga, A.; Mesa, J.L.; Pizarro, J.L.; Pena, A.; Chapman, J.P.; Arriortua, M.I.; Rojo, T.

    2005-01-01

    The Co x Ni 1-x (SeO 3 ).2H 2 O (x = 0, 0.4, 1) family of compounds has been hydrothermally synthesized under autogeneous pressure and characterized by elemental analysis, infrared and UV-vis spectroscopies and thermogravimetric and thermodiffractometric techniques. The crystal structure of Co 0.4 Ni 0.6 (SeO 3 ).2H 2 O has been solved from single-crystal X-ray diffraction data. This phase is isostructural with the M(SeO 3 ).2H 2 O (M = Co and Ni) minerals and crystallizes in the P2 1 /n space group, with a 6.4681(7), b = 8.7816(7), c = 7.5668(7) A, β = 98.927(9) deg and Z = 4. The crystal structure of this series of compounds consists of a three-dimensional framework formed by (SeO 3 ) 2- selenite oxoanions and edge-sharing M 2 O 10 dimeric octahedra in which the metallic cations are coordinated by the oxygens belonging to both the selenite groups and water molecules. The diffuse reflectance spectra show the essential characteristics of Co(II) and Ni(II) cations in slightly distorted octahedral environments. The calculated values of the Dq and Racah (B and C) parameters are those habitually found for the 3d 7 and 3d 8 cations in octahedral coordination. The magnetic measurements indicate the existence of antiferromagnetic interactions in all the compounds. The magnetic exchange pathways involve the metal orbitals from edge-sharing dimeric octahedra and the (SeO 3 ) 2- anions which are linked to the M 2 O 10 polyhedra in three dimensions

  19. HER-2 immunohistochemical expression as prognostic marker in high-grade T1 bladder cancer (T1G3

    Directory of Open Access Journals (Sweden)

    Luca Bongiovanni

    2013-06-01

    Full Text Available Objectives: To evaluate if the Human epidermal growth factor receptor 2 (HER-2 expression levels may be used as potential prognostic marker in high grade T1 blad- der cancer (T1G3 Methods: Specimens from transurethral resection of bladder tumour (TURBT of 103 patients with high-grade T1 bladder cancer were collected. This pathologic database was reviewed. Four-year follow-up data were matched with pathologic data. Eighty-three patients entered the study. HER-2 staining was performed. Patients were grouped for HER-2 status. Statistical analysis included Kaplan Meier survival analysis and Log-rank test. Results: Pathological review of TURBT specimens confirmed high-grade T1 transitional cell bladder cancer in all patients. Median follow-up was 12 months (mean 23,5; range 3-48. Twenty-one patients (25.4% present strong HER-2 expression (3+, 28 (33.7% moderate expression (2+, 26 (33.7% weak staining (1+ and 8 (9.6% negative expression (0. Thirty- one patients of 83 (37.4% had not evidence of disease, 41 (49.4% recurred, 11 (13.2% had a progression of disease. Forty-one patients had high grade T1 recurrence. Patients with HER-2 status 0 did not showed progression of disease. Patients with HER-2 status 3+, undergoing cys- tectomy because progression of disease, had a pathological stage > pT2 and a nodal involve- ment. Median Disease-Free Survival (DFS for all patients was 12 months (DFS probability (pDFS = 49.3%; 95% CI, -11.1/+10.1. Median DFS in HER-2 groups was 8 (pDFS 37.5%; 95% CI,-28.8/+29.9, 24 (pDFS 46.1%; 95% CI,-19.5/+17.5, 20 (pDFS 46.4%; 95% CI,-18.8/+16.9 and 10 months (pDFS 47.6%; 95% CI,-21.9/+19.1 respectively in HER-2 status 0,1+,2+,3+. Log-Rank test is not statistically significant (p = 0,39. Conclusions: This study showed that HER-2 expression does not represent a prognostic mark- er of recurrence/progression of disease in high-grade T1 bladder cancer.

  20. The Pressure in 2, 2+1 and 3 Flavour QCD

    CERN Document Server

    Karsch, Frithjof; Peikert, A

    2000-01-01

    We calculate the pressure in QCD with two and three light quarks on a latticeof size 16^3x4 using tree level improved gauge and fermion actions. We arguethat for temperatures T > 2T_c systematic effects due to the finite latticecut-off and non-vanishing quark masses are below 15 0n this calculation andgive an estimate for the continuum extrapolated pressure in QCD with masslessquarks. We find that the flavour dependence of the pressure is dominated bythat of the Stefan-Boltzmann constant. Furthermore we perform a calculation ofthe pressure using 2 light (m_u,d/T=0.4) and one heavier quark (m_s/T = 1). Inthis case the pressure is reduced relative to that of three flavour QCD. Thiseffect is stronger than expected from the mass dependence of an ideal Fermigas.

  1. Isopiestic investigation of the osmotic coefficients of MgBr{sub 2}(aq) and study of bromide salts solubility in the (m{sub 1}KBr + m{sub 2}MgBr{sub 2})(aq) system at T = 323.15 K. Thermodynamic model of solution behaviour and (solid + liquid) equilibria in the MgBr{sub 2}(aq), and (m{sub 1}KBr + m{sub 2}MgBr{sub 2})(aq) systems to high concentration and temperature

    Energy Technology Data Exchange (ETDEWEB)

    Christov, Christomir, E-mail: christov@svr.igic.bas.b [Institute of General and Inorganic Chemistry, Bulgarian Academy of Sciences, ul. ' Acad. G. Bonchev' , bl. 11, 1113 Sofia (Bulgaria)

    2011-03-15

    The isopiestic method has been used to determine the osmotic coefficients of the binary solutions MgBr{sub 2}(aq) (from 0.4950 to 2.5197 mol {center_dot} kg{sup -1}) at the temperature T = 323.15 K. Sodium chloride solutions have been used as isopiestic reference standards. The solubility of the bromide minerals in the mixed system (m{sub 1}KBr + m{sub 2}MgBr{sub 2})(aq) has been investigated at T = 323.15 K by the physico-chemical analysis method. In addition to simple salts {l_brace}KBr(cr) and MgBr{sub 2} . 6H{sub 2}O(cr){r_brace}, equilibrium crystallization of the highly incongruent double salt with stoichiometric composition 1:1:6 {l_brace}bromcarnallite: KBr . MgBr{sub 2} . 6H{sub 2}O(cr){r_brace} was also established. The results obtained from the isopiestic and solubility measurements have been combined with all other experimental thermodynamic quantities available in the literature (osmotic coefficients, and solubility of the bromide mineral) to construct a chemical model that calculates solute and solvent activities and (solid + liquid) equilibria in the MgBr{sub 2}(aq) binary, and (m{sub 1}KBr + m{sub 2}MgBr{sub 2})(aq) mixed systems from dilute to high solution concentration within the (273.15 to 438.15) K temperature range. The solubility modelling approach based on fundamental Pitzer specific interaction equations is employed. It was found, that the standard for 2-1 type of electrolytes approach with three ({beta}{sup (0)}, {beta}{sup (1)}, and C{sup {phi}}) single electrolyte ion interaction parameters gives excellent agreement with osmotic coefficients from T = (298.15 to 373.45) K; up to saturation at 298.15 K, and up to m(MgBr{sub 2}) = 5.83 mol {center_dot} kg{sup -1} at 373.45 K, and with MgBr{sub 2} {center_dot} 6H{sub 2}O(cr) equilibrium pure water solubility data within the (273.15 to 438.15) K temperature range and up to {approx}8.5 mol {center_dot} kg{sup -1} used in parameterization. The model for the ternary system gives very good

  2. Construction of Eu3+ Ion-Selective Electrode Based on 1,2-Diaminopropane-N,N,N',N'-tetraacetic acid

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Abedi

    2011-01-01

    Full Text Available A new Eu3+ PVC membrane electrode based on 1,2-diaminopropane-N, N,N',N'-tetraacetic acid (DAPTA as a suitable ionophore has been prepared and studied. The electrode shows a good selectivity for Eu(III ion with respect to most common cations including alkali, alkaline earth, transition and heavy metal ions. This electrode has a wide linear dynamic range from 1.0×10-6 to 1.0×10-2 M with a Nernstian slope of 19.7±0.5 mV per decade and a low detection limit of 7.2×10-7 M in the pH range of 2.5–9.1, while the response time was rapid (<10 s. The practical utility of the electrodes has been demonstratedby their use as indicator electrodes in the potentiometric titration of Eu3+ ions with EDTA and for the determination of Eu3+ in some water sample solutions.

  3. Magnetic anisotropy of cobalt nanoparticle 2D arrays grown on corrugated MnF{sub 2}(1 1 0) and CaF{sub 2}(1 1 0) surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Baranov, D.A., E-mail: dbaranov@mail.ioffe.ru [Ioffe Physical-Technical Institute, Russian Academy of Sciences, 26 Polytechnicheskaya str., St. Petersburg 194021 (Russian Federation); Krichevtsov, B.B.; Gastev, S.V.; Banschikov, A.G.; Fedorov, V.V. [Ioffe Physical-Technical Institute, Russian Academy of Sciences, 26 Polytechnicheskaya str., St. Petersburg 194021 (Russian Federation); Koshmak, K.V. [Ioffe Physical-Technical Institute, Russian Academy of Sciences, 26 Polytechnicheskaya str., St. Petersburg 194021 (Russian Federation); Dipartimento di Ingegneria dei Materiali e dell’Ambiente, Università di Modena e Reggio Emilia, Via Vignolese 905, 41100 Modena (Italy); Suturin, S.M.; Sokolov, N.S. [Ioffe Physical-Technical Institute, Russian Academy of Sciences, 26 Polytechnicheskaya str., St. Petersburg 194021 (Russian Federation)

    2013-02-15

    Cobalt nanoparticle 2D arrays with different effective thicknesses of cobalt layer (2 nm < d{sub eff} < 10 nm) were grown by molecular beam epitaxy on CaF{sub 2}(1 1 0)/Si(0 0 1) and MnF{sub 2}(1 1 0)/CaF{sub 2}(1 1 0)/Si(0 0 1) substrates with corrugated morphology of the surface. Surface morphology analysis showed that for effective thickness of cobalt layer d{sub eff} = 5 nm the lateral dimensions of cobalt islands are about 5–10 nm and the distances between the islands differs in a half along and across the grooves. In both types of the heterostructures the shape of hysteresis loops measured by LMOKE depend on orientation of in-plane magnetic field relative to the direction of the grooves. The azimuthal dependence of coercive field H{sub c} in Co/CaF{sub 2}(1 1 0)/Si(0 0 1) structures corresponds to Stoner–Wohlfarth model's predictions, which takes into account the anisotropy of individual particles. In contrast to that, in Co/MnF{sub 2}(1 1 0)/CaF{sub 2}(1 1 0)/Si(0 0 1) structures these dependences are analogous to those predicted by the model based on account of magnetic–dipole interaction between particles which are placed in chains (chain-of-spheres-model). Possible explanations of the difference in magnetic anisotropy are suggested.

  4. Magnetic phase diagram of Co(Cr1-xA lx) 2O4 (x = 0.0-1.0)

    Science.gov (United States)

    Padam, R.; Sarkar, T.; Mathieu, R.; Thota, S.; Pal, D.

    2017-08-01

    We report the role of Al substitution in the magnetic properties of spinel CoCr2O4 by means of temperature dependent dc and ac magnetization and heat capacity measurements. Various compositions (0.0 ≤ x ≤ 1.0) of polycrystalline Co(Cr1-xAlx)2O4 samples have been prepared by sol-gel processing and their crystal structure was investigated by X-ray diffraction which was found to crystallize in the normal cubic spinel structure. For x ≤ 0.1, the system exhibits multiple magnetic orderings (long range ferrimagnetic ordering TC, spin-spiral ordering TS, and lock-in transition TL), similar to that of the parent compound, CoCr2O4. However, all the compositions between x = 0.1 and 0.5 exhibit long range ferrimagnetic ordering below TC and also a short range order at low temperature. Spin-glass like ordering was noticed between x = 0.6 and 0.8 due to the diluted B-site occupancy, whereas the end compound CoAl2O4 (x = 1.0) shows antiferromagnetic behavior. On the basis of these results, we propose a magnetic phase diagram for the Co(Cr1-xAlx)2O4 series as a function of the Al content (x) and measuring temperature (T).

  5. Growth of langasite via Bridgman technique along [ 0 0 0 1], [ 2 1¯ 1¯ 0] and [ 0 1 1¯ 1] for piezoelectric applications

    Science.gov (United States)

    Uda, Satoshi; Inaba, Hitoshi; Harada, Jiro; Hoshikawa, Keigo

    2004-10-01

    2-inch langasite (La 3Ga 5SiO 14) single crystals were grown for the first time via a vertical Bridgman method, assisted by the accelerated crucible rotation technique (ACRT) along [ 0 0 0 1] ( Z-axis), [ 2 1¯ 1¯ 0] ( X-axis) and [ 0 1 1¯ 1] (54°-rotated Y-axis) for piezoelectric applications. Because of the possible liquid immiscibility, incongruency and segregation, secondary phases other than langasite are formed during growth. The mode of occurrence of these phases was closely related to the interface instability that was specific to the growth direction. The formation of inclusions consisting of lanthanum gallate (LaGaO 3), aligned parallel to ( 0 1 1¯ 0), was associated with the constitutional supercooling. The residual products during the terminal transient were the mixture of gallium oxide (Ga 2O 3) and lanthanum gallate (LaGaO 3) or the mixture of gallium oxide and lanthanum silicate (La 2Si 2O 7) reflecting the position of the initial melt, relative to the tie line connecting the langasite solid solution with gallium oxide in the system of La 2O 3-Ga 2O 3-SiO 2. The homogeneity of the grown crystal was evaluated by the distribution of SAW velocities of the devices fabricated on the ( 0 1 1¯ 0) wafer, as well as by the uniformity of d-spacing of 0 5 5¯ 5.

  6. Crystal structures of 2,2′-bipyridin-1-ium 1,1,3,3-tetracyano-2-ethoxyprop-2-en-1-ide and bis(2,2′-bipyridin-1-ium 1,1,3,3-tetracyano-2-(dicyanomethylenepropane-1,3-diide

    Directory of Open Access Journals (Sweden)

    Zouaoui Setifi

    2015-05-01

    Full Text Available In 2,2′-bipyridin-1-ium 1,1,3,3-tetracyano-2-ethoxyprop-2-en-1-ide, C10H9N2+·C9H5N4O−, (I, the ethyl group in the anion is disordered over two sets of atomic sites with occupancies 0.634 (9 and 0.366 (9, and the dihedral angle between the ring planes in the cation is 2.11 (7°. The two independent C(CN2 groups in the anion make dihedral angles of 10.60 (6 and 12.44 (4° with the central propenide unit, and the bond distances in the anion provide evidence for extensive electronic delocalization. In bis(2,2′-bipyridin-1-ium 1,1,3,3-tetracyano-2-(dicyanomethylenepropane-1,3-diide [alternative name bis(2,2′-bipyridin-1-ium tris(dicyanomethylenemethanediide], 2C10H9N2+·C10N62− (II, the dihedral angles between the ring planes in the two independent cations are 7.7 (2 and 10.92 (17°. The anion exhibits approximate C3 symmetry, consistent with extensive electronic delocalization, and the three independent C(CN2 groups make dihedral angles of 23.8 (2, 27.0 (3 and 27.4 (2° with the central plane. The ions in (I are linked by an N—H...N hydrogen bond and the resulting ion pairs are linked by two independent C—H...N hydrogen bonds, forming a ribbon containing alternating R44(18 and R44(26 rings, where both ring types are centrosymmetric. The ions in (II are linked by two independent N—H...N hydrogen bonds and the resulting ion triplets are linked by a C—H...N hydrogen bond, forming a C21(7 chain containing anions and only one type of cation, with the other cation linked to the chain by a further C—H...N hydrogen bond.

  7. Stereotactic hypofractionated radiotherapy in stage I (T1-2 N0 M0) non-small-cell lung cancer (NSCLC)

    Energy Technology Data Exchange (ETDEWEB)

    Zimmermann, Frank B.; Geinitz, Hans; Schill, Sabine; Thamm, Reinhard; Nieder, Carsten; Schratzenstaller, Ulrich; Molls, Michael [Technical Univ., Klinikum rechts der Isar, Munich (Germany). Dept. of Radiation Oncology

    2006-09-15

    Stereotactic Radiotherapy has the potential to produce high local control rates with low risk of severe lung toxicity. From December 2000 to January 2006, 68 inoperable patients (median age 76 years) with stage I NSCLC received definitive hSRT. A mean total dose of 37.5 Gy (24-40 Gy; 60%-isodose) in 3-5 fractions was applied. Immobilisation was carried out by means of a vacuum couch and low pressure foil (Medical Intelligence, Schwab Muenchen, Germany). Staging procedures were thoracic and abdominal CT-scan, FDG-PET and CT or MRI of the brain in all patients. Clinical target volume was the tumor as seen in lung windowing of CT and in FDG-PET. Organ movements (6-22 mm) and patient positioning in the couch (3-12 mm) were added as safety margin for the definition of the planning target volume (PTV), that was enclosed by the 60%-isodose. We observed four (6%) local tumor recurrences, resulting in an actuarial local tumor control rate of 96%, 88% and 88% after 1, 2 and 3 year follow-up. Nineteen patients died, with eight patients due to cancer (12%), two to local tumor progression alone. Cancer-specific survival is 96%, 82% and 73% at 1, 2 and 3 years. Eleven patients died from comorbidities, making a 53% overall 3-year survival. Fifty five percent of the patients were affected by mild acute and subacute side effects, with only 3% experiencing pneumonitis III. Late effects were pneumonitis III in 1%, rib fractures in 3%, and benign pleural effusion in 2 patients. Hypofractionated SRT is safe even in elderly patients with stage I NSCLC and significantly reduced lung capacity. It leads to high local control rates and should be offered to patients not amenable for curative resection.

  8. Defect chemistry and oxygen transport of (La0.6Sr0.4-xMx)(0.99)Co0.2Fe0.8O3-delta, M = Ca (x=0.05, 0.1), Ba (x=0.1, 0.2), Sr Part I: Defect chemistry

    DEFF Research Database (Denmark)

    Dalslet, Bjarke Thomas; Søgaard, Martin; Bouwmeester, Henry J.M.

    2009-01-01

    This paper is the first part of a two part series, where the effects of varying the A-site dopant on the defect chemistry, the diffusion coefficient and the surface catalytic properties of the materials (La0.6Sr0.4 − xMx)0.99Co0.2Fe0.8O3 − δ, M = Sr, Ca (x = 0.05, 0.1), Ba (x = 0.1, 0.2) (LSMFC......) have been investigated. In part I, the findings on the defect chemistry are reported, while the transport properties are reported in part II. Substitution of Sr2+ ions with Ca2+ ions (smaller ionic radius) and Ba2+ ions (larger ionic radius) strains the crystal structure differently for each...... composition while keeping the average valence of the cations constant. The Ba2+ containing materials show the largest oxygen loss at elevated temperatures, while the purely Sr2+ doped material showed the smallest oxygen loss. This was reflected in the partial oxidation entropy of the materials. The measured...

  9. Magnetic and transport properties of Cu1.05Cr0.89 Mg0.05O2 and Cu0.96Cr0.95 Mg0.05Mn0.04O2 films

    International Nuclear Information System (INIS)

    Xu Qingyu; Schmidt, Heidemarie; Zhou Shengqiang; Potzger, Kay; Helm, Manfred; Hochmuth, Holger; Lorenz, Michael; Meinecke, Christoph; Grundmann, Marius

    2008-01-01

    We prepared conductive, polycrystalline or amorphous Cu 1.05 Cr 0.89 Mg 0.05 O 2 films on a-plane sapphire substrates by pulsed laser deposition under different O 2 partial pressure and substrate temperature. Hall measurements were performed to study the majority carrier type in these films. Polycrystalline Cu 1.05 Cr 0.89 Mg 0.05 O 2 is n-type conducting at 290 K, while in amorphous Cu 1.05 Cr 0.89 Mg 0.05 O 2 the type of majority charge carriers changes from electrons to holes at around 270 K. Interestingly, the structure has little influence on the magnetic properties of the films. A clear antiferromagnetic to paramagnetic transition was observed in both polycrystalline and amorphous Cu 1.05 Cr 0.89 Mg 0.05 O 2 films at 25 K. Similar electrical properties to Cu 1.05 Cr 0.89 Mg 0.05 O 2 film were observed for Cu 0.96 Cr 0.95 Mg 0.05 Mn 0.04 O 2 in dependence on the structure, while only paramagnetic without antiferromagnetic ordering was observed down to 5 K. Large negative magnetoresistance of 27% at 20 K was observed at 6 T in amorphous Cu 1.05 Cr 0.89 Mg 0.05 O 2 film

  10. PGE2-induced colon cancer growth is mediated by mTORC1

    International Nuclear Information System (INIS)

    Dufour, Marc; Faes, Seraina; Dormond-Meuwly, Anne; Demartines, Nicolas; Dormond, Olivier

    2014-01-01

    Highlights: • PGE 2 activates mTORC1 in colon cancer cells. • Inhibition of mTORC1 blocks PGE 2 induced colon cancer cell growth. • mTORC1 is a signaling intermediary in PGE 2 induced colon cancer cell responses. - Abstract: The inflammatory prostaglandin E 2 (PGE 2 ) cytokine plays a key role in the development of colon cancer. Several studies have shown that PGE 2 directly induces the growth of colon cancer cells and furthermore promotes tumor angiogenesis by increasing the production of the vascular endothelial growth factor (VEGF). The signaling intermediaries implicated in these processes have however not been fully characterized. In this report, we show that the mechanistic target of rapamycin complex 1 (mTORC1) plays an important role in PGE 2 -induced colon cancer cell responses. Indeed, stimulation of LS174T cells with PGE 2 increased mTORC1 activity as observed by the augmentation of S6 ribosomal protein phosphorylation, a downstream effector of mTORC1. The PGE 2 EP 4 receptor was responsible for transducing the signal to mTORC1. Moreover, PGE 2 increased colon cancer cell proliferation as well as the growth of colon cancer cell colonies grown in matrigel and blocking mTORC1 by rapamycin or ATP-competitive inhibitors of mTOR abrogated these effects. Similarly, the inhibition of mTORC1 by downregulation of its component raptor using RNA interference blocked PGE 2 -induced LS174T cell growth. Finally, stimulation of LS174T cells with PGE 2 increased VEGF production which was also prevented by mTORC1 inhibition. Taken together, these results show that mTORC1 is an important signaling intermediary in PGE 2 mediated colon cancer cell growth and VEGF production. They further support a role for mTORC1 in inflammation induced tumor growth

  11. Elective Inguinal Node Irradiation in Early-Stage T2N0 Anal Cancer: Prognostic Impact on Locoregional Control

    Energy Technology Data Exchange (ETDEWEB)

    Zilli, Thomas, E-mail: Thomas.Zilli@hcuge.ch [Department of Radiation Oncology, Geneva University Hospital, Geneva (Switzerland); Betz, Michael [Department of Radiation Oncology, Geneva University Hospital, Geneva (Switzerland); Radiation Oncology Institute, Hirslanden Lausanne, Lausanne (Switzerland); Bieri, Sabine [Department of Radiation Oncology, Geneva University Hospital, Geneva (Switzerland); Ris, Frederic; Roche, Bruno [Department of Surgery, Geneva University Hospital, Geneva (Switzerland); Roth, Arnaud D. [Oncosurgery Unit, Geneva University Hospital, Geneva (Switzerland); Allal, Abdelkarim S. [Department of Radiation Oncology, Geneva University Hospital, Geneva (Switzerland); Department of Radiation Oncology,Hôpital Fribourgeois, Fribourg (Switzerland)

    2013-09-01

    Purpose: To evaluate the influence of elective inguinal node radiation therapy (INRT) on locoregional control (LRC) in patients with early-stage T2N0 anal cancer treated conservatively with primary RT. Methods and Materials: Between 1976 and 2008, 116 patients with T2 node-negative anal cancer were treated curatively with RT alone (n=48) or by combined chemoradiation therapy (CRT) (n=68) incorporating mitomycin C and 5-fluorouracil. Sixty-four percent of the patients (n=74) received elective INRT. Results: Over a median follow-up of 69 months (range, 4-243 months), 97 (84%) and 95 patients (82%) were locally and locoregionally controlled, respectively. Rates for 5-year actuarial local control, LRC, cancer-specific, and overall survival for the entire population were 81.7% ± 3.8%, 79.2% ± 4.1%, 91.1% ± 3.0%, and 72.1% ± 4.5%, respectively. The overall 5-year inguinal relapse-free survival was 92.3% ± 2.9%. Isolated inguinal recurrence occurred in 2 patients (4.7%) treated without INRT, whereas no groin relapse was observed in those treated with INRT. The 5-year LRC rates for patients treated with and without INRT and with RT alone versus combined CRT were 80.1% ± 5.0% versus 77.8% ± 7.0% (P=.967) and 71.0% ± 7.2% versus 85.4% ± 4.5% (P=.147), respectively. A trend toward a higher rate of grade ≥3 acute toxicity was observed in patients treated with INRT (53% vs 31%, P=.076). Conclusions: In cases of node-negative T2 anal cancer, the inguinal relapse rate remains relatively low with or without INRT. The role of INRT in the treatment of early-stage anal carcinoma needs to be investigated in future prospective trials.

  12. 5-Gb/s 0.18-{mu}m CMOS 2:1 multiplexer with integrated clock extraction

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Changchun; Wang Zhigong; Shi Si; Miao Peng [Institute of RF- and OE-ICs, Southeast University, Nanjing 210096 (China); Tian Ling, E-mail: zgwang@seu.edu.c [School of Science and Engineering, Southeast University, Nanjing 210096 (China)

    2009-09-15

    A 5-Gb/s 2:1 MUX (multiplexer) with an on-chip integrated clock extraction circuit which possesses the function of automatic phase alignment (APA), has been designed and fabricated in SMIC's 0.18 {mu}m CMOS technology. The chip area is 670 x 780 {mu}m{sup 2}. At a single supply voltage of 1.8 V, the total power consumption is 112 mW with an input sensitivity of less than 50 mV and an output single-ended swing of above 300 mV. The measurement results show that the IC can work reliably at any input data rate between 1.8 and 2.6 Gb/s with no need for external components, reference clock, or phase alignment between data and clock. It can be used in a parallel optic-fiber data interconnecting system.

  13. 5-Gb/s 0.18-μm CMOS 2:1 multiplexer with integrated clock extraction

    International Nuclear Information System (INIS)

    Zhang Changchun; Wang Zhigong; Shi Si; Miao Peng; Tian Ling

    2009-01-01

    A 5-Gb/s 2:1 MUX (multiplexer) with an on-chip integrated clock extraction circuit which possesses the function of automatic phase alignment (APA), has been designed and fabricated in SMIC's 0.18 μm CMOS technology. The chip area is 670 x 780 μm 2 . At a single supply voltage of 1.8 V, the total power consumption is 112 mW with an input sensitivity of less than 50 mV and an output single-ended swing of above 300 mV. The measurement results show that the IC can work reliably at any input data rate between 1.8 and 2.6 Gb/s with no need for external components, reference clock, or phase alignment between data and clock. It can be used in a parallel optic-fiber data interconnecting system.

  14. 5-Gb/s 0.18-μm CMOS 2:1 multiplexer with integrated clock extraction

    Science.gov (United States)

    Changchun, Zhang; Zhigong, Wang; Si, Shi; Peng, Miao; Ling, Tian

    2009-09-01

    A 5-Gb/s 2:1 MUX (multiplexer) with an on-chip integrated clock extraction circuit which possesses the function of automatic phase alignment (APA), has been designed and fabricated in SMIC's 0.18 μm CMOS technology. The chip area is 670 × 780 μm2. At a single supply voltage of 1.8 V, the total power consumption is 112 mW with an input sensitivity of less than 50 mV and an output single-ended swing of above 300 mV. The measurement results show that the IC can work reliably at any input data rate between 1.8 and 2.6 Gb/s with no need for external components, reference clock, or phase alignment between data and clock. It can be used in a parallel optic-fiber data interconnecting system.

  15. Funtional MRI of cerebral motor cortex: comparison between 1.0 T and 1.5 T

    International Nuclear Information System (INIS)

    Jang, Hyun Jung; Yu, In Kyu; Song, In Chan; Han, Moon Hee; Lee, Heung Kyu; Chang, Kee Hyun

    1997-01-01

    To evaluate the feasibility of functional MR imaging(fMRI) with a 1.0 T scanner, fMRI of normal cerebral motor cortex at 1.0 T was compared with that at 1.5 T. FMRI of bilateral cerebral motor cortices (left, seven; right, six) was performed in seven healthy male volunteers aged 26-34 (mean 29) years,with BOLD contrast at both 1.0 T and 1.5 T units(Siemens MR scanners). Using both these systems,two-dimensional(2D) FLASH images were obtained with TR/TE of 90/56, flip angle of 40 deg, matrix size 128 * 128, slice thickness of 5mm, and FOV 23cm. A sequence consisting of five-image-off phase(rest phase) followed by five-image-on phase(activation with finger movement) was repeated four times without pause at a single plane. The same study was perfomed for the contralateral motor cortex in each volunteer. Using the z-test, activation images were obtained for the signal difference between on-and off-phases (p<0.05) and were then superimposed on 2D FLASH anatomic images at the same plane. Percentage changes of signal intensities(PCSIs) and numbers of activated pixels were compared, using the non-paramatric t-test, and periodicity of signal changes was compared, using the Mentel-Haenszel Chi-square test. Mean PCSIs at 1.5 T and 1.0 T in the left motor cortex were 3.13 ±1.20% and 1.43±0.56%, respectively(p=0.009),and in the right, 1.78±0.95% and 1.34±0.28%, respectively(p=0.32). The mean number of activated pixels at 1.5 T and 1.0 T in the left cortex was 21.14±10.67 and 19.86±11.36, respectively (p=0.83), and in the right, 22.5±6.47 and 16.8±8.47, respectively (p=0.22). At 1.5 T, periodicity of signal changes was seen in the left cortex in six of seven volunteers, and in the right cortex, in four of six. At 1.0 T, all showed periodicity (left:p=0.32;right:p=0.14). PCSIs in the dominant hemispheres were significantly higher at 1.5 T, but no other indicators showed significant differences between 1.0 T and 1.5 T. Acceptable fMRI can therefore be carried out with a 1.0

  16. Influence of Zr substitution on the stabilization of ThMn12-type (Nd1−αZrα(Fe0.75Co0.2511.25Ti0.75N1.21.4 (α = 00.3 compounds

    Directory of Open Access Journals (Sweden)

    N. Sakuma

    2016-05-01

    Full Text Available The influence of Zr substitution in ThMn12 compounds was investigated using strip casting alloys. It was found that Zr substitution stabilized (Nd1−αZrα(Fe0.75Co0.2511.25Ti0.75N1.21.4 (α = 00.3 compounds. Specifically, a reduction in the lattice constant along the a-axis was observed. Energy-dispersive X-ray spectroscopy mapping combined with Cs-corrected scanning transmission electron microscopy indicated that Zr atoms preferentially occupied Nd 2a sites. Both the magnetic anisotropy field and saturation polarization were maximum at Zr substitution ratio α = 0.1. The (Nd1−αZrα(Fe0.75Co0.2511.25Ti0.75N1.21.4 (α = 00.3 compounds displayed higher saturation polarization than Nd2Fe14B at high temperatures.

  17. Prospective Trial of Stereotactic Body Radiation Therapy for Both Operable and Inoperable T1N0M0 Non-Small Cell Lung Cancer: Japan Clinical Oncology Group Study JCOG0403

    Energy Technology Data Exchange (ETDEWEB)

    Nagata, Yasushi, E-mail: nagat@hiroshima-u.ac.jp [Department of Radiation Oncology, Hiroshima University, Hiroshima (Japan); Hiraoka, Masahiro [Department of Radiation Oncology and Image-Applied Therapy, Kyoto University, Kyoto (Japan); Shibata, Taro [Japan Clinical Oncology Group Data Center, Center for Research Administration and Support, National Cancer Center, Tokyo (Japan); Onishi, Hiroshi [Department of Radiology, University of Yamanashi, Chuo (Japan); Kokubo, Masaki [Department of Image-Based Medicine, Institute of Biomedical Research and Innovation, Kobe (Japan); Karasawa, Katsuyuki [Department of Radiation Oncology, Tokyo Metropolitan Komagome Hospital, Tokyo (Japan); Shioyama, Yoshiyuki [Department of Clinical Radiology, Kyushu University, Fukuoka (Japan); Onimaru, Rikiya [Department of Radiology, Hokkaido University, Sapporo (Japan); Kozuka, Takuyo [Department of Radiation Oncology, The Cancer Institute Hospital, Tokyo (Japan); Kunieda, Etsuo [Department of Radiation Oncology, Keio University, Tokyo (Japan); Saito, Tsutomu [Department of Radiology, Nihon University Itabashi Hospital, Tokyo (Japan); Nakagawa, Keiichi [Department of Radiology, The University of Tokyo Hospital, Tokyo (Japan); Hareyama, Masato [Department of Radiology, Sapporo Medical University, Sapporo (Japan); Takai, Yoshihiro [Department of Radiation Oncology, Tohoku University, Sendai (Japan); Hayakawa, Kazushige [Department of Radiology and Radiation Oncology, Kitasato University, Sagamihara (Japan); Mitsuhashi, Norio [Department of Radiation Oncology, Tokyo Women' s Medical University, Tokyo (Japan); Ishikura, Satoshi [Department of Radiology, Koshigaya Municipal Hospital, Koshigaya (Japan)

    2015-12-01

    Purpose: To evaluate, in Japan Clinical Oncology Group study 0403, the safety and efficacy of stereotactic body radiation therapy (SBRT) in patients with T1N0M0 non-small cell lung cancer (NSCLC). Methods and Materials: Eligibility criteria included histologically or cytologically proven NSCLC, clinical T1N0M0. Prescribed dose was 48 Gy at the isocenter in 4 fractions. The primary endpoint was the percent (%) 3-year overall survival. The threshold % 3-year survival to be rejected was set at 35% for inoperable patients, whereas the expected % 3-year survival was 80% for operable patients. Results: Between July 2004 and November 2008, 169 patients from 15 institutions were registered. One hundred inoperable and 64 operable patients (total 164) were eligible. Patients' characteristics were 122 male, 47 female; median age 78 years (range, 50-91 years); adenocarcinomas, 90; squamous cell carcinomas, 61; others, 18. Of the 100 inoperable patients, the % 3-year OS was 59.9% (95% confidence interval 49.6%-68.8%). Grade 3 and 4 toxicities were observed in 10 and 2 patients, respectively. No grade 5 toxicity was observed. Of the 64 operable patients, the % 3-year OS was 76.5% (95% confidence interval 64.0%-85.1%). Grade 3 toxicities were observed in 5 patients. No grade 4 and 5 toxicities were observed. Conclusions: Stereotactic body radiation therapy for stage I NSCLC is effective, with low incidences of severe toxicity. This treatment can be considered a standard treatment for inoperable stage I NSCLC. This treatment is promising as an alternative to surgery for operable stage I NSCLC.

  18. Prospective Trial of Stereotactic Body Radiation Therapy for Both Operable and Inoperable T1N0M0 Non-Small Cell Lung Cancer: Japan Clinical Oncology Group Study JCOG0403

    International Nuclear Information System (INIS)

    Nagata, Yasushi; Hiraoka, Masahiro; Shibata, Taro; Onishi, Hiroshi; Kokubo, Masaki; Karasawa, Katsuyuki; Shioyama, Yoshiyuki; Onimaru, Rikiya; Kozuka, Takuyo; Kunieda, Etsuo; Saito, Tsutomu; Nakagawa, Keiichi; Hareyama, Masato; Takai, Yoshihiro; Hayakawa, Kazushige; Mitsuhashi, Norio; Ishikura, Satoshi

    2015-01-01

    Purpose: To evaluate, in Japan Clinical Oncology Group study 0403, the safety and efficacy of stereotactic body radiation therapy (SBRT) in patients with T1N0M0 non-small cell lung cancer (NSCLC). Methods and Materials: Eligibility criteria included histologically or cytologically proven NSCLC, clinical T1N0M0. Prescribed dose was 48 Gy at the isocenter in 4 fractions. The primary endpoint was the percent (%) 3-year overall survival. The threshold % 3-year survival to be rejected was set at 35% for inoperable patients, whereas the expected % 3-year survival was 80% for operable patients. Results: Between July 2004 and November 2008, 169 patients from 15 institutions were registered. One hundred inoperable and 64 operable patients (total 164) were eligible. Patients' characteristics were 122 male, 47 female; median age 78 years (range, 50-91 years); adenocarcinomas, 90; squamous cell carcinomas, 61; others, 18. Of the 100 inoperable patients, the % 3-year OS was 59.9% (95% confidence interval 49.6%-68.8%). Grade 3 and 4 toxicities were observed in 10 and 2 patients, respectively. No grade 5 toxicity was observed. Of the 64 operable patients, the % 3-year OS was 76.5% (95% confidence interval 64.0%-85.1%). Grade 3 toxicities were observed in 5 patients. No grade 4 and 5 toxicities were observed. Conclusions: Stereotactic body radiation therapy for stage I NSCLC is effective, with low incidences of severe toxicity. This treatment can be considered a standard treatment for inoperable stage I NSCLC. This treatment is promising as an alternative to surgery for operable stage I NSCLC.

  19. Two S-wave gap symmetry for single crystals of the superconductor BaFe1.8Co0.2As2

    International Nuclear Information System (INIS)

    Choi, Ki-Young; Kim, Soo Hyun; Choi, Changho; Jung, Myung-Hwa; Wang, X.F.; Chen, X.H.; Noh, Jae Dong; Lee, Sung-IK

    2010-01-01

    To clarify the gap structure of the iron-pnictide superconductors, we synthesized optimally doped single crystals of BaFe 1.8 Co 0.2 As 2 , which had a critical temperature, T c , of 23.6 K. The initial M-H curve was used to find the lower critical field, H c1 . The full range of the temperature dependence of H c1 was explained by using a two S-wave gap symmetry. We estimate the two gap as Δ 1 (0) = 1.64 ± 0.2 meV for the small gap and Δ 2 (0) = 6.20 ± 0.2 meV for the large gap.

  20. Characterization of quasi-one-dimensional S=1/2 Heisenberg antiferromagnets Sr2Cu(PO4)2 and Ba2Cu(PO4)2 with magnetic susceptibility, specific heat, and thermal analysis

    International Nuclear Information System (INIS)

    Belik, A.A.; Azuma, M.; Takano, M.

    2004-01-01

    Properties of Sr 2 Cu(PO 4 ) 2 and Ba 2 Cu(PO 4 ) 2 having [Cu(PO 4 ) 2 ] ∞ linear chains in their structures with Cu-O-P-O-Cu linkages were studied by magnetic susceptibility (T=2-400 K, H=100 Oe) and specific heat measurements (T=0.45-21 K). Magnetic susceptibility versus temperature curves, χ(T), showed broad maxima at T M =92 K for Sr 2 Cu(PO 4 ) 2 and T M =82 K for Ba 2 Cu(PO 4 ) 2 characteristic of quasi-one-dimensional systems. The χ(T) data were excellently fitted by the spin susceptibility curve for the uniform S=1/2 chain (plus temperature-independent and Curie-Weiss terms) with g=2.153(4) and J/k B =143.6(2) K for Sr 2 Cu(PO 4 ) 2 and g=2.073(4) and J/k B =132.16(9) K for Ba 2 Cu(PO 4 ) 2 (Hamiltonian H=JΣS i S i+1 ). The similar J/k B values were obtained from the specific heat data. No anomaly was observed on the specific heat from 0.45 to 21 K for both compounds indicating that the temperatures of long-range magnetic ordering, T N , were below 0.45 K. Sr 2 Cu(PO 4 ) 2 and Ba 2 Cu(PO 4 ) 2 are an excellent physical realization of the S=1/2 linear chain Heisenberg antiferromagnet with k B T N /J 2 CuO 3 (k B T N /J∼0.25%) and γ-LiV 2 O 5 (k B T N /J 2 Cu(PO 4 ) 2 and Ba 2 Cu(PO 4 ) 2 were stable in air up to 1280 and 1150 K, respectively

  1. Spin reorientation and magnetoelastic properties of ferromagnetic T b1 -xN dxC o2 systems with a morphotropic phase boundary

    Science.gov (United States)

    Murtaza, Adil; Yang, Sen; Chang, Tieyan; Ghani, Awais; Khan, Muhammad Tahir; Zhang, Rui; Zhou, Chao; Song, Xiaoping; Suchomel, Matthew; Ren, Yang

    2018-03-01

    The spin reorientation (SR) and magnetoelastic properties of pseudobinary ferromagnetic T b1 -xN dxC o2 (0 ≤x ≤1.0 ) systems involving a morphotropic phase boundary (MPB) were studied by high-resolution synchrotron x-ray diffraction (XRD), magnetization, and magnetostriction measurements. The easy magnetization direction of the Laves phase lies along the 〈111 〉 axis with x 0.65 below Curie temperature (TC). The temperature-dependent magnetization curves showed SR; this can be explained by a two-sublattice model. Based on the synchrotron (XRD) and magnetization measurements, the SR phase diagram for a MPB composition of T b0.35N d0.65C o2 was obtained. Contrary to previously reported ferromagnetic systems involving MPB, the MPB composition of T b0.35N d0.65C o2 exhibits a low saturation magnetization (MS), indicating a compensation of the Tb and Nd magnetic moments at MPB. The anisotropic magnetostriction (λS) first decreased until x =0.8 and then continuously increased in the negative direction with further increase of Nd concentration. The decrease in magnetostriction can be attributed to the decrease of spontaneous magnetostriction λ111 and increase of λ100 with opposite sign to λ111. This paper indicates an anomalous type of MPB in the ferromagnetic T b1 -xN dxC o2 system and provides an active way to design novel functional materials with exotic properties.

  2. Oxidative Addition Reactions of I2 with [HIr4(CO10-n(PPh3 n(m-PPh2] (n = 1 and 2 and Crystal and Molecular Structure of [HIr4(m-I2(CO7 (PPh3(m-PPh2

    Directory of Open Access Journals (Sweden)

    Braga Dario

    2002-01-01

    Full Text Available The reactions of the cluster compounds [HIr4(CO10-n(PPh3 n(mu-PPh2] [n = 0, (1; 1, (2 and 2, (3] with I2 have been investigated. Compound 1 does not react, however, the presence of PPh3 in place of CO ligand(s activates the cluster. Both compounds 2 and 3 react with I2 under mild conditions to give [HIr4(mu-I2(CO7(PPh3(mu-PPh 2] (4, as the result of oxidative addition of I2 and dissociation of two CO ligands, or one CO and one PPh3 ligands, respectively. The molecular structure of 4, determined by an X-ray diffraction study, exhibits a butterfly arrangement of iridium atoms with the wings spanned by a mu-PPh2 ligand, the hinge bridged by a mu-H ligand, two hinge to wing tip edges bridged by iodine atoms and all metal atoms bearing two CO ligands, with the exception of one of the hinge atoms that contains a CO and a PPh3 ligands. This cluster exhibits the shortest average Irfraction three-quartersIr bond length [2.698(2 Å] observed so far for a derivative of 1 and this is in accord with the relatively high average oxidation state of its metal atoms (+1 for a carbonyl cluster compound.

  3. CD4+/CD8+ T lymphocytes imbalance in children with severe 2009 pandemic influenza A (H1N1 pneumonia

    Directory of Open Access Journals (Sweden)

    Ji Eun Kim

    2011-05-01

    Full Text Available Purpose : This study was conducted to investigate the immune responses of children with moderate and severe novel influenza A virus (H1N1 pneumonia, and to compare their clinical and immunological findings with those of control subjects. Methods : Thirty-two admitted patients with H1N1 pneumonia were enrolled in the study. The clinical profiles, humoral and cell-mediated immune responses of the 16 H1N1 pneumonia patients who were admitted to the pediatric intensive care unit (severe pneumonia group, 16 H1N1 pneumonia patients admitted to the pediatric general ward (moderate pneumonia group and 13 control subjects (control group were measured. Results : Total lymphocyte counts were significantly lower in patients with H1N1 pneumonia than in the control group (P=0.02. The number of CD4+ T lymphocytes was significantly lower in the severe pneumonia group (411.5±253.5/μL than in the moderate pneumonia (644.9±291.1/μL, P=0.04 and control (902.5±461.2/μL, P=0.01 groups. However, the number of CD8+ T lymphocytes was significantly higher in the severe pneumonia group (684.2±420.8/μL than in the moderate pneumonia (319.7±176.6/μL, P=0.02 and control (407.2±309.3/μL, P=0.03 groups. The CD4+/CD8+ T lymphocytes ratio was significantly lower in the severe pneumonia group (0.86±0.24 than in the moderate pneumonia (1.57±0.41, P=0.01 and control (1.61±0.49, P=0.01 groups. The serum levels of immunoglobulin G, immunoglobulin M and immunoglobulin E were significantly higher in the severe pneumonia group than in the 2 other groups. Conclusion : The results of this study suggest that increased humoral immune responses and the differences in the CD4+ and CD8+ T lymphocyte profiles, and imbalance of their ratios may be related to the severity of H1N1 pneumonia in children.

  4. T1 and T2 relaxivity of intracellular and extracellular USPIO at 1.5T and 3T clinical MR scanning

    International Nuclear Information System (INIS)

    Simon, Gerhard H.; Bauer, Jan; Saborovski, Olaf; Fu, Yanjun; Wendland, Michael F.; Daldrup-Link, Heike E.; Corot, Claire

    2006-01-01

    In this study we evaluated the effects of intracellular compartmentalization of the ultrasmall superparamagnetic iron oxide (USPIO) ferumoxtran-10 on its proton T1 and T2 relaxivities at 1.5 and 3T. Monocytes were labeled with ferumoxtran-10 by simple incubation. Decreasing quantities of ferumoxtran-10-labeled cells (2.5 x 10 7 -0.3 x 10 7 cells/ml) and decreasing concentrations of free ferumoxtran-10 (without cells) in Ficoll solution were evaluated with 1.5 and 3T clinical magnetic resonance (MR) scanners. Pulse sequences comprised axial spin echo (SE) sequences with multiple TRs and fixed TE and SE sequences with fixed TR and increasing TEs. Signal intensity measurements were used to calculate T1 and T2 relaxation times of all samples, assuming a monoexponential signal decay. The iron content in all samples was determined by inductively coupled plasma atomic emission spectrometry and used for calculating relaxivities. Measurements at 1.5T and 3T showed higher T1 and T2 relaxivity values of free extracellular ferumoxtran-10 as opposed to intracellularly compartmentalized ferumoxtran-10, under the evaluated conditions of homogeneously dispersed contrast agents/cells in Ficoll solution and a cell density of up to 2.5 x 10 7 cells/ml. At 3T, differences in T1-relaxivities between intra- and extracellular USPIO were smaller, while differences in USPIO T2-relaxivities were similar compared with 1.5T. In conclusion, cellular compartmentalization of ferumoxtran-10 changes proton relaxivity. (orig.)

  5. mer-Bis[3,5-difluoro-2-(2-pyridylphenyl-κ2C1,N]{5-(2-pyridyl-κN-3-[3-(4-vinylbenzyloxyphenyl]-1,2,4-triazol-1-ido}iridium(III methanol solvate

    Directory of Open Access Journals (Sweden)

    Peter G. Jones

    2010-01-01

    Full Text Available In the title compound, [Ir(C11H6F2N2(C22H17N4O]·CH3OH, the coordination at iridium is essentially octahedral, but with distortions associated with the bite angles of the ligands [76.25 (9–80.71 (12°] and the differing trans influences of C and N ligands [Ir—N = 2.04 Å (average trans to N but 2.14 Å trans to C]. All three bidentate ligands have coordinating ring systems that are almost coplanar [interplanar angles = 1.7 (1–3.8 (2°]. The vinylbenzyl group is disordered over two positions with occupations of 0.653 (4 and 0.347 (4. The methanol solvent molecule is involved in a classical O—H...N hydrogen bond to a triazole N atom.

  6. Synthesis, structure, luminescent, and magnetic properties of carbonato-bridged Zn(II)2Ln(III)2 complexes [(μ4-CO3)2{Zn(II)L(n)Ln(III)(NO3)}2] (Ln(III) = Gd(III), Tb(III), Dy(III); L(1) = N,N'-bis(3-methoxy-2-oxybenzylidene)-1,3-propanediaminato, L(2) = N,N'-bis(3-ethoxy-2-oxybenzylidene)-1,3-propanediaminato).

    Science.gov (United States)

    Ehama, Kiyomi; Ohmichi, Yusuke; Sakamoto, Soichiro; Fujinami, Takeshi; Matsumoto, Naohide; Mochida, Naotaka; Ishida, Takayuki; Sunatsuki, Yukinari; Tsuchimoto, Masanobu; Re, Nazzareno

    2013-11-04

    Carbonato-bridged Zn(II)2Ln(III)2 complexes [(μ4-CO3)2{Zn(II)L(n)Ln(III)(NO3)}2]·solvent were synthesized through atmospheric CO2 fixation reaction of [Zn(II)L(n)(H2O)2]·xH2O, Ln(III)(NO3)3·6H2O, and triethylamine, where Ln(III) = Gd(III), Tb(III), Dy(III); L(1) = N,N'-bis(3-methoxy-2-oxybenzylidene)-1,3-propanediaminato, L(2) = N,N'-bis(3-ethoxy-2-oxybenzylidene)-1,3-propanediaminato. Each Zn(II)2Ln(III)2 structure possessing an inversion center can be described as two di-μ-phenoxo-bridged {Zn(II)L(n)Ln(III)(NO3)} binuclear units bridged by two carbonato CO3(2-) ions. The Zn(II) ion has square pyramidal coordination geometry with N2O2 donor atoms of L(n) and one oxygen atom of a bridging carbonato ion at the axial site. Ln(III) ion is coordinated by nine oxygen atoms consisting of four from the deprotonated Schiff-base L(n), two from a chelating nitrate, and three from two carbonate groups. The temperature-dependent magnetic susceptibilities in the range 1.9-300 K, field-dependent magnetization from 0 to 5 T at 1.9 K, and alternating current magnetic susceptibilities under the direct current bias fields of 0 and 1000 Oe were measured. The magnetic properties of the Zn(II)2Ln(III)2 complexes are analyzed on the basis of the dicarbonato-bridged binuclear Ln(III)-Ln(III) structure, as the Zn(II) ion with d(10) electronic configuration is diamagnetic. ZnGd1 (L(1)) and ZnGd2 (L(2)) show a ferromagnetic Gd(III)-Gd(III) interaction with J(Gd-Gd) = +0.042 and +0.028 cm(-1), respectively, on the basis of the Hamiltonian H = -2J(Gd-Gd)ŜGd1·ŜGd2. The magnetic data of the Zn(II)2Ln(III)2 complexes (Ln(III) = Tb(III), Dy(III)) were analyzed by a spin Hamiltonian including the crystal field effect on the Ln(III) ions and the Ln(III)-Ln(III) magnetic interaction. The Stark splitting of the ground state was so evaluated, and the energy pattern indicates a strong easy axis (Ising type) anisotropy. Luminescence spectra of Zn(II)2Tb(III)2 complexes were observed, while those

  7. Stability Constants of Mixed Ligand Complexes of Transition Metal(II Ions with N-(2-Hydroxy-1-naphthylidene-2,6-diisopropylaniline as Primary Ligand and N-(2-Hydroxybenzylidene-2,3-dimethylaniline as Secondary Ligand

    Directory of Open Access Journals (Sweden)

    A. K. Mapari

    2011-01-01

    Full Text Available Binary and ternary complexes of the type M-Y and M-X-Y [M = Co(II, Ni(II, Cu(II and Zn(II; X = N-(2-hydroxy-1-naphthylidene-2,6-diisopropylaniline and Y = N-(2-hydroxybenzylidene-2,3-dimethylaniline] have been examined pH-metrically at 27±0.5 °C and µ = 0.1 M in 75: 25% (v/v 1,4-dioxne-water medium. The logarithms of the values of stability constants for binary (M-Y and for ternary (M-X-Y systems were calculated.

  8. Insights from investigating the interactions of adamantane-based drugs with the M2 proton channel from the H1N1 swine virus

    International Nuclear Information System (INIS)

    Wang, Jing-Fang; Wei, Dong-Qing; Chou, Kuo-Chen

    2009-01-01

    The M2 proton channel is one of indispensable components for the influenza A virus that plays a vital role in its life cycle and hence is an important target for drug design against the virus. In view of this, the three-dimensional structure of the H1N1-M2 channel was developed based on the primary sequence taken from a patient recently infected by the H1N1 (swine flu) virus. With an explicit water-membrane environment, molecular docking studies were performed for amantadine and rimantadine, the two commercial drugs generally used to treat influenza A infection. It was found that their binding affinity to the H1N1-M2 channel is significantly lower than that to the H5N1-M2 channel, fully consistent with the recent report that the H1N1 swine virus was resistant to the two drugs. The findings and the relevant analysis reported here might provide useful structural insights for developing effective drugs against the new swine flu virus.

  9. Data of evolutionary structure change: 1AIFH-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available > 0 n> 1AIF n>H ...n>1AIFHn> VAHPA-SSTKV n> 2AI0 n>K 2AI...1AIFH-2AI0K 1AIF 2AI0 H K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  10. Contribution to the study of πN → π1π2N reactions with creation of an intermediate N*3/2(1236) isobar from 0.4 to 1.5 GeV

    International Nuclear Information System (INIS)

    Merlo, J.P.

    1976-01-01

    The one pion production reaction π + p → π + pπ 0 has been studied up to 1.5 GeV. The π 0 angular distribution measured by counter techniques has been compared to bubble chamber data. Angular distributions are interpreted in the hypothesis of formation of the intermediate N * 3/2 (1236) isobar. Angular distributions for isobar production and decay in one pion production reactions πN → π 1 N * (N * → π 2 N], are calculated in chapter II. π + p → π + pπ 0 experimental results are reported and analyzed in chapter III. An estimation of the pion-isobar partial wave amplitudes in reaction π + p → π 0 N *++ 3/2 (1236) has been tempted. Comparison with π + p phase shift analyses is made. Bubble chamber data for π - p → π - π + n channel are presented at the end of chapter III. (author) [fr

  11. Data of evolutionary structure change: 1AIFB-2AI0K [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ignment> 0 n> 1AIF n>B 1AI... CA 272 n> 2AI0 n>K ...n>2AI0Kn> VAHPASSTKVD EEE EEEE...1AIFB-2AI0K 1AIF 2AI0 B K EVKLQESGGGLVQPGGSMKLSCVASGFTFNNYWMSWVRQ...SCAASGFTFRNYGMSWVRQTPEKRLEWVAAIS--GNSLYTSYPDSVKGRFTISRDNAKNNLYLQMSSLRSEDTALYFCARH

  12. Magnetic properties and magnetocaloric effects in Mn1.2Fe0.8P1-xGex compounds

    International Nuclear Information System (INIS)

    Ou, Z Q; Wang, G F; Lin Song; Tegus, O; Brueck, E; Buschow, K H J

    2006-01-01

    We have studied the magnetic properties and magnetocaloric effects in the Mn 1.2 Fe 0.8 P 1-x Ge x compounds with x = 0.2, 0.22, 0.3, 0.4 and 0.5. X-ray diffraction patterns show that the Mn 1.2 Fe 0.8 P 1-x Ge x compounds crystallize in the hexagonal Fe 2 P-type crystal structure. The magnetic moments of the Mn 1.2 Fe 0.8 P 1-x Ge x compounds measured at 5 K and 5 T increase with increasing Ge content. The Curie temperature increases strongly and the magnetic entropy change has a maximum around 233 K for the compound with x = 0.22, which is about 19 and 31 J kg -1 K -1 for a field change of 2 and 5 T, respectively

  13. T2 laryngeal cancer study in our department

    International Nuclear Information System (INIS)

    Ikenoya, Yoichi; Shimane, Toshikazu; Kobayashi, Sei

    2011-01-01

    Laryngeal cancer is the most common malignant tumor in the head and neck region. Because early detection and treatment are possible, outcomes are relatively good. Many studies have reported on the treatment of laryngeal cancer. Different hospitals have used generally similar treatment regimens. However, factors such as laryngeal preservation and the treatment of choice for patients with T2 laryngeal cancer still differ among hospitals. Survival rates can be increased depending on treatment, sometimes at the cost of losing voice functions that could have been preserved. In our department, we have emphasized curative treatment and the preservation of organs and functions. We have mainly used chemoradiotherapy concurrently with S-1 and nedaplatin for the treatment of T2 laryngeal cancer. We studied 27 patients (23 men and 4 women) with T2 laryngeal cancer, who received first-line therapy in our department from April 2005 through March 2010. Their mean age was 64.1 years (range, 42 to 80). The mean follow-up period was 30.6 months (range, 2 to 60 months). The tumor-node-metastasis classification was T2N0M0 in 24 patients, T2N1M0 in 1, and T2N2bM0 in 2.In our department, the disease-specific survival rate was 96.3%. The complete response rate was 88.9%, and the laryngeal preservation rate was 92.6%. (author)

  14. Structural, magnetic and magnetocaloric properties of AMn{sub 1-x}Ga{sub x}O{sub 3} compounds with 0{<=}x{<=}0.2

    Energy Technology Data Exchange (ETDEWEB)

    Omri, A., E-mail: omriaref@yahoo.fr [Laboratoire de Physique Appliquee, Faculte des Sciences de Sfax, Universite de Sfax, BP 1171, Sfax 3000 (Tunisia); Bejar, M. [Laboratoire de Physique Appliquee, Faculte des Sciences de Sfax, Universite de Sfax, BP 1171, Sfax 3000 (Tunisia); Sajieddine, M. [Laboratoire de Physique et Mecanique des Materiaux, Faculte des Sciences et Techniques, BP 523, 23000, Beni-Mellal-Universite Sultan Moulay Sliman, Maroc (Morocco); Dhahri, E. [Laboratoire de Physique Appliquee, Faculte des Sciences de Sfax, Universite de Sfax, BP 1171, Sfax 3000 (Tunisia); Hlil, E.K. [Institut Neel, CNRS-Universite J. Fourier, BP 166, 38042 Grenoble (France); Es-Souni, M. [University of Applied Sciences, Institute for Materials and Surface Technology, Grenzstrasse 3, Kiel (Germany)

    2012-07-01

    Structural, magnetic and magnetocaloric properties of manganites series with the AMn{sub 1-x}Ga{sub x}O{sub 3} (A=La{sub 0.75}Ca{sub 0.08}Sr{sub 0.17} and x=0, 0.05, 0.1 and 0.2) composition have been investigated to shed light on Ga-doping influence. Solid-state reaction method was used for preparation. From XRD study, all samples are found single phase and crystallize in the orthorhombic structure with the Pnma space group. The variation of the magnetization M vs. temperature T, under an applied magnetic field of 0.05 T, reveals a ferromagnetic-paramagnetic transition for all samples. The experimental results indicate that T{sub C} decreases from 336 to 135 K with increasing Ga substitution. Magnetocaloric effect (MCE) was estimated, in terms of isothermal magnetic entropy change (-{Delta}S{sub M}), using the M(T, {mu}{sub 0}H) data and employing the thermodynamic Maxwell equation. The maximum entropy change and Relative Cooling Power (RCP) show non-monotonic behaviors with increasing the concentration of Gallium. In fact, the maximum value of {Delta}S{sub Mmax}of AMn{sub 1-x}Ga{sub x}O{sub 3} for x=0.00 and 0.2 samples is found to be, respectively, 2.87 and 1.17 J/kg/K under an applied magnetic field change of 2 T. For the same applied magnetic field ({mu}{sub 0}H=2 T), the RCP values are found to vary between 97.58 and 89 J/kg.

  15. Thermal expansion and magnetostriction in Pr(n+2)(n+1)Nin(n-1)+2Sin(n+1) compounds

    International Nuclear Information System (INIS)

    Jiles, D.C.; Song, S.H.; Snyder, J.E.; Pecharsky, V.K.; Lograsso, T.A.; Wu, D.; Pecharsky, A.O.; Mudryk, Ya.; Dennis, K.W.; McCallum, R.W.

    2006-01-01

    Thermal expansion and magnetostriction of members of a homologous series of compounds based on the alloy series Pr (n+2)(n+1) Ni n(n-1)+2 Si n(n+1) have been measured. The crystal structures of these compounds are closely interrelated because they form trigonal prismatic columns in which the number of trigonal prisms that form the base of the trigonal columns is determined by the value of n in the chemical formula. Two compositions were investigated, Pr 5 Ni 2 Si 3 and Pr 15 Ni 7 Si 10 , corresponding to n=3 and n=4, respectively. The results were analyzed and used to determine the location of magnetic phase transitions by calculating the magnetic contribution to thermal expansion using the Gruneisen-Debye theory. This allowed more precise determination of the magnetic transition temperatures than could be achieved using the total thermal expansion. The results show two phase transitions in each material, one corresponding to the Curie temperature and the other at a lower temperature exhibiting characteristics of a spin reorientation transition

  16. A study of analysis PB1-F2 protein of Influenza Viruses A/H1N1pdm09, A/ H3N2, and A/H5N1

    Directory of Open Access Journals (Sweden)

    Hana Apsari Pawestri

    2016-07-01

    Full Text Available Abstrak Tujuan. Protein PB1-F2 (polymerase basic 1-frame 2 adalah protein terbaru yang ditemukan pada virus Influenza dan telah terbukti berperan dalam induksi kematian sel dan patogenitas. Tujuan dari tulisan ini adalah untuk menganalisis protein PB1-F2 pada virus Influenza A/H5N1 dan A/H1N1pdm09. Metode. Kami melakukan pencarian data yang relevan yaitu sekuens gen virus Influenza A/H5N1 dan A/H1N1pdm09 dari Gen Bank National Center for Biotechnology Information (NCBI selama tahun 1997-2015. Data yang digunakan adalah data sekuens nukleotida gen PB1 (polymerase basic1 virus influenza A/H5N1 dan A/H1N1pdm09. Kemudian dilakukan analisis alignment untuk mengetahui variasi protein dan mutasi yang berhubungan dengan patogenitas dan virulensi. Hasil. Kami melakukan penelitian terhadap sekuens PB1-F2 sebanyak 3262 influenza A/H5N1 dan 2472 Influenza A/H1N1pdm09. Hasil analisis menunjukkan bahwa semua sekuens A/H5N1 memiliki panjang yang penuh sebanyak 90 asam amino, kecuali influenza pandemi 2009 hanya memiliki panjang 87 asam amino. Kemudian, ditemukan mutasi yang berhubungan dengan virulensi yang ditunjukan dengan perubahan asam amino Asparagin (N menjadi Serin (S. Mutasi tersebut terjadi pada Influenza A/H5N1 sebanyak 8.5% dan Influenza A/H1N1pdm09 sebanyak 0.5%. Kesimpulan. Ditemukan beberapa variasi panjang asam amino dan mutasi penting pada sekuens PB1-F2 dari subtipe yang berbeda yaitu influenza A/H5N1 dan A/H1N1pdm09  yang mengindikasikan seleksi spesifik karena introduksi dan adaptasi terhadap inang yang berbeda. Diperlukan penelitian lanjutan untuk lebih memahami variasi dan kontribusi protein PB1-F2 tersebut terhadap virulensi dan patogenitas virus Influenza. Kata kunci : Patogenesis, Virus Influenza, Protein  PB1-F2 Abstract Aim. Influenza virus PB1-F2 (polymerase basic 1-frame 2 protein is a novel protein previously shown to be involved in cell death induction and pathogenesis. Here we analysis the PB1-F2 protein of Influenza virus A

  17. A study of analysis PB1-F2 protein of Influenza Viruses A/H1N1pdm09, A/ H3N2, and A/H5N1

    Directory of Open Access Journals (Sweden)

    Hana Apsari Pawestri

    2016-07-01

    Full Text Available Abstrak Tujuan. Protein PB1-F2 (polymerase basic 1-frame 2 adalah protein terbaru yang ditemukan pada virus Influenza dan telah terbukti berperan dalam induksi kematian sel dan patogenitas. Tujuan dari tulisan ini adalah untuk menganalisis protein PB1-F2 pada virus Influenza A/H5N1 dan A/H1N1pdm09. Metode. Kami melakukan pencarian data yang relevan yaitu sekuens gen virus Influenza A/H5N1 dan A/H1N1pdm09 dari Gen Bank National Center for Biotechnology Information (NCBI selama tahun 1997-2015. Data yang digunakan adalah data sekuens nukleotida gen PB1 (polymerase basic1 virus influenza A/H5N1 dan A/H1N1pdm09. Kemudian dilakukan analisis alignment untuk mengetahui variasi protein dan mutasi yang berhubungan dengan patogenitas dan virulensi. Hasil. Kami melakukan penelitian terhadap sekuens PB1-F2 sebanyak 3262 influenza A/H5N1 dan 2472 Influenza A/H1N1pdm09. Hasil analisis menunjukkan bahwa semua sekuens A/H5N1 memiliki panjang yang penuh sebanyak 90 asam amino, kecuali influenza pandemi 2009 hanya memiliki panjang 87 asam amino. Kemudian, ditemukan mutasi yang berhubungan dengan virulensi yang ditunjukan dengan perubahan asam amino Asparagin (N menjadi Serin (S. Mutasi tersebut terjadi pada Influenza A/H5N1 sebanyak 8.5% dan Influenza A/H1N1pdm09 sebanyak 0.5%. Kesimpulan. Ditemukan beberapa variasi panjang asam amino dan mutasi penting pada sekuens PB1-F2 dari subtipe yang berbeda yaitu influenza A/H5N1 dan A/H1N1pdm09  yang mengindikasikan seleksi spesifik karena introduksi dan adaptasi terhadap inang yang berbeda. Diperlukan penelitian lanjutan untuk lebih memahami variasi dan kontribusi protein PB1-F2 tersebut terhadap virulensi dan patogenitas virus Influenza. Kata kunci : Patogenesis, Virus Influenza, Protein  PB1-F2 Abstract Aim. Influenza virus PB1-F2 (polymerase basic 1-frame 2 protein is a novel protein previously shown to be involved in cell death induction and pathogenesis. Here we analysis the PB1-F2 protein of Influenza virus A

  18. On Positive Solutions for the Rational Difference Equation Systems x n+1 = A/x n y n (2), and y n+1 = By n /x n-1 y n-1.

    Science.gov (United States)

    Ma, Hui-Li; Feng, Hui

    2014-01-01

    Our aim in this paper is to investigate the behavior of positive solutions for the following systems of rational difference equations: x n+1 = A/x n y n (2), and y n+1 = By n /x n-1 y n-1, n = 0,1,…, where x -1, x 0, y -1, and y 0 are positive real numbers and A and B are positive constants.

  19. Increase in IFNγ(-IL-2(+ cells in recent human CD4 T cell responses to 2009 pandemic H1N1 influenza.

    Directory of Open Access Journals (Sweden)

    Jason M Weaver

    Full Text Available Human CD4 T cell recall responses to influenza virus are strongly biased towards Type 1 cytokines, producing IFNγ, IL-2 and TNFα. We have now examined the effector phenotypes of CD4 T cells in more detail, particularly focusing on differences between recent versus long-term, multiply-boosted responses. Peptides spanning the proteome of temporally distinct influenza viruses were distributed into pools enriched for cross-reactivity to different influenza strains, and used to stimulate antigen-specific CD4 T cells representing recent or long-term memory. In the general population, peptides unique to the long-circulating influenza A/New Caledonia/20/99 (H1N1 induced Th1-like responses biased toward the expression of IFNγ(+TNFα(+ CD4 T cells. In contrast, peptide pools enriched for non-cross-reactive peptides of the pandemic influenza A/California/04/09 (H1N1 induced more IFNγ(-IL-2(+TNFα(+ T cells, similar to the IFNγ(-IL-2(+ non-polarized, primed precursor T cells (Thpp that are a predominant response to protein vaccination. These results were confirmed in a second study that compared samples taken before the 2009 pandemic to samples taken one month after PCR-confirmed A/California/04/09 infection. There were striking increases in influenza-specific TNFα(+, IFNγ(+, and IL-2(+ cells in the post-infection samples. Importantly, peptides enriched for non-cross-reactive A/California/04/09 specificities induced a higher proportion of Thpp-like IFNγ(-IL-2(+TNFα(+ CD4 T cells than peptide pools cross-reactive with previous influenza strains, which induced more Th1 (IFNγ(+TNFα(+ responses. These IFNγ(-IL-2(+TNFα(+ CD4 T cells may be an important target population for vaccination regimens, as these cells are induced upon infection, may have high proliferative potential, and may play a role in providing future effector cells during subsequent infections.

  20. Data of evolutionary structure change: 1AIFA-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2> 0 n> 1AIF n>A ...n>1AIFAn> VSSSI----SSSNL...n> 2AI0 n>L 2AI...1AIFA-2AI0L 1AIF 2AI0 A L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  1. Protonation of 1-alkyl-2-allyllithium-0-carboranes and 1-methyl-2-allylmaonesium chloride-0-carborane

    International Nuclear Information System (INIS)

    Ivanova, N.N.; Kazantsev, A.V.; Zakharkin, L.I.

    1975-01-01

    The ratio of 1-alkyl-2-allyl and 1-alkyl-2-propenyl-0-carboranes generated in protonation of 1-alkyl-2-lithium allyl-0-carboranes with various protolytic agents in ether, THF and liquid ammonia depends on the nature of protolytic agent and solvent. The rat:o of these allyl and propenyl isomers is also affected by steric effects of the protolytic agent and 0-carborane nucleus

  2. Critical Parameters and Critical-Region (p,ρ ,T) Data of trans-1,1,1,3-Tetrafluorobut-2-ene [HFO-1354mzy(E)

    Science.gov (United States)

    Kimura, Takeru; Kayukawa, Yohei; Miyamoto, Hiroyuki; Saito, Kiyoshi

    2017-08-01

    This study presents the experimental measurement of the pρ T properties and critical parameters of a low GWP type refrigerant, trans-1,1,1,3-Tetrafluorobut-2-ene (HFO-1354mzy(E)). The sample purity of the substance was 99 area %. p ρ T property measurements and visual observations of the meniscus of HFO-1354mzy(E) were carried out using a metal-bellows volumometer with an optical cell. The critical temperature was determined by observation of the critical opalescence. The critical pressure and critical density were determined as the inflection point of the isothermal p ρ T property data at the critical temperature. For more precise clarification of the thermodynamic surface in the vicinity of the critical point, additional p ρ T property measurements were carried out on three isotherms in the supercritical region. The expanded uncertainties (k = 2) in the temperature, pressure, and density measurements were estimated to be less than 3 mK, 1.2 kPa, and 0.32 \\hbox {kg} \\cdot \\hbox {m}^{-3}, respectively. The expanded uncertainties of the critical parameters were estimated to be less than 13 mK, 1.4 kPa, and 2.3 \\hbox {kg} \\cdot \\hbox {m}^{-3}, respectively. These values are the first reported for HFO-1354mzy(E) and are necessary for the development of its equation of state in the near future.

  3. A homologous series of homoleptic zinc bis(1,4-di-tert-butyl-1,4-diaza-1,3-butadiene) complexes: Kx[Zn(t-BuNCHCHN-t-Bu)2], Zn(t-BuNCHCHN-t-Bu)2, and [Zn(t-BuNCHCHN-t-Bu)2](OTf)x)(X=1,2)

    NARCIS (Netherlands)

    Koten, G. van; Rijnberg, E.; Richter, B.; Thiele, K.-H.; Boersma, J.; Veldman, N.; Spek, A.L.

    1998-01-01

    A homologous series of mono- and dicationic, neutral, and mono- and dianionic zinc diazabutadiene complexes, Kx[Zn(t-BuNCHCHN-t-Bu)2], Zn(t-BuNCHCHN-t-Bu)2, and [Zn(t-BuNCHCHN-t-Bu)2](OTf)x (x = 1, 2), have been prepared and isolated in pure form. The crystal structures of the mono- and dicationic

  4. Do Cartilage Repair Procedures Prevent Degenerative Meniscus Changes? Longitudinal T1ρ and Morphological Evaluation at 3.0T

    Science.gov (United States)

    Jungmann, Pia M.; Li, Xiaojuan; Nardo, Lorenzo; Subburaj, Karupppasamy; Lin, Wilson; Ma, C. Benjamin; Majumdar, Sharmila; Link, Thomas M.

    2014-01-01

    Background Cartilage repair (CR) procedures are widely accepted for treatment of isolated cartilage defects at the knee joint. However, it is not well known whether these procedures prevent degenerative joint disease. Hypothesis/Purpose CR procedures prevent accelerated qualitative and quantitative progression of meniscus degeneration in individuals with focal cartilage defects. Study Design Cohort Study; Level of evidence 2b Methods A total of 94 subjects were studied. CR procedures were performed on 34 patients (n=16 osteochondral transplantation, n=18 microfracture); 34 controls were matched. An additional 13 patients received CR and anterior cruciate ligament (ACL) reconstruction (CR&ACL) and 13 patients received only ACL reconstruction. 3.0T MRI with T1ρ mapping and sagittal fat-saturated intermediate-weighted fast spin echo (FSE) sequences was performed to analyze menisci quantitatively and qualitatively (Whole-Organ Magnetic Resonance Imaging Score, WORMS). CR and CR&ACL patients were examined 4 months (n=34; n=13), 1 (n=21; n=8) and 2 (n=9; n=5) years post CR. Control subjects were scanned at baseline and after 1 and 2 years, ACL patients after 1 and 2 years. Results At baseline, global meniscus T1ρ values were higher in individuals with CR (14.2±0.6ms; P=0.004) and in individuals with CR&ACL (17.1±0.9ms; Pmeniscus above cartilage defects (16.4±1.0ms) and T1ρ of the subgroup of control knees without cartilage defects (12.1±0.8ms; Pmeniscus tears at the overlying meniscus; 10% of CR subjects showed an increase of WORMS meniscus score within the first year, none progressed in the second year. Control subjects with (without) cartilage defects showed meniscus tears in 30% (5%) at baseline; 38% (19%) increased within the first, and 15% (10%) within the second year. Conclusions This study identified more severe meniscus degeneration after CR surgery compared to controls. However, progression of T1ρ values was not observed from 1 to 2 years after surgery

  5. A Sequential Method to Prepare Polymorphs and Solvatomorphs of [Fe(1,3-bpp)2 ](ClO4 )2nH2 O (n=0, 1, 2) with Varying Spin-Crossover Behaviour.

    Science.gov (United States)

    Bartual-Murgui, Carlos; Codina, Carlota; Roubeau, Olivier; Aromí, Guillem

    2016-08-26

    Two polymorphs of the spin crossover (SCO) compound [Fe(1,3-bpp)2 ](ClO4 )2 (1 and 2; 1,3-bpp=2-(pyrazol-1-yl)-6-(pyrazol-3-yl)pyridine) were prepared using a novel, stepwise procedure. Crystals of 1 deposit from dry solvents, while 2 is obtained from a solid-state procedure, by sequentially removing lattice H2 O molecules from the solvatomorph [Fe(1,3-bpp)2 ](ClO4 )22 H2 O (22 H2 O), using single-crystal-to-single-crystal (SCSC) transformations. Hydrate 22 H2 O is obtained through the same reaction as 1, now with 2.5 % of water added. Compounds 2 and 22 H2 O are unstable in the atmosphere and absorb or lose one equivalent of water, respectively, to both yield the stable solvatomorph [Fe(1,3-bpp)2 ](ClO4 )2 ⋅H2 O (2⋅H2 O), also following SCSC processes. The four derivatives have been characterised by single-crystal X-ray diffraction (SCXRD). Furthermore, the homogeneity of the various compounds as well as their SCSC interconversions have been confirmed by powder X-ray diffraction (PXRD). Polymorphs 1 and 2 exhibit abrupt SCO behaviour near room temperature with T1/2↑ =279/316 K and T1/2↓ =276/314 K (near 40 K of shift) and different cooperativity. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. In Silico Identification of Highly Conserved Epitopes of Influenza A H1N1, H2N2, H3N2, and H5N1 with Diagnostic and Vaccination Potential

    Directory of Open Access Journals (Sweden)

    José Esteban Muñoz-Medina

    2015-01-01

    Full Text Available The unpredictable, evolutionary nature of the influenza A virus (IAV is the primary problem when generating a vaccine and when designing diagnostic strategies; thus, it is necessary to determine the constant regions in viral proteins. In this study, we completed an in silico analysis of the reported epitopes of the 4 IAV proteins that are antigenically most significant (HA, NA, NP, and M2 in the 3 strains with the greatest world circulation in the last century (H1N1, H2N2, and H3N2 and in one of the main aviary subtypes responsible for zoonosis (H5N1. For this purpose, the HMMER program was used to align 3,016 epitopes reported in the Immune Epitope Database and Analysis Resource (IEDB and distributed in 34,294 stored sequences in the Pfam database. Eighteen epitopes were identified: 8 in HA, 5 in NA, 3 in NP, and 2 in M2. These epitopes have remained constant since they were first identified (~91 years and are present in strains that have circulated on 5 continents. These sites could be targets for vaccination design strategies based on epitopes and/or as markers in the implementation of diagnostic techniques.

  7. Salvage brachytherapy (BT) of 85 T1 T2 oral cavity second head and neck primaries (SHNP) in previously irradiated patients

    International Nuclear Information System (INIS)

    Peiffert, D; Hoffstetter, S; Pernot, M.; Aletti, P.; Luporsi, E.; Kozminski, P.; Lapeyre, M.; Dartois, D.; Bey, P.

    1996-01-01

    The occurrence of a SNHP (20%) represents a major therapeutic dilemma for salvage treatment. BT achieves a local conservative treatment but neglects the node areas. The aim of the study is to evaluate the local control, the late complications, and the survival. Materials and Methods. From 1976 to 1994, 85 patients were treated by salvage BT for a T1 T2 SHNP (38 mobile tongues and 47 floors of mouth). All of them had been previously irradiated for a first head and neck primary by external beam irradiation (80 patients, mean dose = 55 Gy) and/or BT (31 patients, mean dose 39 Gy). A tumour resection had been performed in 33 patients. Results: They were 81 males and 4 females, their mean age was 59 (range 40-80). 78 had infiltrative squamous cell carcinomas, and 7 micro-invasive or intra-epithelial carcinomas. They were 20 T1N0, 17 T2 N0 and 1 T2 N1 mobile tongue, and 39 T1 N0, 8 T2 N0 floor of mouth tumours. The mean follow-up was 46 months (range 1-130). The BT used Ir 192 wires, at low dose rate (mean = 0.58 Gy/h, range 0.3-1.1), and delivered a mean dose of 62 Gy (range 26-70) in the 85% ref. isodose of the Paris System. For the tongue and the floor respectively, the 5 years overall survival was 41% and 26%, and the 5 years specific survival 74% and 94%. The causes of death were respectively the tumour for 32% and 5%, and another primary for 42% and 66%. The local relapse rate was respectively 18% and 8.5%, half of them occurring in the first year of follow-up, the nodal relapses were 8% and 4%. Only one patient developed a distant metastasis. 5 patients developed osteoradionecrosis (3 grade 3 with fracture and/or mandible resection) and 19 soft tissue necrosis (2 grade 3 treated by local excision, and 9 grade 2 treated by hyperbaric 02). 47 patients developed other primaries, especially in the oesophagus (18 patients) explaining the low overall survival. Conclusion: Salvage BT is a useful treatment for T1 T2 oral cavity SHNP occurring in previous irradiated

  8. M-theory solutions invariant under D(2,1; γ) + D(2,1;γ)

    International Nuclear Information System (INIS)

    Bachas, C.; D'Hoker, E.; Estes, J.; Krym, D.

    2014-01-01

    We simplify and extend the construction of half-BPS solutions to 11-dimensional supergravity, with isometry superalgebra D(2,1;γ) + D(2,1;γ). Their space-time has the form AdS 3 x S 3 x S 3 warped over a Riemann surface Σ. It describes near-horizon geometries of M2 branes ending on, or intersecting with, M5 branes along a common string. The general solution to the BPS equations is specified by a reduced set of data (γ, h, G), where γ is the real parameter of the isometry superalgebra, and h and G are functions on Σ whose differential equations and regularity conditions depend only on the sign of γ. The magnitude of γ enters only through the map of h,G onto the supergravity fields, thereby promoting all solutions into families parametrized by vertical stroke γ vertical stroke. By analyzing the regularity conditions for the supergravity fields, we prove two general theorems: (i) that the only solution with a 2-dimensional CFT dual is AdS 3 x S 3 x S 3 x R 2 , modulo discrete identifications of the flat R 2 , and (ii) that solutions with γ 4 /Z 2 or AdS 7 ' regions; highly-curved M5-branes; and a coordinate singularity called the ''cap''. By putting these ''Lego'' pieces together we recover all known global regular solutions with the above symmetry, including the self-dual strings on M5 for γ 0, but now promoted to families parametrized by vertical stroke γ vertical stroke. We also construct exactly new regular solutions which are asymptotic to AdS 4 /Z 2 for γ 0 solutions with highly curved M5-brane regions, which are the formal continuation of the self-dual string solutions across the decompactification point at γ = 0. (Copyright copyright 2014 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  9. Unusual electronic features and reactivity of the dipyridylazaallyl ligand: characterizations of (smif)2M [M = Fe, Co, Co+, Ni; smif = {(2-py)CH}2N] and [(TMS)2NFe]2(smif)2.

    Science.gov (United States)

    Frazier, Brenda A; Wolczanski, Peter T; Lobkovsky, Emil B; Cundari, Thomas R

    2009-03-18

    Application of the dipyridylazaallyl ligand (2-py)CHNCH(2-py) (smif) to a series of first-row transition metals afforded (smif)(2)M(n) [n = 0, M = Fe (1), Co (2), Ni (3); n = +1, M = Co (2+)] and {(TMS)(2)NFe}(2)(smif)(2) (4(2)) via metathetical procedures. The Mossbauer spectrum of 1 (S = 0) and TDDFT calculations, including a UV-vis spectral simulation, reveal it to be a covalent, strong-field system with Delta(o) estimated as approximately 18,000 cm(-1) and B approximately 470 cm(-1). (smif)(2)Co (2) has S = 1/2 according to SQUID data at 10 K. DFT calculations suggest that the odd electron is localized in a smif pi* orbital, i.e., smif is redox-active. EPR-silent (smif)(2)Ni (3) has S = 1 (SQUID), and calculations show that the unpaired spins reside in the d(z(2)) and d(x(2))(-y(2)) orbitals. X-ray structural parameters suggest that low-spin d(6) 1 and 2+ are relatively symmetric D(2d) species, but 2 and 3 manifest a distortion in which one smif is canted in the plane perpendicular to the other. (smif)FeN(TMS)(2) (4) is principally monomeric in solution, but reversibly dimerizes (K(eq) approximately 10(-4) M(-1)) via C-C bond formation in the azaallyl backbone to crystallize as {(TMS)(2)NFe}(2)(smif)(2) (4(2)). The azaallyl compounds possess extraordinary UV-vis absorptivities (epsilon approximately 18,000-52,000) at 580 +/- 15 nm and 406(25) nm that have been identified as intraligand bands with C(nb) --> smif pi* character.

  10. Data of evolutionary structure change: 1AIFA-2AI0O [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available s_2> 0 n> 1AIF A...n> 1AIFAn> VSSSI----SSSNL n> 2AI0 n>O 2AI...1AIFA-2AI0O 1AIF 2AI0 A O DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...e>SER CA 251 SER CA 276 SER CA 258 ASN CA 337 LEU CA 410

  11. Neutron-scattering studies of the S=2 antiferromagnetic chain MnCl sub 3 (C sub 1 sub 0 D sub 8 N sub 2)

    CERN Document Server

    Granroth, G E; Coldea, R; Eccleston, R S; Ward, B H; Talham, D R; Meisel, M W

    2002-01-01

    Quasi-elastic and inelastic neutron scattering studies of the quasi-one-dimensional S=2 antiferromagnet MnCl sub 3 (C sub 1 sub 0 D sub 8 N sub 2) are reported. The quasi-elastic measurements exhibit a broad peak at Q approx 0.69 A sup - sup 1 , which is consistent with short-range antiferromagnetic coupling between neighboring Mn sup 3 sup + ions. Inelastic experiments, at 150 mK and Q=0.70 A sup - sup 1 , reveal decreased magnetic scattering at energies less than 0.2 meV when compared to similar studies at 20 K. These results provide microscopic evidence for the presence of a Haldane gap and are consistent with the bulk magnetization measurements of Granroth et al. (orig.)

  12. M-theory solutions invariant under D(2,1; γ) + D(2,1;γ)

    Energy Technology Data Exchange (ETDEWEB)

    Bachas, C. [Laboratoire de Physique Theorique de l' Ecole Normale Superieure Unite mixte (UMR 8549) du CNRS et de l' ENS, Paris (France); D' Hoker, E. [Department of Physics and Astronomy, University of California, Los Angeles, CA (United States); Estes, J. [Blackett Laboratory, Imperial College, London (United Kingdom); Krym, D. [Physics Department, New York City College of Technology, The City University of New York, Brooklyn, NY (United States)

    2014-03-06

    We simplify and extend the construction of half-BPS solutions to 11-dimensional supergravity, with isometry superalgebra D(2,1;γ) + D(2,1;γ). Their space-time has the form AdS{sub 3} x S{sup 3} x S{sup 3} warped over a Riemann surface Σ. It describes near-horizon geometries of M2 branes ending on, or intersecting with, M5 branes along a common string. The general solution to the BPS equations is specified by a reduced set of data (γ, h, G), where γ is the real parameter of the isometry superalgebra, and h and G are functions on Σ whose differential equations and regularity conditions depend only on the sign of γ. The magnitude of γ enters only through the map of h,G onto the supergravity fields, thereby promoting all solutions into families parametrized by vertical stroke γ vertical stroke. By analyzing the regularity conditions for the supergravity fields, we prove two general theorems: (i) that the only solution with a 2-dimensional CFT dual is AdS{sub 3} x S{sup 3} x S{sup 3} x R {sup 2}, modulo discrete identifications of the flat R {sup 2}, and (ii) that solutions with γ < 0 cannot have more than one asymptotic higher-dimensional AdS region. We classify the allowed singularities of h and G near the boundary of Σ, and identify four local solutions: asymptotic AdS{sub 4}/Z{sub 2} or AdS{sub 7}' regions; highly-curved M5-branes; and a coordinate singularity called the ''cap''. By putting these ''Lego'' pieces together we recover all known global regular solutions with the above symmetry, including the self-dual strings on M5 for γ <0, and the Janus solution for γ > 0, but now promoted to families parametrized by vertical stroke γ vertical stroke. We also construct exactly new regular solutions which are asymptotic to AdS{sub 4}/Z{sub 2} for γ < 0, and conjecture that they are a different superconformal limit of the self-dual string. Finally, we construct exactly γ > 0 solutions with highly curved M5

  13. Spontaneous transition rates for electric dipole (E1), magnetic dipole (M1), electric quadrupole (E2) and magnetic quadrupole (M2) transitions for He-like calcium and sulfur ions

    International Nuclear Information System (INIS)

    Kingston, A.E.; Norrington, P.H.; Boone, A.W.

    2002-01-01

    The spontaneous decay rates for the electric dipole (E1), electric quadrupole (E2), magnetic dipole (M1) and magnetic quadrupole (M2) transitions between all of the 1s 2 , 1s2 l and 1s3 l states have been obtained for helium-like calcium and sulfur ions. To assess the accuracy of the calculations, the transition probabilities were calculated using two sets of configuration interaction wavefunctions. One set of wavefunctions was generated using the fully relativistic GRASP code and the other was obtained using CIV3, in which relativistic effects are introduced using the Breit-Pauli approximation. The transition rates, A values, oscillator strengths and line strengths from our two calculations are found to be similar and to compare very well with other recent results for Δn=1 or 2 transitions. For Δn=0 transitions the agreement is much less good; this is mainly due to differences in the calculated excitation energies. (author)

  14. Defect chemistry and oxygen transport of (La0.6Sr0.4 − xMx)0.99Co0.2Fe0.8O3 − δ, M = Ca (x = 0.05, 0.1), Ba (x = 0.1, 0.2), Sr: Part II: Oxygen transport

    DEFF Research Database (Denmark)

    Dalslet, Bjarke Thomas; Søgaard, Martin; Hendriksen, Peter Vang

    2009-01-01

    This paper is the second part of a two part series, where the effects of varying the A-site dopant on the defect chemistry and transport properties of the materials (La0.6Sr0.4 − xMx)0.99Co0.2Fe0.8O3 − δ, M = Sr, Ca (x = 0.05, 0.1), Ba (x = 0.1, 0.2) (LSMFC) have been investigated. In part I......, the findings on the defect chemistry were reported, while the oxygen transport properties are reported here in part II. In the investigated material series, the amount of divalent dopant has been kept constant, while Sr ions have been substituted with Ca ions (smaller ionic radius) or Ba ions (larger ionic...... electrolyte probe were used to extract the permeability and surface resistance, rs. The highest permeability was found for (La0.6Sr0.3Ca0.1)0.99Co0.2Fe0.8O3 − δ. The apparent activation energy of the permeability was 78 kJ/mol. The inverse surface resistance, rs− 1, also had an activated behavior...

  15. Radiation dose response in patients with favorable localized prostate cancer (Stage T1-T2, biopsy Gleason ≤6, and pretreatment prostate-specific antigen ≤10)

    International Nuclear Information System (INIS)

    Kupelian, Patrick A.; Buchsbaum, Jeffrey C.; Reddy, Chandana A.; Klein, Eric A.

    2001-01-01

    Purpose: To study the radiation dose response as determined by biochemical relapse-free survival in patients with favorable localized prostate cancers, i.e., Stage T1-T2, biopsy Gleason score (bGS) ≤6, and pretreatment prostate-specific antigen (iPSA) ≤10 ng/mL. Methods and Materials: A total of 292 patients with favorable localized prostate cancer were treated with radiotherapy alone between 1986 and 1999. The median age was 69 years. Sixteen percent of cases (n=46) were African-American. The distribution by clinical T stage was as follows: T1/T2A, 243 (83%); and T2B/T2C, 49 (17%). The distribution by iPSA was as follows: ≤4 ng/mL, 49 (17%); and >4 ng/mL, 243 (83%). The mean iPSA level was 6.2 (median, 6.4). The distribution by bGS was as follows: ≤5 in 89 cases (30%) and 6 in 203 cases (70%). The median radiation dose was 70.0 Gy (range, 63.0-78.0 Gy). Doses of ≤70.0 Gy were delivered in 175 cases, 70.2-72.0 Gy in 24 cases, 74 Gy in 30 cases, and 78 Gy in 63 cases. For patients receiving 2 =5.7), and radiation dose (p=0.021, χ 2 =5.3) were independent predictors of outcome. Age (p=0.94), race (p=0.89), stage (p=0.45), biopsy GS (p=0.40), and radiation technique (p=0.45) were not. Conclusion: There is a clear radiation dose response in patients with favorable localized prostate cancers (i.e., Stage T1-T2, biopsy Gleason score ≤6, and iPSA ≤10 ng/mL). At least 74 Gy should be delivered to the prostate and periprostatic tissues. With our cohort of patients, longer follow-up will be needed to assess the importance of doses exceeding 74 Gy

  16. Oxygen vibrations in the series Bi2Sr2Ca{_{n-1}}Cu{n}O{_{4+2 n+y}}

    Science.gov (United States)

    Faulques, E.; Dupouy, P.; Lefrant, S.

    1991-06-01

    We present a discussion of the oxygen vibrations in the Bi{2}Sr{2}Ca{n-1}Cu{n}O{4+2 n+y} high T_c superconductors with the aim of interpreting Raman spectra in the case of the non-symmorphic Amaa structure. Group theory shows that the oxygen atoms belonging to the central CuO{2} plane generate a Raman activity for the n=1,3 phases. Consequently, we propose a novel assignment for the lines of weak intensity at 297, 316 and 333 cm^{-1}. It is shown that the two components of the 460 cm^{-1} band may be consistent with the Amma structure. Spectra recorded in crossed polarization exhibit weak lines which could be assigned to B {1g} modes expected for the three phases. Nous présentons une discussion sur les vibrations des atomes d'oxygène dans la série des supraconducteurs Bi{2}Sr{2}Ca{n-1}Cu{n}O{4+2 n+y} dans le but d'interpréter les spectres Raman. L'analyse des modes normaux de vibration de la structure Amaa pour les phases n=1 ou 3 montre que les atomes d'oxygène du plan CuO{2} contenant les centres d'inversion donnent lieu à une activité Raman. En conséquence, nous proposons une nouvelle attribution pour les raies de faible intensité à 297, 316 et 333 cm^{-1}. Nous montrons que le dédoublement de la bande à 460 cm^{-1} pourrait être dû à la structure Amaa. Les spectres enregistrés en polarization croisée montrent de faibles bandes qui peuvent être attribuées aux modes B {1g} attendus pour les trois phases.

  17. Depairing current density of Ba0.5K0.5Fe1.95Co0.05As2 microbridges with nanoscale thickness

    International Nuclear Information System (INIS)

    Li, Jun; Yuan, Jie; Ge, Jun-Yi; Ji, Min; Feng, Hai-Luke; Yuan, Ya-Hua; Hatano, Takeshi; Vanacken, Johan; Yamaura, Kazunari; Wang, Hua-Bing

    2014-01-01

    Highlights: • The critical current density of Ba 0.5 K 0.5 Fe 1.95 Co 0.05 As 2 microbridges is 7.9 MA/cm 2 at 21 K. • The critical current is in consistence with the Ginzburg–Landau depairing limit. • The depairing current density is less than that of impurity-free crystal. - Abstract: We investigated the depairing current density of Ba 0.5 K 0.5 Fe 1.95 Co 0.05 As 2 microbridges with width of 2 μm and thickness of 150 nm. The current vs. voltage characteristics of the microbridges show a Josephson-like behavior with the obvious hysteresis. The critical current density was observed as J c = 7.9 MA/cm 2 at temperature 21 K, which is consistent with the Ginzburg–Landau depairing limit. However, the depairing current density is less than that of impurity-free crystal, although the Co ions provide additional pinning centers within the superconducting Fe 2 As 2 layers. The Co impurity also enhances the anisotropic factor of the critical current density by 1.3 (1 T) or 1.7 (3 T)

  18. Genetic Characterization of H1N1 and H1N2 Influenza A Viruses Circulating in Ontario Pigs in 2012.

    Science.gov (United States)

    Grgić, Helena; Costa, Marcio; Friendship, Robert M; Carman, Susy; Nagy, Éva; Poljak, Zvonimir

    2015-01-01

    The objective of this study was to characterize H1N1 and H1N2 influenza A virus isolates detected during outbreaks of respiratory disease in pig herds in Ontario (Canada) in 2012. Six influenza viruses were included in analysis using full genome sequencing based on the 454 platform. In five H1N1 isolates, all eight segments were genetically related to 2009 pandemic virus (A(H1N1)pdm09). One H1N2 isolate had hemagglutinin (HA), polymerase A (PA) and non-structural (NS) genes closely related to A(H1N1)pdm09, and neuraminidase (NA), matrix (M), polymerase B1 (PB1), polymerase B2 (PB2), and nucleoprotein (NP) genes originating from a triple-reassortant H3N2 virus (tr H3N2). The HA gene of five Ontario H1 isolates exhibited high identity of 99% with the human A(H1N1)pdm09 [A/Mexico/InDRE4487/09] from Mexico, while one Ontario H1N1 isolate had only 96.9% identity with this Mexican virus. Each of the five Ontario H1N1 viruses had between one and four amino acid (aa) changes within five antigenic sites, while one Ontario H1N2 virus had two aa changes within two antigenic sites. Such aa changes in antigenic sites could have an effect on antibody recognition and ultimately have implications for immunization practices. According to aa sequence analysis of the M2 protein, Ontario H1N1 and H1N2 viruses can be expected to offer resistance to adamantane derivatives, but not to neuraminidase inhibitors.

  19. Dual mTORC1/C2 inhibitors suppress cellular geroconversion (a senescence program).

    Science.gov (United States)

    Leontieva, Olga V; Demidenko, Zoya N; Blagosklonny, Mikhail V

    2015-09-15

    In proliferating cells, mTOR is active and promotes cell growth. When the cell cycle is arrested, then mTOR converts reversible arrest to senescence (geroconversion). Rapamycin and other rapalogs suppress geroconversion, maintaining quiescence instead. Here we showed that ATP-competitive kinase inhibitors (Torin1 and PP242), which inhibit both mTORC1 and TORC2, also suppressed geroconversion. Despite inhibition of proliferation (in proliferating cells), mTOR inhibitors preserved re-proliferative potential (RP) in arrested cells. In p21-arrested cells, Torin 1 and PP242 detectably suppressed geroconversion at concentrations as low as 1-3 nM and 10-30 nM, reaching maximal gerosuppression at 30 nM and 300 nM, respectively. Near-maximal gerosuppression coincided with inhibition of p-S6K(T389) and p-S6(S235/236). Dual mTOR inhibitors prevented senescent morphology and hypertrophy. Our study warrants investigation into whether low doses of dual mTOR inhibitors will prolong animal life span and delay age-related diseases. A new class of potential anti-aging drugs can be envisioned.

  20. Implications of the (H2O)n + CO ↔ trans-HCOOH + (H2O)n-1 (n = 1, 2, and 3) reactions for primordial atmospheres of Venus and Earth

    Science.gov (United States)

    Vichietti, R. M.; Spada, R. F. K.; da Silva, A. B. F.; Machado, F. B. C.; Haiduke, R. L. A.

    2018-04-01

    The forward and backward (H2O)n + CO ↔ HCOOH + (H2O)n-1 (n = 1, 2, and 3) reactions were studied in order to furnish trustworthy thermochemical and kinetic data. Stationary point structures involved in these chemical processes were achieved at the B2PLYP/cc-pVTZ level so that the corresponding vibrational frequencies, zero-point energies, and thermal corrections were scaled to consider anharmonicity effects. A complete basis set extrapolation was also employed with the CCSD(T) method in order to improve electronic energy descriptions and providing therefore more accurate results for enthalpies, Gibbs energies, and rate constants. Forward and backward rate constants were encountered at the high-pressure limit between 200 and 4000 K. In turn, modified Arrhenius' equations were fitted from these rate constants (between 700 and 4000 K). Next, considering physical and chemical conditions that have supposedly prevailed on primitive atmospheres of Venus and Earth, our main results indicate that 85-88 per cent of all water forms on these atmospheres were monomers, whereas (H2O)2 and (H2O)3 complexes would represent 12-15 and ˜0 per cent, respectively. Besides, we estimate that Earth's and Venus' primitive atmospheres could have been composed by ˜0.001-0.003 per cent of HCOOH when their temperatures were around 1000-2000 K. Finally, the water loss process on Venus may have occurred by a mechanism that includes the formic acid as intermediate species.

  1. Comparative pathology of pigs infected with Korean H1N1, H1N2, or H3N2 swine influenza A viruses.

    Science.gov (United States)

    Lyoo, Kwang-Soo; Kim, Jeong-Ki; Jung, Kwonil; Kang, Bo-Kyu; Song, Daesub

    2014-09-24

    The predominant subtypes of swine influenza A virus (SIV) in Korea swine population are H1N1, H1N2, and H3N2. The viruses are genetically close to the classical U.S. H1N1 and triple-reassortant H1N2 and H3N2 viruses, respectively. Comparative pathogenesis caused by Korean H1N1, H1N2, and H3N2 SIV was evaluated in this study. The H3N2 infected pigs had severe scores of gross and histopathological lesions at post-inoculation days (PID) 2, and this then progressively decreased. Both the H1N1 and H1N2 infected pigs lacked gross lesions at PID 2, but they showed moderate to severe pneumonia on PID 4, 7 and 14. The pigs infected with H1N1 had significant scores of gross and histopathological lesions when compared with the other pigs infected with H1N2, H3N2, and mock at PID 14. Mean SIV antigen-positive scores were rarely detected for pigs infected with H1N2 and H3N2 from PID 7, whereas a significantly increased amount of viral antigens were found in the bronchioles and alveolar epithelium of the H1N1infected pigs at PID 14. We demonstrated that Korean SIV subtypes had different pulmonary pathologic patterns. The Korean H3N2 rapidly induced acute lung lesions such as broncho-interstitial pneumonia, while the Korean H1N1 showed longer course of infection as compared to other strains.

  2. "2"1"0Po and "2"1"0Pb in medicinal plants in the region of Karnataka, Southern India

    International Nuclear Information System (INIS)

    Chandrashekara, K.; Somashekarappa, H.M.

    2016-01-01

    The activity concentrations of naturally occurring radionuclides "2"1"0Po and "2"1"0Pb were estimated in some selected medicinal plants and soil samples of coastal Karnataka in India. The mean activity concentrations of "2"1"0Po and "2"1"0Pb varied in the range of 4.7–42.9 Bq kg"−"1 (dry weight) and 36.1–124 Bq kg"−"1 (dry weight) in the soil samples, and 3.3–63.7 Bq kg"−"1 (dry weight) and 12.0–406 Bq kg"−"1 (dry weight), in the medicinal plant samples, respectively. The plants, Ocimum sanctum L. and Plectranthus amboinicus (Lour.) Spreng had significantly higher activity concentrations of "2"1"0Po and "2"1"0Pb than other species sampled. In spite of disequilibrium between them, these two radionuclides were well correlated in both soil and medicinal plants. - Highlights: • "2"1"0Po and "2"1"0Pb concentrations in medicinal plants were estimated. • Concentrations are higher in leaves than in rhizome or bark. • "2"1"0Po and "2"1"0Pb were in disequilibrium, but correlated very well. • Study helps to form database of radionuclides in medicinal plants.

  3. Influence of submarine groundwater discharge on "2"1"0Po and "2"1"0Pb bioaccumulation in fish tissues

    International Nuclear Information System (INIS)

    Garcia-Orellana, J.; López-Castillo, E.; Casacuberta, N.; Rodellas, V.; Masqué, P.; Carmona-Catot, G.

    2016-01-01

    This study presents the results of the accumulation of "2"1"0Po and "2"1"0Pb in fish tissues and organs in a brackish-water marshland that is characterized by high concentrations of "2"2"2Rn and "2"2"6Ra supplied by submarine groundwater discharge (SGD). Tissues and organs from Cyprinus carpio, Chelon labrosus and Carassius auratus in the wetland were significantly enriched by both "2"1"0Pb and "2"1"0Po (up to 55 and 66 times, respectively) compared to blanks. The major input route of "2"1"0Pb and "2"1"0Po into the fish body seems to be through ingestion, due to the high levels of "2"1"0Pb and "2"1"0Po found in the gut content as well as in organs involved in digestion and metabolism (i.e. gut, kidney and hepatopancreas). Results showed that "2"1"0Po was more accumulated in all fish tissues and organs except for the spine, which showed a higher affinity for "2"1"0Pb, due to its capacity to replace Ca from apatite in bones. Over all the variables analyzed, fish tissues/organs and, secondarily, fish species were the most important factors explaining the concentration of radionuclides, whereas fish length and the sampling location played a minor role. The relationship of the two radionuclides varied markedly among tissues and their concentration levels were only correlated in gills, gut and, marginally, in spines. In general, the highest values of "2"1"0Pb and "2"1"0Po concentrations in tissues were found on C. labrosus tissues rather C. auratus and C. carpio. This study demonstrates that inputs of natural radionuclides supplied by SGD to coastal semi-enclosed areas (such as marshlands, lagoons or ponds) may significantly increase the contents of "2"1"0Pb and "2"1"0Po in fish tissues/organs. Thus, this study represents one of the first evidences of direct ecological effects derived from SGD. - Highlights: • Fish tissues showed high concentrations of "2"1"0Pb and "2"1"0Po. • Ingestion pointed to be the major input route of "2"1"0Pb and "2"1"0Po into the fish.

  4. Lactate and T2 measurements of synovial aspirates at 1.5 T: differentiation of septic from non-septic arthritis

    International Nuclear Information System (INIS)

    Wiener, Edzard; Zanetti, Marco; Hodler, Juerg; Pfirrmann, Christian W.A.

    2008-01-01

    The aim of this study was to differentiate septic from non-septic arthritis by measuring lactate concentration with 1 H magnetic resonance spectroscopy (HMRS) and by estimating total protein content with the assessment of T 2 values. In 30 patients with acute arthritis, synovial fluid was aspirated. Lactate concentrations were analyzed with single voxel HMRS at 1.5 T. T 2 relaxation times were mapped with a multi-spin echo sequence. All samples underwent microbiological testing and routine laboratory analysis to quantify lactate concentration and total protein content. Values obtained in septic and non-septic arthritis were compared with a Mann-Whitney U test. Synovial fluid from patients with septic arthritis (n=10) had higher concentrations of lactate (11.4 ± 4.0 mmol/L) and higher total protein content (51.8 ± 10.7 g/L) than fluid obtained in non-septic arthritis (n=20; 5.2±1.1 mmol/L and 40.4±6.9 g/L, respectively, p 2 relaxation times (as an indicator of total protein content) were moderately correlated to laboratory-confirmed lactate concentration (r 2 =0.71) and total protein content (r 2 =0.73). Markedly increased lactate concentrations (>6 mmol/L) in combination with low T 2 values ( 2 may be of value in the differentiation of septic from non-septic arthritis. (orig.)

  5. Comparative pathology of pigs infected with Korean H1N1, H1N2, or H3N2 swine influenza A viruses

    OpenAIRE

    Lyoo, Kwang-Soo; Kim, Jeong-Ki; Jung, Kwonil; Kang, Bo-Kyu; Song, Daesub

    2014-01-01

    Background The predominant subtypes of swine influenza A virus (SIV) in Korea swine population are H1N1, H1N2, and H3N2. The viruses are genetically close to the classical U.S. H1N1 and triple-reassortant H1N2 and H3N2 viruses, respectively. Comparative pathogenesis caused by Korean H1N1, H1N2, and H3N2 SIV was evaluated in this study. Findings The H3N2 infected pigs had severe scores of gross and histopathological lesions at post-inoculation days (PID) 2, and this then progressively decrease...

  6. The electronic structure of the metastable layer compound 1T-CrSe2

    NARCIS (Netherlands)

    Fang, C.M.; Groot, R.A. de; Wiegers, G.A.; Haas, C.; vanBruggen, C.F.; deGroot, R.A.

    1997-01-01

    The electronic structure of the metastable compound 1T-CrSe2 (a = 3.399 Å, c = 5.911 Å, space group P_3m1) was calculated with and without spin polarization using the LSW method. The energy is 0.29 eV/mol CrSe2 lower for the spin-polarized calculation. The total magnetic moment of +2.44 μB on Cr

  7. Reversible operation of microtubular solid oxide cells using La0.6Sr0.4Co0.2Fe0.8O3-δ-Ce0.9Gd0.1O2-δ oxygen electrodes

    Science.gov (United States)

    López-Robledo, M. J.; Laguna-Bercero, M. A.; Larrea, A.; Orera, V. M.

    2018-02-01

    Yttria stabilized zirconia (YSZ) based microtubular solid oxide fuel cells (mT-SOFCs) using La0.6Sr0.4Co0.2Fe0.8O3-δ (LSCF) and Ce0.9Gd0.1O2-δ (GDC) as the oxygen electrode, along with a porous GDC electrolyte-electrode barrier layer, were fabricated and characterized in both fuel cell (SOFC) and electrolysis (SOEC) operation modes. The cells were anode-supported, the NiO-YSZ microtubular supports being made by Powder Extrusion Moulding (PEM). The cells showed power densities of 695 mW cm-2 at 800 °C and 0.7 V in SOFC mode, and of 845 mA cm-2 at 800 °C and 1.3 V in SOEC mode. AC impedance experiments performed under different potential loads demonstrated the reversibility of the cells. These results showed that these cells, prepared with a method suitable for using on an industrial scale, are highly reproducible and reliable, as well as very competitive as reversible SOFC-SOEC devices operating at intermediate temperatures.

  8. Synthesis of (+-)-[1,1'-15N2, 2'-13C]-trans-3'-methylnicotine

    International Nuclear Information System (INIS)

    Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr.

    1992-01-01

    The synthesis of (±)- [1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine is reported. 15 N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/[carbonyl- 13 C]-methyl formate. The resulting 15 n-Pyridine-3-[ 13 C-carbonyl]-carboxaldehyde was reacted with 15 N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give (±)- [1,1'- 15 N 2 , 5'- 13 C]-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave (±)-[1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine. (Author)

  9. Prognostic Significance of the Number of Positive Lymph Nodes in Women With T1-2N1 Breast Cancer Treated With Mastectomy: Should Patients With 1, 2, and 3 Positive Lymph Nodes Be Grouped Together?

    Energy Technology Data Exchange (ETDEWEB)

    Dai Kubicky, Charlotte, E-mail: charlottedai@gmail.com [Department of Radiation Medicine and Knight Cancer Institute, Oregon Health and Science University, Portland, Oregon (United States); Mongoue-Tchokote, Solange [Biostatistics Shared Resource, Knight Cancer Institute, Oregon Health and Science University, Portland, Oregon (United States)

    2013-04-01

    Purpose: To determine whether patients with 1, 2, or 3 positive lymph nodes (LNs) have similar survival outcomes. Methods and Materials: We analyzed the Surveillance, Epidemiology, and End Results registry of breast cancer patients diagnosed between 1990 and 2003. We identified 10,415 women with T1-2N1M0 breast cancer who were treated with mastectomy with no adjuvant radiation, with at least 10 LNs examined and 6 months of follow-up. The Kaplan-Meier method and log–rank test were used for survival analysis. Multivariate analysis was performed using the Cox proportional hazard model. Results: Median follow-up was 92 months. Ten-year overall survival (OS) and cause-specific survival (CSS) were progressively worse with increasing number of positive LNs. Survival rates were 70%, 64%, and 60% (OS), and 82%, 76%, and 72% (CSS) for 1, 2, and 3 positive LNs, respectively. Pairwise log–rank test P values were <.001 (1 vs 2 positive LNs), <.001 (1 vs 3 positive LNs), and .002 (2 vs 3 positive LNs). Multivariate analysis showed that number of positive LNs was a significant predictor of OS and CSS. Hazard ratios increased with the number of positive LNs. In addition, age, primary tumor size, grade, estrogen receptor and progesterone receptor status, race, and year of diagnosis were significant prognostic factors. Conclusions: Our study suggests that patients with 1, 2, and 3 positive LNs have distinct survival outcomes, with increasing number of positive LNs associated with worse OS and CSS. The conventional grouping of 1-3 positive LNs needs to be reconsidered.

  10. Temperature dependence of partial conductivities of the BaZr0.7Ce0.2Y0.1O3-δ proton conductor

    Science.gov (United States)

    Heras-Juaristi, Gemma; Pérez-Coll, Domingo; Mather, Glenn C.

    2017-10-01

    Partial conductivities are presented for BaZr0.7Ce0.2Y0.1O3-δ, an important proton conductor for protonic-ceramic fuel cells and membrane reactors. Atmospheric dependencies of impedance performed in humidified and dry O2, air, N2 and H2(10%)/N2(90%) in the temperature range 300-900 °C, supported by the modified emf method, confirm significant electron-hole and protonic contributions to transport. For very reducing and wet atmospheres, the conductivity is predominantly ionic, with a higher participation of protons with decreasing temperature and increasing water-vapour partial pressure (pH2O). From moderately reducing conditions of wet N2 to wet O2, however, the conductivity is considerably influenced by electron holes as revealed by a significant dependence of total conductivity on oxygen partial pressure (pO2). With higher pH2O, proton transport increases, with a concomitant decrease of holes and oxygen vacancies. However, the effect of pH2O is also influenced by temperature, with a greater protonic contribution at both lower temperature and pO2. Values of proton transport number tH ≈ 0.63 and electronic transport number th ≈ 0.37 are obtained at 600 °C for pH2O = 0.022 atm and pO2 = 0.2 atm, whereas tH ≈ 0.95 and th ≈ 0.05 for pO2 = 10-5 atm. A hydration enthalpy of -109 kJ mol-1 is obtained in the range 600-900 °C.

  11. Ag doped (Bi1.6Pb0.4Sr2CaCu2O8+δ textured rods

    Directory of Open Access Journals (Sweden)

    Díez, J. C.

    2008-06-01

    Full Text Available In this work, superconducting samples of (Bi1.6Pb0.4Sr2CaCu2O8+δ with Ag additions have been studied. (Bi1.6Pb0.4Sr2CaCu2O8+δ + x wt.% Ag (with x = 0, 1 and 3 powders were synthesized using a sol-gel method. The obtained powders were used as precursors to fabricate long textured cylindrical bars through a floating zone melting method. A drastic change on the microstructure has been found when comparing with undoped Bi2Sr2CaCu2O8+δ samples. The results showed that electrical resistivity at room temperature, critical current as well as flexural strength are improved when Ag is added to these Pb doped samples, while critical temperature does not change. On the other hand, it has been found that samples with composition (Bi1.6Pb0.4Sr2CaCu2O8+δ + Ag shown E-I curves with very high sharpness values on the zone of the superconducting to normal transition, reaching n-values (E∼In as high as 45 at 65K.Se han preparado polvos cerámicos de composición (Bi1.6Pb0.4Sr2CaCu2O8+δ + x % Ag en peso (con x = 0, 1 y 3 mediante un proceso sol-gel. Estos polvos se han utilizado para fabricar precursores que se texturaron por medio del método de fusión zonal flotante. Se ha encontrado un gran cambio en la microestructura cuando se compara con muestras de composición pura Bi2Sr2CaCu2O8+δ. Tanto la resistividad eléctrica a temperatura ambiente, como la corriente crítica, así como la resistencia a flexión se mejoran cuando la Ag se adiciona a estas muestras dopadas con Pb, mientras que no se observa cambio en la temperatura crítica. Por otra parte, se ha encontrado que las muestras de composición (Bi1.6Pb0.4Sr2CaCu2O8+δ + Ag presentan una gran pendiente de la curva E-I en la zona de transición entre el estado superconductor y el estado normal. Con estas composiciones, se han encontrado valores de n (E∼In de hasta 45 a 65K.

  12. Crystal structure of 1-(2,4-dimethylphenyl-2-(4-trimethylsilyl-1H-1,2,3-triazol-1-ylethanone

    Directory of Open Access Journals (Sweden)

    G. B. Venkatesh

    2014-12-01

    Full Text Available The asymmetric unit of the title compound, C15H21N3OSi, contains two molecules with similar conformations (r.m.s. overlay fit for the 20 non-H atoms = 0.163 Å. The dihedral angles between the planes of the 1,2,3-triazole and 2,4-dimethylbenzene rings are 27.0 (3 and 19.5 (3°. In the crystal, molecules are linked by very weak C—H...O and C—H...N hydrogen bonds to generate [100] chains. The chains are cross-linked by C—H...π interactions.

  13. First-principles study of Mg incorporation at wurtzite InN (0 0 0 1) and (0001-bar) surfaces

    International Nuclear Information System (INIS)

    Ding, S.F.; Qu, X.P.; Fan, G.H.

    2009-01-01

    In this article we investigate the energetics of Mg adsorption and incorporation at the InN(0 0 0 1) and InN(0001-bar) surfaces by the method of total energy plane-wave expansions with ultra-soft pseudo potential technology based on the density functional theory (DFT) in the generalized approximation (GGA). It is found that for a 1/4 monolayer (ML) coverage of the InN(0 0 0 1) surface, Mg atoms preferentially adsorb at the bridge sites and T4 sites, but they are unstable when compared with Mg incorporated in the first three layers. For a 1/4 ML coverage of the InN(0001-bar) surface, Mg atoms preferentially adsorb at the H3 sites with the formation energy of -3.49 (eV/(2x2) supercell), which is lower than that of the T4 sites, and the formation energy increases with increasing magnesium coverage. Further study shows that the formation energy for Mg atom is lower than that of In atom, which indicates that magnesium adsorption is more favorable in these conditions.

  14. Association of glutathione S-transferase (GSTM1, T1 and P1 gene polymorphisms with type 2 diabetes mellitus in north Indian population

    Directory of Open Access Journals (Sweden)

    Bid H

    2010-01-01

    Full Text Available Background: Diabetes mellitus is associated with an increased production of reactive oxygen species (ROS and a reduction in antioxidant defense. The oxidative stress becomes evident as a result of accumulation of ROS in conditions of inflammation and Type 2 diabetes mellitus (T2DM. The genes involved in redox balance, which determines the susceptibility to T2DM remain unclear. In humans, the glutathione S-transferase (GST family comprises several classes of GST isozymes, the polymorphic variants of GSTM1, T1 and P1 genes result in decreased or loss of enzyme activity. Aims: The present study evaluated the effect of genetic polymorphisms of the GST gene family on the risk of developing T2DM in the North Indian population. Settings and Design: GSTM1, T1 and P1 polymorphisms were genotyped in 100 T2DM patients and 200 healthy controls from North India to analyze their association with T2DM susceptibility. Materials and Methods: Analysis of GSTM1 and GSTT1 gene polymorphisms was performed by multiplex polymerase chain reaction (PCR and GSTP1 by PCR-Restriction Fragment Length Polymorphism (RFLP. Statistical Analysis: Fisher′s exact test and χ2 statistics using SPSS software (Version-15.0. Results: We observed significant association of GSTM1 null (P=0.004, OR= 2.042, 95%CI= 1.254-3.325 and GSTP1 (I/V (P=0.001, OR= 0.397, 95%CI=0.225-0.701 with T2DM and no significant association with GSTT1 (P=0.493. The combined analysis of the three genotypes GSTM1 null, T1 present and P1 (I/I demonstrated an increase in T2DM risk (P= 0.005, OR= 2.431 95% CI=1.315-4.496. Conclusions: This is the first study showing the association of a combined effect of GSTM1, T1 and P1 genotypes in a representative cohort of Indian patients with T2DM. Since significant association was seen in GSTM1 null and GSTP1 (I/V and multiple association in GSTM1 null, T1 present and P1 (I/I, these polymorphisms can be screened in the population to determine the diabetic risk.

  15. Genetic Characterization of H1N1 and H1N2 Influenza A Viruses Circulating in Ontario Pigs in 2012.

    Directory of Open Access Journals (Sweden)

    Helena Grgić

    Full Text Available The objective of this study was to characterize H1N1 and H1N2 influenza A virus isolates detected during outbreaks of respiratory disease in pig herds in Ontario (Canada in 2012. Six influenza viruses were included in analysis using full genome sequencing based on the 454 platform. In five H1N1 isolates, all eight segments were genetically related to 2009 pandemic virus (A(H1N1pdm09. One H1N2 isolate had hemagglutinin (HA, polymerase A (PA and non-structural (NS genes closely related to A(H1N1pdm09, and neuraminidase (NA, matrix (M, polymerase B1 (PB1, polymerase B2 (PB2, and nucleoprotein (NP genes originating from a triple-reassortant H3N2 virus (tr H3N2. The HA gene of five Ontario H1 isolates exhibited high identity of 99% with the human A(H1N1pdm09 [A/Mexico/InDRE4487/09] from Mexico, while one Ontario H1N1 isolate had only 96.9% identity with this Mexican virus. Each of the five Ontario H1N1 viruses had between one and four amino acid (aa changes within five antigenic sites, while one Ontario H1N2 virus had two aa changes within two antigenic sites. Such aa changes in antigenic sites could have an effect on antibody recognition and ultimately have implications for immunization practices. According to aa sequence analysis of the M2 protein, Ontario H1N1 and H1N2 viruses can be expected to offer resistance to adamantane derivatives, but not to neuraminidase inhibitors.

  16. Measurement of B(t ---> Wb)/B(t ---> Wq) at s**(1/2) = 1.96-TeV

    Energy Technology Data Exchange (ETDEWEB)

    Abazov, V.M.; Abbott, B.; Abolins, M.; Acharya, B.S.; Adams, M.; Adams, T.; Agelou, M.; Agram, J.-L.; Ahn, S.H.; Ahsan, M.; Alexeev, G.D.; /Buenos Aires U. /Rio de

    2006-03-01

    The authors present the measurement of R = {Beta}(t {yields} Wb)/{Beta}(t {yields} Wq) in p{bar p} collisions at {radical}s = 1.96 TeV, using 230 pb{sup -1} of data collected by the D0 experiment at the Fermilab Tevatron Collider. They fit simultaneously R and the number (N{sub t{bar t}}) of selected top quark pairs (t{bar t}), to the number of identified b-quark jets in events with one electron or one muon, three or more jets, and high transverse energy imbalance. To improve sensitivity, kinematical properties of events with no identified b-quark jets are included in the fit. They measure R = 1.03{sub -0.17}{sup +0.19}(stat+syst), in good agreement with the standard model. They set lower limits of R > 0.61 and |V{sub tb}| > 0.78 at 95% confidence level.

  17. Efficient white organic light-emitting devices using a thin 4,4'-bis(2,2'-diphenylvinyl)-1,1'-diphenyl layer

    International Nuclear Information System (INIS)

    Wang Jun; Yu Junsheng; Li Lu; Tang Xiaoqing; Jiang Yadong

    2008-01-01

    White organic light-emitting devices (OLEDs) were fabricated using phosphorescent material bis[2-(4-tert-butylphenyl)benzothiazolato-N,C 2' ]iridium (acetylacetonate) [(t-bt) 2 Ir(acac)] doped in 4,4'-bis(carbazol-9-yl) biphenyl (CBP) matrix as a yellow light-emitting layer and a thin layer 4,4'-bis(2,2'-diphenylvinyl)-1,1'-diphenyl (DPVBi) as the blue light-emitting layer. The light colour of the OLEDs can be adjusted by changing doped concentration and the thickness of the DPVBi thin layer. The maximum luminance and power efficiency of 5% doped device reached 15 460 cd m -2 and 8.1 lm W -1 , respectively. The 3% doped device showed the CIE coordinates of (0.344, 0.322) at 8 V and a maximum power efficiency of 5.7 lm W -1 at 4.5 V

  18. Comparison of T1rho and T2 mapping of knee articular cartilage in an asymptomatic population

    Energy Technology Data Exchange (ETDEWEB)

    Yoon, Min A; Hong, Suk Joo; Im, A Lan [Dept. of Radiology, Korea University Guro Hospital, Korea University College of Medicine, Seoul (Korea, Republic of); Kang, Chang Ho [Dept. of Radiology, Korea University Anam Hospital, Korea University College of Medicine, Seoul (Korea, Republic of); Kim, Baek Hyun [Dept. of Radiology, Korea University Ansan Hospital, Korea University College of Medicine, Ansan (Korea, Republic of); Kim, In Seong [Siemens Healthcare, Seoul (Korea, Republic of)

    2016-11-15

    To analyze subregional differences in T1rho (T1ρ) and T2 values and their correlation in asymptomatic knee cartilage, and to evaluate angular dependence with magic angles. Six asymptomatic volunteers underwent knee MRI with T1ρ and T2 mapping. T1ρ and T2 values were measured by two radiologists independently, at nine subregions in the medial femoral condyle (MFC) cartilage, at angles of ± 0°, 15°, 35°, 55°, 75° respective to a vertical line (B0) bisecting the width of the distal femur, and at two locations in the patella. Subregional values of T1ρ and T2 were analyzed and significant differences in three divided portions of the MFC (anterior, central, and posterior) were statistically evaluated. Correlation between T1ρ and T2 and angular dependence with magic angles were also assessed for statistical significance. T1ρ values were lowest at +15° and highest at -55°. T2 values were lowest at +75° and highest at +35°. Both T1ρ and T2 were higher in superior patella than inferior patella. T1ρ showed significant differences in the three divided portions of the MFC, while T2 showed significant differences only between central and posterior portions. There was a weak correlation between T1ρ and T2 (r = 0.217, p = 0.127). T1ρ showed more angular dependence than T2. T1ρ and T2 showed different subregional values and angular dependence in asymptomatic knee cartilage with a weak correlation. Awareness of these differences will aid in assessment of cartilage in a specific subregion of the knee.

  19. Dissociative adsorption of CCl 4 on the Fe 3O 4(1 1 1)-(2×2) selvedge of α-Fe 2O 3(0 0 0 1)

    Science.gov (United States)

    Adib, K.; Mullins, D. R.; Totir, G.; Camillone, N.; Fitts, J. P.; Rim, K. T.; Flynn, G. W.; Osgood, R. M.

    2003-02-01

    The surface reactions of CCl 4 with the Fe 3O 4(1 1 1)-(2×2) selvedge of naturally occurring α-Fe 2O 3(0 0 0 1) single-crystals have been investigated using synchrotron X-ray photoelectron spectroscopy (XPS) and temperature-programmed desorption (TPD). CCl 4 was found to dissociate on the Fe 3O 4 surface at 100 K producing chemisorbed Cl and adsorbed CCl 2. TPD shows that the large majority of the dissociatively adsorbed CCl 2 fragments extract lattice oxygen and desorb as phosgene at >275 K. However, the XPS spectra show no evidence for the formation of surface-bound phosgene, at 100 K, indicating that its formation involves two steps. The first step, dissociation, is spontaneous at 100 K, whereas the second, oxygen atom abstraction to form phosgene, requires thermal excitation. Cl chemisorption yielded two separate species, the mono- and dichloride terminations of surface iron sites. The identification of these two surface terminations is based on the coverage dependence and the surface temperature history of their Cl 2p 3/2 peak intensity. For example, heating to >450 K allows the monochloride to transform into iron dichloride, indicating Cl adatom mobility at these temperatures.

  20. Main: 1M2Q [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1M2Q トウモロコシ Corn Zea mays L. Casein Kinase Ii, Alpha Chain Name=Ack2; Zea Mays Mole...cule: Casein Kinase Ii, Alpha Chain; Chain: A; Fragment: Catlytic Subunit; Synonym: Ckii; Engineered: Yes Tr...ansferase 2.7.1.37 (Casein Kinase Ii, Alpha Chain) E.De Moliner, S.Sarno, S.Moro, G.Zagotto, G.Zanotti, L.A....=2-326.|PDB; 1M2Q; X-ray; A=2-328.|PDB; 1M2R; X-ray; A=2-328.|PDB; 1OM1; X-ray; A=1-332.|Mai

  1. Understanding the stability of Fe incorporation within Mn_3N_2(0 0 1) surfaces: An ab-initio study

    International Nuclear Information System (INIS)

    Guerrero-Sánchez, J.; Mandru, Andrada-Oana; Takeuchi, Noboru; Cocoletzi, Gregorio H.; Smith, Arthur R.

    2016-01-01

    Graphical abstract: - Highlights: • The Fe incorporation into inner layers of the Mn_3N_2 surfaces is stable in all range of chemical potential. • Displaced Mn atoms forming cluster-like structures induce the stability of incorporated Fe atoms. • Antiferromagnetic alignment in the [0 0 1] direction and in-plane Ferromagnetic Fe–Fe and Fe–Mn alignments are the same as in Mn_3N_2 bulk structure. • Incorporated Fe layers contribute to the metallic character of these surfaces. - Abstract: We present first principles spin-polarized calculations of the adsorption and incorporation of iron in the Mn_3N_2(0 0 1) surfaces. By means of a surface formation energy criterion, it is demonstrated that Fe incorporation is energetically stable for all studied surfaces. An Fe bilayer formation is achieved after Fe atoms displace Mn atoms in the sub-surface N-vacancy layers. An analysis of the magnetic coupling shows an antiferromagnetic alignment along the [0 0 1] direction as in the clean, ideal surfaces. Also, the in-plane magnetic coupling between Fe–Fe and Fe–Mn shows a ferromagnetic tendency, similar to the clean, ideally terminated surfaces. These results clearly indicate that Fe behaves like Mn when adsorbed into the Mn_3N_2 surface. Density of states calculations of the stable structures show a slight deviation from the antiferromagnetic-like behavior, with the most important contribution around the Fermi level coming from the Fe-d and Mn-d orbitals.

  2. Successful Completion of the Pilot Phase of a Randomized Controlled Trial Comparing Sentinel Lymph Node Biopsy to No Further Axillary Staging in Patients with Clinical T1-T2 N0 Breast Cancer and Normal Axillary Ultrasound.

    Science.gov (United States)

    Cyr, Amy E; Tucker, Natalia; Ademuyiwa, Foluso; Margenthaler, Julie A; Aft, Rebecca L; Eberlein, Timothy J; Appleton, Catherine M; Zoberi, Imran; Thomas, Maria A; Gao, Feng; Gillanders, William E

    2016-08-01

    Axillary surgery is not considered therapeutic in patients with clinical T1-T2 N0 breast cancer. The importance of axillary staging is eroding in an era in which tumor biology, as defined by biomarker and gene expression profile, is increasingly important in medical decision making. We hypothesized that axillary ultrasound (AUS) is a noninvasive alternative to sentinel lymph node biopsy (SLNB), and AUS could replace SLNB without compromising patient care. Patients with clinical T1-T2 N0 breast cancer and normal AUS were eligible for enrollment. Subjects were randomized to no further axillary staging (arm 1) vs SLNB (arm 2). Descriptive statistics were used to describe the results of the pilot phase of the randomized controlled trial. Sixty-eight subjects were enrolled in the pilot phase of the trial (34 subjects in arm 1, no further staging; 32 subjects in arm 2, SLNB; and 2 subjects voluntarily withdrew from the trial). The median age was 61 years (range 40 to 80 years) in arm 1 and 59 years (range 31 to 81 years) in arm 2, and there were no significant clinical or pathologic differences between the arms. Median follow-up was 17 months (range 1 to 32 months). The negative predictive value (NPV) of AUS for identification of clinically significant axillary disease (>2.0 mm) was 96.9%. No axillary recurrences have been observed in either arm. Successful completion of the pilot phase of the randomized controlled trial confirms the feasibility of the study design, and provides prospective evidence supporting the ability of AUS to exclude clinically significant disease in the axilla. The results provide strong support for a phase 2 randomized controlled trial. Copyright © 2016 American College of Surgeons. Published by Elsevier Inc. All rights reserved.

  3. Ligand effects on single-electron transfer of isolated iron atoms in the gaseous complexes [(OC)(m)Fe(OH2)(n)](+) (m, n=0-2, m plus n=1, 2)

    Czech Academy of Sciences Publication Activity Database

    Karlický, F.; Otyepka, M.; Schröder, Detlef

    2012-01-01

    Roč. 330, 15 Dec (2012), s. 95-99 ISSN 1387-3806 R&D Projects: GA ČR GBP208/12/G016 Grant - others:GA ČR(CZ) GPP208/11/P463; European Regional Development Fund(XE) CZ.1.05/2.1.00/03.0058; GA MŠk(CZ) EE2.3.20.0017 Program:EE Institutional support: RVO:61388963 Keywords : electron transfer * iron carbonyl * microhydration * neutralization-reionization mass * spectrometry * redox transitions Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.142, year: 2012

  4. (2-Formyl-6-methoxyphenolato-κ2O1,O2(perchlorato-κO(1,10-phenanthroline-κ2N,N′copper(II

    Directory of Open Access Journals (Sweden)

    Zhi-Yong Wu

    2008-05-01

    Full Text Available In the title molecule, [Cu(C8H7O3(ClO4(C12H8N2], the CuII ion is five-coordinated by two N atoms [Cu—N = 1.995 (3 and 2.022 (3 Å] from a 1,10-phenanthroline ligand, two O atoms [Cu—O = 1.908 (2 and 1.927 (2 Å] from an o-vanillin ligand and one O atom [Cu—O = 2.510 (3 Å] from a perchlorate anion in a distorted square-pyramidal geometry. Three O atoms of the perchlorate anion are rotationally disordered between two orientations, with occupancies of 0.525 (13 and 0.475 (13. In the crystal structure, two molecules related by a centre of symmetry are paired in such a way that the phenolate O atom from one molecule completes the distorted octahedral Cu coordination in another molecule [Cu...O = 2.704 (2 Å].

  5. Contribution to the study of {pi}N {yields} {pi}{sub 1}{pi}{sub 2}N reactions with creation of an intermediate N{sup *}{sub 3/2} {sub (1236)} isobar from 0.4 to 1.5 GeV; Contribution a l'etude des reactions {pi}N {yields} {pi}{sub 1}{pi}{sub 2}N avec creation d'un isobare intermediaire N{sup *}{sub 3/2} {sub (1236)} de 0.4 a 1.5 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Merlo, J P [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires. Division de la Physique, Departement de Physique des Particules Elementaires

    1976-07-01

    The one pion production reaction {pi}{sup +}p {yields} {pi}{sup +}p{pi}{sup 0} has been studied up to 1.5 GeV. The {pi}{sup 0} angular distribution measured by counter techniques has been compared to bubble chamber data. Angular distributions are interpreted in the hypothesis of formation of the intermediate N{sup *}{sub 3/2}(1236) isobar. Angular distributions for isobar production and decay in one pion production reactions {pi}N {yields} {pi}{sub 1}N{sup *} (N{sup *} {yields} {pi}{sub 2}N], are calculated in chapter II. {pi}{sup +}p {yields} {pi}{sup +}p{pi}{sup 0} experimental results are reported and analyzed in chapter III. An estimation of the pion-isobar partial wave amplitudes in reaction {pi}{sup +}p {yields} {pi}{sup 0}N{sup *++}{sub 3/2}(1236) has been tempted. Comparison with {pi}{sup +}p phase shift analyses is made. Bubble chamber data for {pi}{sup -}p {yields} {pi}{sup -}{pi}{sup +}n channel are presented at the end of chapter III. (author) [French] La reaction de production d'un pion {pi}{sup +}p {yields} {pi}{sup +}p{pi}{sup 0} a ete etudiee jusqu'a 1.5 GeV. La distribution angulaire du {pi}{sup 0} mesuree par la technique des compteurs a ete comparee aux resultats de chambre a bulles. Les distributions angulaires sont interpretees dans l'hypothese de la formation de l'isobare N{sup *}{sub 3/2}(1236) intermediaire. Les distributions angulaires de production et de desintegration de l'isobare dans les reactions de production d'un pion, {pi}N {yields} {pi}{sub 1}N{sup *} (N{sup *} {yields} {pi}{sub 2}N], sont calculees au second chapitre. Les resultats experimentaux de la voie {pi}{sup +}p {yields} {pi}{sup +}p{pi}{sup 0} sont presentes et analyses au troisieme chapitre. Une evaluation des amplitudes d'ondes partielles de production de l'isobare N{sup *}{sub 3/2}(1236) dans la reaction {pi}{sup +}p {yields} {pi}{sup 0}N{sup *++}{sub 3/2}(1236) a ete tentee. Une comparaison est faite avec les analyses en dephasages de l'interaction {pi}{sup +}p. Les

  6. In-situ SCC observation on thermally-sensitized type 304 stainless steel irradiated to 1 x 10{sup 25} n/m{sup 2}

    Energy Technology Data Exchange (ETDEWEB)

    Nakano, J.; Nemoto, Y.; Tsukada, T.; Usami, K. [Japan Atomic Energy Agency, Tokai-mura, Naga-gun, Ibaraki-ken (Japan); Hide, K. [Central Research Institute of Electric Power Industry, Yokosuka-shi, Kanagawa-ken (Japan)

    2007-07-01

    Full text of publication follows: Irradiation assisted stress corrosion cracking (IASCC) is concerned as being one of the specific problems for water-cooled first wall/blanket components in the design activity of international thermonuclear experimental reactor (ITER). To examine the crack initiation and growth behaviors of IASCC, in-situ observation on gage length of specimens was conducted during slow strain rate tests (SSRT) in high temperature water. Results from in-situ observation on Type 304 stainless steel (SS) irradiated to 1.0 x 10{sup 26} n/m{sup 2} have been reported already. Type 304 SS was subjected to a solution annealing (SA), a thermally sensitization (TS) or a cold working (CW, 20%) and irradiated to 1.0 x 10{sup 25} n/m{sup 2} in the Japan Materials Testing Reactor (JMTR). After neutron irradiation, SSRT for the specimens was conducted in oxygenated high purity water at 561 K. The gage length of the specimen was observed through a window equipped on an autoclave during the SSRT. Subsequently, fracture surface examination was performed using a scanning electron microscope (SEM). In fracture surface examination of the specimens irradiated to 1.0 x 10{sup 25} n/m{sup 2}, almost entire intergranular stress corrosion cracking (IGSCC) was exhibited for the TS material while mixtures of transgranular stress corrosion cracking (TGSCC) and ductile dimple fracture were observed for the SA and the CW materials. Although crack initiation was observed immediately after maximum stress for the CW irradiated to 1.0 x 10{sup 26} n/m{sup 2}, crack initiation was observed immediately before maximum stress (99% of maximum stress) for the CW irradiated to 1.0 x 10{sup 25} n/m{sup 2} in in-situ observation. (authors)

  7. Calculation of the single lepton SUSY analysis limits in the cMSSM m0-m1/2 plane

    CERN Document Server

    Megas, Efstathios

    2014-01-01

    The goal of the summer student project was the calculation of the single lepton SUSY analysis limits in the cMSSM $m_0$-$m_{1/2}$ plane. To this end, the analysis code, the production of the ntuples and a familarization with the higgs combination tool was needed.

  8. T1rho, T{sub 2} and focal knee cartilage abnormalities in physically active and sedentary healthy subjects versus early OA patients - a 3.0-Tesla MRI study

    Energy Technology Data Exchange (ETDEWEB)

    Stahl, Robert [University of California, San Francisco, Musculoskeletal and Quantitative Imaging Group, Department of Radiology, San Francisco, CA (United States); University Hospitals-Campus Grosshadern, Ludwig Maximilians University of Munich, Department of Clinical Radiology, Munich (Germany); Luke, Anthony; Ma, C.B. [University of California, San Francisco, Department of Orthopedic Surgery, San Francisco, CA (United States); Li, Xiaojuan; Carballido-Gamio, Julio; Majumdar, Sharmila; Link, Thomas M. [University of California, San Francisco, Musculoskeletal and Quantitative Imaging Group, Department of Radiology, San Francisco, CA (United States)

    2009-01-15

    (1) To assess the degree of focal cartilage abnormalities in physically active and sedentary healthy subjects as well as in patients with early osteoarthritis (OA). (2) To determine the diagnostic value of T2 and T1rho measurements in identifying asymptomatic physically active subjects with focal cartilage lesions. Thirteen asymptomatic physically active subjects, 7 asymptomatic sedentary subjects, and 17 patients with mild OA underwent 3.0-T MRI of the knee joint. T1rho and T2 values, cartilage volume and thickness, as well as the WORMS scores were obtained. Nine out of 13 active healthy subjects had focal cartilage abnormalities. T1rho and T2 values in active subjects with and without focal cartilage abnormalities differed significantly (p<0.05). T1rho and T2 values were significantly higher (p<0.05) in early OA patients compared to healthy subjects. T1rho measurements were superior to T2 in differentiating OA patients from healthy subjects, yet T1rho was moderately age-dependent. (1) Active subjects showed a high prevalence of focal cartilage abnormalities and (2) active subjects with and without focal cartilage abnormalities had different T1rho and T2 composition of cartilage. Thus, T1rho and T2 could be a parameter suited to identify active healthy subjects at higher risk for developing cartilage pathology. (orig.)

  9. Data of evolutionary structure change: 1AIFL-2AI0L [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available /ss_2> 0 n> 1AIF L...n> 1AIFLn> VSSSI----SSSNL 2AI0 Ln> 2AI0L...1AIFL-2AI0L 1AIF 2AI0 L L DIQLTQSPAFMAASPGEKVTITCSVSSSI----SSSNLH...line> SER CA 273 SER CA 260 ASN CA 337 LEU CA 408

  10. Visible-light-driven g-C{sub 3}N{sub 4}/Ti{sup 3+}-TiO{sub 2} photocatalyst co-exposed {0 0 1} and {1 0 1} facets and its enhanced photocatalytic activities for organic pollutant degradation and Cr(VI) reduction

    Energy Technology Data Exchange (ETDEWEB)

    Lu, Dan; Zhang, Gaoke, E-mail: gkzhang@whut.edu.cn; Wan, Zhen

    2015-12-15

    Graphical abstract: Schematic illustration for the mechanism of photo-generated charge carrier transfers in g-C{sub 3}N{sub 4}/Ti{sup 3+}-TiO{sub 2} photocatalyst and its visible-light photocatalytic performance. - Highlights: • g-C{sub 3}N{sub 4}/Ti{sup 3+}-TiO{sub 2} composite co-exposed {0 0 1} and {1 0 1} facets of TiO{sub 2} was synthesized. • RhB and Cr(VI) aqueous solutions were used to evaluate the photocatalytic activities. • h{sup +} and ·O{sub 2}{sup −} are the critical reactive species in the degradation of RhB solution. • Surface heterojunction of co-exposed {1 0 1} and {0 0 1} facets improve the separation. - Abstract: Novel g-C{sub 3}N{sub 4/}Ti{sup 3+}-TiO{sub 2} photocatalyst co-exposed {0 0 1} and {1 0 1} facets of TiO{sub 2} was synthesized via a hydrothermal–sonication assisted strategy. The photocatalytic activities of the as-obtained photocatalyst were evaluated by the degradation of rhodamine B (RhB) and the reduction of Cr(VI) under visible-light irradiation. It was found that the g-C{sub 3}N{sub 4}/Ti{sup 3+}-TiO{sub 2} composites with 6 wt% g-C{sub 3}N{sub 4} exhibited the highest visible-light photocatalytic efficiency, which is also higher than the pure g-C{sub 3}N{sub 4} and Ti{sup 3+}-TiO{sub 2}. A possible photocatalytic mechanism was discussed on the basis of the theoretical analyses and scavenger experiments. Results show that holes (h{sup +}) and superoxide anions (·O{sub 2}{sup −}) reactive species participated in the degradation of RhB solution over the g-C{sub 3}N{sub 4}/Ti{sup 3+}-TiO{sub 2} composites. The enhanced photocatalytic activities of g-C{sub 3}N{sub 4}/Ti{sup 3+}-TiO{sub 2} composites can be attributed to the wide optical adsorption of g-C{sub 3}N{sub 4} and Ti{sup 3+} as well as the effectively separation and transportation of photo-generated electrons and holes pairs, which was resulted from the surface heterojunction between the g-C{sub 3}N{sub 4} and Ti{sup 3+}-TiO{sub 2} nanosheets co-exposed {1

  11. Single-Crystal X-Ray Diffraction Studies of Homologues in the Series nBa(Nb,Zr)O 3+3 mNbO with n=2, 3, 4, 5 and m=1

    Science.gov (United States)

    Nilsson, G.; Svensson, G.

    2001-01-01

    Single crystals of four homologues in the series nBa(Nb,Zr)O3+3mNbO, with n:m=2:1, 3:1, 4:1, and 5:1, were found in the reduced Ba-Nb-Zr-O system. Single-crystal X-ray diffraction data were collected for all the crystals. For all homologues the space group was found to be P4/mmm. The structures can be described as intergrowths of Ba(Nb,Zr)O3 perovskite and NbO slabs. The refined cell parameters and compositions of the 2:1, 3:1, and 4:1 homologues are a=4.1768(5) Å and c=12.269(2) Å for Ba2Nb4.5(1)Zr0.5(1)O9, a=4.1769(5) Å and c=16.493(3) Å for Ba3+δNb4.8(2)-δ Zr1.2(2)O12-δ (δ=0.098(4)), and a=4.1747(6) Å and c= 20.619(4) Å for Ba4+δNb5.1(4)-δZr1.9(4)O15-δ (δ=0.270(9)). The refined cell parameters of the 5:1 homologue are a=4.1727(3) Å and c=24.804(3) Å. Zr replaces Nb only in the NbO6 octahedra found in the perovskite slabs.

  12. Relaxation times T1, T2, and T2{sup *} of apples, pears, citrus fruits, and potatoes with a comparison to human tissues; T1-, T2- und T2{sup *}-Relaxationswerte von Aepfeln, Birnen, Zitrusfruechten und Kartoffeln im Vergleich zu menschlichen Geweben

    Energy Technology Data Exchange (ETDEWEB)

    Werz, Karin; Braun, Hans; Vitha, Dominik; Bruno, Graziano; Martirosian, Petros; Steidle, Guenter; Schick, Fritz [Tuebingen Univ. (Germany). Sektion fuer Experimentelle Radiologie

    2011-07-01

    The aim of the project was a systematic assessment of relaxation times of different fruits and vegetables and a comparison to values of human tissues. Results provide an improved basis for selection of plant phantoms for development of new MR techniques and sequences. Vessels filled with agar gel are mostly used for this purpose, preparation of which is effortful and time-consuming. In the presented study apples, (malus, 8 species), pears, (pyrus, 2 species), citrus fruits (citrus, 5 species) and uncooked potatoes (solanum tuberosum, 8 species) from the supermarket were examined which are easily available nearly all-the-year. T1, T2 and T2{sup *} relaxation times of these nature products were measured on a 1.5 Tesla MR system with adapted examination protocols and mono-exponential fitting, and compared to literature data of human parenchyma tissues, fatty tissue and body fluid (cerebrospinal fluid). Resulting values were as follows: apples: T1: 1486 - 1874 ms, T2: 163 - 281 ms, T2{sup *}: 2,3 - 3,2 ms; pears: T1: 1631 - 1969 ms, T2: 119 - 133 ms, T2{sup *}: 10,1 - 10,6 ms, citrus fruits (pulp) T1: 2055 - 2632 ms, T2: 497 - 998 ms, T2{sup *}: 151 - 182 ms; citrus fruits (skin) T1: 561 - 1669 ms, T2: 93 - 119 ms; potatoes: T1: 1011 - 1459 ms, T2: 166 - 210 ms, T2{sup *}: 20 - 30 ms. All T1-values of the examined objects (except for potatoes and skins of citrus fruits) were longer than T1 values of human tissues. Also T2 values (except for pears and skins of citrus fruits) of the fruits and the potatoes tended to be longer. T2{sup *} values of apples, pears and potatoes were shorter than in healthy human tissue. Results show relaxation values of many fruits to be not exactly fitting to human tissue, but with suitable selection of the fruits and optionally with an adaption of measurement parameters one can achieve suitable contrast and signal characteristics for some purposes. (orig.)

  13. MR imaging of intracerebral hemorrhage lesions: Comparison of 2.0 T and 0.5 T images

    International Nuclear Information System (INIS)

    Han, Moon Hee; Chang, Kee Hyun

    1990-01-01

    Seventeen patients with intracerebral hemorrhage lesions were examined with magnetic resonance imaging at both 2.0 T and 0.5 T, in order to evaluate the capability of detecting and characterizing the hemorrhagic lesions at each field strength and to compare the signal intensities of the hemorrhages between both field strengths. The intervals between two imagings were within 2 hours in all patients except for 4 patients with subacute hematoma and occult cerebrovascular malformations in whom the intervals were 1 to 4 days. At each field strength, both T1 and T2-weighted spin echo(SE) images were obtained in all patients. All the hemorrhagic lesions were readily detected and characterized as hemorrhagic lesions at 2.0 T, whereas one lesion of chronic hemorrhage was not detected, and three lesions(one acute hemorrhage, one chronic hemorrhage and one occult cerebrovascular malformation) could not be characterized as hemorrhagic lesions at 0.5 T. There were statistically significant differences in signal intensity of the hematomas between 2.0 T and 0.5 T on proton density-weighted and T2-weighted images in cases of acute intracerebral hematomas: the hematomas seen as low intensity at 2.0 T appeared iso-or slightly high at 0.5 T. In conclusion, the intracerebral hematomas may be difficult to detect and to characterize with SE technique at 0.5 T, and then the gradient echo technique may be useful at 0.5 T

  14. SU-E-T-63: Carotid Sparing Tomohelical Three Dimensional Conformal Radiotherapy for T1N0 Glottic Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Hong, C; Ju, S; Ahn, Y; Oh, D; Noh, J; Chung, K; Kim, J; Han, Y; Choi, D [Department of Radiation Oncology, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of)

    2014-06-01

    Purpose: We investigated the dosimetric benefit and treatment efficiency of carotid-sparing TomoHelical (TH) three-dimensional conformal radiotherapy (3DCRT) for early glottic cancer. Methods: Computed tomography (CT) simulation was performed for 10 patients with early-stage (T1N0M0) glottic squamous cell carcinoma. The clinical target volume, planning target volume (PTV), carotid artery (CA), and spinal cord (SP) were delineated for each CT data set. Two-field 3DCRT (2F-3DCRT), three-field intensity-modulated radiation therapy (IMRT) (3F-IMRT), TomoHelical-IMRT (TH-IMRT), and TH-3DCRT plans were generated, with a total prescribed dose of 67.5 Gy in 30 fractions to the PTV for each patient. In order to evaluate plan quality, dosimetric characteristics were compared in terms of the conformity index (CI) and homogeneity index (HI) for the PTV, V35, V50, and V63 for the CAs and in terms of the maximum dose for the SP. Additionally, treatment planning and delivery times were compared to evaluate treatment efficiency. Results: The CIs for 3F-IMRT (0.650±0.05), TH-IMRT (0.643±0.03), and TH-3DCRT (0.631±0.03) were much better than that for 2F-3DCRT (0.318±0.03). The HIs for TH-IMRT (1.053±0.01) and TH-3DCRT (1.055±0.01) were slightly better than those for 2F-3DCRT (1.062±0.01) and 3F-IMRT (1.091±0.007). 2F-3DCRT showed poor CA sparing in terms of the V35, V50, and V63 compared to 3F-IMRT, TH-IMRT, and TH-3DCRT (p<0.05), whereas there was no significant dose difference between 3F-IMRT, TH-IMRT, and TH-3DCRT (p>0.05). The maximum dose to the SP with all plans was below 45 Gy. The treatment planning times for 2F-3DCRT (5.9±0.66 min) and TH-3DCRT (7.32±0.94 min) were much lower than those for 3F-IMRT (45.51±2.76 min) and TH-IMRT (35.58±4.41 min), whereas the delivery times with all plans was below 3 minutes. Conclusion: TH-3DCRT showed excellent carotid sparing capability, comparable to that with TH-IMRT, with high treatment efficiency and short planning and

  15. PGE{sub 2}-induced colon cancer growth is mediated by mTORC1

    Energy Technology Data Exchange (ETDEWEB)

    Dufour, Marc, E-mail: Marc.dufour@chuv.ch; Faes, Seraina, E-mail: Seraina.faes@chuv.ch; Dormond-Meuwly, Anne, E-mail: Anne.meuwly-Dormond@chuv.ch; Demartines, Nicolas, E-mail: Demartines@chuv.ch; Dormond, Olivier, E-mail: Olivier.dormond@chuv.ch

    2014-09-05

    Highlights: • PGE{sub 2} activates mTORC1 in colon cancer cells. • Inhibition of mTORC1 blocks PGE{sub 2} induced colon cancer cell growth. • mTORC1 is a signaling intermediary in PGE{sub 2} induced colon cancer cell responses. - Abstract: The inflammatory prostaglandin E{sub 2} (PGE{sub 2}) cytokine plays a key role in the development of colon cancer. Several studies have shown that PGE{sub 2} directly induces the growth of colon cancer cells and furthermore promotes tumor angiogenesis by increasing the production of the vascular endothelial growth factor (VEGF). The signaling intermediaries implicated in these processes have however not been fully characterized. In this report, we show that the mechanistic target of rapamycin complex 1 (mTORC1) plays an important role in PGE{sub 2}-induced colon cancer cell responses. Indeed, stimulation of LS174T cells with PGE{sub 2} increased mTORC1 activity as observed by the augmentation of S6 ribosomal protein phosphorylation, a downstream effector of mTORC1. The PGE{sub 2} EP{sub 4} receptor was responsible for transducing the signal to mTORC1. Moreover, PGE{sub 2} increased colon cancer cell proliferation as well as the growth of colon cancer cell colonies grown in matrigel and blocking mTORC1 by rapamycin or ATP-competitive inhibitors of mTOR abrogated these effects. Similarly, the inhibition of mTORC1 by downregulation of its component raptor using RNA interference blocked PGE{sub 2}-induced LS174T cell growth. Finally, stimulation of LS174T cells with PGE{sub 2} increased VEGF production which was also prevented by mTORC1 inhibition. Taken together, these results show that mTORC1 is an important signaling intermediary in PGE{sub 2} mediated colon cancer cell growth and VEGF production. They further support a role for mTORC1 in inflammation induced tumor growth.

  16. 4d N=1 from 6d (1,0)

    Energy Technology Data Exchange (ETDEWEB)

    Razamat, Shlomo S. [Physics Department, Technion,Haifa, 32000 (Israel); Vafa, Cumrun [Jefferson Physical Laboratory, Harvard University,Cambridge, MA 02138 (United States); Zafrir, Gabi [Physics Department, Technion,Haifa, 32000 (Israel); Kavli IPMU (WPI), UTIAS, the University of Tokyo,Kashiwa, Chiba 277-8583 (Japan)

    2017-04-11

    We study the geometry of 4d N=1 SCFT’s arising from compactification of 6d (1,0) SCFT’s on a Riemann surface. We show that the conformal manifold of the resulting theory is characterized, in addition to moduli of complex structure of the Riemann surface, by the choice of a connection for a vector bundle on the surface arising from flavor symmetries in 6d. We exemplify this by considering the case of 4d N=1 SCFT’s arising from M5 branes probing ℤ{sub k} singularity compactified on a Riemann surface. In particular, we study in detail the four dimensional theories arising in the case of two M5 branes on ℤ{sub 2} singularity. We compute the conformal anomalies and indices of such theories in 4d and find that they are consistent with expectations based on anomaly and the moduli structure derived from the 6 dimensional perspective.

  17. Effect of Sintering Temperature on Microstructure, Chemical Stability and Electrical Properties of Transition Metal or Yb-Doped BaZr0.1Ce0.7Y0.1M0.1O3-δ (M = Fe, Ni, Co and Yb

    Directory of Open Access Journals (Sweden)

    Behzad eMirfakhraei

    2014-03-01

    Full Text Available Perovskite-type BaZr0.1Ce0.7Y0.1M0.1O3-δ (M = Fe, Ni, Co and Yb (BZCY-M oxides were synthesized using the conventional solid-state reaction method at 1350-1550 oC in air in order to investigate the effect of dopants on sintering, crystal structure, chemical stability under CO2 and H2S, and electrical transport properties. The formation of the single-phase perovskite-type structure with an orthorhombic space group Imam was confirmed by Rietveld refinement using powder X-ray diffraction (PXRD for the Fe, Co, Ni and Yb-doped samples. The BZCY-Co and BZCY-Ni oxides show a total electrical conductivity of 0.01 and 8 × 10-3 Scm-1 at 600 oC in wet H2 with an activation energy of 0.36 and 0.41 eV, respectively. Scanning electron microscopy (SEM and energy-dispersive X-ray analysis (EDX revealed Ba and Co rich secondary phase at the grain-boundaries, which may explain the enhancement in the total conductivity of the BZCY-Co. However, ex-solution of Ni at higher sintering temperatures, especially at 1550 oC, decreases the total conductivity of the BZCY-Ni material. The Co and Ni dopants act as a sintering aid and form dense pellets at a lower sintering temperature of 1250 oC. The Fe, Co and Ni-doped BZCY-M samples synthesized at 1350 oC show stability in 30 ppm H2S/H2 at 800 oC, and increasing the firing temperature to 1550 oC, enhanced the chemical stability in CO2 / N2 (1: 2 at 25-900 oC. The BZCY-Co and Ni compounds with high conductivity in wet H2 could be considered as possible anodes for intermediate temperature solid oxide fuel cells (IT-SOFCs.

  18. Interaction of photoactive cis(CO)-trans(I)-Ru-(4,4‧-dicarboxylate-2,2‧-bipyridine)(CO)2I2 with anatase (1 0 1) surface

    Science.gov (United States)

    Haukka, Matti; Hirva, Pipsa

    2002-06-01

    The coordination of cis(CO)-trans(I)-Ru(4,4‧-dicarboxylate-2,2‧-bipyridine)(CO)2I2 on an anatase (1 0 1) surface was investigated using a computational density functional method. The adsorbate is able to interact with the anatase surface by one or two carboxylate substituents of the bipyridine ligand. Three of the studied coordination modes involved a single carboxylate as the binding group, including monodentate (1M), bidentate chelating (1BC) and bidentate bridging (1BB) modes. The possibility of monodentate binding via both carboxylate groups in (2M) was also studied. The results showed that the multidentate binding is clearly preferred over monodentate coordination. The stability of the modes increased in the order 1M, 1BC, 1BB and 2M. The flexibility of the bipyridine ligand was found to be the key factor in the binding via two carboxylate groups.

  19. (nBuCp)2ZrCl2-catalyzed Ethylene-4M1P Copolymerization: Copolymer Backbone Structure, Melt Behavior, and Crystallization

    KAUST Repository

    Atiqullah, Muhammad

    2016-01-08

    The judicious design of methylaluminoxane (MAO) anions expands the scope for developing industrial metallocene catalysts. Therefore, the effects of MAO anion design on the backbone structure, melt behavior, and crystallization of ethylene−4-methyl-1-pentene (E−4M1P) copolymer were investigated. Ethylene was homopolymerized, as well as copolymerized with 4M1P, using (i) MAO anion A (unsupported [MAOCl2]−) premixed with dehydroxylated silica, (nBuCp)2ZrCl2, and Me2SiCl2; and (ii) MAO anion B (Si−O−Me2Si−[MAOCl2]−) supported with (nBuCp)2ZrCl2 on Me2SiCl2-functionalized silica. Unsupported Me2SiCl2, opposite to the supported analogue, acted as a co-chain transfer agent with 4M1P. The modeling of polyethylene melting and crystallization kinetics, including critical crystallite stability, produced insightful results. This study especially illustrates how branched polyethylene can be prepared from ethylene alone using particularly one metallocene-MAO ion pair, and how a compound, that functionalizes silica as well as terminates the chain, can synthesize ethylene−α-olefin copolymers with novel structures. Hence, it unfolds prospective future research niches in polyethyne systhesis. This article is protected by copyright. All rights reserved.

  20. Global behavior of the difference equation $x_{n+1}=\\frac{Ax_{n-1}} {B-Cx_{n}x_{n-2}}$

    Directory of Open Access Journals (Sweden)

    R. Abo-Zeid

    2013-11-01

    Full Text Available The aim of this work is to investigate the global stability, periodic nature, oscillation and the boundedness of all admissible solutions of the difference equation $x_{n+1}=\\frac{Ax_{n-1}} {B-Cx_{n}x_{n-2}}$, n=0,1,2,... where A, B, C are positive real numbers.

  1. Neutron electric dipole moment using N{sub f}=2+1+1 twisted mass fermions

    Energy Technology Data Exchange (ETDEWEB)

    Alexandrou, C.; Athenodorou, A.; Constantinou, M.; Hadjiyiannakou, K. [Cyprus Univ., Nicosia (Cyprus). Dept. of Physics; The Cyprus Institute, Nicosia (Cyprus). Computation-based Science and Technology Research Center; Jansen, K. [Deutsches Elektronen-Synchrotron (DESY), Zeuthen (Germany). John von Neumann-Inst. fuer Computing NIC; Koutsou, G. [The Cyprus Institute, Nicosia (Cyprus). Computation-based Science and Technology Research Center; Ottnad, K. [Cyprus Univ., Nicosia (Cyprus). Dept. of Physics; Bonn Univ. (Germany). Helmholtz-Institut fuer Strahlen- und Kernphysik; Bonn Univ. (Germany). Bethe Center for Theoretical Physics; Petschlies, M. [The Cyprus Institute, Nicosia (Cyprus). Computation-based Science and Technology Research Center; Bonn Univ. (Germany). Helmholtz-Institut fuer Strahlen- und Kernphysik; Bonn Univ. (Germany). Bethe Center for Theoretical Physics

    2016-03-15

    We evaluate the neutron electric dipole moment vertical stroke vector d{sub N} vertical stroke using lattice QCD techniques. The gauge configurations analyzed are produced by the European Twisted Mass Collaboration using N{sub f}=2+1+1 twisted mass fermions at one value of the lattice spacing of a ≅0.082 fm and a light quark mass corresponding to m{sub π}≅373 MeV. Our approach to extract the neutron electric dipole moment is based on the calculation of the CP-odd electromagnetic form factor F{sub 3}(Q{sup 2}) for small values of the vacuum angle θ in the limit of zero Euclidean momentum transfer Q{sup 2}. The limit Q{sup 2}→0 is realized either by adopting a parameterization of the momentum dependence of F{sub 3}(Q{sup 2}) and performing a fit, or by employing new position space methods, which involve the elimination of the kinematical momentum factor in front of F{sub 3}(Q{sup 2}). The computation in the presence of a CP-violating term requires the evaluation of the topological charge Q. This is computed by applying the cooling technique and the gradient flow with three different actions, namely the Wilson, the Symanzik tree-level improved and the Iwasaki action. We demonstrate that cooling and gradient flow give equivalent results for the neutron electric dipole moment. Our analysis yields a value of vertical stroke vector d{sub N} vertical stroke =0.045(6)(1) anti θ e.fm for the ensemble with m{sub π}=373 MeV considered.

  2. Optimal MR pulse sequences for hepatic hemangiomas : comparison of T2-weighted turbo-spin-echo, T2-weighted breath-hold turbo-spin-echo, and T1-weighted FLASH dynamic imaging

    International Nuclear Information System (INIS)

    Wang, Wen Chao; Choi, Byung Ihn; Han, Joon Koo; Kim, Tae Kyoung; Cho, Soon Gu

    1997-01-01

    To optimize MR imaging pulse sequences in the imaging of hepatic hemangioma and to evaluate on dynamic MR imaging the enhancing characteristics of the lesions. Twenty patients with 35 hemangiomas were studied by using Turbo-spin-echo (TSE) sequence (T2-weighted, T2- and heavily T2-weighted breath-hold) and T1-weighted FLASH imaging acquired before, immediately on, and 1, 3 and 5 minutes after injection of a bolus of Gd-DTPA (0.1mmol/kg). Phased-array multicoil was employed. Images were quantitatively analyzed for lesion-to-liver signal difference to noise ratios (SD/Ns), and lesion-to-liver signal ratios (H/Ls), and qualitatively analyzed for lesion conspicuity. The enhancing characteristics of the hemangiomas were described by measuring the change of signal intensity as a curve in T1-weighted FLASH dynamic imaging. For T2-weighted images, breath-hold T2-weighted TSE had a slightly higher SD/N than other pulse sequences, but there was no statistical difference in three fast pulse sequences (p=0.211). For lesion conspicuity, heavily T2-weighted breath-hold TSE images was superior to T2-weighted breath-hold or non-breath-hold TSE (H/L, 5.75, 3.81, 2.87, respectively, p<0.05). T2-weighted breath-hold TSE imaging was more effective than T2-weighted TSE imaging in removing lesion blurring or lack of sharpness, and there was a 12-fold decrease in acquisition time (20sec versus 245 sec). T1-weighted FLASH dynamic images of normal liver showed peak enhancement at less than 1 minute, and of hemangioma at more than 3 minutes;the degree of enhancement for hemangioma decreased after a 3 minute delay. T2-weighed breath-hold TSE imaging and Gd-DTPA enhanced FLASH dynamic imaging with 5 minutes delay are sufficient for imaging hepatic hemangiomas

  3. Cardiac cine MRI: Comparison of 1.5 T, non-enhanced 3.0 T and blood pool enhanced 3.0 T imaging

    International Nuclear Information System (INIS)

    Gerretsen, S.C.; Versluis, B.; Bekkers, S.C.A.M.; Leiner, T.

    2008-01-01

    Introduction: Cardiac cine imaging using balanced steady state free precession sequences (bSSFP) suffers from artefacts at 3.0 T. We compared bSSFP cardiac cine imaging at 1.5 T with gradient echo imaging at 3.0 T with and without a blood pool contrast agent. Materials and methods: Eleven patients referred for cardiac cine imaging underwent imaging at 1.5 T and 3.0 T. At 3.0 T images were acquired before and after administration of 0.03 mmol/kg gadofosveset. Blood pool signal-to-noise ratio (SNR), temporal variations in SNR, ejection fraction and myocardial mass were compared. Subjective image quality was scored on a four-point scale. Results: Blood pool SNR increased with more than 75% at 3.0 T compared to 1.5 T (p < 0.001); after contrast administration at 3.0 T SNR increased with 139% (p < 0.001). However, variations in blood pool SNR at 3.0 T were nearly three times as high versus those at 1.5 T in the absence of contrast medium (p < 0.001); after contrast administration this was reduced to approximately a factor 1.4 (p = 0.21). Saturation artefacts led to significant overestimation of ejection fraction in the absence of contrast administration (1.5 T: 44.7 ± 3.1 vs. 3.0 T: 50.7 ± 4.2 [p = 0.04] vs. 3.0 T post contrast: 43.4 ± 2.9 [p = 0.55]). Subjective image quality was highest for 1.5 T (2.8 ± 0.3), and lowest for non-enhanced 3.0 T (1.7 ± 0.6; p = 0.006). Conclusions: GRE cardiac cine imaging at 3.0 T after injection of the blood pool agent gadofosveset leads to improved objective and subjective cardiac cine image quality at 3.0 T and to the same conclusions regarding cardiac ejection fraction compared to bSSFP imaging at 1.5 T

  4. Magnetism of Bi2Sr2Can-1CunO2n+4+δ (n = 1,2,3)

    International Nuclear Information System (INIS)

    Ishida, T.; Koga, K.; Kanoda, K.; Takahashi, T.

    1992-01-01

    The normal-state dc susceptibility χ dc of the Bi 2 Sr 2 Ca n-1 Cu n O 2n+4+δ (n=1, 2, 3) pellet is of the order of +10 -7 emu/g. A large Curie-Weiss component is found in χ dc and the ESR spin susceptibility χ ESR of the pulverized 2201, 2212 and 2223 samples but it almost disappears by annealing. The relative magnitudes of χ ESR to χ dc for the annealed powders are dissimilar among the three phases: ESR of the 2201 sample is silent, χ ESR of the 2212 phase has almost the same magnitude as χ dc and χ ESR of the 2223 phase is appreciable but smaller than χ dc . (orig.)

  5. Role of Neck Dissection in Clinical T3N0M0 Lesion of Oral Cavity: Changing Trend.

    Science.gov (United States)

    Dass, Arjun; Singhal, Surinder K; Punia, Rps; Gupta, Nitin; Verma, Hitesh; Budhiraja, Shilpi; Salaria, Minakshi

    2017-08-01

    Neck dissection is an important part in the management of head and neck malignancies especially in terms of control of nodal metastasis. The study is focused on evaluating the profile of lymph nodes in T 3 N 0 M 0 lesion of different subsides of oral cavity. To evaluate the utility of neck dissection in T 3 N 0 M 0 stage of carcinomas of the different region of oral cavity. Ninety patients aged 20 to 70 years underwent treatment for carcinoma of the oral cavity at our center between 2005 and 2013. Of these, 39 patients were stage T 3 N 0 M 0 and underwent excision of the primary lesion with neck dissection. The data were collected retrospectively from hospital record library. These patients were evaluated clinically, radiologically and compared with intra operative finding. Addition of radiotherapy was decided on final histopathology. Out of 39 patients, the site of primary tumour in 21 patients was tongue, in 13 patients was Buccal Mucosa (BM), in 2 patients was lip and in 3 patients was Floor of Mouth (FOM) with tongue. In patients with clinically negative neck nodes, ultrasonography and intra-operative examination revealed the presence of suspicious nodes in 35.9% and 30.7% cases respectively. Occult metastasis in the nodes was identified on histopathological examination in 15 patients (38.5%). A total of 14 patients of carcinoma of tongue and one patient of BM showed positive nodes on histopathology. These patients with positive neck nodes on histopathology, were sent for postoperative radiotherapy. At follow up examination, four patients showed local and distal recurrence and they were managed accordingly. Out of 39 patients, 11 patients of BM, 2 patients of lip, 1 patient of FOM and 6 patients of tongue were disease free in last follow up. Selective neck dissection is an effective therapeutic intervention in patients without clinically involved neck nodes. It can upstage the tumour and additional treatment may be advised. In patients with carcinoma of buccal

  6. N-(1-Acryloyl-2,2,6,6-tetramethylpiperidin-4-ylacrylamide

    Directory of Open Access Journals (Sweden)

    Shailesh K. Goswami

    2011-11-01

    Full Text Available The title compound, C15H24N2O2, crystallizes with two unique molecules, (I and (II, in the asymmetric unit, differing in the orientation of the acryloyl units with respect to the piperidine rings. The acrylamide units are essentially planar in both molecules (r.m.s. deviations = 0.042 and 0.024 Å, respectively, as are the C3N chains of the acryloyl units. The carbonyl O atoms of the acryloyl systems lie significantly out of these planes, viz. by −0.171 (9 Å for molecule (I and by 0.33 (1 Å for molecule (II. The acrylamide and acryloyl planes are inclined at 68.7 (4° and 59.8 (3° in the two molecules. The piperidine rings each adopt twist boat conformations. In the crystal, strong N—H...O hydrogen bonds link the molecules into zigzag C(4 chains along b. Additional C—H...O contacts result in the formation of stacks along a.

  7. Macrophage polarisation: an immunohistochemical approach for identifying M1 and M2 macrophages.

    Directory of Open Access Journals (Sweden)

    Mário Henrique M Barros

    Full Text Available Macrophage polarization is increasingly recognised as an important pathogenetic factor in inflammatory and neoplastic diseases. Proinflammatory M1 macrophages promote T helper (Th 1 responses and show tumoricidal activity. M2 macrophages contribute to tissue repair and promote Th2 responses. CD68 and CD163 are used to identify macrophages in tissue sections. However, characterisation of polarised macrophages in situ has remained difficult. Macrophage polarisation is regulated by transcription factors, pSTAT1 and RBP-J for M1, and CMAF for M2. We reasoned that double-labelling immunohistochemistry for the detection of macrophage markers together with transcription factors may be suitable to characterise macrophage polarisation in situ. To test this hypothesis, we have studied conditions associated with Th1- and Th2-predominant immune responses: infectious mononucleosis and Crohn's disease for Th1 and allergic nasal polyps, oxyuriasis, wound healing and foreign body granulomas for predominant Th2 response. In all situations, CD163+ cells usually outnumbered CD68+ cells. Moreover, CD163+ cells, usually considered as M2 macrophages, co-expressing pSTAT1 and RBP-J were found in all conditions examined. The numbers of putative M1 macrophages were higher in Th1- than in Th2-associated diseases, while more M2 macrophages were seen in Th2- than in Th1 related disorders. In most Th1-related diseases, the balance of M1 over M2 cells was shifted towards M1 cells, while the reverse was observed for Th2-related conditions. Hierarchical cluster analysis revealed two distinct clusters: cluster I included Th1 diseases together with cases with high numbers of CD163+pSTAT1+, CD68+pSTAT1+, CD163+RBP-J+ and CD68+RBP-J+ macrophages; cluster II comprised Th2 conditions together with cases displaying high numbers of CD163+CMAF+ and CD68+CMAF+ macrophages. These results suggest that the detection of pSTAT1, RBP-J, and CMAF in the context of CD68 or CD163 expression is a

  8. Macrophage polarisation: an immunohistochemical approach for identifying M1 and M2 macrophages.

    Science.gov (United States)

    Barros, Mário Henrique M; Hauck, Franziska; Dreyer, Johannes H; Kempkes, Bettina; Niedobitek, Gerald

    2013-01-01

    Macrophage polarization is increasingly recognised as an important pathogenetic factor in inflammatory and neoplastic diseases. Proinflammatory M1 macrophages promote T helper (Th) 1 responses and show tumoricidal activity. M2 macrophages contribute to tissue repair and promote Th2 responses. CD68 and CD163 are used to identify macrophages in tissue sections. However, characterisation of polarised macrophages in situ has remained difficult. Macrophage polarisation is regulated by transcription factors, pSTAT1 and RBP-J for M1, and CMAF for M2. We reasoned that double-labelling immunohistochemistry for the detection of macrophage markers together with transcription factors may be suitable to characterise macrophage polarisation in situ. To test this hypothesis, we have studied conditions associated with Th1- and Th2-predominant immune responses: infectious mononucleosis and Crohn's disease for Th1 and allergic nasal polyps, oxyuriasis, wound healing and foreign body granulomas for predominant Th2 response. In all situations, CD163+ cells usually outnumbered CD68+ cells. Moreover, CD163+ cells, usually considered as M2 macrophages, co-expressing pSTAT1 and RBP-J were found in all conditions examined. The numbers of putative M1 macrophages were higher in Th1- than in Th2-associated diseases, while more M2 macrophages were seen in Th2- than in Th1 related disorders. In most Th1-related diseases, the balance of M1 over M2 cells was shifted towards M1 cells, while the reverse was observed for Th2-related conditions. Hierarchical cluster analysis revealed two distinct clusters: cluster I included Th1 diseases together with cases with high numbers of CD163+pSTAT1+, CD68+pSTAT1+, CD163+RBP-J+ and CD68+RBP-J+ macrophages; cluster II comprised Th2 conditions together with cases displaying high numbers of CD163+CMAF+ and CD68+CMAF+ macrophages. These results suggest that the detection of pSTAT1, RBP-J, and CMAF in the context of CD68 or CD163 expression is a suitable tool for

  9. Mechanical Properties of Aerojet, Thiokol, and JA2 High-Energy Gun Propellants at 1.5 m/s Deformation Rate

    Science.gov (United States)

    2002-01-01

    a2 6 n -32 4C La /C A> i c 4S Figure 5. Remains of specimens tested at 210, 630, and -32 0C. 5 I AUg 2001 "-1t AERQJET/"THIDKOL LOTS 0111W PM 4-40.00...10.00 +78.00 STRESS (Mra) -THIOKOL LOT LA -10T3--01 +5.C THIOKOL LOT JA-IEZ35--Z-02 JAZ LOT HCL03JO14-001 -28.00 AE J>:T? +0.00 4.00 0.0 .0 *20.0 O30 +40M0...WARREN MI 48397-5000 MATERIAL SCIENCE TEAM AMSSB RSS 14 BENET LABORATORIES J HERBERT AMSTA AR CCB M SENNETT R FISCELLA KANSAS ST M SOJA NATICK MA 01760

  10. The Sr2.75Ce0.25Co2O7-δ oxide, n=2 member of the Ruddlesden-Popper series: Structural and magnetic evolution depending on oxygen stoichiometry

    International Nuclear Information System (INIS)

    Demont, A.; Hebert, S.; Pelloquin, D.; Maignan, A.

    2008-01-01

    The second member of the Ruddlesden-Popper series, n=2 in Sr n+1 Co n O 3n+1 , has been stabilized by substituting cerium for strontium leading to the pure compound Sr 2.75 Ce 0.25 Co 2 O 7-δ . The oxygen vacancies of this phase can be partially filled by a post-annealing oxidizing treatment with δ decreasing from 1.1 to 0.3 for the as-prepared and oxidized phases, respectively. As the samples are oxidized from δ∼1.1 to 0.3, the a and b unit cell parameters decrease from 3.836 to 3.815 A and from 20.453 to 20.047 A, respectively. Despite the average value of the cobalt valence state, V Co ∼+3.5, obtained in the oxidized Sr 2.75 Ce +4 0.25 Co 2 O 6.7 phase, a clear ferromagnetic state wit T C =175 K and M S =0.8 μB/Co is reached. - Graphical abstract: Temperature dependence of the magnetic susceptibility of as-prepared and PO 2 annealing Sr 2.75 Ce 0.25 Co 2 O 7-δ RP2-type structures

  11. Measurements of e p →e'π+n at 1.6 2.0 GeV and extraction of nucleon resonance electrocouplings at CLAS

    Science.gov (United States)

    Park, K.; Aznauryan, I. G.; Burkert, V. D.; Adhikari, K. P.; Amaryan, M. J.; Pereira, S. Anefalos; Avakian, H.; Battaglieri, M.; Badui, R.; Bedlinskiy, I.; Biselli, A. S.; Bono, J.; Briscoe, W. J.; Brooks, W. K.; Carman, D. S.; Celentano, A.; Chandavar, S.; Charles, G.; Colaneri, L.; Cole, P. L.; Contalbrigo, M.; Cortes, O.; Crede, V.; D'Angelo, A.; Dashyan, N.; De Vita, R.; De Sanctis, E.; Deur, A.; Djalali, C.; Doughty, D.; Dupre, R.; Egiyan, H.; Alaoui, A. El; Elouadrhiri, L.; Fassi, L. El; Eugenio, P.; Fedotov, G.; Fegan, S.; Fersch, R.; Filippi, A.; Fleming, J. A.; Garillon, B.; Garçon, M.; Gevorgyan, N.; Gilfoyle, G. P.; Giovanetti, K. L.; Girod, F. X.; Joo, H. S.; Goetz, J. T.; Golovatch, E.; Gothe, R. W.; Griffioen, K. A.; Guegan, B.; Guidal, M.; Guo, L.; Hakobyan, H.; Hanretty, C.; Hattawy, M.; Hicks, K.; Holtrop, M.; Hughes, S. M.; Hyde, C. E.; Ilieva, Y.; Ireland, D. G.; Ishkhanov, B. S.; Isupov, E. L.; Jenkins, D.; Jiang, H.; Jo, H. S.; Joo, K.; Joosten, S.; Keller, D.; Khandaker, M.; Kim, A.; Kim, W.; Klein, A.; Klein, F. J.; Kubarovsky, V.; Kuhn, S. E.; Kuleshov, S. V.; Lenisa, P.; Livingston, K.; Lu, H. Y.; MacGregor, I. J. D.; Markov, N.; Martinez, D.; McKinnon, B.; Mokeev, V.; Montgomery, R. A.; Moutarde, H.; Camacho, C. Munoz; Nadel-Turonski, P.; Niccolai, S.; Niculescu, G.; Niculescu, I.; Osipenko, M.; Ostrovidov, A. I.; Paolone, M.; Pasyuk, E.; Peng, P.; Phelps, W.; Phillips, J. J.; Pisano, S.; Pogorelko, O.; Price, J. W.; Procureur, S.; Prok, Y.; Protopopescu, D.; Puckett, A. J. R.; Raue, B. A.; Ripani, M.; Rizzo, A.; Rosner, G.; Rossi, P.; Roy, P.; Sabatié, F.; Salgado, C.; Schott, D.; Schumacher, R. A.; Seder, E.; Sharabian, Y. G.; Simonyan, A.; Skorodumina, Iu.; Smith, E. S.; Smith, G. D.; Sparveris, N.; Stoler, P.; Strakovsky, I. I.; Strauch, S.; Sytnik, V.; Taiuti, M.; Tang, W.; Taylor, C. E.; Tian, Ye; Trivedi, A.; Ungaro, M.; Voskanyan, H.; Voutier, E.; Walford, N. K.; Watts, D. P.; Wei, X.; Weinstein, L. B.; Wood, M. H.; Zachariou, N.; Zana, L.; Zhang, J.; Zhao, Z. W.; Zonta, I.; CLAS Collaboration

    2015-04-01

    Differential cross sections of the exclusive process e p →e'π+n were measured with good precision in the range of the photon virtuality Q2=1.8 -4.5 GeV2 and the invariant mass range of the π+n final state W =1.6 -2.0 GeV using the Continuous Electron Beam Accelerator Facility Large Acceptance Spectrometer. Data were collected with nearly complete coverage in the azimuthal and polar angles of the n π+ center-of-mass system. More than 37 000 cross-section points were measured. The contributions of the isospin I =1/2 resonances N (1675 ) 5/2-,N (1680 ) 5/2+ , and N (1710 ) 1/2+ were extracted at different values of Q2 using a single-channel, energy-dependent resonance amplitude analysis. Two different approaches, the unitary isobar model and the fixed-t dispersion relations, were employed in the analysis. We observe significant strength of the N (1675 ) 5/2- in the A1 /2 amplitude, which is in strong disagreement with quark models that predict both transverse amplitudes to be strongly suppressed. For the N (1680 ) 5/2+ we observe a slow changeover from the dominance of the A3 /2 amplitude at the real photon point (Q2=0 ) to a Q2 where A1 /2 begins to dominate. The scalar amplitude S1 /2 drops rapidly with Q2 consistent with quark model prediction. For the N (1710 ) 1/2+ resonance our analysis shows significant strength for the A1 /2 amplitude at Q2<2.5 GeV2.

  12. Crystal structure of 2-(thiophen-2-yl)-1-(5-thioxo-4,5-dihydro-1,3,4-oxadiazol-2-yl) ethenyl]benzamide: N,N-dimethylformamide (1 : 1)

    Energy Technology Data Exchange (ETDEWEB)

    Sharma, P. [University of Jammu, X-ray Crystallography Laboratory, Department of Physics (India); Subbulakshmi, K. N.; Narayana, B. [Mangalore University, Department of Chemistry (India); Sarojini, B. K. [Mangalore University, Industrial Chemistry Division, Department of Studies in Chemistry (India); Kant, R., E-mail: rkant.ju@gmail.com [University of Jammu, X-ray Crystallography Laboratory, Department of Physics (India)

    2016-03-15

    The title compound, 2-(thiophen-2-yl)-1-(5-thioxo-4,5-dihydro-1,3,4-oxadiazol-2-yl)ethenyl] benzamide:N,N-dimethylformamide (1: 1), (C{sub 15}H{sub 11}N{sub 3}O{sub 2}S{sub 2} · C{sub 3}H{sub 7}NO), was synthesized, and its structure was established by spectral analysis and X-ray diffraction studies. The compound crystallizes in the monoclinic space group P2{sub 1}/n with a = 10.8714(7), b = 9.0497(5), c = 19.8347(13) Å, β = 91.093(5)°, Z = 4. The crystal structure is stabilized by N–H···S, C–H···O and N–H···O hydrogen bonds. The π···π interactions are also observed between the rings.

  13. Maintenance of T1 response as induced during PEG-IFNalpha plus ribavirin therapy controls viral replication in genotype-1 patients with chronic hepatitis C La respuesta inmune T1 inducida durante el tratamiento con PEG-IFNα mαs ribavirina controla la replicaciσn viral en pacientes con hepatitis crónica C

    Directory of Open Access Journals (Sweden)

    M. Trapero

    2005-07-01

    Full Text Available Objectives: to analyze the T1/T2 cytokine profile in CD8 T cells from peripheral blood mononuclear cells from patients with genotype-1 CHC during treatment with pegylated interferon (Peg-IFN α2a plus ribavirin (RBV. To correlate Th1/Th2 balance with virological response. Patients and methods: in this prospective longitudinal study, a total of 28 naïve genotype-1 CHC patients received Peg-IFNα2a (180 µg/week plus RBV (1-1.2 g/day for 48 weeks. All patients (mean age 45 ± 8 years completed treatment and follow-up: 12 (43% achieved a sustained virological response (SVR, 13 relapsed after end of treatment (47%, and only 3 (10% were non-responders. Sixteen healthy controls were also analyzed (mean age 39 ± 17 years. The production of IL-4, IIFNγ, and TTNFα by CD8 T cells was measured by intracytoplasmic detection using flow cytometry in both resting and stimulated cells with a phorbol ester. Statistics: Student's t test for independent values, χ2 test, and ANOVA test were used; relapsers and non-responders were joined to achieve a higher statistical power. Results: at third month during treatment, phorbol ester-stimulated-IL-4 levels tend to be lower in patients who presented with SVR versus those who did not (0.97 vs 2.58; p = 0.1. No statistically significant differences were found in IIFNγ and TTNFα levels at month 3. At EOT, the stimulated-IIFNγ production was significantly higher in patients with SVR (20 vs. 8; p Objetivos: analizar el perfil de citocinas T1/T2 producidas por los linfocitos T CD8+ de sangre periférica en pacientes con hepatitis crónica C (HCC y genotipo 1 durante el tratamiento con interferón pegilado (Peg-IFN α2a y ribavirina (RBV y compararlos con controles sanos. Correlacionar el balance T1/T2 con la respuesta virológica al tratamiento combinado. Pacientes y métodos: en este estudio prospectivo longitudinal se incluyeron 28 pacientes naïve con HCC genotipo 1 tratados con Peg-IFNα2a (180 µg/semana más RBV

  14. Synthesis and characterization of La0.8Sr0.2Ni(1−xCrxO3 (x = 0.0, 0.2, 0.4, 0.6, 0.8, 1.0 system by the combustion method

    Directory of Open Access Journals (Sweden)

    Jairo Alberto Gómez-Cuaspud

    2017-11-01

    Full Text Available This research focuses on the synthesis and characterization of six ceramic perovskite oxides based on La0.8Sr0.2Ni(1−xCrxO3 system, with different levels of chromium modification (x = 0.0, 0.2, 0.4, 0.6, 0.8 and 1.0, for use as anode material in solid oxide fuel cells (SOFC. The oxides were obtained in two reaction stages, starting from corresponding nitrate salts and citric acid until formation of a solid metal complex consistent with citrate species. The solid metalorganic foams were calcined at 1000 °C for 120 min under oxygen flow conditions and were characterized by infrared and ultraviolet spectroscopy (FTIR-UV, validating the proposed methodology in terms of purity and chemical composition. The characterization by X-ray diffraction (XRD, scanning electron microscopy (SEM and X-ray energy dispersive spectroscopy (EDX confirms the obtention of a homogeneous perovskite structure in all analyzed phases. The evaluation of crystallite size by means of the Debye–Scherrer equation establishes a nanometric prevalence around 3.2–4.4 nm along main diffraction signals. The electrical characterization of materials by solid-state impedance spectroscopy allowed identifying a particular behavior depending on the microstructure of solids for potential applications in SOFC devices. Resumen: Esta investigación se centra en la síntesis y caracterización de seis óxidos de perovskita cerámicos basados en el sistema La0.8Sr0.2Ni(1-xCrxO3, con diferentes niveles de modificación de cromo (x = 0.0, 0.2, 0.4, 0.6, 0.8 y 1.0, para uso como material de ánodo en pilas de combustible de óxido sólido (SOFC. Los óxidos se obtuvieron en dos etapas de reacción, partiendo de las correspondientes sales de nitrato y ácido cítrico hasta la formación de un complejo metálico sólido consistente con especies de citrato. Las espumas sólidas metal-orgánicas se calcinaron a 1000° C

  15. High-resolution T{sub 2}-weighted cervical cancer imaging: a feasibility study on ultra-high-field 7.0-T MRI with an endorectal monopole antenna

    Energy Technology Data Exchange (ETDEWEB)

    Hoogendam, Jacob P.; Verheijen, Rene H.M.; Zweemer, Ronald P. [University Medical Centre Utrecht, Department of Gynaecological Oncology, UMC Utrecht Cancer Centre, PO Box 85500, Utrecht (Netherlands); Kalleveen, Irene M.L.; Castro, Catalina S.A. de; Raaijmakers, Alexander J.E.; Bosch, Maurice A.A.J. van den; Klomp, Dennis W.J.; Veldhuis, Wouter B. [University Medical Centre Utrecht, Department of Radiology, Utrecht (Netherlands)

    2017-03-15

    We studied the feasibility of high-resolution T{sub 2}-weighted cervical cancer imaging on an ultra-high-field 7.0-T magnetic resonance imaging (MRI) system using an endorectal antenna of 4.7-mm thickness. A feasibility study on 20 stage IB1-IIB cervical cancer patients was conducted. All underwent pre-treatment 1.5-T MRI. At 7.0-T MRI, an external transmit/receive array with seven dipole antennae and a single endorectal monopole receive antenna were used. Discomfort levels were assessed. Following individualised phase-based B{sub 1} {sup +} shimming, T{sub 2}-weighted turbo spin echo sequences were completed. Patients had stage IB1 (n = 9), IB2 (n = 4), IIA1 (n = 1) or IIB (n = 6) cervical cancer. Discomfort (ten-point scale) was minimal at placement and removal of the endorectal antenna with a median score of 1 (range, 0-5) and 0 (range, 0-2) respectively. Its use did not result in adverse events or pre-term session discontinuation. To demonstrate feasibility, T{sub 2}-weighted acquisitions from 7.0-T MRI are presented in comparison to 1.5-T MRI. Artefacts on 7.0-T MRI were due to motion, locally destructive B{sub 1} interference, excessive B{sub 1} under the external antennae and SENSE reconstruction. High-resolution T{sub 2}-weighted 7.0-T MRI of stage IB1-IIB cervical cancer is feasible. The addition of an endorectal antenna is well tolerated by patients. (orig.)

  16. T1-T2 dual-modal MRI of brain gliomas using PEGylated Gd-doped iron oxide nanoparticles.

    Science.gov (United States)

    Xiao, Ning; Gu, Wei; Wang, Hao; Deng, Yunlong; Shi, Xin; Ye, Ling

    2014-03-01

    To overcome the negative contrast limitations of iron oxide-based contrast agents and to improve the biocompatibility of Gd-chelate contrast agents, PEGylated Gd-doped iron oxide (PEG-GdIO) NPs as a T1-T2 dual-modal contrast agent were synthesized by the polyol method. The transverse relaxivity (r2) and longitudinal relaxivity (r1) of PEG-GdIO were determined to be 66.9 and 65.9 mM(-1) s(-1), respectively. The high r1 value and low r2/r1 ratio make PEG-GdIO NPs suitable as a T1-T2 dual-modal contrast agent. The in vivo MRI demonstrated a brighter contrast enhancement in T1-weighted image and a simultaneous darken effect in T2-weighted MR image compared to the pre-contrast image in the region of glioma. Furthermore, the biocompatibility of PEG-GdIO NPs was confirmed by the in vitro MTT cytotoxicity and in vivo histological analyses (H&E). Therefore, PEG-GdIO NPs hold great potential in T1-T2 dual-modal imaging for the diagnosis of brain glioma. Copyright © 2013 Elsevier Inc. All rights reserved.

  17. Synthesis of LiNi0.8Co0.1Mn0.1O2 cathode material by chloride co-precipitation method

    Institute of Scientific and Technical Information of China (English)

    李灵均; 李新海; 王志兴; 伍凌; 郑俊超; 李金辉

    2010-01-01

    LiNi0.8Co0.1Mn0.1O2 was prepared by a chloride co-precipitation method and characterized by thermogravimetric analysis, X-ray diffractometry with Rietveld refinement,electron scanning microscopy and electrochemical measurements.Effects of lithium ion content and sintering temperature on physical and electrochemical performance of LiNi0.8Co0.1Mn0.1O2 were also investigated. The results show that the sample synthesized at 750℃with 105%lithium content has fine particle sizes around 200 nm and homogenous sizes distribution.The initial discharge capacity for the powder is 184 mA·h/g between 2.7 and 4.3 V at 0.1C and room temperature.

  18. Formation of epitaxial Al 2O 3/NiAl(1 1 0) films: aluminium deposition

    Science.gov (United States)

    Lykhach, Y.; Moroz, V.; Yoshitake, M.

    2005-02-01

    Structure of epitaxial Al 2O 3 layers formed on NiAl(1 1 0) substrates has been studied by means of reflection high-energy electron diffraction (RHEED). The elucidated structure was compared to the model suggested for 0.5 nm-thick Al 2O 3 layers [K. Müller, H. Lindner, D.M. Zehner, G. Ownby, Verh. Dtsch. Phys. Ges. 25 (1990) 1130; R.M. Jaeger, H. Kuhlenbeck, H.J. Freund, Surf. Sci. 259 (1991) 235]. The stepwise growth of Al 2O 3 film, involving deposition and subsequent oxidation of aluminium onto epitaxial 0.5 nm-thick Al 2O 3 layers, has been investigated. Aluminium was deposited at room temperature, whereas its oxidation took place during annealing at 1070 K. The Al 2O 3 thickness was monitored by means of Auger electron spectroscopy (AES). It was found that Al 2O 3 layer follows the structure of 0.5 nm thick Al 2O 3 film, although a tilting of Al 2O 3(1 1 1) surface plane with respect to NiAl(1 1 0) surface appeared after Al deposition.

  19. Transport and thermoelectric properties of n-type Ruddlesden-Popper phase (Sr1-xGdx)3(Ti1-yTay)2O7 oxides

    International Nuclear Information System (INIS)

    Sun, R R; Qin, X Y; Li, L L; Li, D; Zhang, J; Wang, Q Q

    2012-01-01

    The transport and thermoelectric properties of (Sr 1-x Gd x ) 3 (Ti 1-y Ta y ) 2 O 7 (x = 0.05, y = 0.05-0.15; x = 0.1, y = 0.05-0.1) compounds with Ruddlesden-Popper (RP) phase, prepared by a conventional solid-state reaction method plus spark plasma sintering (SPS), were investigated in the temperature range from 300 to 1000 K. The results indicate that the electrical resistivity ρ for all compounds increases with temperature, and has a relation ρ ∝ T M (i.e. the mobility μ ∝ T -M ) with M = 1.58-1.92 at T ≳ 650 K, indicating that the phonon scattering is predominant. Basically, the absolute value of the Seebeck coefficient |S| increases almost linearly with temperature above ∼400 K, showing degenerated semiconducting behaviour. Moreover, both ρ and |S| decrease with the increase in both Ta and Gd content, which can be attributed to an increase in the carrier concentration. The lattice thermal conductivity κ L of the compounds decreases monotonically with an increase in both Ta and Gd content due to mass-defect phonon scattering, and the lowest κ L (κ L = 3.3 W K -1 m -1 at room temperature and 2.0 W K -1 m -1 at 1000 K) is achieved in (Sr 0.9 Gd 0.1 ) 3 (Ti 0.9 Ta 0.1 ) 2 O 7 . Among all the compounds investigated here, the largest dimensionless figure of merit ZT = 0.08 (at 1000 K) is obtained in the compound (Sr 0.9 Gd 0.1 ) 3 (Ti 0.95 Ta 0.05 ) 2 O 7 .

  20. Type 1 Responses of Human Vγ9Vδ2 T Cells to Influenza A Viruses▿

    Science.gov (United States)

    Qin, Gang; Liu, Yinping; Zheng, Jian; Ng, Iris H. Y.; Xiang, Zheng; Lam, Kwok-Tai; Mao, Huawei; Li, Hong; Peiris, J. S. Malik; Lau, Yu-Lung; Tu, Wenwei

    2011-01-01

    γδ T cells are essential constituents of antimicrobial and antitumor defenses. We have recently reported that phosphoantigen isopentenyl pyrophosphate (IPP)-expanded human Vγ9Vδ2 T cells participated in anti-influenza virus immunity by efficiently killing both human and avian influenza virus-infected monocyte-derived macrophages (MDMs) in vitro. However, little is known about the noncytolytic responses and trafficking program of γδ T cells to influenza virus. In this study, we found that Vγ9Vδ2 T cells expressed both type 1 cytokines and chemokine receptors during influenza virus infection, and IPP-expanded cells had a higher capacity to produce gamma interferon (IFN-γ). Besides their potent cytolytic activity against pandemic H1N1 virus-infected cells, IPP-activated γδ T cells also had noncytolytic inhibitory effects on seasonal and pandemic H1N1 viruses via IFN-γ but had no such effects on avian H5N1 or H9N2 virus. Avian H5N1 and H9N2 viruses induced significantly higher CCL3, CCL4, and CCL5 production in Vγ9Vδ2 T cells than human seasonal H1N1 virus. CCR5 mediated the migration of Vγ9Vδ2 T cells toward influenza virus-infected cells. Our findings suggest a novel therapeutic strategy of using phosphoantigens to boost the antiviral activities of human Vγ9Vδ2 T cells against influenza virus infection. PMID:21752902

  1. Contribution to the study of πN→π1π2N reactions with creation of an intermediate N*sub(3/2) (1236) isobare from 0.4 to 1.5 GeV

    International Nuclear Information System (INIS)

    Merlo, J.P.

    1976-10-01

    The one pion production reaction π + p→π + pπ 0 has been studied up to 1.5 GeV. The π 0 angular distribution measured by counter techniques has been compared to bubble chamber data. Angular distributions are interpreted in the hypothesis of formation of the intermediate N*sub(3/2) (1236) isobar. Angular distributions for isobar production and decay in one pion production reactions πN→π 1 N* (N*→π 2 N) are calculated. π + p→π + pπ 0 experimental results are reported and analyzed. An estimation of the pion-isobar partial wave amplitudes in reaction π + p→π 0 N*sub(3/2)sup(++) (1236) has been tempted. Comparison with π + p phase shift analyses is made. Bubble chamber data for π - p→π - π + n channel are presented [fr

  2. 5-[(3-Fluorophenyl(2-hydroxy-6-oxocyclohex-1-en-1-ylmethyl]-6-hydroxy-1,3-dimethylpyrimidine-2,4(1H,3H-dione

    Directory of Open Access Journals (Sweden)

    Assem Barakat

    2016-09-01

    Full Text Available 5-[(3-Fluorophenyl(2-hydroxy-6-oxocyclohex-1-en-1-yl-methyl]-6-hydroxy-1,3-di-methylpyrimidine-2,4(1H,3H-dione 3 was synthesized via a multicomponent reaction. The Aldol–Michael addition reactions of N,N-dimethylbarbituric acid, cyclohexane-1,3-dione, and 3-fluorobenzaldehyde in aqueous solution gave the product in high yield. The molecular structure of the compound was confirmed by spectroscopic methods and X-ray crystallography. The title compound (C19H19FN2O5·H2O crystallizes in the Monoclinic form, P21/c, a = 7.8630 (5 Å, b = 20.0308 (13 Å, c = 11.3987 (8 Å, β = 104.274 (3°, V = 1739.9 (2° Å3, Z = 4, Rint = 0.117, wR(F2 = 0.124, T = 100 K.

  3. Calculation of parity violating effects in the 62P/sub 1/2/-72P/sub 1/2/ forbidden M1 transition in thallium

    International Nuclear Information System (INIS)

    Neuffer, D.B.

    1977-05-01

    Calculations are presented of the E1 amplitude expected in forbidden M1 transitions of Tl and Cs if parity is violated in the neutral weak e-N interaction, as proposed in a number of gauge models, including that of Weinberg and Salam. Valence electron wave functions are generated as numerical solutions to the Dirac equation in a modified Tietz central potential. These wave functions are used to calculate allowed E1 transition rates, hfs splittings, and Stark E1 transition ampitudes. These results are compared with experiment and the agreement is generally good. The relativistic Tl 6 2 P/sub 1/2/-7 2 P/sub 1/2/ M1 transition amplitude M is also calculated, and corrections due to interconfiguration interaction, Breit interaction, and hfs mixing are included. The parity violating E1 amplitude E/sub PV/ is calculated and a value for the circular dichroism in the Weinberg model delta = -2.6 x 10 -3 is obtained. Parity violating effects in other Tl transitions are discussed. Contributions to the M1 amplitude for the forbidden Cs 6 2 S/sub 1/2/-7 2 S/sub 1/2/ and 6 2 S/sub 1/2/-8 2 S/sub 1/2/ transitions and to the Cs 6 2 S/sub 1/2/ g-factor anomaly from relativistic effects, Breit interaction, interconfiguration interaction, and hfs mixing are calculated, and it is found that this current theoretical description is not entirely adequate. The parity violating E1 amplitude E/sub PV/ for the 6S/sub 1/2/-7 2 S/sub 1/2/ and 6S/sub 1/2/-8 2 S/sub 1/2/ transitions is evaluated. With a measured value M/sub expt/ and the Weinberg value Q/sub W/ = -99, a circular dichroism delta = 1.64 x 10 -4 for the 6 2 S/sub 1/2/-7 2 S/sub 1/2/ transition is found

  4. Effect of Sb{sub 2}O{sub 3} on the electrical properties of Ba{sub 0.9}Ca{sub 0.1}Zr{sub 0.1}Ti{sub 0.9}O{sub 3} ceramics fabricated using nanocrystals seed

    Energy Technology Data Exchange (ETDEWEB)

    Parjansri, P. [Rajamangala University of Technology Krungthep, Physics Division, Faculty of Science and Technology, Bangkok (Thailand); Intatha, U. [Mae Fah Luang University, School of Science, Chiang Rai (Thailand); Guo, R.; Bhalla, A.S. [University of Texas at San Antonio, Department of Electrical and Computer Engineering, Faculty of Engineering, San Antonio, TX (United States); Eitssayeam, S. [Chiang Mai University, Department of Physics and Materials Science, Faculty of Science, Chiang Mai (Thailand); Chiang Mai University, Materials Science Research Center, Faculty of Science, Chiang Mai (Thailand)

    2016-09-15

    This work was to investigate the effects of antimony oxide (Sb{sub 2}O{sub 3}) on the electrical properties of Ba{sub 0.9}Ca{sub 0.1}Zr{sub 0.1}Ti{sub 0.9}O{sub 3} (BCZT) ceramics and was prepared by adding 1 mol% of BCZT nanocrystals. The seed is nanocrystals of BCZT which was synthesized by the molten salt method. The ceramics powders were prepared by the mixed oxide method using BaCO{sub 3}, CaCO{sub 3}, ZrO{sub 2}, TiO{sub 2} as starting materials, and the BCZT seed was added as nanocrystal for induce phase transition. They were doped with x mol% Sb{sub 2}O{sub 3} (x = 0.0-0.5). Results indicated that all samples show pure perovskite phase. The Sb{sub 2}O{sub 3} enhanced the electrical properties of the ceramic systems. Excellent values of a dielectric constant (ε {sub r}) at room temperature (T{sub r}) were 4086 with sample of x = 0.5, and at Curie temperature (T{sub c}) was 15,485 for samples with x = 0.1. The highest remnant polarization (P{sub r}), piezoelectric charge coefficient (d{sub 33}), piezoelectric voltage coefficient (g{sub 33}), electromechanical coefficient for planar mode (k{sub p}) and thickness mode (k{sub t}) values were 6.3 μC/cm{sup 2}, 346 pC/N, 15.6 x 10{sup -3} Vm/N, 42 and 41 %, respectively, which were obtained for the sample of x = 0.2 mol% Sb. (orig.)

  5. Raman study of HgBa 2Ca n-1 Cu nO 2 n+2+ δ ( n=1,2,3,4 and 5) superconductors

    Science.gov (United States)

    Zhou, Xingjiang; Cardona, M.; Chu, C. W.; Lin, Q. M.; Loureiro, S. M.; Marezio, M.

    1996-02-01

    Polarized micro-Raman scattering measurements have been performed on the five members of the HgBa 2Ca n-1 Cu nO 2 n+2+ δ ( n=1,2,3,4 and 5) high- Tc superconductor family using different laser frequencies. Local laser annealing measurements were carried out to investigate the variation of the Raman spectra with the excess oxygen content, δ. A systematic evolution of the spectra, which display mainly peaks near 590, 570, 540 and 470 cm -1, with increasing number of CuO 2 layers has been observed; its origin has been shown to lie in the variation of the interstitial oxygen content. In addition to confirming that the 590 cm -1 mode represents vibration of apical oxygens in the absence of neighboring excess oxygen, the 570 cm -1 mode, which may be composed of some finer structures, has been assigned to the vibration of the apical oxygen modified by the presence of the neighboring excess oxygens. The 540 and 470 cm -1 modes may represent the direct vibration of excess oxygens. The implication of possible different distribution sites of excess oxygens is discussed. All other observed lower-frequency modes are also assigned.

  6. Clinical study of T1 and T2 laryngeal cancers. Key points for laryngeal preservation

    International Nuclear Information System (INIS)

    Nasu, Takashi; Koike, Shuji; Inamura, Hiroo; Aoyagi, Masaru; Namura, Tadashi

    2004-01-01

    Between 1989 and 2003, we treated 129 patients with T1 and T2 laryngeal cancers. The purpose of this study was to estimate the management of T1 and T2 laryngeal cancers, referring to the relationship with the T classification, subtype, treatment, prognosis and laryngeal preservation. The treatment plan for T1 and T2 laryngeal cancers is fundamentally radiotherapy. To raise the laryngeal preservation rate, concurrent chemoradiotherapy by FAR therapy, carboplatin (CBDCA), docetaxel (DOC) and laser treatment was performed for the T2 cases. The 5-year survival rates of the T1 and T2 cases were 94.7% and 94.8%, respectively. The 5-year laryngeal preservation rates of the T1 and T2 cases were 97.1% and 72.3%, respectively. The 5-year survival rates of the glottic cancer and supraglottic cancer cases were 96.7% and 87.0% and the 5-year laryngeal preservation rates of these cases were 97.1% and 57.2%, respectively. Particularly in T2 supraglottic laryngeal cancer, the laryngeal preservation rate is not improved even with concurrent chemoradiotherapy by CBDCA and FAR therapy. To improve the laryngeal preservation rate in T2 supraglottic laryngeal cancer, it is necessary to consider concurrent chemoradiotherapy by DOC or hyperfractionation. (author)

  7. The rate of charge tunneling is insensitive to polar terminal groups in self-assembled monolayers in Ag(TS)S(CH2)(n)M(CH2)(m)T//Ga2O3/EGaIn junctions.

    Science.gov (United States)

    Yoon, Hyo Jae; Bowers, Carleen M; Baghbanzadeh, Mostafa; Whitesides, George M

    2014-01-08

    This paper describes a physical-organic study of the effect of uncharged, polar, functional groups on the rate of charge transport by tunneling across self-assembled monolayer (SAM)-based large-area junctions of the form Ag(TS)S(CH2)(n)M(CH2)(m)T//Ga2O3/EGaIn. Here Ag(TS) is a template-stripped silver substrate, -M- and -T are "middle" and "terminal" functional groups, and EGaIn is eutectic gallium-indium alloy. Twelve uncharged polar groups (-T = CN, CO2CH3, CF3, OCH3, N(CH3)2, CON(CH3)2, SCH3, SO2CH3, Br, P(O)(OEt)2, NHCOCH3, OSi(OCH3)3), having permanent dipole moments in the range 0.5 < μ < 4.5, were incorporated into the SAM. A comparison of the electrical characteristics of these junctions with those of junctions formed from n-alkanethiolates led to the conclusion that the rates of charge tunneling are insensitive to the replacement of terminal alkyl groups with the terminal polar groups in this set. The current densities measured in this work suggest that the tunneling decay parameter and injection current for SAMs terminated in nonpolar n-alkyl groups, and polar groups selected from common polar organic groups, are statistically indistinguishable.

  8. Redundant Notch1 and Notch2 signaling is necessary for IFNγ secretion by T helper 1 cells during infection with Leishmania major.

    Directory of Open Access Journals (Sweden)

    Floriane Auderset

    Full Text Available The protective immune response to intracellular parasites involves in most cases the differentiation of IFNγ-secreting CD4(+ T helper (Th 1 cells. Notch receptors regulate cell differentiation during development but their implication in the polarization of peripheral CD4(+ T helper 1 cells is not well understood. Of the four Notch receptors, only Notch1 (N1 and Notch2 (N2 are expressed on activated CD4(+ T cells. To investigate the role of Notch in Th1 cell differentiation following parasite infection, mice with T cell-specific gene ablation of N1, N2 or both (N1N2(ΔCD4Cre were infected with the protozoan parasite Leishmania major. N1N2(ΔCD4Cre mice, on the C57BL/6 L. major-resistant genetic background, developed unhealing lesions and uncontrolled parasitemia. Susceptibility correlated with impaired secretion of IFNγ by draining lymph node CD4(+ T cells and increased secretion of the IL-5 and IL-13 Th2 cytokines. Mice with single inactivation of N1 or N2 in their T cells were resistant to infection and developed a protective Th1 immune response, showing that CD4(+ T cell expression of N1 or N2 is redundant in driving Th1 differentiation. Furthermore, we show that Notch signaling is required for the secretion of IFNγ by Th1 cells. This effect is independent of CSL/RBP-Jκ, the major effector of Notch receptors, since L. major-infected mice with a RBP-Jκ deletion in their T cells were able to develop IFNγ-secreting Th1 cells, kill parasites and heal their lesions. Collectively, we demonstrate here a crucial role for RBP-Jκ-independent Notch signaling in the differentiation of a functional Th1 immune response following L. major infection.

  9. Lightweight Towed Howitzer Demonstrator. Phase 1 and Partial Phase 2. Volume D1. Part 1. Structural Analysis (Less Cradle and System).

    Science.gov (United States)

    1987-04-01

    X4Cro 7WAW,"G9 N k Y,1i ACCA . 2 JVM ly y,- L OA.0 v roo*Ler t-OAD. FA’ A /"Fi./A/a. (" -A,E’ CNAiv*6:CP A/ ’r/O’,L C4A$4P&4R.* -1MAGC.T?D0 VI.3 Moon...M- S 3D = .. = ==-=== Version 1.1 02/01/85 LTHD muzzle brate thermal load - steel Load Case 1: Loads Node F x FFM - My

  10. Multiplex RT-PCR assay for differentiating European swine influenza virus subtypes H1N1, H1N2 and H3N2.

    Science.gov (United States)

    Chiapponi, Chiara; Moreno, Ana; Barbieri, Ilaria; Merenda, Marianna; Foni, Emanuela

    2012-09-01

    In Europe, three major swine influenza viral (SIV) subtypes (H1N1, H1N2 and H3N2) have been isolated in pigs. Developing a test that is able to detect and identify the subtype of the circulating strain rapidly during an outbreak of respiratory disease in the pig population is of essential importance. This study describes two multiplex RT-PCRs which distinguish the haemagglutinin (HA) gene and the neuraminidase (NA) gene of the three major subtypes of SIV circulating in Europe. The HA PCR was able to identify the lineage (avian or human) of the HA of H1 subtypes. The analytical sensitivity of the test, considered to be unique, was assessed using three reference viruses. The detection limit corresponded to 1×10(-1) TCID(50)/200μl for avian-like H1N1, 1×10(0) TCID(50)/200μl for human-like H1N2 and 1×10(1) TCID(50)/200μl for H3N2 SIV. The multiplex RT-PCR was first carried out on a collection of 70 isolated viruses showing 100% specificity and then on clinical samples, from which viruses had previously been isolated, resulting in an 89% positive specificity of the viral subtype. Finally, the test was able to identify the viral subtype correctly in 56% of influenza A positive samples, from which SIV had not been isolated previously. It was also possible to identify mixed viral infections and the circulation of a reassortant strain before performing genomic studies. Copyright © 2012 Elsevier B.V. All rights reserved.

  11. Anti-HER2 CD4(+) T-helper type 1 response is a novel immune correlate to pathologic response following neoadjuvant therapy in HER2-positive breast cancer.

    Science.gov (United States)

    Datta, Jashodeep; Berk, Erik; Xu, Shuwen; Fitzpatrick, Elizabeth; Rosemblit, Cinthia; Lowenfeld, Lea; Goodman, Noah; Lewis, David A; Zhang, Paul J; Fisher, Carla; Roses, Robert E; DeMichele, Angela; Czerniecki, Brian J

    2015-05-23

    A progressive loss of circulating anti-human epidermal growth factor receptor-2/neu (HER2) CD4(+) T-helper type 1 (Th1) immune responses is observed in HER2(pos)-invasive breast cancer (IBC) patients relative to healthy controls. Pathologic complete response (pCR) following neoadjuvant trastuzumab and chemotherapy (T + C) is associated with decreased recurrence and improved prognosis. We examined differences in anti-HER2 Th1 responses between pCR and non-pCR patients to identify modifiable immune correlates to pathologic response following neoadjuvant T + C. Anti-HER2 Th1 responses in 87 HER2(pos)-IBC patients were examined using peripheral blood mononuclear cells pulsed with 6 HER2-derived class II peptides via IFN-γ ELISPOT. Th1 response metrics were anti-HER2 responsivity, repertoire (number of reactive peptides), and cumulative response across 6 peptides (spot-forming cells [SFC]/10(6) cells). Anti-HER2 Th1 responses of non-pCR patients (n = 4) receiving adjuvant HER2-pulsed type 1-polarized dendritic cell (DC1) vaccination were analyzed pre- and post-immunization. Depressed anti-HER2 Th1 responses observed in treatment-naïve HER2(pos)-IBC patients (n = 22) did not improve globally in T + C-treated HER2(pos)-IBC patients (n = 65). Compared with adjuvant T + C receipt, neoadjuvant T + C - utilized in 61.5 % - was associated with higher anti-HER2 Th1 repertoire (p = 0.048). While pCR (n = 16) and non-pCR (n = 24) patients did not differ substantially in demographic/clinical characteristics, pCR patients demonstrated dramatically higher anti-HER2 Th1 responsivity (94 % vs. 33 %, p = 0.0002), repertoire (3.3 vs. 0.3 peptides, p vs. 22.4 SFC/10(6), p non-pCR patients. After controlling for potential confounders, anti-HER2 Th1 responsivity remained independently associated with pathologic response (odds ratio 8.82, p = 0.016). This IFN-γ(+) immune disparity was mediated by anti-HER2 CD4(+)T-bet(+)IFN-γ(+) (i.e., Th1) - not CD4(+)GATA-3(+)IFN-γ(+) (i.e., Th2

  12. Isospin symmetry of T-z=+/- 3/2 ->+/- 1/2 Gamow-Teller transitions in A=41 nuclei

    NARCIS (Netherlands)

    Fujita, Y; Shimbara, Y; Adachi, T; Berg, GPA; Fujita, H; Hatanaka, K; Kamiya, J; Nakanishi, K; Sakemi, Y; Sasaki, S; Shimizu, Y; Tameshige, Y; Uchida, M; Wakasa, T; Yosoi, M

    2004-01-01

    Under the assumption that isospin T is a good quantum number, isobaric analog states and various analogous transitions are expected in isobars with mass number A. The, strengths of T-z = +/-3/2 --> 1/2 analogous Gamow-Teller (GT) transitions and analogous M1 transitions within the A = 41 isobar

  13. Isospin symmetry of T-z=+/- 3/2 ->+/- 1/2 Gamow-Teller transitions in A=41 nuclei

    NARCIS (Netherlands)

    Fujita, Y; Shimbara, Y; Adachi, T; Berg, GPA; Fujita, H; Hatanaka, K; Kamiya, J; Nakanishi, K; Sakemi, Y; Sasaki, S; Shimizu, Y; Tameshige, Y; Uchida, M; Wakasa, T; Yosoi, M

    Under the assumption that isospin T is a good quantum number, isobaric analog states and various analogous transitions are expected in isobars with mass number A. The, strengths of T-z = +/-3/2 --> 1/2 analogous Gamow-Teller (GT) transitions and analogous M1 transitions within the A = 41 isobar

  14. Structure and stability of small Li2 +(X2Σ+ g )-Xen (n = 1-6) clusters

    Science.gov (United States)

    Saidi, Sameh; Ghanmi, Chedli; Berriche, Hamid

    2014-04-01

    We have studied the structure and stability of the Li2 +(X2Σ+ g )Xe n ( n = 1-6) clusters for special symmetry groups. The potential energy surfaces of these clusters, are described using an accurate ab initio approach based on non-empirical pseudopotential, parameterized l-dependent polarization potential and analytic potential forms for the Li+Xe and Xe-Xe interactions. The pseudopotential technique has reduced the number of active electrons of Li2 +(X2Σ+ g )-Xe n ( n = 1-6) clusters to only one electron, the Li valence electron. The core-core interactions for Li+Xe are included using accurate CCSD(T) potential fitted using the analytical form of Tang and Toennies. For the Xe-Xe potential interactions we have used the analytical form of Lennard Jones (LJ6 - 12). The potential energy surfaces of the Li2 +(X2Σ+ g )Xe n ( n = 1-6) clusters are performed for a fixed distance of the Li2 +(X2Σ+ g ) alkali dimer, its equilibrium distance. They are used to extract information on the stability of the Li2 +(X2Σ+ g Xe n ( n = 1-6) clusters. For each n, the stability of the different isomers is examined by comparing their potential energy surfaces. Moreover, we have determined the quantum energies ( D 0), the zero-point-energies (ZPE) and the ZPE%. To our best knowledge, there are neither experimental nor theoretical works realized for the Li2 +(X2Σ+ g Xe n ( n = 1-6) clusters, our results are presented for the first time.

  15. Radiative rates for E1, E2, M1 and M2 transitions in Fe X

    International Nuclear Information System (INIS)

    Aggarwal, K.M.; Keenan, F.P.

    2004-01-01

    Energies of the 54 levels belonging to the (1s 2 2s 2 2p 6 ) 3s 2 3p 5 , 3s3p 6 , 3s 2 3p 4 3d and 3s3p 5 3d configurations of Fe X have been calculated using the GRASP code of Dyall and colleagues (1989). Additionally, radiative rates, oscillator strengths, and line strengths are calculated for all electric dipole (E1), magnetic dipole (M1), electric quadrupole (E2), and magnetic quadrupole (M2) transitions among these levels. Comparisons are made with results available in the literature, and the accuracy of the data is assessed. Our energy levels are estimated to be accurate to better than 3%, whereas results for other parameters are probably accurate to better than 20% . Additionally, the agreement between measured and calculated lifetimes is better than 10%. (authors)

  16. Enrichment of variations in KIR3DL1/S1 and KIR2DL2/L3 among H1N1/09 ICU patients: an exploratory study.

    Directory of Open Access Journals (Sweden)

    David La

    Full Text Available BACKGROUND: Infection by the pandemic influenza A (H1N1/09 virus resulted in significant pathology among specific ethnic groups worldwide. Natural Killer (NK cells are important in early innate immune responses to viral infections. Activation of NK cells, in part, depend on killer-cell immunoglobulin-like receptors (KIR and HLA class I ligand interactions. To study factors involved in NK cell dysfunction in overactive immune responses to H1N1 infection, KIR3DL1/S1 and KIR2DL2/L3 allotypes and cognate HLA ligands of H1N1/09 intensive-care unit (ICU patients were determined. METHODOLOGY AND FINDINGS: KIR3DL1/S1, KIR2DL2/L3, and HLA -B and -C of 51 H1N1/09 ICU patients and 105 H1N1-negative subjects (St. Theresa Point, Manitoba were characterized. We detected an increase of 3DL1 ligand-negative pairs (3DL1/S1(+ Bw6(+ Bw4(-, and a lack of 2DL1 HLA-C2 ligands, among ICU patients. They were also significantly enriched for 2DL2/L3 ligand-positive pairs (PVA, P=0.024, Pc=0.047; Odds Ratio:2.563, CI95%:1.109-5.923, 3DL1*00101 (Ab>VA, PSTh, P=0.034, Pc=0.268, and 3DL1*029 (Ab>STh, P=0.039, Pc=0.301. Aboriginal patients ligand-positive for 3DL1/S1 and 2DL1 had the lowest probabilities of death (R(d (R(d=28%, compared to patients that were 3DL1/S1 ligand-negative (R(d=52% or carried 3DL1*029 (R(d=52%. Relative to Caucasoids (CA, two allotypes were enriched among non-aboriginal ICU patients (NAb: 3DL1*00401 (NAb>CA, P<0.001, Pc<0.001 and 3DL1*01502 (CA0.012, Pc=0.156. Non-aboriginal patients with ligands for all three KIRs (3DL1/S1, 2DL2/L3, and 2DL1 had the lowest probabilities of death (R(d=36%, compared to subjects with 3DL1*01502 (R(d=48% and/or 3DL1*00401 (R(d=58%. CONCLUSIONS: Specific KIR3DL1/S1 allotypes, 3DL1/S1 and 2DL1 ligand-negative pairs, and 2DL2/L3 ligand-positive pairs were enriched among ICU patients. This suggests a possible association with NK cell dysfunction in patients with overactive immune responses to H1N1/09, leading to

  17. Direct Reduction of 1,2- and 1,6-Dibromohexane at Silver Cathodes in Dimethylformamide

    International Nuclear Information System (INIS)

    Martin, Erin T.; Strawsine, Lauren M.; Mubarak, Mohammad S.; Peters, Dennis G.

    2015-01-01

    Electrochemical reduction of 1,2-dibromohexane (1) and 1,6-dibromohexane (2) at silver cathodes in dimethylformamide (DMF) containing tetramethylammonium perchlorate (TMAP) has been investigated with the aid of cyclic voltammetry and controlled-potential electrolysis. Cyclic voltammograms for reduction of 1 and 2 both exhibit a single irreversible cathodic peak associated with reduction of carbon–bromine bonds; however, the cathodic peak potential (−0.33 V) for 1 is significantly less negative than that (−1.00 V) for 2, and the peak current for 1 is approximately half of that for 2. Cyclic voltammograms for 0.5–20.0 mM solutions of 1 and 2, separately, show that the parameter I pc /C* increases as the concentration (C*) decreases; this trend is likely due to a combination of adsorption phenomena and a potential-dependent transfer coefficient (α). Coulometric n values and product distributions arising from bulk electrolyses of 5.0 mM solutions of 1 and 2 depend on the positions of the bromine atoms: (a) for 1, n was 2.13 and 1-hexene was the only product; (b) for 2, n was 2.12 and a mixture of products was obtained [1-hexene (21%), n-hexane (37%), 1,5-hexadiene (22%), 5-hexen-1-ol (9%), and a trace of n-dodecane]. When 2 was electrolyzed in the presence of a proton or deuteron donor (2,2,2-trifluoroethanol or D 2 O), the n value and the amount of n-hexane increased, whereas 1-hexene and 1,5-hexadiene decreased in yield. We conclude that reduction of 1 follows a concerted mechanism, but that reduction of 2 proceeds via carbanionic intermediates.

  18. Transanal endoscopic microsurgery versus laparoscopic lower anterior resection for the treatment of T1-2 rectal cancers.

    Science.gov (United States)

    Chen, Yue-yu; Liu, Zhao-hui; Zhu, Kun; Shi, Pei-dong; Yin, Lu

    2013-06-01

    It remains unknown whether transanal endoscopic microsurgery (TEMS) is superior to laparoscopic lower anterior resection (LAR) for the treatment of rectal cancer. This study aimed to compare the surgical and oncological effectiveness as well as safety of TEMS and LAR in T1-2 rectal cancer patients. T1-2N0 rectal cancer patients were prospectively and randomly assigned to local excision using TEMS (n=30) or radical resection using LAR (n=30). The primary outcome measures were postoperative recovery course. The operative duration of TEMS was significantly shorter than that of LAR (130.3±16.7 minutes vs. 198.7±16.8 minutes, pTEMS group restarted bowel movement significantly earlier than the LAR group (51.4±5.4h vs. 86.2±8.7h, pTEMS, respectively; no patient (0/30, 0.0%) developed local recurrence following LAR. TEMS was associated with more rapid postoperative recovery and minimal surgical morbidity in T1-2 rectal cancer patients as compared to LAR.

  19. Myocardial T1 and T2 mapping: Techniques and clinical applications

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Pan Ki; Hong, Yoo Jin; Im, Dong Jin [Dept. of Radiology and Research Institute of Radiological Science, Severance Hospital, Yonsei University College of Medicine, Seoul (Korea, Republic of); and others

    2017-01-15

    Cardiac magnetic resonance (CMR) imaging is widely used in various medical fields related to cardiovascular diseases. Rapid technological innovations in magnetic resonance imaging in recent times have resulted in the development of new techniques for CMR imaging. T1 and T2 image mapping sequences enable the direct quantification of T1, T2, and extracellular volume fraction (ECV) values of the myocardium, leading to the progressive integration of these sequences into routine CMR settings. Currently, T1, T2, and ECV values are being recognized as not only robust biomarkers for diagnosis of cardiomyopathies, but also predictive factors for treatment monitoring and prognosis. In this study, we have reviewed various T1 and T2 mapping sequence techniques and their clinical applications.

  20. A q-deformation of the parastatistics and an alternative to the Chevalley description of Uq[osp(2n+1/2m)

    International Nuclear Information System (INIS)

    Palev, T.D.

    1997-08-01

    The paper contains essentially two new results. Physically, a deformation of the parastatistics in a sense of quantum groups is carried out. Mathematically, an alternative to the Chevalley description of the quantum orthosymplectic superalgebra U q [osp(2n + 1/2m)] in terms of m pairs of deformed parabosons and n pairs of deformed parafermions is outlined. (author). 35 refs

  1. Th1/M1 conversion to Th2/M2 responses in models of inflammation lacking cell death stimulates maturation of monocyte precursors to fibroblasts

    Directory of Open Access Journals (Sweden)

    JoAnn eTrial

    2013-09-01

    Full Text Available We have demonstrated that cardiac fibrosis arises from the differentiation of monocyte-derived fibroblasts. We present here evidence that this process requires sequential Th1 and Th2 induction promoting analogous M1 (classically activated and M2 (alternatively activated macrophage polarity. Our models are 1 mice subjected to daily repetitive ischemia reperfusion (I/R without infarction and 2 the in vitro transmigration of human mononuclear leukocytes through human cardiac microvascular endothelium. In the mouse heart, leukocytes entered after I/R in response to monocyte chemoattractant protein-1 (MCP-1 which is the major cytokine induced by this protocol. Monocytes within the heart then differentiated into fibroblasts making collagen while bearing the markers of M2 macrophages. T cells were seen in these hearts as well as in the human heart with cardiomyopathy. In the in vitro model, transmigration of the leukocytes was likewise induced by MCP-1 and some monocytes matured into fibroblasts bearing M2 markers. In this model, the MCP-1 stimulus induced a transient Th1 and M1 response that developed into a predominately Th2 and M2 response. An increase in the Th2 product IL-13 was present in both the human and the mouse models, consistent with its known role in fibrosis. In these simplified models, in which there is no cell death to stimulate an anti-inflammatory response, there is nonetheless a resolution of inflammation enabling a profibrotic environment. This induces the maturation of monocyte precursors into fibroblasts.

  2. COMPLETE SUPPRESSION OF THE m=2/n-1 NEOCLASSICAL TEARING MODE USING ELECTRON CYCLOTRON CURRENT DRIVE ON DIII-D

    International Nuclear Information System (INIS)

    PETTY, CC; LAHAYE, LA; LUCE, TC; HUMPHREYS, DA; HYATT, AW; PRATER, R; STRAIT, EJ; WADE, MR

    2003-01-01

    A271 COMPLETE SUPPRESSION OF THE M=2/N-1 NEOCLASSICAL TEARING MODE USING ELECTRON CYCLOTRON CURRENT DRIVE ON DIII-D. The first suppression of the important and deleterious m=2/n=1 neoclassical tearing mode (NTM) is reported using electron cyclotron current drive (ECCD) to replace the ''missing'' bootstrap current in the island O-point. Experiments on the DIII-D tokamak verify the maximum shrinkage of the m=2/n=1 island occurs when the ECCD location coincides with the q = 2 surface. The DIII-D plasma control system is put into search and suppress mode to make small changes in the toroidal field to find and lock onto the optimum position, based on real time measurements of dB θ /dt, for complete m=2/n=1 NTM suppression by ECCD. The requirements on the ECCD for complete island suppression are well modeled by the modified Rutherford equation for the DIII-D plasma conditions

  3. Identification of Risk Factors for Locoregional Recurrence in Breast Cancer Patients with Nodal Stage N0 and N1: Who Could Benefit from Post-Mastectomy Radiotherapy?

    Directory of Open Access Journals (Sweden)

    Eunjin Jwa

    Full Text Available The locoregional recurrence (LRR rate was reported as high as approximately 20% in stage I-II breast cancer following mastectomy. To investigate the risk factors for LRR in pT1-2N0-1 breast cancer patients treated with mastectomy but not radiation, and to define a subgroup of patients at high risk of LRR who may benefit from postmastectomy radiotherapy (PMRT.In total, 390 patients with pT1-2N0M0 (n = 307 and pT1-2N1M0 (n = 83 breast cancer who underwent total mastectomy without adjuvant radiotherapy from 2002 to 2011 were enrolled in the study.After a median follow-up period of 5.6 years (range, 0.6-11.3 years, 21 patients had 18 systemic relapses and 12 LRRs including six in the chest wall and eight in the regional nodal area. The 5-year LRR-free survival (LRRFS rates were 97.0% in pN0, 98.8% in pN1, and 97.4% in all patients. Multivariate analysis revealed that age < 50 years (Hazard Ratio, 11.4; p = 0.01 and no adjuvant chemotherapy (Hazard Ratio, 10.2; p = 0.04 were independent risk factors for LRR in pN0 patients. Using these factors, the 5-year LRRFS rates were 100% without any risk factors, 96.4% with one risk factor, and 86.7% with two risk factors. In pN1 patients, multivariate analysis revealed that having a hormone receptor negative tumor (Hazard Ratio, 18.3; p = 0.03 was the only independent risk factor for LRR. The 5-year LRRFS rates were 100.0% for luminal type, and 92.3% for non-luminal type cancer.Patients with pT1-2N0-1 breast cancer who underwent total mastectomy without PMRT could be stratified by nodal stage and risk factors for LRR. PMRT may have of value for node negative patients aged less than 50 years and who are not treated with adjuvant chemotherapy, and for non-luminal type patients with one to three positive nodes.

  4. N,N,N′,N′,N′′,N′′-Hexamethylguanidinium 1,1,3,3-tetracyanoprop-2-en-1-ide

    Directory of Open Access Journals (Sweden)

    Ioannis Tiritiris

    2016-03-01

    Full Text Available The asymmetric unit of the title salt, C7H18N3+·C7HN4−, comprises one cation and one anion. The N,N,N′,N′,N′′,N′′-hexamethylguanidinium ion shows orientational disorder and two sets of N- and C-atom positions were found, with an occupancy ratio of 0.535 (3:0.465 (3. The C—N bond lengths in the guanidinium ion range from 1.339 (16 to 1.35 (2 Å, indicating partial double-bond character pointing towards charge delocalization within the NCN planes. The negative charge in the 1,1,3,3-tetracyanoprop-2-en-1-ide ion is delocalized within the CCC planes with the C—C bonds ranging in length from 1.379 (3 to 1.427 (3 Å, also indicating partial double-bond character.

  5. Determination of the 1s2{\\ell }2{{\\ell }}^{\\prime } state production ratios {{}^{4}P}^{o}/{}^{2}P, {}^{2}D/{}^{2}P and {{}^{2}P}_{+}/{{}^{2}P}_{-} from fast (1{s}^{2},1s2s\\,{}^{3}S) mixed-state He-like ion beams in collisions with H2 targets

    Science.gov (United States)

    Benis, E. P.; Zouros, T. J. M.

    2016-12-01

    New results are presented on the ratio {R}m={σ }{T2p}( {}4P)/{σ }{T2p}({}2P) concerning the production cross sections of Li-like 1s2s2p quartet and doublet P states formed in energetic ion-atom collisions by single 2p electron transfer to the metastable 1s2s {}3S component of the He-like ion beam. Spin statistics predict a value of R m = 2 independent of the collision system in disagreement with most reported measurements of {R}m≃ 1{--}9. A new experimental approach is presented for the evaluation of R m having some practical advantages over earlier approaches. It also allows for the determination of the separate contributions of ground- and metastable-state beam components to the measured spectra. Applying our technique to zero-degree Auger projectile spectra from 4.5 MeV {{{B}}}3+ (Benis et al 2002 Phys. Rev. A 65 064701) and 25.3 MeV {{{F}}}7+ (Zamkov et al 2002 Phys. Rev. A 65 062706) mixed state (1{s}2 {}1S,1s2s {}3S) He-like ion collisions with H2 targets, we report new values of {R}m=3.5+/- 0.4 for boron and {R}m=1.8+/- 0.3 for fluorine. In addition, the ratios of {}2D/{}2P and {{}2P}+/{{}2P}- populations from either the metastable and/or ground state beam component, also relevant to this analysis, are evaluated and compared to previously reported results for carbon collisions on helium (Strohschein et al 2008 Phys. Rev. A 77 022706) including a critical comparison to theory.

  6. Protection level of AI H5N1 vaccine clade 2.1.3 commercial against AI H5N1 clade 2.3.2 virus from Ducks to SPF chicken in laboratory conditions

    Directory of Open Access Journals (Sweden)

    Indriani R

    2015-03-01

    Full Text Available Highly Pathogenic Avian Influenza (HPAI subtype H5N1 clade 2.3.2 has infected chickens in farms, causing mortality and a decrease in egg production. Vaccination is one of the strategies to control disease of AI subtype H5N1. AI H5N1 clade 2.1.3 vaccine is available commercially. The effectiveness of two vaccines of AI H5N1 clade 2.1.3 (product A and B, and AI H5N1 clade 2.3.2 (Sukoharjo against AI H5N1 clade 2.3.2 (Sukoharjo virus SPF chickens was tested in laboratory. Four groups of SPF chickens were used in this study, there were (1 vaccinated with H5N1 clade 2.1.3 (product A, (2 vaccinated with H5N1 clade 2.1.3 (product B, (3 vaccinated with AI H5N1 clade 2.3.2 and (4 unvaccinated (as a control. Each vaccinated group consisted of 10 chicken except 8 chicken for control group. SPF chicken were vaccinated with 1 dose of vaccine at 3 weeks olds, and then after 3 weeks post vaccination (at 6 weeks olds. All group of chicken were challenged with 106 EID50 per 0.1 ml via intranasal. The results showed, chicken vaccinated with H5N1 clade 2.1.3 product A and B gave 100 and 80% protection respectively, but showed challenged virus shedding, whereas vaccine of H5N1 clade 2.3.2 gave 100% protection from mortality and without virus shedding. Vaccines of AI H5N1 clade 2.1.3 product A was better than vaccine product B, and when chicken vaccinated against H5N1 clade 2.3.2, H5N1 clade 2.3.2 vaccine was the best to be used. In order to protect chicken from AI subtype H5N1 clade 2.1.3 and 2.3.2 in the field, a bivalent vaccine of H5N1 clade 2.1.3 and 2.3.2 subtypes should be developed.

  7. [Results of conservative surgery in T1 breast carcinoma. Our experience in 66 treated cases].

    Science.gov (United States)

    Barillari, P; Leuzzi, R; Nardi, M; Cerasi, A; Calcaterra, D; Cesareo, S; Brandimarte, A; Manetti, G; Bovino, A; Sammartino, P

    1994-11-01

    Between 1989 and 1991, 66 women affected by breast cancer smaller than 2 cm in diameter, were treated with conservative procedure plus radiotherapy. Conservative procedure consisted in quadrantectomy and axillary dissection of the 3 axillary nodes levels. Neoplasms were grouped according to TNM classification. Eleven were classified as Tis, 9 as T1aN0M0, 12 as T1bN0M0, one case T1bN1M0, 24 as T1cN0M0 and finally 9 as T1cN1M0. Actuarial 5-year survival rate was related to TNM. It has been reported to be 100% in Tis and T1aN0M0 neoplasms; 91.7% in pT1bN0M0 tumors, 95.8% in pT1cN0M0 neoplasms, 55.6% in patients affected with pT1cN1M0 tumors. According to the relationship between receptor status of the neoplasm and survival, this was 88.9% in ER+ and 77.8% in ER- tumors, and 97.1% against 71.4% (p < 0.05) in PR+ and PR- neoplasms respectively. Two patients presented (3%) local recurrence which were treated by means of a tumorectomy and radiotherapy. Both patients are still living and disease free after 6 and 9 months from re-operation.

  8. Robust T1-weighted structural brain imaging and morphometry at 7T using MP2RAGE.

    Directory of Open Access Journals (Sweden)

    Kieran R O'Brien

    Full Text Available PURPOSE: To suppress the noise, by sacrificing some of the signal homogeneity for numerical stability, in uniform T1 weighted (T1w images obtained with the magnetization prepared 2 rapid gradient echoes sequence (MP2RAGE and to compare the clinical utility of these robust T1w images against the uniform T1w images. MATERIALS AND METHODS: 8 healthy subjects (29.0 ± 4.1 years; 6 Male, who provided written consent, underwent two scan sessions within a 24 hour period on a 7T head-only scanner. The uniform and robust T1w image volumes were calculated inline on the scanner. Two experienced radiologists qualitatively rated the images for: general image quality; 7T specific artefacts; and, local structure definition. Voxel-based and volume-based morphometry packages were used to compare the segmentation quality between the uniform and robust images. Statistical differences were evaluated by using a positive sided Wilcoxon rank test. RESULTS: The robust image suppresses background noise inside and outside the skull. The inhomogeneity introduced was ranked as mild. The robust image was significantly ranked higher than the uniform image for both observers (observer 1/2, p-value = 0.0006/0.0004. In particular, an improved delineation of the pituitary gland, cerebellar lobes was observed in the robust versus uniform T1w image. The reproducibility of the segmentation results between repeat scans improved (p-value = 0.0004 from an average volumetric difference across structures of ≈ 6.6% to ≈ 2.4% for the uniform image and robust T1w image respectively. CONCLUSIONS: The robust T1w image enables MP2RAGE to produce, clinically familiar T1w images, in addition to T1 maps, which can be readily used in uniform morphometry packages.

  9. ÿþ1 . D r E z e o m e S e p t 2 0 1 0 4 A j o l . . .

    African Journals Online (AJOL)

    ÿþU s e r

    of health care personnel and institutions to patients presenting with breast ... reported first to Alternative practitioners. Forty six patients ... patients (3.7%) can access a hospital only by going outside their town of ... while 8 patients. (5.0%) contacted a nurse or other allied health care .... Trying to go abroad for treatment 2. 1.5.

  10. MR imaging pulse sequence rationale: SD-, T1-, and T2-weighted images

    International Nuclear Information System (INIS)

    Sax, S.; Weathers, S.W.; Schneiders, N.J.; Horowitz, B.L.; Mawad, M.E.; Sandlin, M.E.; Blackwell, R.; Bryan, R.N.

    1986-01-01

    Over 500 patients have been examined with a pulse sequence designed to provide spin-density (SD)-weighted images (TR=3 sec, TE=35 msec), T1-weighted images (TR=0.3 sec, TE=35msec), and T2-weighted images (TR=3 sec, TE=105 msec) from which calculated ''synthesized'' images and SD, T1, and T2 calculated images could be obtained. Each image contributes unique information. SD-weighted images optimally display anatomy and often best highlight pathology. T1-weighted images are critical in assessing cerebral hemorrhages. T2-weighted images best display most lesions, but yield incomplete information in 35% of cases. All three types of ''weighted'' images are necessary to optimally display anatomy and fully characterize a lesion. Computerized calculations and simulations suggest that no other combination of pulse sequences yields equal information for a given examination time

  11. Measurement of CD8+ and CD4+ T Cell Frequencies Specific for EBV LMP1 and LMP2a Using mRNA-Transfected DCs.

    Directory of Open Access Journals (Sweden)

    Dae-Hee Sohn

    Full Text Available An EBV-specific cellular immune response is associated with the control of EBV-associated malignancies and lymphoproliferative diseases, some of which have been successfully treated by adoptive T cell therapy. Therefore, many methods have been used to measure EBV-specific cellular immune responses. Previous studies have mainly used autologous EBV-transformed B-lymphoblastoid cell lines (B-LCLs, recombinant viral vectors transfected or peptide pulsed dendritic cells (DCs as stimulators of CD8(+ and CD4(+ T lymphocytes. In the present study, we used an interferon-γ (IFN-γ enzyme-linked immunospot (ELISPOT assay by using isolated CD8(+ and CD4(+ T cells stimulated with mRNA-transfected DCs. The frequency of latent membrane protein 1 (LMP1-specific IFN-γ producing CD4(+ T cells was significantly higher than that of LMP2a. The frequency of IFN-γ producing CD4(+ T cells was significantly correlated with that of CD8(+ T cells in LMP1-specific immune responses (r = 0.7187, Pc < 0.0001. To determine whether there were changes in LMP1- or LMP2a-specific immune responses, subsequent peripheral blood mononuclear cells (PBMCs samples were analyzed. Significant changes were observed in 5 of the 10 donors examined, and CD4(+ T cell responses showed more significant changes than CD8(+ T cell responses. CD8(+ and CD4(+ T cells from EBV-seropositive donors secreted only the Th1 cytokines IFN-γ, TNF-α, and IL-2, while Th2 (IL-4 and Th17 (IL-17a cytokines were not detected. CD4(+ T cells secreted significantly higher cytokine levels than did CD8(+ T cells. Analysis of EBV-specific T cell responses using autologous DCs transfected with mRNA might provide a comprehensive tool for monitoring EBV infection and new insights into the pathogenesis of EBV-associated diseases.

  12. Lithium-Rich Nanoscale Li 1.2 Mn 0.54 Ni 0.13 Co 0.13 O 2 Cathode Material Prepared by Co-Precipitation Combined Freeze Drying (CP-FD) for Lithium-Ion Batteries

    Energy Technology Data Exchange (ETDEWEB)

    Bai, Ying; Li, Yu; Wu, Chuan; Lu, Jun; Li, Hui; Liu, Zhaolin; Zhong, Yunxia; Chen, Shi; Zhang, Cunzhong; Amine, Khalil; Wu, Feng

    2015-07-14

    Nanoscale Li-rich Li1.2Mn0.54Ni0.13Co0.13O2 material is synthesized by a co-precipitation combined freeze drying (CP-FD) method, and compared with a conventional co-precipitation method combined vacuum drying (CP-VD). With the combination of X-ray diffraction (XRD) and scanning electron microscopy (SEM), it is found that the sample from CP-FD method consists of a pure phase with good crystallinity and small, homogenous particles (100-300 nm) with uniform particle size distribution. Inductively coupled plasma spectroscopy (ICP) shows that the sample has a stoichiometric ratio of n((Li)): n((Mn)): n((Ni)): n((Co))=9: 4: 1: 1; and its Brunauer-Emmett-Teller (BET) specific surface area is 5.749 m(2)g(-1). This sample achieves excellent electrochemical properties: its initial discharge capacities are 298.9 mAhg(-1) at 0.1C (20 mAg(-1)), 246.1 mAhg(-1) at 0.5C, 215.8 mAhg(-1) at 1C, and 154.2 mAhg(-1) at 5C (5C charge and 5C discharge), as well as good cycling performance. In addition, the Li+ chemical diffusion coefficient of Li1.2Mn0.54Ni0.13Co0.13O2 material prepared by the CP-FD method is 4.59 x 10(-11) cm(2) s(-1), which is higher than that of the Li1.2Mn0.54Ni0.13Co0.13O2 material prepared by CP-VD. This phenomenon illustrates the potential for Li1.2Mn0.54Ni0.13Co0.13O2 with good rate performance synthesized by CP-FD method.

  13. Observation of spin reorientation in layered manganites La1.2Sr1.8(Mn1-yRuy)2O7 (0.0=0.2) by Lorentz transmission electron microscopy

    International Nuclear Information System (INIS)

    Yu, X.Z.; Uchida, M.; Onose, Y.; He, J.P.; Kaneko, Y.; Asaka, T.; Kimoto, K.; Matsui, Y.; Arima, T.; Tokura, Y.

    2006-01-01

    The effect of Ru substitution for Mn in bilayered oxides La 1.2 Sr 1.8 (Mn 1-y Ru y ) 2 O 7 (0= for the y=0 crystal to the c-axis for y=0.2, and it rotates away from the c-axis for the y=0.05 and y=0.07 crystals with decreasing temperature. Furthermore, maze-shaped magnetic domain structures were observed in the (001) thin crystals with 0.05=< y=<0.2. Changes in domain size and structure indicate that the uniaxial magnetic anisotropy becomes stronger as Ru content y increases

  14. Tc dependence on the number of CuO2 planes in multilayered Ba2Can-1CunO2n(O, F)2 superconductors

    International Nuclear Information System (INIS)

    Iyo, A; Tanaka, Y; Kodama, Y; Kito, H; Tokiwa, K; Watanabe, T

    2006-01-01

    Multilayered cuprates of Ba 2 Ca n-1 Cu n O 2n (O, F) 2 (F-02(n-1)n) with n = 5 - 9 have been synthesized by using high pressure synthesis method in order to investigate the variation of T c . The temperature dependence of susceptibility showed that the T c (about 80 K) does not depend on n for n 5 - 9. This result can be explained using the carrier imbalance model in multilayered cuprates. Charge reservoir layers supply most of the carriers to adjacent CuO 2 planes (OP) and the OP keeps the T c constant even for large n

  15. The characterization of electroplex generated from the interface between 2-(4-trifluoromethyl-2-hydroxyphenyl)benzothiazole] zinc and N,N'-diphenyl-N,N'- bis(1-naphthyl)-(1,1'-biphenyl)-4,4'-diamine

    Science.gov (United States)

    Zhang, Ye; Hao, Yuying; Meng, Weixin; Xu, Huixia; Wang, Hua; Xu, Bingshe

    2012-03-01

    The electroplex between (2-(4-trifluoromethyl-2-hydroxyphenyl)benzothiazole) zinc [Zn(4-TfmBTZ)2] as an electron-acceptor and N,N'-diphenyl-N,N'-bis(1-naphthyl)-(1,1'-biphenyl)-4,4'-diamine (NPB) as an electron-donor was characterized by bilayer, blend, and multilayer quantum-well (MQW) device, respectively. The blend composition and quantum-well number are effective parameters for tuning electroluminescence color. White light with high color purity and color rendering index (CRI) was observed from these devices based on Zn(4-TfmBTZ)2/NPB. Moreover, the blend and MQW devices all exhibit high operation stability, hence excellent color stability. For the device with 5 mol% NPB in blend layer, its Commission International Del'Eclairage (CIE) coordinate region is x=0.28-0.31, y=0.33-0.35 and CRI is 83.3-91.2 at 5-9 V. For MQW structure device with NPB of 60 nm thickness, its CIE coordinate region is x=0.29-0.32, y=0.31-0.34 and CRI=87.9-92.5 at 10-15 V. Such high color stability and purity and CRI, being close to ideal white light, are of current important for white OLED.

  16. Non(anti)commutative N = (1,1/2) supersymmetric U(1) gauge theory

    International Nuclear Information System (INIS)

    Araki, Takeo; Ito, Katsushi; Ohtsuka, Akihisa

    2005-01-01

    We study a reduction of deformation parameters in non(anti)commutative N = 2 harmonic superspace to those in non(anti)commutative N = 1 superspace. By this reduction we obtain the exact gauge and supersymmetry transformations in the Wess-Zumino gauge of non(anti)commutative N = 2 supersymmetric U(1) gauge theory defined in the deformed harmonic superspace. We also find that the action with the first order correction in the deformation parameter reduces to the one in the N = 1 superspace by some field redefinition. We construct deformed N = (1,1/2) supersymmetry in N = 2 supersymmetric U(1) gauge theory in non(anti)commutative N = 1 superspace

  17. Contribution to the study of {pi}N {yields} {pi}{sub 1}{pi}{sub 2}N reactions with creation of an intermediate N{sup *}{sub 3/2} {sub (1236)} isobar from 0.4 to 1.5 GeV; Contribution a l'etude des reactions {pi}N {yields} {pi}{sub 1}{pi}{sub 2}N avec creation d'un isobare intermediaire N{sup *}{sub 3/2} {sub (1236)} de 0.4 a 1.5 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Merlo, J.P. [Commissariat a l' Energie Atomique, 91 - Saclay (France). Centre d' Etudes Nucleaires. Division de la Physique, Departement de Physique des Particules Elementaires

    1976-07-01

    The one pion production reaction {pi}{sup +}p {yields} {pi}{sup +}p{pi}{sup 0} has been studied up to 1.5 GeV. The {pi}{sup 0} angular distribution measured by counter techniques has been compared to bubble chamber data. Angular distributions are interpreted in the hypothesis of formation of the intermediate N{sup *}{sub 3/2}(1236) isobar. Angular distributions for isobar production and decay in one pion production reactions {pi}N {yields} {pi}{sub 1}N{sup *} (N{sup *} {yields} {pi}{sub 2}N], are calculated in chapter II. {pi}{sup +}p {yields} {pi}{sup +}p{pi}{sup 0} experimental results are reported and analyzed in chapter III. An estimation of the pion-isobar partial wave amplitudes in reaction {pi}{sup +}p {yields} {pi}{sup 0}N{sup *++}{sub 3/2}(1236) has been tempted. Comparison with {pi}{sup +}p phase shift analyses is made. Bubble chamber data for {pi}{sup -}p {yields} {pi}{sup -}{pi}{sup +}n channel are presented at the end of chapter III. (author) [French] La reaction de production d'un pion {pi}{sup +}p {yields} {pi}{sup +}p{pi}{sup 0} a ete etudiee jusqu'a 1.5 GeV. La distribution angulaire du {pi}{sup 0} mesuree par la technique des compteurs a ete comparee aux resultats de chambre a bulles. Les distributions angulaires sont interpretees dans l'hypothese de la formation de l'isobare N{sup *}{sub 3/2}(1236) intermediaire. Les distributions angulaires de production et de desintegration de l'isobare dans les reactions de production d'un pion, {pi}N {yields} {pi}{sub 1}N{sup *} (N{sup *} {yields} {pi}{sub 2}N], sont calculees au second chapitre. Les resultats experimentaux de la voie {pi}{sup +}p {yields} {pi}{sup +}p{pi}{sup 0} sont presentes et analyses au troisieme chapitre. Une evaluation des amplitudes d'ondes partielles de production de l'isobare N{sup *}{sub 3/2}(1236) dans la reaction {pi}{sup +}p {yields} {pi}{sup 0}N{sup *++}{sub 3/2}(1236) a ete tentee. Une comparaison est faite avec les analyses en

  18. Form factors of descendant operators: reduction to perturbed M(2,2s+1) models

    International Nuclear Information System (INIS)

    Lashkevich, Michael; Pugai, Yaroslav

    2015-01-01

    In the framework of the algebraic approach to form factors in two-dimensional integrable models of quantum field theory we consider the reduction of the sine-Gordon model to the Φ 13 -perturbation of minimal conformal models of the M(2,2s+1) series. We find in an algebraic form the condition of compatibility of local operators with the reduction. We propose a construction that make it possible to obtain reduction compatible local operators in terms of screening currents. As an application we obtain exact multiparticle form factors for the compatible with the reduction conserved currents T ±2k , Θ ±(2k−2) , which correspond to the spin ±(2k−1) integrals of motion, for any positive integer k. Furthermore, we obtain all form factors of the operators T 2k T2l , which generalize the famous TT̄ operator. The construction is analytic in the s parameter and, therefore, makes sense in the sine-Gordon theory.

  19. MR relaxometry in chronic liver diseases: Comparison of T1 mapping, T2 mapping, and diffusion-weighted imaging for assessing cirrhosis diagnosis and severity

    Energy Technology Data Exchange (ETDEWEB)

    Cassinotto, Christophe, E-mail: christophe.cassinotto@chu-bordeaux.fr [Department of Diagnostic and Interventional Imaging, Hôpital Haut-Lévêque, Centre Hospitalier Universitaire et Université de Bordeaux, 1 Avenue de Magellan, 33604 Pessac (France); INSERM U1053, Université Bordeaux, Bordeaux (France); Feldis, Matthieu, E-mail: matthieu.feldis@chu-bordeaux.fr [Department of Diagnostic and Interventional Imaging, Hôpital Haut-Lévêque, Centre Hospitalier Universitaire et Université de Bordeaux, 1 Avenue de Magellan, 33604 Pessac (France); Vergniol, Julien, E-mail: julien.vergniol@chu-bordeaux.fr [Centre D’investigation de la Fibrose Hépatique, Hôpital Haut-Lévêque, Centre Hospitalier Universitaire de Bordeaux, 1 Avenue de Magellan, 33604 Pessac (France); Mouries, Amaury, E-mail: amaury.mouries@chu-bordeaux.fr [Department of Diagnostic and Interventional Imaging, Hôpital Haut-Lévêque, Centre Hospitalier Universitaire et Université de Bordeaux, 1 Avenue de Magellan, 33604 Pessac (France); Cochet, Hubert, E-mail: hubert.cochet@chu-bordeaux.fr [Department of Diagnostic and Interventional Imaging, Hôpital Haut-Lévêque, Centre Hospitalier Universitaire et Université de Bordeaux, 1 Avenue de Magellan, 33604 Pessac (France); and others

    2015-08-15

    Highlights: • The use of MR to classify cirrhosis in different stages is a new interesting field. • We compared liver and spleen T1 mapping, T2 mapping and diffusion-weighted imaging. • MR relaxometry using liver T1 mapping is accurate for the diagnosis of cirrhosis. • Liver T1 mapping shows that values increase with the severity of cirrhosis. • Diffusion-weighted imaging is less accurate than T1 mapping while T2 mapping is not reliable. - Abstract: Background: MR relaxometry has been extensively studied in the field of cardiac diseases, but its contribution to liver imaging is unclear. We aimed to compare liver and spleen T1 mapping, T2 mapping, and diffusion-weighted MR imaging (DWI) for assessing the diagnosis and severity of cirrhosis. Methods: We prospectively included 129 patients with normal (n = 40) and cirrhotic livers (n = 89) from May to September 2014. Non-enhanced liver T1 mapping, splenic T2 mapping, and liver and splenic DWI were measured and compared for assessing cirrhosis severity using Child-Pugh score, MELD score, and presence or not of large esophageal varices (EVs) and liver stiffness measurements using Fibroscan{sup ®} as reference. Results: Liver T1 mapping was the only variable demonstrating significant differences between normal patients (500 ± 79 ms), Child-Pugh A patients (574 ± 84 ms) and Child-Pugh B/C patients (690 ± 147 ms; all p-values <0.00001). Liver T1 mapping had a significant correlation with Child-Pugh score (Pearson's correlation coefficient of 0.46), MEDL score (0.30), and liver stiffness measurement (0.52). Areas under the receiver operating characteristic curves of liver T1 mapping for the diagnosis of cirrhosis (O.85; 95% confidence intervals (CI), 0.77–0.91), Child-Pugh B/C cirrhosis (0.87; 95%CI, 0.76–0.93), and large EVs (0.75; 95%CI, 0.63–0.83) were greater than that of spleen T2 mapping, liver and spleen DWI (all p-values < 0.01). Conclusion: Liver T1 mapping is a promising new diagnostic

  20. MR relaxometry in chronic liver diseases: Comparison of T1 mapping, T2 mapping, and diffusion-weighted imaging for assessing cirrhosis diagnosis and severity

    International Nuclear Information System (INIS)

    Cassinotto, Christophe; Feldis, Matthieu; Vergniol, Julien; Mouries, Amaury; Cochet, Hubert

    2015-01-01

    Highlights: • The use of MR to classify cirrhosis in different stages is a new interesting field. • We compared liver and spleen T1 mapping, T2 mapping and diffusion-weighted imaging. • MR relaxometry using liver T1 mapping is accurate for the diagnosis of cirrhosis. • Liver T1 mapping shows that values increase with the severity of cirrhosis. • Diffusion-weighted imaging is less accurate than T1 mapping while T2 mapping is not reliable. - Abstract: Background: MR relaxometry has been extensively studied in the field of cardiac diseases, but its contribution to liver imaging is unclear. We aimed to compare liver and spleen T1 mapping, T2 mapping, and diffusion-weighted MR imaging (DWI) for assessing the diagnosis and severity of cirrhosis. Methods: We prospectively included 129 patients with normal (n = 40) and cirrhotic livers (n = 89) from May to September 2014. Non-enhanced liver T1 mapping, splenic T2 mapping, and liver and splenic DWI were measured and compared for assessing cirrhosis severity using Child-Pugh score, MELD score, and presence or not of large esophageal varices (EVs) and liver stiffness measurements using Fibroscan ® as reference. Results: Liver T1 mapping was the only variable demonstrating significant differences between normal patients (500 ± 79 ms), Child-Pugh A patients (574 ± 84 ms) and Child-Pugh B/C patients (690 ± 147 ms; all p-values <0.00001). Liver T1 mapping had a significant correlation with Child-Pugh score (Pearson's correlation coefficient of 0.46), MEDL score (0.30), and liver stiffness measurement (0.52). Areas under the receiver operating characteristic curves of liver T1 mapping for the diagnosis of cirrhosis (O.85; 95% confidence intervals (CI), 0.77–0.91), Child-Pugh B/C cirrhosis (0.87; 95%CI, 0.76–0.93), and large EVs (0.75; 95%CI, 0.63–0.83) were greater than that of spleen T2 mapping, liver and spleen DWI (all p-values < 0.01). Conclusion: Liver T1 mapping is a promising new diagnostic tool for

  1. M2e-displaying virus-like particles with associated RNA promote T helper 1 type adaptive immunity against influenza A.

    Directory of Open Access Journals (Sweden)

    Lorena Itatí Ibañez

    Full Text Available The ectodomain of influenza A matrix protein 2 (M2e is a candidate for a universal influenza A vaccine. We used recombinant Hepatitis B core antigen to produce virus-like particles presenting M2e (M2e-VLPs. We produced the VLPs with and without entrapped nucleic acids and compared their immunogenicity and protective efficacy. Immunization of BALB/c mice with M2e-VLPs containing nucleic acids induced a stronger, Th1-biased antibody response compared to particles lacking nucleic acids. The former also induced a stronger M2e-specific CD4(+ T cell response, as determined by ELISPOT. Mice vaccinated with alum-adjuvanted M2e-VLPs containing the nucleic acid-binding domain were better protected against influenza A virus challenge than mice vaccinated with similar particles lacking this domain, as deduced from the loss in body weight following challenge with X47 (H3N2 or PR/8 virus. Challenge of mice that had been immunized with M2e-VLPs with or without nucleic acids displayed significantly lower mortality, morbidity and lung virus titers than control-immunized groups. We conclude that nucleic acids present in M2e-VLPs correlate with improved immune protection.

  2. ASXL2 mutations are frequently found in pediatric AML patients with t(8;21)/ RUNX1-RUNX1T1 and associated with a better prognosis.

    Science.gov (United States)

    Yamato, Genki; Shiba, Norio; Yoshida, Kenichi; Shiraishi, Yuichi; Hara, Yusuke; Ohki, Kentaro; Okubo, Jun; Okuno, Haruna; Chiba, Kenichi; Tanaka, Hiroko; Kinoshita, Akitoshi; Moritake, Hiroshi; Kiyokawa, Nobutaka; Tomizawa, Daisuke; Park, Myoung-Ja; Sotomatsu, Manabu; Taga, Takashi; Adachi, Souichi; Tawa, Akio; Horibe, Keizo; Arakawa, Hirokazu; Miyano, Satoru; Ogawa, Seishi; Hayashi, Yasuhide

    2017-05-01

    ASXL2 is an epigenetic regulator involved in polycomb repressive complex regulation or recruitment. Clinical features of pediatric acute myeloid leukemia (AML) patients with ASXL2 mutations remain unclear. Thus, we investigated frequencies of ASXL1 and ASXL2 mutations, clinical features of patients with these mutations, correlations of these mutations with other genetic alterations including BCOR/BCORL1 and cohesin complex component genes, and prognostic impact of these mutations in 369 pediatric patients with de novo AML (0-17 years). We identified 9 (2.4%) ASXL1 and 17 (4.6%) ASXL2 mutations in 25 patients. These mutations were more common in patients with t(8;21)(q22;q22)/RUNX1-RUNX1T1 (ASXL1, 6/9, 67%, P = 0.02; ASXL2, 10/17, 59%, P = 0.01). Among these 25 patients, 4 (27%) of 15 patients with t(8;21) and 6 (60%) of 10 patients without t(8;21) relapsed. However, most patients with relapse were rescued using stem cell transplantation irrespective of t(8;21). The overall survival (OS) and event-free survival (EFS) rates showed no differences among pediatric AML patients with t(8;21) and ASXL1 or ASXL2 mutations and ASXL wild-type (5-year OS, 75% vs. 100% vs. 91% and 5-year EFS, 67% vs. 80% vs. 67%). In 106 patients with t(8;21) AML, the coexistence of mutations in tyrosine kinase pathways and chromatin modifiers and/or cohesin complex component genes had no effect on prognosis. These results suggest that ASXL1 and ASXL2 mutations play key roles as cooperating mutations that induce leukemogenesis, particularly in pediatric AML patients with t(8;21), and these mutations might be associated with a better prognosis than that reported previously. © 2017 Wiley Periodicals, Inc.

  3. r-1,t-2,3,c-4-tetrahydroxy-1,2,3,4-tetrahydrophenanthrene in humanurine: A potential biomarker for assessing polycyclic aromatic hydrocarbon metabolic activation

    Energy Technology Data Exchange (ETDEWEB)

    Hecht, S.S.; Chen, M.L.; Yagi, H.; Jerina, D.M.; Carmella, S.G. [University of Minnesota, Minneapolis, MN (United States)

    2003-12-01

    Carcinogen metabolite phenotyping is proposed as a more reliable way to determinethe role of host metabolism in PAH-related cancer. Phenanthrene,is the simplest PAH with a bay region and is metabolized to diol epoxides by the same enzymes and with the same stereochemistry as the prototypic carcinogenic PAH, benzo(a)pyrene. The major end product of this metabolic activation pathway is r-1,t-2,3,c-4-tetrahydroxy-1,2,3,4-tetrahydrophenanthrene (trans, anti-PheT). We have developed a method for the analysis of trans, anti-PheT in human urine. r-1,t-2,4,c-3,-tetrahydroxy-1,2,3,4-tetrahydrophenanthrene (trans,syn-PheT) was used as internal standard. After hydrolysis by beta-glucuronidase and sulfatase, solid phase extraction, and high-performance liquid chromatography collection, the sample was silylated and analyzed by gas chromatography-negative ion chemical ionization-mass spectrometry-selected ion monitoring. Thechromatograms were clean and trans, anti-PheT was detected in all human urine samples. Levels of trans, anti-PheT were 791 {+-} 363 pmol/mg creatinine (n = 20) in psoriasis patients treated with a PAH-containing ointment, 25.7 {+-} 16.8 pmol/mg creatinine (n = 32) in coke oven workers exposed to PAH, 4.58 {+-} 2.95 pmol/mg creatinine (n = 31) in smokers, and 1.51 {+-} 1.15 pmol/mg creatinine (n = 30) in nonsmokers. Levels of trans, anti-PheT correlated with levels of 1-hydroxypyrene in the urine of coke oven workers, smokers, and nonsmokers. Trans, anti-PheT appears to be an excellent biomarker of PAH uptake. Levels of trans, anti-PheT were 8,000-19,000 times higher than those can be detected in human urine.

  4. Word Frequency Analysis MOS: 95C. Skill Levels 1 & 2.

    Science.gov (United States)

    1981-05-01

    EMTAEEN I Bt.ANKST 2 BLANK-. S 1 SLIND I BREA~ CNCD I EGICK I Of I flf.NG 2 BR~OKE N 1 BULBS t BLNK 2 aUtK. 2 BUT 14 By 3 C 9 C ,;LL I CALLS 4 CAN 1 C’O0... POLICIES 4 PCPULATION I PCta 7 PEP7.3m 3 PCSIT ION I POSSIBLE I FC!TS I I’!’!P .q I P.,FPsCRIBED 2 PkEt NCE I PRESENT 1 ppVi l I PR Iok 54 PR I SCNER

  5. 3-Methyl-1-(prop-2-en-1-ylquinoxalin-2(1H-one

    Directory of Open Access Journals (Sweden)

    Youssef Ramli

    2010-07-01

    Full Text Available In the molecule of the title compound, C12H12N2O, the quinoxaline ring is planar with an r.m.s. deviation of 0.007 (15 Å. The dihedral angle between the quinoxaline and propenyl planes is 82.1 (2°. The crystal packing is stabilized by offset π–π stacking between the quinoxaline rings [centroid–centroid distance = 3.8832 (9 Å].

  6. (1R,2R,3R,4R,5S-2,3-Bis[(2S′-2-acetoxy-2-phenylacetoxy]-4-azido-1-[(2,4-dinitrophenylhydrazonomethyl]bicyclo[3.1.0]hexane

    Directory of Open Access Journals (Sweden)

    Robert McDonald

    2008-02-01

    Full Text Available In the title compound, C38H29N7O12, the five-membered ring adopts an envelope conformation in which the `flap' is cis to the cyclopropane group. This conformation is similar to those of other bicyclo[3.1.0]hexane analogues for which crystal structures have been reported. The absolute configuration of the stereogenic centers on the cyclopentane ring, as determined by comparison with the known configurations of the stereogenic centers in the (2S-2-acetoxy-2-phenylacetoxy groups, is 1(R, 2(R, 3(R, 4(R and 5(S. An intramolecular N—H...O hydrogen bond is present.

  7. Synthesis, molecular modeling, and opioid receptor affinity of 9, 10-diazatricyclo[4.2.1.1(2,5)]decanes and 2,7-diazatricyclo[4.4.0. 0(3,8)]decanes structurally related to 3,8-diazabicyclo[3.2. 1]octanes.

    Science.gov (United States)

    Vianello, P; Albinati, A; Pinna, G A; Lavecchia, A; Marinelli, L; Borea, P A; Gessi, S; Fadda, P; Tronci, S; Cignarella, G

    2000-06-01

    Various lines of evidence, including molecular modeling studies, imply that the endoethylenic bridge of 3,8-diazabicyclo[3.2. 1]octanes (DBO, 1) plays an essential role in modulating affinity toward mu opioid receptors. This hypothesis, together with the remarkable analgesic properties observed for N(3) propionyl, N(8) arylpropenyl derivatives (2) and of the reverted isomers (3), has prompted us to insert an additional endoethylenic bridge on the piperazine moiety in order to identify derivatives with increased potency toward this receptor class. In the present report, we describe the synthesis of the novel compounds 9,10-diazatricyclo[4.2. 1.1(2,5)]decane (4) and 2,7-diazatricyclo[4.4.0.0(3,8)]decane (5), as well as the representative derivatives functionalized at the two nitrogen atoms by propionyl and arylpropenyl groups (6a-e, 7a-d). Opioid receptor binding assays revealed that, among the compounds tested, the N-propionyl-N-cinnamyl derivatives 6a and 7a exhibited the highest mu-receptor affinity, and remarkably, compound 7a displayed in vivo (mice) an analgesic potency 6-fold that of morphine.

  8. A fast response cadmium-selective polymeric membrane electrode based on N,N'-(4-methyl-1,2-phenylene)diquinoline-2-carboxamide as a new neutral carrier.

    Science.gov (United States)

    Rezaei, B; Meghdadi, S; Zarandi, R Fazel

    2008-05-01

    A new polyvinylchloride membrane sensor for Cd(2+) ions based on N,N'-(4-methyl-1,2-phenylene)diquinoline-2-carboxamide (Mebqb) as a new and excellent neutral ionophore has been prepared. The sensor shows a Nernestian response for cadmium ions over a wide concentration range (1.0 x 10(-6) to 1.0 x 10(-1) M) with the determination coefficient of 0.9964 and slope of 29.9 +/- 0.5 mV decade(-1). The limit of detection is 8 x 10(-7) M. It has a fast response time of 3-8s and can be used for at least 8 weeks without any divergence in potential. The electrode can be used in the pH range from 4.0 to 9.0. The proposed sensor shows a very good discriminating ability towards Cd(2+) ion in comparison to some alkali, alkaline earth, transition and heavy metal ions. It was successfully applied for the direct determination of Cd(2+) in standard and real sample solutions.

  9. A fast response cadmium-selective polymeric membrane electrode based on N,N'-(4-methyl-1,2-phenylene)diquinoline-2-carboxamide as a new neutral carrier

    International Nuclear Information System (INIS)

    Rezaei, B.; Meghdadi, S.; Zarandi, R. Fazel

    2008-01-01

    A new polyvinylchloride membrane sensor for Cd 2+ ions based on N,N'-(4-methyl-1,2-phenylene)diquinoline-2-carboxamide (Mebqb) as a new and excellent neutral ionophore has been prepared. The sensor shows a Nernestian response for cadmium ions over a wide concentration range (1.0 x 10 -6 to 1.0 x 10 -1 M) with the determination coefficient of 0.9964 and slope of 29.9 ± 0.5 mV decade -1 . The limit of detection is 8 x 10 -7 M. It has a fast response time of 3-8 s and can be used for at least 8 weeks without any divergence in potential. The electrode can be used in the pH range from 4.0 to 9.0. The proposed sensor shows a very good discriminating ability towards Cd 2+ ion in comparison to some alkali, alkaline earth, transition and heavy metal ions. It was successfully applied for the direct determination of Cd 2+ in standard and real sample solutions

  10. An M2e-based multiple antigenic peptide vaccine protects mice from lethal challenge with divergent H5N1 influenza viruses

    Directory of Open Access Journals (Sweden)

    Chan Chris CS

    2010-01-01

    Full Text Available Abstract Background A growing concern has raised regarding the pandemic potential of the highly pathogenic avian influenza (HPAI H5N1 viruses. Consequently, there is an urgent need to develop an effective and safe vaccine against the divergent H5N1 influenza viruses. In the present study, we designed a tetra-branched multiple antigenic peptide (MAP-based vaccine, designated M2e-MAP, which contains the sequence overlapping the highly conserved extracellular domain of matrix protein 2 (M2e of a HPAI H5N1 virus, and investigated its immune responses and cross-protection against different clades of H5N1 viruses. Results Our results showed that M2e-MAP vaccine induced strong M2e-specific IgG antibody responses following 3-dose immunization of mice with M2e-MAP in the presence of Freunds' or aluminium (alum adjuvant. M2e-MAP vaccination limited viral replication and attenuated histopathological damage in the challenged mouse lungs. The M2e-MAP-based vaccine protected immunized mice against both clade1: VN/1194 and clade2.3.4: SZ/406H H5N1 virus challenge, being able to counteract weight lost and elevate survival rate following lethal challenge of H5N1 viruses. Conclusions These results suggest that M2e-MAP presenting M2e of H5N1 virus has a great potential to be developed into an effective subunit vaccine for the prevention of infection by a broad spectrum of HPAI H5N1 viruses.

  11. Quantum state-to-state dynamics for the quenching process of Br(2P1/2) + H2(v(i) = 0, 1, j(i) = 0).

    Science.gov (United States)

    Xie, Changjian; Jiang, Bin; Xie, Daiqian; Sun, Zhigang

    2012-03-21

    Quantum state-to-state dynamics for the quenching process Br((2)P(1/2)) + H(2)(v(i) = 0, 1, j(i) = 0) → Br((2)P(3/2)) + H(2)(v(f), j(f)) has been studied based on two-state model on the recent coupled potential energy surfaces. It was found that the quenching probabilities have some oscillatory structures due to the interference of reflected flux in the Br((2)P(1/2)) + H(2) and Br((2)P(3/2)) + H(2) channels by repulsive potential in the near-resonant electronic-to-vibrational energy transfer process. The final vibrational state resolved integral cross sections were found to be dominated by the quenching process Br((2)P(1/2)) + H(2)(v) → Br((2)P(3/2)) + H(2)(v+1) and the nonadiabatic reaction probabilities for Br((2)P(1/2)) + H(2)(v = 0, 1, j(i) = 0) are quite small, which are consistent with previous theoretical and experimental results. Our calculated total quenching rate constant for Br((2)P(1/2)) + H(2)(v(i) = 0, j(i) = 0) at room temperature is in good agreement with the available experimental data. © 2012 American Institute of Physics

  12. Synthesis and characterization of La1+xSr2-xCoMnO7-δ (x=0,0.2; δ=0,1)

    International Nuclear Information System (INIS)

    El Shinawi, H.; Bertha, A.; Hadermann, J.; Herranz, T.; Santos, B.; Marco, J.F.; Berry, F.J.; Greaves, C.

    2010-01-01

    The n=2 Ruddlesden-Popper phases LaSr 2 CoMnO 7 and La 1.2 Sr 1.8 CoMnO 7 have been synthesized by a sol-gel method. The O6-type phases LaSr 2 CoMnO 6 and La 1.2 Sr 1.8 CoMnO 6 were produced by reduction of the O7 phases under a hydrogen atmosphere. The materials crystallize in the tetragonal I4/mmm space group with no evidence of long-range cation order in the neutron and electron diffraction data. Oxygen vacancies in the reduced materials are located primarily at the common apex of the double perovskite layers giving rise to square pyramidal coordination around cobalt and manganese ions. The oxidation states Co 3+ /Mn 4+ and Co 2+ /Mn 3+ predominate in the as-prepared and reduced materials, respectively. The materials are spin glasses at low temperature and the dominant magnetic interactions change from ferro- to antiferromagnetic following reduction. - Graphical abstract: The n=2 Ruddlesden-Popper phases LaSr 2 CoMnO 7 , La 1.2 Sr 1.8 CoMnO 7 , LaSr 2 CoMnO 6 and La 1.2 Sr 1.8 CoMnO 6 are synthesized and characterized.

  13. Structural, magnetic and magnetocaloric properties of La{sub 0.7}Ca{sub 0.2}Sr{sub 0.1}Mn{sub 1−x}Cr{sub x}O{sub 3} compounds with x = 0, 0.05 and 0.1

    Energy Technology Data Exchange (ETDEWEB)

    Dhahri, Ah., E-mail: dhahri.ahmad@outlook.fr [Laboratoire de Physique Appliquée, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Jemmali, M. [Laboratoire des Sciences des Matériaux et de l’Environnement, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Taibi, K. [Département SDM, FGMGP/USTHB, 16311 (Algeria); Dhahri, E. [Laboratoire de Physique Appliquée, Faculté des Sciences de Sfax, BP 1171, Université de Sfax, 3000 (Tunisia); Hlil, E.K. [Institut Néel, CNRS et Université J. Fourier, BP 166, 38042 Grenoble (France)

    2015-01-05

    Highlights: • The samples crystallize in the rhombohedral structure with the R3{sup ¯}c space group. • Enhancement of T{sub C} for the rhombohedral samples. • The relative cooling power increases with Cr-doping. • All samples exhibit a large magnetocaloric effect. • High values of the magnetoresistance in all samples. - Abstract: Structural, magnetic and magnetocaloric properties of La{sub 0.7}Sr{sub 0.1}Ca{sub 0.2}Mn{sub 1−x}Cr{sub x}O{sub 3} compounds with x = 0, 0.05 and 0.1 have been investigated to shed light on Cr-doping influence. X-ray diffraction studies show that all samples crystallize in the rhombohedral symmetry with R3{sup ¯}c space group. Rietveld refinement structure shows that the insertion of Cr in Mn network modifies the structural parameters such as the volume, Mn–O–Mn angles and the Mn–O bond length. The substitution of Mn by Cr decreases the 2p-3d hybridization between O and Mn ions, reduces the bandwidth and increases the electron–phonon coupling. The investigation of magnetic and magnetocaloric properties reveals that the samples exhibit a paramagnetic(PM)–ferromagnetic (FM) transition with decreasing Curie temperature (T{sub C}) from 294 K to 255 K when Cr doping level increases. The magnetic entropy change (ΔS{sub M}{sup max}) also decreases from 6.20 J kg{sup −1} K{sup −1} for x = 0 to3.80 J kg{sup −1} K{sup −1} for x = 0.1, while the relative cooling power (RCP) increases from 234.5 to 240 J kg{sup −1}, respectively, under a magnetic field of 5 T. These outcomes suggest that Mn-site Cr doping inhibits the enhancement of the magnetocaloric effect in some perovskite manganites. This is explained by the weakening of the ferromagnetic double-exchange interaction between Mn{sup 3+} and Mn{sup 4+} ions.

  14. Comparison of the Roche COBAS AmpliPrep/COBAS TaqMan HIV-1 test v1.0 with v2.0 in HIV-1 viral load quantification

    Directory of Open Access Journals (Sweden)

    Yi-Ching Tung

    2015-04-01

    Full Text Available Roche modified the COBAS AmpliPrep/COBAS TaqMan human immunodeficiency virus type 1 (HIV-1 test version 1.0 (CAP/CTM v1.0, resulting in the COBAS AmpliPrep/COBAS TaqMan HIV-1 test version 2.0 (CAP/CTM v2.0. The aim of this study was to evaluate the performance of the CAP/CTM v2.0 and to compare this performance with that of the CAP/CTM v1.0. The study was conducted in a small local study group in Kaohsiung Medical University Hospital, Kaohsiung, Taiwan. A total of 86 plasma samples from HIV-1-seropositive patients were tested using the two assays. The correlation and concordance of results between the two assays were calculated. The CAP/CTM v2.0 generated higher values than did the CAP/CTM v1.0, and five samples (5.8% yielded a difference of > 1 log10 copies/mL. In addition, our data show that CAP/CTM v1.0 and CAP/CTM v2.0 yielded relatively consistent values for 23 samples with low viral loads (< 200 copies/mL. Furthermore, when viral loads were in a medium range (2–5 log10 copies/mL, the results of the two assays were more compatible. This study shows a good correlation between CAP/CTM v1.0 and v2.0 in HIV-1 viral load measurement. Further attention must be paid to those cases in which measured viral loads present larger differences between the two assays.

  15. 26 CFR 1.181-0T - Table of contents (temporary).

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 3 2010-04-01 2010-04-01 false Table of contents (temporary). 1.181-0T Section...-0T Table of contents (temporary). This section lists the table of contents for §§ 1.181-1T through 1... deduction allowed. § 1.181-2TElection (temporary). (a) Time and manner of making election. (b) Election by...

  16. Evaluation of neonatal brain myelination using the T1- and T2-weighted MRI ratio.

    Science.gov (United States)

    Soun, Jennifer E; Liu, Michael Z; Cauley, Keith A; Grinband, Jack

    2017-09-01

    To validate the T1- and T2-weighted (T1w/T2w) MRI ratio technique in evaluating myelin in the neonatal brain. T1w and T2w MR images of 10 term neonates with normal-appearing brain parenchyma were obtained from a single 1.5 Tesla MRI and retrospectively analyzed. T1w/T2w ratio images were created with a postprocessing pipeline and qualitatively compared with standard clinical sequences (T1w, T2w, and apparent diffusion coefficient [ADC]). Quantitative assessment was also performed to assess the ratio technique in detecting areas of known myelination (e.g., posterior limb of the internal capsule) and very low myelination (e.g., optic radiations) using linear regression analysis and the Michelson Contrast equation, a measure of luminance contrast intensity. The ratio image provided qualitative improvements in the ability to visualize regional variation in myelin content of neonates. Linear regression analysis demonstrated a significant inverse relationship between the ratio intensity values and ADC values in the posterior limb of the internal capsule and the optic radiations (R 2  = 0.96 and P ratio images were 1.6 times higher than T1w, 2.6 times higher than T2w, and 1.8 times higher than ADC (all P ratio improved visualization of the corticospinal tract, one of the earliest myelinated pathways. The T1w/T2w ratio accentuates contrast between myelinated and less myelinated structures and may enhance our diagnostic ability to detect myelination patterns in the neonatal brain. 2 Technical Efficacy: Stage2 J. MAGN. RESON. IMAGING 2017;46:690-696. © 2016 International Society for Magnetic Resonance in Medicine.

  17. Synthesis, structure and chemical bonding of CaFe2−xRhxSi2 (x=0, 1.32, and 2) and SrCo2Si2

    International Nuclear Information System (INIS)

    Hlukhyy, Viktor; Hoffmann, Andrea V.; Fässler, Thomas F.

    2013-01-01

    The finding of superconductivity in Ba 0.6 K 0.4 Fe 2 As 2 put the attention on the investigation of compounds that crystallize with ThCr 2 Si 2 structure type such as AT 2 X 2 (A=alkali/alkaline earth/rare earth element; T=transition metal and X=element of the 13–15th group). In this context the silicides CaFe 2 Si 2 , CaFe 0.68(6) Rh 1.32(6) Si 2 , CaRh 2 Si 2 and SrCo 2 Si 2 have been synthesized by reaction of the elements under an argon atmosphere. Single crystals were obtained by special heat treatment in welded niobium/tantalum ampoules. The compounds were investigated by means of powder and single crystal X-ray diffraction. All compounds crystallize in the ThCr 2 Si 2 -type structure with space group I4/mmm (No. 139): a=3.939(1) Å, c=10.185(1) Å, R 1 =0.045, 85 F 2 values, 8 variable parameters for CaFe 2 Si 2 ; a=4.0590(2) Å, c=9.9390(8) Å, R 1 =0.030, 90 F 2 values, 10 variable parameters for CaFe 0.68(6) Rh 1.32(6) Si 2 ; a=4.0695(1) Å, c=9.9841(3) Å, R 1 =0.031, 114 F 2 values, 9 variable parameters for CaRh 2 Si 2 ; and a=3.974(1) Å, c=10.395(1) Å, R 1 =0.036, 95 F 2 values, 8 variable parameters for SrCo 2 Si 2 . The structure of SrCo 2 Si 2 contains isolated [Co 2 Si 2 ] 22D-layers in the ab-plane whereas in CaFe 2−x Rh x Si 2 the [T 2 Si 2 ] layers (T=Fe and Rh) are interconnected along the c-axis via Si3Si bonds resulting in a three-dimentional (3D) [T 2 Si 2 ] 2− polyanions and therefore belong to the so-called collapsed form of the ThCr 2 Si 2 -type structure. The SrCo 2 Si 2 and CaRh 2 Si 2 are isoelectronic to the parent 122 iron–pnictide superconductors AeFe 2 As 2 (Ae=alkaline earth elements), whereas CaFe 2 Si 2 is a full substituted variant (As/Si) of CaFe 2 As 2 . The crystal chemistry and chemical bonding in the title compounds are discussed in terms of LMTO band structure calculations and a topological analysis using the Electron Localization Function (ELF). - Graphical abstract: The SrCo 2 Si 2 and CaFe 2−x Rh x Si

  18. Pressure-induced instability of magnetic order in Kondo-lattice system. Neutron diffraction study of the pseudo-binary alloy system Ce(Ru sub 0 sub . sub 9 sub 0 Rh sub 0 sub . sub 1 sub 0) sub 2 (Si sub 1 sub - sub y Ge sub y) sub 2

    CERN Document Server

    Watanabe, K; Kanadani, C; Taniguchi, T; Kawarazaki, S; Uwatoko, Y; Kadowaki, H

    2003-01-01

    Neutron diffraction experiments have been carried out to study the nature of the magnetic order of the pseudo-binary alloy system Ce(Ru sub 0 sub . sub 9 sub 0 Rh sub 0 sub . sub 1 sub 0) sub 2 (Si sub 1 sub - sub y Ge sub y) sub 2. Response of the ordered atomic magnetic moment, mu, the transition temperature, T sub N , and the magnitude of the magnetic modulation vector, q, to the chemical pressure and also to the applied hydrostatic pressure, P, were examined at low temperatures. When y changes, all of mu, T sub N and q show a sudden alteration of the manner of the y-dependence at around y - 0.08. The P-dependence of q shows quite different features for different y's of 0.0, 0.2 and 0.25. On the basis of these observations the possibility of a pressure-induced alternation of the magnetic regime of the order is discussed. (author)

  19. Diaqua-2κ2O-bis(μ-1-oxido-2-naphthoato-1:2κ3O1,O2:O2′;2:3κ3O2:O1,O2′-bis(1-oxido-2-naphthoato-1κ1O2,O2;3κ2O1,O2-hexapyridine-1κ2N,2κ2N,3κ2N-trimanganese(II/III pyridine disolvate dihydrate

    Directory of Open Access Journals (Sweden)

    Daqi Wang

    2008-12-01

    Full Text Available The title complex, [Mn3(C11H6O34(C5H5N6(H2O22H22C5H5N, is a trinuclear mixed oxidation state complex of overline1 symmetry. The three Mn atoms are six-coordinated in the shape of distorted octahedra, each coordinated with an O4N2 set of donor atoms, where the ligands exhibit mono- and bidentate modes. However, the coordination of the MnII ion located on the inversion centre involves water molecules at two coordination sites, whereas that of the two symmetry-related MnIII ions involves an O4N2 set of donor atoms orginating from the organic ligands. Intramolecular C—H...π interactions between neighbouring pyridine ligands stabilize this arrangement. A two-dimensional network parallel to (001 is formed by intermolecular O—H...O hydrogen bonds.

  20. cis-[1,4-Bis(diphenylphosphanylbutane-κ2P,P′]dichlorido(cyclohexane-1,2-diamine-κ2N,N′ruthenium(II dichloromethane monosolvate

    Directory of Open Access Journals (Sweden)

    Ismail Warad

    2012-05-01

    Full Text Available In the title compound, [RuCl2(C6H14N2(C28H28P2]·CH2Cl2, the RuII ion is coordinated in a slightly distorted octahedral environment, formed by two cis-oriented chloride ligands, two cis P atoms of a 1,4-bis(diphenylphosphanylbutane ligand and two cis-chelating N atoms of a bidentate cyclohexane-1,2-diamine ligand. In the crystal, pairs of molecules form inversion dimers via N—H...Cl hydrogen bonds. In addition, intramolecular N—H...Cl and weak C—H...Cl, C—H...N, N—H...π and C—H...π hydrogen bonds are observed. One of the Cl atoms of the solvent molecule is disordered over two sites with refined occupancies of 0.62 (1 and 0.38 (1.

  1. Linewidths in OCS: Isotope effects, vibrational effects, temperature dependence, and T1/T2

    International Nuclear Information System (INIS)

    Creswell, R.A.; Brown, S.R.; Schwendeman, R.H.

    1976-01-01

    A computer-controlled microwave spectrometer has been used to record the frequency dependence of the absorption of the J=2reverse arrow1 transition of OCS under varying conditions of pressure, temperature, and microwave power. From least-squares fits of the data to Lorentzian line shapes, a variety of linewidths and linewidth parameters have been deduced. The linewidth parameter for the J=2reverse arrow1 transition of 16 O 12 C 32 S in the ground vibrational state has been determined to be 6.03+-0.05 MHz/torr. The ratios of linewidth parameters for this transition for several other species to that for the ground state of 16 O 12 C 32 S are: 16 O 12 C 34 S, ground state, 0.987+-0.003; 16 O 13 C 32 S, ground state, 0.991+-0.005; 18 O 12 C 32 S, ground state, 0.966+-0.018; 16 O 12 C 32 S, v 3 =1, 1.024+-0.026; 16 O 12 C 32 S, v 2 /subl/=2degree, 0.978+-0.003. The linewidth parameter for the ground state of the parent species was determined to be inversely proportional to the absolute temperature in the range 297--346 K. From comparison of theoretical and experimental power-broadened lineshapes it is shown that T 1 /T 2 =1.04+-0.10 for the transition

  2. N-Formylated humanin activates both formyl peptide receptor-like 1 and 2

    International Nuclear Information System (INIS)

    Harada, Masataka; Habata, Yugo; Hosoya, Masaki; Nishi, Kazunori; Fujii, Ryo; Kobayashi, Makoto; Hinuma, Shuji

    2004-01-01

    We have discovered that humanin (HN) acts as a ligand for formyl peptide receptor-like 1 (FPRL1) and 2 (FPRL2). This discovery was based on our finding that HN suppressed forskolin-induced cAMP production in Chinese hamster ovary (CHO) cells expressing human FPRL1 (CHO-hFPRL1) or human FPRL2 (CHO-hFPRL2). In addition, we found that N-formylated HN (fHN) performed more potently as a ligand for FPRL1 than HN: in CHO-hFPRL1 cells, the effective concentration for the half-maximal response (EC 50 ) value of HN was 3.5 nM, while that of fHN was 0.012 nM. We demonstrated by binding experiments using [ 125 I]-W peptide that HN and fHN directly interacted with hFPRL1 on the membrane. In addition, we found that HN and fHN showed strong chemotactic activity for CHO-hFPRL1 and CHO-hFPRL2 cells. HN is known to have a protective effect against neuronal cell death. Our findings contribute to the understanding of the mechanism behind HN's function

  3. 2D numerical comparison between S{sub n} and M{sub 1} radiation transport methods

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, Matthias [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, calle Jose Gutierrez Abascal 2, 28006 Madrid (Spain)], E-mail: matthias@din.upm.es; Garcia-Fernandez, Carlos [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, calle Jose Gutierrez Abascal 2, 28006 Madrid (Spain)], E-mail: carlos@din.upm.es; Velarde, Pedro [Instituto de Fusion Nuclear, Universidad Politecnica de Madrid, calle Jose Gutierrez Abascal 2, 28006 Madrid (Spain)], E-mail: velarde@din.upm.es

    2009-07-15

    In this article we study the accuracy of the M{sub 1} method to solve some relevant radiation transport problems in 2D. We compare two radiation models (S{sub n} and M{sub 1}) with analytical and numerical tests to highlight the strengths and limitations of each method. These methods give comparable results except when sharp geometry effects are present. We have used these methods in a test that mimics, without fluid motion or electron heat conduction, the cone-target interaction relevant to inertial confinement fusion physics. In this case, we show that S{sub n} and M{sub 1} models agree with a quite good accuracy but shows differences in the temperature profiles and heating times inside the target. These results point out that M{sub 1} is a possible alternative candidate for 3D simulations, where full energy transport methods are extremely computer time consuming.

  4. O1, P1, N2 models of the global ocean tide on an elastic earth plus surface potential and spherical harmonic decompositions for M2, S2, and K1

    Science.gov (United States)

    Parke, M. E.

    1982-01-01

    The models of M2, S2, and K1 presented in Parke and Hendershott (1980) are supplemented with models of O1, P1, and N2. The models satisfy specified elevation boundary conditions and are generated by fighting a small number of test functions to island data. Maps are presented of the geocentric tide, the induced free space potential, the induced vertical component of the solid earth tide, and the induced vertical component of the gravitational field for each new component. Maps of the tidal potential seen by an observer fixed to the surface of the solid earth are also presented for all six constituents. Spherical harmonic coefficients up to order four and the rms magnitude of the coefficients to order fifteen are presented for each constituent. The rms magnitudes of the P1 and K1 coefficients normalized by their respective equilibrium amplitudes are compared to determine the effect of the diurnal core resonance.

  5. Temperature dependent polarization reversal mechanism in 0.94(Bi1/2Na1/2) TiO3-0.06Ba(Zr0.02Ti0.98)O3 relaxor ceramics

    DEFF Research Database (Denmark)

    Glaum, Julia; Simons, Hugh; Hudspeth, Jessica

    2015-01-01

    and structural investigation of the polarization reversal process in the prototypical lead-free relaxor 0.94(Bi1/2Na1/2)TiO3-0.06Ba(Zr0.02Ti0.98)O3 reveals that an applied electric field can trigger depolarization and onset of relaxor-like behavior well below TF-R. The polarization reversal process can...... as such be described as a combination of (1) ferroelectric domain switching and (2) a reversible phase transition between two polar ferroelectric states mediated by a non-polar relaxor state. Furthermore, the threshold fields of the second, mediated polarization reversal mechanism depend strongly on temperature....... These results are concomitant with a continuous ferroelectric to relaxortransition occurring over a broad temperature range, during which mixed behavior is observed. The nature of polarization reversal can be illustrated in electric-field-temperature (E-T) diagrams showing the electric field amplitudes...

  6. Diversification of the vacAs1m1 and vacAs2m2 strains of Helicobacter pylori in Meriones unguiculatus

    Directory of Open Access Journals (Sweden)

    Sandra Mendoza Elizalde

    2016-11-01

    Full Text Available The bacterium Helicobacter pylori exhibits great genetic diversity, and the pathogenic roles of its virulence factors have been widely studied. However, the evolutionary dynamics of H. pylori strains during stomach colonization are not well characterized. Here, we analyzed the microevolutionary dynamics of the toxigenic strain vacAs1m1, the non-toxigenic strain vacAs2m2, and a combination of both strains in an animal model over time. Meriones unguiculatus were inoculated with the following bacteria: group 1–toxigenic strain vacAs1m1/cagA+/cagE+/babA2+; ST181, group 2–non-toxigenic strain vacAs2m2/ cagA+/ cagE+/ babA2+; ST2901, and group 3–both strains. The gerbils were euthanized at different time points (3, 6, 12 and 18 months. In group 1, genetic alterations were observed at 6 and 12 months. With the combination of both strains, group 3 also exhibited genetic alterations at 3 and 18 months; moreover, a chimera, vacA m1-m2, was detected. Additionally, four new sequence types (STs were reported in the PubMLST database for H. pylori. Synonymous and non-synonymous mutations were analyzed and associated with alterations in amino acids. Microevolutionary analysis of the STs (PHYLOViZ identified in each group revealed many mutational changes in the toxigenic (vacAs1m1 and non-toxigenic (vacAs2m2 strains. Phylogenetic assessments (eBURST did not reveal clonal complexes. Our findings indicate that the toxigenic strain, vacAs1m1, and a combination of toxigenic and non-toxigenic strains acquired genetic material by recombination. The allelic combination, vacAs2m1, displayed the best adaptation in the animal model over time, and a chimera, m1-m2, was also identified, which confirmed previous reports.

  7. [Neratinib + Valproate] exposure permanently reduces ERBB1 and RAS expression in 4T1 mammary tumors and enhances M1 macrophage infiltration.

    Science.gov (United States)

    Booth, Laurence; Roberts, Jane L; Rais, Rumeesa; Kirkwood, John; Avogadri-Connors, Francesca; Cutler, Richard E; Lalani, Alshad S; Poklepovic, Andrew; Dent, Paul

    2018-01-19

    The irreversible ERBB1/2/4 inhibitor neratinib has been shown in vitro to rapidly reduce the expression of ERBB1/2/4 and RAS proteins via autophagic/lysosomal degradation. We have recently demonstrated that neratinib and valproate interact to suppress the growth of 4T1 mammary tumors but had not defined whether the [neratinib + valproate] drug combination, in a mouse, had altered the biology of the 4T1 cells. Exposure of 4T1 mammary tumors to [neratinib + valproate] for three days resulted, two weeks later, in tumors that expressed less ERBB1, K-RAS, N-RAS, indoleamine-pyrrole 2,3-dioxygenase (IDO-1), ornithine decarboxylase (ODC) and had increased Class I MHCA expression. Tumors previously exposed to [neratinib + valproate] grew more slowly than those exposed to vehicle control and contained more CD8+ cells and activated NK cells. M1 but not M2 macrophage infiltration was significantly enhanced by the drug combination. In vitro exposure of 4T1 tumor cells to [neratinib + valproate] variably reduced the expression of histone deacetylases 1-11. In vivo , prior exposure of tumors to [neratinib + valproate] permanently reduced the expression of HDACs 1-3, 6 and 10. Combined knock down of HDACs 1/2/3 or of 3/10 rapidly reduced the expression IDO-1, and ODC and increased the expression of MHCA. H&E staining of normal tissues at animal nadir revealed no obvious cyto-architectural differences between control and drug-treated animals. We conclude that [neratinib + valproate] evolves 4T1 tumors to grow more slowly and to be more sensitive to checkpoint immunotherapy antibodies.

  8. Measurements of the ground-state ionization energy and wavelengths for the 1snp {sup 1}P{sub 1}{sup *}-1s{sup 2} {sup 1}S{sub 0} (n=4-9) lines of Mg XI and F VIII

    Energy Technology Data Exchange (ETDEWEB)

    Pal' chikov, V.G. [Multicharged Ions Spectra Data Centre of VNIIFTRI, Mendeleevo (Russian Federation)). E-mail: vitpal@mail.ru; Ya Faenov, A.; Yu Skobelev, I. [Multicharged Ions Spectra Data Centre of VNIIFTRI, Mendeleevo (RU)] [and others

    2002-06-28

    The wavelengths of the 1snp {sup 1}P{sub 1}{sup 0}-1s{sup 2} {sup 1}S{sub 0} transitions in the He-like Mg XI (n = 4-9) and F VIII (n=4-8) have been measured in laser-produced plasmas. The accuracy of the present measurements (0.4-1.6 mA) is a large improvement over previous results. The Rydberg series is used to determine the ground-state ionization energy of F VIII and Mg XI: E{sub i}on (F VIII) 953.96{+-}0.11 eV, E{sub i}on (Mg XI)=1761.88{+-}0.15 eV. These experimental results are compared with theoretical data calculated by the 1/Z-expansion method and the HFR and MCDF approaches. Fairly good agreement between theory and experiment is observed with a precision up to 5x10{sup -5}. Radiative corrections to the 1s{sup 2} {sup 1}S{sub 0} state are analysed and compared with experiments. It is found that QED corrections to the ground-state ionization energy are significant at the present level of experimental accuracy. (author)

  9. Spin canting and magnetic transition in NixZn1-xFe2O4 (x=0.0, 0.5 and 1.0) nanoparticles

    Science.gov (United States)

    Rani, Stuti; Raghav, Dharmendra Singh; Yadav, Prashant; Varma, G. D.

    2018-04-01

    Nanoparticles of NixZn1-xFe2O4(x=0.0, 0.5 and 1.0) have been synthesized via co-precipitation method and studied thestructural and magnetic properties. Rietveld refinement of X ray diffraction data of as synthesized samples revealthat the samples have mixed spinel structure with space group Fd-3m. The lattice parameter of the samples decreases as doping concentration of Ni ions increases. Magnetic measurements show paramagnetic to ferrimagnetic transition at room temperature on Ni doping in ZnFe2O4 nanoparticles. The magnetic measurements also show spin canting in samples possibly due to their nanocrystalline nature. The spin canting angles have been calculated with the help of Yafet-Kittel (Y-K) model. Furthermore, the Law of approach (LA) fitting of M-H curves indicates that the samples are highly anisotropicin nature. The Arrot plots of as synthesized samples also indicate the paramagnetic to ferrimagnetic transition. The correlation between the structural and observed magnetic properties of NixZn1-xFe2O4(x=0.0, 0.5 and 1.0) nanocrystals will be described and discussed in this paper.

  10. Thermodynamic study of (alkyl esters+{alpha},{omega}-alkyl dihalides) V. H{sub m}{sup E}andV{sub m}{sup E} for 25 binary mixtures {l_brace}xC{sub u-1}H{sub 2u-1}CO{sub 2}CH{sub 3}+(1-x){alpha},{omega}-ClCH{sub 2}(CH{sub 2}){sub v-2}CH{sub 2}Cl{r_brace}, where u=1 to 5, {alpha}=1 and v={omega}=2 to 6

    Energy Technology Data Exchange (ETDEWEB)

    Ortega, J. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071 Las Palmas de Gran Canaria, Canary Islands (Spain)]. E-mail: jortega@dip.ulpgc.es; Marrero, E. [Laboratorio de Termodinamica y Fisicoquimica de Fluidos, Parque Cientifico-Tecnologico, Campus Universitario de Tafira, Universidad de Las Palmas de Gran Canaria, 35071 Las Palmas de Gran Canaria, Canary Islands (Spain)

    2007-05-15

    The experimental data of excess molar enthalpies H{sub m}{sup E} and excess molar volumes V{sub m}{sup E} are presented for a set of 25 binary mixtures comprised of the first five methyl esters C{sub u-1}H{sub 2u-1}COOCH{sub 3} (u=1 to 5) and five {alpha},{omega}-dichloroalkanes, ClCH{sub 2}(CH{sub 2}){sub v-2}CH{sub 2}Cl (v=2 to 6), obtained at a temperature of 298.15K and atmospheric pressure. Except for the mixtures with u=1 and v=2 to 6, which are all endothermic and with u=5 and v=2 to 6, which are all exothermic, the others present net endo/exothermic effects and these mixing effects evolve quasiregularly, from endothermic to exothermic, depending on the dichloroalkane present. However, the V{sub m}{sup E} are positive in most mixtures except for those corresponding to u=4,5 and v=5,6, which present contraction effects. These results indicate a set of specific interactions with simultaneous effects for V{sub m}{sup E} of expansion/contraction and for exothermic/endothermic H{sub m}{sup E} for this set of mixtures. The change in V{sub m}{sup E} with the chain length of the compounds is irregular. To achieve a good application of the UNIFAC model using the version of Dang and Tassios, parameters of the ester (G)/dichloride (G') interaction were calculated again, making a distinction, during its application, dependent on the acid part of the ester u. Hence, interaction parameters are presented as a function of u, and of the dichloroalkane chain length v. The most appropriate general expression was of the type:a{sub G/G{sup '}}={phi}(u,v)={sigma}sub(i=0)sup(n)a{sub i-1}u{sup i-1}+{sigma}sub(i=0= )sup(n)b{sub i-1}v{sup i-1}and with this proposal good estimations of enthalpies were obtained with the UNIFAC model.

  11. Valence isomerization of 2-phospha-4-silabicyclo[1.1.0]butane: a high-level ab initio study

    NARCIS (Netherlands)

    Slootweg, J.C.; Ehlers, A.W.; Lammertsma, K.

    2006-01-01

    The rearrangements for 2-phospha-4-silabicyclo[1.1.0]butane, analogous to the valence isomerization of the hydrocarbons bicyclobutane, 1,3-butadiene, and cyclobutene, were studied at the (U)QCISD(T)/ 6-311+G**//(U)QCISD/6-31G* level of theory. The monocyclic 1,2-dihydro-1,2-phosphasiletes are shown

  12. Polarization dependence of resonant X-ray emission spectra in 3dn transition metal compounds with n=0, 1, 2, 3

    International Nuclear Information System (INIS)

    Matsubara, Masahiko; Kotani, Akio; Shin, Shik; Uozumi, Takayuki; Harada, Yoshihisa

    2002-01-01

    The polarization dependence of 2p → 3d → 2p resonant X-ray emission spectroscopy (RXES) in 3d 1 , 3d 2 and 3d 3 systems (TiF 3 , VF 3 and Cr 2 O 3 , respectively) is measured and analyzed by means of the MX 6 (M denotes a transition metal and X denotes a ligand, respectively) cluster model. The results are compared with a previous one for the 3d 0 system (TiO 2 ). Generally, with increasing 3d electron number, the spectral structure of RXES becomes more complicated by the influence of the crystal field and the multiplet coupling effect. Moreover, we point out that the selection rules on the polarization dependence of RXES change with the 3d electron number and that a drastic resonance enhancement corresponding to the excitation to an antibonding state in the 3d 0 system is almost absent for the 3d n systems with n=1, 2 and 3. (author)

  13. Refining prognostic stratification of human papillomavirus-related oropharyngeal squamous cell carcinoma: different prognosis between T1 and T2

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Su Min; Lee, Sang Wook; Park, Sun Min [Dept. of Radiation Oncology, Asan Medical Center, University of Ulsan College of Medicine, Seoul (Korea, Republic of); and others

    2017-09-15

    To validate the 8th edition of the American Joint Committee on Cancer/Union for International Cancer Control (AJCC/UICC) TNM staging system for human papillomavirus (HPV)-related oropharyngeal squamous cell carcinoma (OPSCC) and investigate whether a modified classification better reflects the prognosis. Medical records of patients diagnosed with non-metastatic HPV-related OPSCC between 2010 and 2016 at a single institution were retrospectively reviewed. HPV status was determined by immunohistochemical analysis of p16 and/or HPV DNA polymerase chain reaction (PCR). We reclassified TNM stage T0-1 and N0-1 as group A, T2-3 or N2 as B, and T4 or N3 as C. Survival analysis according to 8th AJCC/UICC TNM staging and the modified classification was performed. Of 383 OPSCC patients, 211 were positive for HPV DNA PCR or p16. After exclusion, 184 patients were included in this analysis. Median age was 56 years (range, 31 to 81 years). Most primary tumors were in the palatine tonsil (148 tumors, 80%). The eighth AJCC/UICC TNM classification could not differentiate between stage I and II (p = 0.470) or II and III (p = 0.209). Applying modified grouping, the 3-year overall survival rate of group A was significantly higher than that of group B and C (98% vs. 91%, p = 0.039 and 98% vs. 78%, p < 0.001, respectively). Differentiation between group B and C was marginally significant (p = 0.053). The 8th AJCC/UICC TNM staging system did not clearly distinguish the prognosis of stage II from that of other stages. Including the T2N0-1 group in stage II may improve prognostic stratification.

  14. Pre-synaptic glycine GlyT1 transporter--NMDA receptor interaction: relevance to NMDA autoreceptor activation in the presence of Mg2+ ions.

    Science.gov (United States)

    Musante, Veronica; Summa, Maria; Cunha, Rodrigo A; Raiteri, Maurizio; Pittaluga, Anna

    2011-05-01

    Rat hippocampal glutamatergic terminals possess NMDA autoreceptors whose activation by low micromolar NMDA elicits glutamate exocytosis in the presence of physiological Mg(2+) (1.2 mM), the release of glutamate being significantly reduced when compared to that in Mg(2+)-free condition. Both glutamate and glycine were required to evoke glutamate exocytosis in 1.2 mM Mg(2+), while dizocilpine, cis-4-[phosphomethyl]-piperidine-2-carboxylic acid and 7-Cl-kynurenic acid prevented it, indicating that occupation of both agonist sites is needed for receptor activation. D-serine mimicked glycine but also inhibited the NMDA/glycine-induced release of [(3H]D-aspartate, thus behaving as a partial agonist. The NMDA/glycine-induced release in 1.2 mM Mg(2+) strictly depended on glycine uptake through the glycine transporter type 1 (GlyT1), because the GlyT1 blocker N-[3-(4'-fluorophenyl)-3-(4'-phenylphenoxy)propyl])sarcosine hydrochloride, but not the GlyT2 blocker Org 25534, prevented it. Accordingly, [(3)H]glycine was taken up during superfusion, while lowering the external concentration of Na(+), the monovalent cation co-transported with glycine by GlyT1, abrogated the NMDA-induced effect. Western blot analysis of subsynaptic fractions confirms that GlyT1 and NMDA autoreceptors co-localize at the pre-synaptic level, where GluN3A subunits immunoreactivity was also recovered. It is proposed that GlyT1s coexist with NMDA autoreceptors on rat hippocampal glutamatergic terminals and that glycine taken up by GlyT1 may permit physiological activation of NMDA pre-synaptic autoreceptors. © 2011 The Authors. Journal of Neurochemistry © 2011 International Society for Neurochemistry.

  15. Dipropyl 3,6-diphenyl-1,2-dihydro-1,2,4,5-tetrazine-1,2-dicarboxylate.

    Science.gov (United States)

    Rao, Guo-Wu; Hu, Wei-Xiao

    2003-05-01

    The title compound, C(22)H(24)N(4)O(4), was prepared from propyl chloroformate and 3,6-diphenyl-1,2-dihydro-s-tetrazine. This reaction yields the title compound rather than dipropyl 3,6-diphenyl-1,4-dihydro-s-tetrazine-1,4-dicarboxylate. The 2,3-diazabutadiene group in the central six-membered ring is not planar; the C=N double-bond length is 1.285 (2) A, and the average N-N single-bond length is 1.401 (3) A, indicating a lack of conjugation. The ring has a twist conformation, in which adjacent N atoms lie +/- 0.3268 (17) A from the plane of the ring. The molecule has twofold crystallographic symmetry.

  16. Trichoderma asperelloides Spores Downregulate dectin1/2 and TLR2 Receptors of Mice Macrophages and Decrease Candida parapsilosis Phagocytosis Independent of the M1/M2 Polarization

    Directory of Open Access Journals (Sweden)

    Andréa G. dos Santos

    2017-09-01

    Full Text Available The intensive use of pesticides to control pests in agriculture has promoted several issues relating to environment. As chemical pesticides remain controversial, biocontrol agents originating from fungi could be an alternative. Among them, we highlight biocontrol agents derived from the fungi genus Trichoderma, which have been documented in limiting the growth of other phytopathogenic fungus in the roots and leaves of several plant species. An important member of this genus is Trichoderma asperelloides, whose biocontrol agents have been used to promote plant growth while also treating soil diseases caused by microorganisms in both greenhouses and outdoor crops. To evaluate the safety of fungal biological agents for human health, tests to detect potentially adverse effects, such as allergenicity, toxicity, infectivity and pathogenicity, are crucial. In addition, identifying possible immunomodulating properties of fungal biocontrol agents merits further investigation. Thus, the aim of this study was to evaluate the effects of T. asperelloides spores in the internalization of Candida parapsilosis yeast by mice phagocytes, in order to elucidate the cellular and molecular mechanism of this interaction, as a model to understand possible in vivo effects of this fungus. For this, mice were exposed to a fungal spore suspension through-intraperitoneal injection, euthanized and cells from the peripheral blood and peritoneal cavity were collected for functional, quantitative and phenotypic analysis, throughout analysis of membrane receptors gene expression, phagocytosis ability and cells immunophenotyping M1 (CCR7 and CD86 and M2 (CCR2 and CD206. Our analyses showed that phagocytes exposed to fungal spores had reduced phagocytic capacity, as well as a decrease in the quantity of neutrophils and monocytes in the peripheral blood and peritoneal cavity. Moreover, macrophages exposed to T. asperelloides spores did not display the phenotypic profile M1/M2, and

  17. Non-covalent interactions between {N,N′-bis[(2-pyridinyl)methylene]-1, 2-benzenediamine]-bis(nitrato)}Cu(II) with pyridoxine hydrochloride in methanol at T = (298.15, 308.15 and 318.15) K

    International Nuclear Information System (INIS)

    Brahman, Dhiraj; Sinha, Biswajit

    2014-01-01

    Highlights: • Methanolic solution of pyridoxine hydrochloride used as solvent. • {N,N′-bis[(2-pyridinyl)methylene]-1, 2-benzenediamine]-bis(nitrato)}Cu(II) used as solute. • Partial molar volumes and viscosity B-coefficients of the solute were determined. • Weak 1:1 association between the complex and pyridoxine hydrochloride found. • Non-covalent interactions and Cu(II) complex acts as a net structure maker in the ternary solutions. - Abstract: Non-covalent interactions between of {N,N′-bis[(2-pyridinyl)methylene]-1, 2-benzenediamine]-bis(nitrato)}Cu(II) with pyridoxine hydrochloride in methanol were investigated by a combination of physico-chemical and spectrophotometric methods at T = (298.15, 308.15 and 318.15) K under ambient pressure. From measured density and viscosity data the apparent molar volume (ϕ V ), the slope (S V ∗ ), standard partial molar volume (ϕ V 0 ), standard transfer volume (Δ t ϕ V 0 ), isobaric apparent molar expansibility (ϕ E ), standard isobaric partial molar expansibility (ϕ E 0 ), the viscosity B-coefficient, its temperature derivative (∂B/∂T), solvation number (S n ) were calculated and discussed on the basis of specific or non-specific (solute + cosolute) and (solute + solvent) interactions. Thermodynamics of viscous flow were discussed on the basis of the transition state theory. Spectrophotometric results indicated 1:1 (solute + cosolute) interaction between the complex and pyridoxine hydrochloride

  18. Enrofloxacin and Probiotic Lactobacilli Influence PepT1 and LEAP-2 mRNA Expression in Poultry

    NARCIS (Netherlands)

    Pavlova, Ivelina; Milanova, Aneliya; Danova, Svetla; Fink-Gremmels, Johanna

    2016-01-01

    Expression of peptide transporter 1 (PepT1) and liver-expressed antimicrobial peptide 2 (LEAP-2) in chickens can be influenced by food deprivation, pathological conditions and drug administration. Effect of three putative probiotic Lactobacillus strains and enrofloxacin on the expression of PepT1

  19. M1 and M2 macrophages derived from THP-1 cells differentially modulate the response of cancer cells to etoposide

    International Nuclear Information System (INIS)

    Genin, Marie; Clement, Francois; Fattaccioli, Antoine; Raes, Martine; Michiels, Carine

    2015-01-01

    Tumor associated macrophages (TAMs) are present in high density in solid tumors. TAMs share many characteristics with alternatively activated macrophages, also called M2. They have been shown to favor tumor development and a role in chemoresistance has also been suggested. Here, we investigated the effects of M2 in comparison to M1 macrophages on cancer cell sensitivity to etoposide. We set up a model of macrophage polarization, starting from THP-1 monocytes differentiated into macrophages using PMA (Phorbol 12-myristate 13-acetate). Once differentiated (M0 macrophages), they were incubated with IL-4 and IL-13 in order to obtain M2 polarized macrophages or with IFN-gamma and LPS for classical macrophage activation (M1). To mimic the communication between cancer cells and TAMs, M0, M1 or M2 macrophages and HepG2 or A549 cancer cells were co-cultured during respectively 16 (HepG2) or 24 (A549) hours, before etoposide exposure for 24 (HepG2) or 16 (A549) hours. After the incubation, the impact of etoposide on macrophage polarization was studied and cancer cell apoptosis was assessed by western-blot for cleaved caspase-3 and cleaved PARP-1 protein, caspase activity assay and FACS analysis of Annexin V and PI staining. mRNA and protein expression of M1 and M2 markers confirmed the polarization of THP-1-derived macrophages, which provide a new, easy and well-characterized model of polarized human macrophages. Etoposide-induced cancer cell apoptosis was markedly reduced in the presence of THP-1 M2 macrophages, while apoptosis was increased in cells co-cultured with M1 macrophages. On the other hand, etoposide did not influence M1 or M2 polarization. These results evidence for the first time a clear protective effect of M2 on the contrary to M1 macrophages on etoposide-induced cancer cell apoptosis

  20. Artrodese Cervical C1-C2 pelas técnicas de Harms e Magerl Artrodesis cervical C1-C2 por las técnicas de Harms y Magerl Harms and Magerl types of C1-C2 cervical artrodesis

    Directory of Open Access Journals (Sweden)

    Cristina Maria Varino Sousa

    2010-09-01

    Full Text Available INTRODUÇÃO: A instabilidade atlantoaxial pode resultar em alterações neurológicas, dor e limitação da mobilidade cervical. É uma situação grave pelo risco de tetraparésia ou morte súbita. Na literatura estão descritas várias técnicas de estabilização cirúrgica C1-C2 e neste artigo foram comentadas com maior ênfase as técnicas de Harms e Magerl, as mais utilizadas em nossa instituição. OBJETIVO: Descrever a casuística das artrodeses atlantoaxiais realizadas nos últimos cinco anos no Centro Hospitalar do Porto, particularmente, taxa de consolidações, complicações observadas, reintervenções e comparação com os estudos publicados. MÉTODOS: Estudo retrospectivo, com cinco anos, dos doentes submetidos a artrodese atlantoaxial no Centro Hospitalar do Porto. RESULTADOS: Foram operados 11 doentes no período do estudo, a maioria com instabilidade de causa traumática. O método de artrodese mais utilizado foi o descrito por Magerl. Não foram observadas lesões vasculares. Foram registradas complicações infecciosas em quatro doentes, sendo que essas infecções foram mais comuns em doentes com patologias inflamatórias de base. Obteve-se uma taxa de consolidação da artrodese de 100%; não foram necessárias cirurgias de revisão. CONCLUSÃO: Em nossa série, as artrodeses posteriores pelas técnicas de Harms e de Magerl resultaram em um ótimo controle da instabilidade C1-C2. Doentes com indicação de artrodese por instabilidade reumática apresentaram alta taxa de complicações infecciosas.INTRODUCCIÓN: la inestabilidad atlantoaxial puede resultar en alteraciones neurológicas, dolor y limitación de la movilidad cervical. Es una situación grave por el riesgo de tetraparesia o muerte súbita. En la literatura están descritas varias técnicas de estabilización quirúrgica C1-C2 y en este artículo serán comentadas con mayor énfasis las técnicas de Harms y Magerl, las más utilizadas en nuestra institución

  1. Half-lives of isomeric levels of sup 1 sup 0 sup 7 sup m Ag, sup 1 sup 0 sup 9 sup m Ag and sup 1 sup 0 sup 3 sup m Rh photoactivated by sup 6 sup 0 Co gamma-ray irradiation

    CERN Document Server

    Yoshida, E; Kojima, Y; Shizuma, K

    2000-01-01

    Photoactivation by gamma-rays from sup 6 sup 0 Co of 10 kCi has been performed for isomers of sup 1 sup 0 sup 7 sup m Ag, sup 1 sup 0 sup 9 sup m Ag and sup 1 sup 0 sup 3 sup m Rh and half-lives of these isomers were determined. Gamma-rays emitted from sup 1 sup 0 sup 7 sup m Ag and sup 1 sup 0 sup 9 sup m Ag were measured with a low-background Ge detector and internal conversion electrons from sup 1 sup 0 sup 3 sup m Rh were measured with a 2 pi gas flow counter. The half-lives obtained are: sup 1 sup 0 sup 7 sup m Ag: 44.5+-0.8 s, sup 1 sup 0 sup 9 sup m Ag: 38.0+-1.2 s and sup 1 sup 0 sup 3 sup m Rh: 54.8+-3.8 min. The results are in agreement with previous values obtained by different excitation methods.

  2. Minimal unitary representation of D(2,1;λ) and its SU(2) deformations and d=1, N=4 superconformal models

    International Nuclear Information System (INIS)

    Govil, Karan; Gunaydin, Murat

    2013-01-01

    Quantization of the geometric quasiconformal realizations of noncompact groups and supergroups leads directly to their minimal unitary representations (minreps). Using quasiconformal methods massless unitary supermultiplets of superconformal groups SU(2,2|N) and OSp(8 ⁎ |2n) in four and six dimensions were constructed as minreps and their U(1) and SU(2) deformations, respectively. In this paper we extend these results to SU(2) deformations of the minrep of N=4 superconformal algebra D(2,1;λ) in one dimension. We find that SU(2) deformations can be achieved using n pair of bosons and m pairs of fermions simultaneously. The generators of deformed minimal representations of D(2,1;λ) commute with the generators of a dual superalgebra OSp(2n ⁎ |2m) realized in terms of these bosons and fermions. We show that there exists a precise mapping between symmetry generators of N=4 superconformal models in harmonic superspace studied recently and minimal unitary supermultiplets of D(2,1;λ) deformed by a pair of bosons. This can be understood as a particular case of a general mapping between the spectra of quantum mechanical quaternionic Kähler sigma models with eight super symmetries and minreps of their isometry groups that descends from the precise mapping established between the 4d, N=2 sigma models coupled to supergravity and minreps of their isometry groups.

  3. CYP1A1, CYP2E1 Y RIESGO A CÁNCER GÁSTRICO EN UNA POBLACIÓN COLOMBIANA DE ALTA INCIDENCIA

    Directory of Open Access Journals (Sweden)

    Eduardo Castaño

    2009-09-01

    Full Text Available El objetivo fue probar la hipótesis de que en casos y controles, de una población colombiana con alta incidencia de cáncer gástrico, muestran diferencias significativas entre las frecuencias de los polimorfismos genéticos CYP1A1-m2 y CYP2E1-c2; y a la vez, probar si hay diferencias entre el hábito del tabaquismo, el consumo de licor y el estrato socioeconómico; así como también sus posibles interacciones. Ochenta y siete pacientes afectados por cáncer gástrico e igual número de controles, del mismo grupo poblacional, genéticamente aislado, pertenecientes a la comunidad “paisa” del departamento de Caldas, fueron genotipíficados por medio de PCR-RFLPs para los polimorfismos CYP1A1-m2 y CYP2E1-c2. Además, se tuvo en cuenta las variables socioeconómicas y el estilo de vida, con respecto al tabaquismo y al consumo de alcohol. Los resultados encontrados sugieren que los portadores del polimorfismo CYP2E1-c2, asociado con mayor actividad metabólica, tienen mayor riesgo a desarrollar cáncer gástrico (OR=3.6, CI95% 1.6-8.1/p=0,002. En contraste, la frecuencia del polimorfismo CYP1A1*2A (MspI, también asociado con mayor actividad enzimática, mostró similar frecuencia entre los dos grupos. El tabaquismo y el estrato socioeconómico bajo, también mostraron diferencias significativas. En conclusión, se evidencia interacción significativa entre gen-ambiente, particularmente entre el tabaquismo y los alelos bioactiavantes CYP2E1- c2 y CYP1A1-m2, que pueden alterar la susceptibilidad a cáncer de estómago en esta región Andina del noroeste de Sur América.

  4. Composition dependent room temperature structure, electric and magnetic properties in magnetoelectric Pb(Fe{sub 1/2}Nb{sub 1/2})O{sub 3}−Pb(Fe{sub 2/3}W{sub 1/3})O{sub 3} solid-solutions

    Energy Technology Data Exchange (ETDEWEB)

    Matteppanavar, Shidaling [Department of Physics, Jnanabharathi Campus, Bangalore University, Bangalore, 560056 (India); Rayaprol, Sudhindra [UGC-DAE-Consortium for Scientific Research, Mumbai Centre, B A R C Campus, Mumbai, 400085 (India); Angadi, Basavaraj, E-mail: brangadi@gmail.com [Department of Physics, Jnanabharathi Campus, Bangalore University, Bangalore, 560056 (India); Sahoo, Balaram [Materials Research Centre, Indian Institute of Science, Bangalore, 560012 (India)

    2016-08-25

    We report on the studies of room temperature (RT) crystal structure, electric and magnetic properties of (1−x) Pb(Fe{sub 1/2}Nb{sub 1/2})O{sub 3} – x Pb(Fe{sub 2/3}W{sub 1/3})O{sub 3} (PFN{sub 1−x} – PFW{sub x}) (x = 0.0, 0.2, 0.4, 0.6, 0.8 and 1.0) solid solutions through the measurements of X-ray diffraction, FTIR, scanning electron microscopy (SEM), Neutron diffraction, Raman, Magnetic, Mössbauer and ferroelectric measurements. FTIR spectra showed two main perovskite related transmission bands. The SEM analysis shows an average grain size of 2 μm for all the solid solutions. Rietveld refinement was performed on RT X-ray diffraction (XRD) and neutron diffraction (ND), which reveals, the monoclinic phase for x = 0.0 with space group Cm and Cubic phase for x = 1.0 with space group Pm-3m. In other words, increasing x, the samples exhibit a gradual phase transition from monoclinic to cubic. In addition, the Raman spectroscopy corroborates the change in structural symmetry from monoclinic (Cm) to cubic (Pm-3m) on varying x. The coexistence of both monoclinic and cubic symmetries was observed between x = 0.20.8. Magnetic measurements shows that, the magnetic phase transition from paramagnetic to antiferromagnetic (AFM) was observed at or above RT for x = 0.6 and above. The magnetic structure was refined using the propagation vector k = (½, ½, ½) and structure was found to be G-type antiferromagnetic. Magnetic properties (M-H loops) shows, a weak ferromagnetic behaviour with antiferromagnetic ordering at RT. At RT, x = 0.00.6 the samples exhibits disordered paramagnetic property but weakly coupled with antiferromagnetic domains. But, x = 0.8 and 1.0 samples show antiferromagnetic and they are weakly coupled with paramagnetic domains. The temperature dependent magnetization (M(T)) confirms, the augmentation of Néel temperature (T{sub N}) from 155 K to 350 K on increasing x. Mössbauer spectroscopy confirms superparamagnetic nature with the presence of

  5. Synthesis of 1-(2,3-dihydroxypropyl)-2-nitro-1H-imidazole-2-14C and N-(2-hydroxyethyl)-2-(2-nitro-1H-imidazol-1-YL-2-14C)acetamide

    International Nuclear Information System (INIS)

    Fong, M.T.; Leaffer, M.A.

    1986-01-01

    We have prepared the 14 C-labeled analogs of NSC 261036, 1-(2,3-dihydroxypropyl)-2-nitro-1H-imidazole-2- 14 C, and NSC 301467, N-(2-hydroxyethyl)-2-(2-nitro-1H-imidazol-1-yl-2- 14 C) acetamide, for pharmacological, drug distribution, and mechanisms of action studies. The latter is an analog designed for lower toxicity and improved properties. The former is a metabolite of, and appears to be less toxic than, misonidazole. (author)

  6. Gadolinium-enhanced T{sub 1}-weighted MR urography versus T{sub 2}-weighted (HASTE) MR urography in children; Kontrastangehobene T{sub 1}-gewichtete MR-Urographie versus T{sub 2}-gewichtete (HASTE) MR-Urographie im Kindesalter

    Energy Technology Data Exchange (ETDEWEB)

    Staatz, G.; Nolte-Ernsting, C.C.A.; Haage, P.; Tacke, J.; Guenther, R.W. [Technische Hochschule Aachen (Germany). Klinik fuer Radiologische Diagnostik; Rohrmann, D. [Technische Hochschule Aachen (Germany). Urologische Klinik; Stollbrink, C. [Technische Hochschule Aachen (Germany). Kinderklinik

    2001-11-01

    Purpose: To evaluate gadolinium-enhanced T{sub 1}-weighted excretory MR urography (EMRU) versus T{sub 2}-weighted (HASTE) MR urography in children with upper urinary tract abnormalities. Patients and Methods: In a prospective study 63 children, aged from 3 weeks to 15 years, underwent MR urography in a 1.5-T scanner. Before and after an intravenous injection of 0.05 mg/kg body weight of furosemide, respiratory-triggered HASTE images were obtained for T{sub 2}-weighted MR urography. EMRU was performed subsequent to i.v. gadolinium injection with respiratory-gated, coronal 3D-gradient-echo sequences. Results: Compared to T{sub 2}-weighted (HASTE) MR urography, gadolinium-enhanced MR urography revealed a superior diagnostic accuracy in non-dilated collecting systems (horseshoe kidneys, ectopic kidneys, duplex systems, single ectopic ureters, ureteroceles). EMRU and T{sub 2}-weighted (HASTE) MRU turned out to be equivalent in the assessment of obstructed but normal functioning upper urinary tracts (UPJ obstructions, megaureters). Non-functioning dilated collecting systems and multicystic dysplastic kidneys were best visualized with use of T{sub 2}-weighted (HASTE) MR urography. Conclusion: Respiratory-gated gadolinium-enhanced T{sub 1}-weighted MRU allows accurate evaluation of most upper urinary tract abnormalities. T{sub 2}-weighted (HASTE) MRU complements GMRU in the evaluation of non-functioning renal units and cystic disease of the kidneys. (orig.) [German] Ziel: Vergleich der kontrastangehobenen T{sub 1}-gewichteten MR-Urographie mit der T{sub 2}-gewichteten (HASTE) MR-Urographie bei Kindern mit Anomalien des oberen Harntraktes. Methoden: In einer prospektiven Studie wurde bei 63 Kindern (3 Wo. - 15J.) eine MR-Urographie (MRU) in einem 1,5-Tesla-Magneten durchgefuehrt. Die T{sub 2}-gewichtete MRU erfolgte vor und nach intravenoeser Injektion von 0,05 mg/kg KG Furosemid mit atemgetriggerten HASTE-Sequenzen. Fuer die T{sub 1}-gewichtete MRU wurden nach

  7. Amplification of the Ect2 proto-oncogene and over-expression of Ect2 mRNA and protein in nickel compound and methylcholanthrene-transformed 10T1/2 mouse fibroblast cell lines

    International Nuclear Information System (INIS)

    Clemens, Farrah; Verma, Rini; Ramnath, Jamuna; Landolph, Joseph R.

    2005-01-01

    Occupational exposure of humans to mixtures of insoluble and soluble nickel (Ni) compounds correlates with increased incidences of lung, sinus, and pharyngeal tumors. Specific insoluble Ni compounds are carcinogenic to animals by inhalation and induce morphological and neoplastic transformation of cultured rodent cells. Our objectives were to (1) understand mechanisms of nickel ion-induced cell transformation, hence carcinogenesis and (2) develop biomarkers of nickel ion exposure and nickel ion-induced cell transformation. We isolated mRNAs from green nickel oxide (NiO), crystalline nickel monosulfide (NiS), and 3-methylcholanthrene (MCA) transformed C3H/10T1/2 Cl 8 cell lines, and determined by mRNA differential display that nine mRNA fragments were differentially expressed between Ni transformed and non-transformed 10T1/2 cell lines. Fragment R2-5 was expressed at higher steady-state levels in the transformed cell lines. R2-5 had 100% sequence identity to part of the coding region of Ect2, a mouse proto-oncogene encoding a GDP-GTP exchange factor. The 3.9-kb Ect2 transcript was expressed at 1.6- to 3.6-fold higher steady-state levels in four Ni transformed, and in two MCA-transformed, cell lines. Ect2 protein was expressed at 3.0- to 4.5-fold higher steady-state levels in Ni-transformed and in MCA-transformed cell lines. The Ect2 gene was amplified by 3.5- to 10-fold in Ni transformed, and by 2.5- to 3-fold in MCA transformed cell lines. Binding of nickel ions to enzymes of DNA synthesis likely caused amplification of the Ect2 gene. Ect2 gene amplification and over-expression of Ect2 mRNA and protein can cause microtubule disassembly and cytokinesis, contributing to induction and maintenance of morphological, anchorage-independent, and neoplastic transformation of these cell lines. Over-expression of Ect2 protein is a useful biomarker to detect exposure to nickel compounds and nickel ion-induced morphological and neoplastic cell transformation

  8. 1/N expansions in P(phi2)sub(4-epsilon) theory. Pt. 1

    International Nuclear Information System (INIS)

    Symanzik, K.

    1977-01-01

    1/N expansions in O(N) invariant one-scale massless P(phi vector 2 )4-epsilon theory are derived for finite and infinite bare coupling constant. Since superficially relevant (phi vector 2 )sup(m), m >= 3, interactions can hereby be transformed into interactions irrelevant for large-distance behaviour, the scale-invariant limit theory is universal. (orig.) [de

  9. Does occupational exposure to solvents and pesticides in association with glutathione S-transferase A1, M1, P1, and T1 polymorphisms increase the risk of bladder cancer? The Belgrade case-control study.

    Directory of Open Access Journals (Sweden)

    Marija G Matic

    Full Text Available OBJECTIVE: We investigated the role of the glutathione S-transferase A1, M1, P1 and T1 gene polymorphisms and potential effect modification by occupational exposure to different chemicals in Serbian bladder cancer male patients. PATIENTS AND METHODS: A hospital-based case-control study of bladder cancer in men comprised 143 histologically confirmed cases and 114 age-matched male controls. Deletion polymorphism of glutathione S-transferase M1 and T1 was identified by polymerase chain reaction method. Single nucleotide polymorphism of glutathione S-transferase A1 and P1 was identified by restriction fragment length polymorphism method. As a measure of effect size, odds ratio (OR with corresponding 95% confidence interval (95%CI was calculated. RESULTS: The glutathione S-transferase A1, T1 and P1 genotypes did not contribute independently toward the risk of bladder cancer, while the glutathione S-transferase M1-null genotype was overrepresented among cases (OR = 2.1, 95% CI = 1.1-4.2, p = 0.032. The most pronounced effect regarding occupational exposure to solvents and glutathione S-transferase genotype on bladder cancer risk was observed for the low activity glutathione S-transferase A1 genotype (OR = 9.2, 95% CI = 2.4-34.7, p = 0.001. The glutathione S-transferase M1-null genotype also enhanced the risk of bladder cancer among subjects exposed to solvents (OR = 6,5, 95% CI = 2.1-19.7, p = 0.001. The risk of bladder cancer development was 5.3-fold elevated among glutathione S-transferase T1-active patients exposed to solvents in comparison with glutathione S-transferase T1-active unexposed patients (95% CI = 1.9-15.1, p = 0.002. Moreover, men with glutathione S-transferase T1-active genotype exposed to pesticides exhibited 4.5 times higher risk in comparison with unexposed glutathione S-transferase T1-active subjects (95% CI = 0.9-22.5, p = 0.067. CONCLUSION: Null or low-activity genotypes of the

  10. Nicotine can skew the characterization of the macrophage type-1 (M{Phi}1) phenotype differentiated with granulocyte-macrophage colony-stimulating factor to the M{Phi}2 phenotype

    Energy Technology Data Exchange (ETDEWEB)

    Yanagita, Manabu; Kobayashi, Ryohei [Department of Periodontology, Division of Oral Biology and Disease Control, Osaka University Graduate School of Dentistry, Osaka 565-0871 (Japan); Murakami, Shinya, E-mail: ipshinya@dent.osaka-u.ac.jp [Department of Periodontology, Division of Oral Biology and Disease Control, Osaka University Graduate School of Dentistry, Osaka 565-0871 (Japan)

    2009-10-09

    Macrophages (M{Phi}s) exhibit functional heterogeneity and plasticity in the local microenvironment. Recently, it was reported that M{Phi}s can be divided into proinflammatory M{Phi}s (M{Phi}1) and anti-inflammatory M{Phi}s (M{Phi}2) based on their polarized functional properties. Here, we report that nicotine, the major ingredient of cigarette smoke, can modulate the characteristics of M{Phi}1. Granulocyte-macrophage colony-stimulating factor-driven M{Phi}1 with nicotine (Ni-M{Phi}1) showed the phenotypic characteristics of M{Phi}2. Like M{Phi}2, Ni-M{Phi}1 exhibited antigen-uptake activities. Ni-M{Phi}1 suppressed IL-12, but maintained IL-10 and produced high amounts of MCP-1 upon lipopolysaccharide stimulation compared with M{Phi}1. Moreover, we observed strong proliferative responses of T cells to lipopolysaccharide-stimulated M{Phi}1, whereas Ni-M{Phi}1 reduced T cell proliferation and inhibited IFN-{gamma} production by T cells. These results suggest that nicotine can change the functional characteristics of M{Phi} and skew the M{Phi}1 phenotype to M{Phi}2. We propose that nicotine is a potent regulator that modulates immune responses in microenvironments.

  11. Canted ferrimagnetism and giant coercivity in the nonstoichiometric double perovskite L a2N i1.19O s0.81O6

    Science.gov (United States)

    Feng, Hai L.; Reehuis, Manfred; Adler, Peter; Hu, Zhiwei; Nicklas, Michael; Hoser, Andreas; Weng, Shih-Chang; Felser, Claudia; Jansen, Martin

    2018-05-01

    The nonstoichiometric double perovskite oxide L a2N i1.19O s0.81O6 was synthesized by solid-state reaction and its crystal and magnetic structures were investigated by powder x-ray and neutron diffraction. L a2N i1.19O s0.81O6 crystallizes in the monoclinic double perovskite structure (general formula A2B B'O6 ) with space group P 21/n , where the B site is fully occupied by Ni and the B ' site by 19% Ni and 81% Os atoms. Using x-ray absorption spectroscopy an O s4.5 + oxidation state was established, suggesting the presence of about 50% paramagnetic O s5 + (5 d3 , S =3 /2 ) and 50% nonmagnetic O s4 + (5 d4 , Jeff=0 ) ions at the B ' sites. Magnetization and neutron diffraction measurements on L a2N i1.19O s0.81O6 provide evidence for a ferrimagnetic transition at 125 K. The analysis of the neutron data suggests a canted ferrimagnetic spin structure with collinear N i2 + -spin chains extending along the c axis but a noncollinear spin alignment within the a b plane. The magnetization curve of L a2N i1.19O s0.81O6 features a hysteresis with a very high coercive field, HC=41 kOe , at T =5 K , which is explained in terms of large magnetocrystalline anisotropy due to the presence of Os ions together with atomic disorder. Our results are encouraging to search for rare-earth-free hard magnets in the class of double perovskite oxides.

  12. Modulation-free bismuth-lead cuprate superconductors: BiPbSr1+xL1-xCuO6 and BiPbSr2Y1-xCaxCu2O8

    International Nuclear Information System (INIS)

    Manivannan, V.; Gopalakrishnan, J.; Rao, C.N.R.

    1991-01-01

    Modulation-free BiPbSrLCuO 6 (L=La, Pr, Nd) and BiPbSr 2 YCu 2 O 8 , which are isotypic with the n=1 and 2 members of the Bi 2 Sr 2 Ca n-1 Cu n O 2n+4 family, have been prepared and characterized. These parent compounds are nonsuperconducting, but when doped with holes by substitution chemistry give modulation-free superconducting cuprates of the general formulas BiPbSr 1+xL1-x CuO 6 and BiPbSr 2 Y 1-x Ca x Cu 2 O 8 , exhibiting maximum T c 's of 24 and 85 K, respectively. Significantly, the hole concentration at the maximum T c is 0.12 in the cuprate family with a single Cu-O layer and 0.22 in that with two Cu-O layers

  13. Kinetics and thermodynamics of the dissolution of Th1-xMxO2 solid solutions (M = U, Pu)

    International Nuclear Information System (INIS)

    Hubert, S.; Heisbourg, G.; Dacheux, N.; Moisy, Ph.; Purans, J.

    2004-01-01

    Kinetics of the dissolution of Th 1-x M x O 2 (M = U, Pu) solid solutions was investigated as a function of several chemical parameters such as pH, substitution ratio, temperature, ionic strength, and electrolyte. Several compositions of Th 1-x U x O 2 and Th 1-x Pu x O 2 were synthesized and characterized before and after leaching by using several methods such as XRD, EXAFS, BET, PIXE, SEM, and XPS. Leaching tests were performed in nitric, hydrochloric or sulfuric media and groundwater. The normalized dissolution rates were evaluated for Th 1-x U x O 2 , and Th 0.88 Pu 0.12 O 2 leading to the determination of the partial order related to the proton concentration, n, and to the corresponding normalized dissolution rate constant at pH = 0, k'T. While for Th enriched solids, the solid solutions Th 1-x U x O 2 have the same dissolution behaviour than ThO 2 with a partial order n0.3, in the case of uranium enriched solids, Th 1-x U x O 2 has the same dissolution behaviour than UO 2 with a partial order of n = 1, indicating that uranium oxidation rate becomes the limiting step of the dissolution process. The stoichiometry of the release of both actinides (U or Pu, Th) was verified until the precipitation of thorium occurred in the leachate for pH > 2, while uranium was released in the solution as an uranyl form. For uranium enriched solid solutions, thermodynamic equilibrium was reached after 100 days, and solubility constant of secondary phase was determined. In the case of Th 1-x Pu x O 2 , the dissolution behaviour is similar to that of ThO 2 , but only kinetic aspect of the dissolution can be studied. From the analysis of XPS and EXAFS data on leached and un-leached Th 1-x U x O 2 samples, the dissolution mechanism of solid solutions was explained and will be discussed. The role of the electrolytes on the dissolution of the solid solutions is discussed. Kinetics parameters of dissolution are also given in groundwater and in neutral media

  14. Preclinical pharmacological study of 99mTcN(NOET)2 and comparison with 201Tl in redistribution of ischemia myocardium

    International Nuclear Information System (INIS)

    Wang, J.C.; Zhang, J.B.; Wang, Q.; Mi, H.Z.; Wang, X.B.

    2002-01-01

    0.46%,blood clearance T(α) 1/2 =2.8±0.1min,T(β) 1/2 =142.7±32.7min,Cl=292.3±117.1ml/h.Imaging studies demonstrated that 99m TcN(NOET) 2 was distributed rapidly in the myocardium of dogs, disappearance of pulmonary uptake was faster than that of myocardium, the uptake was higher in liver. At 10,30,60,90 and 120min postinjection the myocardial uptake were 4.2±0.21, 5.3±1.48, 5.3±0.66, 4.0±0.53 and 3.67±0.35% ID; the heart-to-lung and heart-liver ratio was 1.24±0.31, 2.03±0.45, 2.33±0.31, 2.23±0.5, 2.07±0.49, and 0.94±0.008, 0.78±0.15, 0.56±0.22, 0.53±0.22, 0.38±0.15, respectively. The myocardial images were best distinct at 30 and 60 min postinjection. The redistribution of 99m TcN(NOET) 2 in the area of ischemia myocardial was quite obvious at 60 and 120 min after injection. The result of redistribution of 99m TcN(NOET) 2 was about same in comparison with that of 201 Tl in the same dog. Conclusion: 99m TcN(NOET) 2 is very worth to be one of new myocardial imaging agent, it has re-distributive character just as that of 201 Tl.

  15. Synthesis, Magnetization, and Electrical Transport Properties of Mn3Zn0.9Cu0.1N

    Directory of Open Access Journals (Sweden)

    Y. Yin

    2013-01-01

    Full Text Available We synthesized Mn3Zn0.9Cu0.1N by solid state reaction, and magnetic as well as electrical transport properties were investigated. It is found that Mn3Zn0.9Cu0.1N exhibits a first-order antiferromagnetism (AFM to paramagnetic (PM transition with the Néel temperature TN ~163 K, and substitution of Cu for Zn would favor ferromagnetism (FM state and weaken AFM ground state, leading to a convex curvature character of M(T curve. With high external fields 10 kOe–50 kOe, magnetic transition remains a robust AFM-PM feature while FM phase is completely suppressed. Thermal hysteresis of M(T under 500 Oe is also suppressed when the magnetic field exceeds 10 kOe. Mn3Zn0.9Cu0.1N exhibits a good metallic behavior except for a slope change around TN, which is closely related to AFM-PM magnetic transition. Compared with the first differential of resistivity with respect to temperature for (dρ/dTMn3ZnN in transition temperature range, the absolute value of (dρ/dTMn3Zn0.9Cu0.1N is much lower which is close to zero.

  16. Survival benefit of post-mastectomy radiotherapy in breast carcinoma patients with T1-2 tumor and 1-3 axillary lymph node(s) metastasis

    International Nuclear Information System (INIS)

    Duraker, N.; Demir, D.; Bati, B.; Yilmaz, B.D.; Bati, Y.; Sobutay, E.; Caynak, Z.C.

    2012-01-01

    The objective of this study was to investigate the role of post-mastectomy radiotherapy in breast carcinoma patients with a tumor size of 5 cm or smaller (T1-2) and 1-3 axillary lymph node(s) metastasis (N1). We retrospectively reviewed the file records of 575 patients receiving radiotherapy (452 patients) and not receiving radiotherapy (123 patients). In the whole series, locoregional recurrence-free survival was significantly better in patients receiving radiotherapy compared with patients not receiving radiotherapy (P 0.25 and in T2N1 breast carcinoma patients with a lymph node ratio of >0.08. In patients with a lymph node ratio equal to or less than these ratios, post-mastectomy radiotherapy could be omitted to avoid radiotherapy-related risks. (author)

  17. A fast response cadmium-selective polymeric membrane electrode based on N,N'-(4-methyl-1,2-phenylene)diquinoline-2-carboxamide as a new neutral carrier

    Energy Technology Data Exchange (ETDEWEB)

    Rezaei, B. [Department of Chemistry, Isfahan University of Technology, Isfahan 84156-84111 (Iran, Islamic Republic of)], E-mail: rezaei@cc.iut.ac.ir; Meghdadi, S.; Zarandi, R. Fazel [Department of Chemistry, Isfahan University of Technology, Isfahan 84156-84111 (Iran, Islamic Republic of)

    2008-05-01

    A new polyvinylchloride membrane sensor for Cd{sup 2+} ions based on N,N'-(4-methyl-1,2-phenylene)diquinoline-2-carboxamide (Mebqb) as a new and excellent neutral ionophore has been prepared. The sensor shows a Nernestian response for cadmium ions over a wide concentration range (1.0 x 10{sup -6} to 1.0 x 10{sup -1} M) with the determination coefficient of 0.9964 and slope of 29.9 {+-} 0.5 mV decade{sup -1}. The limit of detection is 8 x 10{sup -7} M. It has a fast response time of 3-8 s and can be used for at least 8 weeks without any divergence in potential. The electrode can be used in the pH range from 4.0 to 9.0. The proposed sensor shows a very good discriminating ability towards Cd{sup 2+} ion in comparison to some alkali, alkaline earth, transition and heavy metal ions. It was successfully applied for the direct determination of Cd{sup 2+}in standard and real sample solutions.

  18. Atmospheric chemistry of n-CxF2x+1CHO (x = 1, 2, 3, 4)

    DEFF Research Database (Denmark)

    Hurley, M. D.; Ball, J. C.; Wallington, T. J.

    2006-01-01

    Smog chamber/FTIR techniques were used to study the atmospheric fate of n-C(x)F(2)(x)(+1)C(O) (x = 1, 2, 3, 4) radicals in 700 Torr O(2)/N(2) diluent at 298 +/- 3 K. A competition is observed between reaction with O(2) to form n-C(x)()F(2)(x)()(+1)C(O)O(2) radicals and decomposition to form n-C(x...... to the atmospheric chemistry of n-C(x)F(2)(x)(+1)C(O) radicals and their possible role in contributing to the formation of perfluorocarboxylic acids in the environment....

  19. Cross sections for the 14N(n,p0), (n0), and (n1) reactions from 0.5 to 15 MeV

    International Nuclear Information System (INIS)

    Morgan, G.L.

    1978-09-01

    Cross sections were measured for the 14 N(n,p 0 ) reaction from 0.5 to 7.0 MeV and for the (n0 ) and (n1 ) reactions from 1 to 15 MeV and 4 to 15 MeV, respectively. The data were obtained using a gaseous scintillator containing N 2 and Xe mixtures. A linac was used as a pulsed, white neutron source with a 29-m fight path. The results of the measurement are compared to the current evaluated file for nitrogen; agreement is good for neutron energies below 8 MeV, but the measurement is substantially higher than the evaluation for neutron energies near 10 MeV

  20. J e (4.2 K, 31.2 T) beyond 1 kA/mm2 of a ~3.2 μm thick, 20 mol% Zr-added MOCVD REBCO coated conductor.

    Science.gov (United States)

    Xu, A; Zhang, Y; Gharahcheshmeh, M Heydari; Yao, Y; Galstyan, E; Abraimov, D; Kametani, F; Polyanskii, A; Jaroszynski, J; Griffin, V; Majkic, G; Larbalestier, D C; Selvamanickam, V

    2017-07-31

    A main challenge that significantly impedes REBa 2 Cu 3 O x (RE = rare earth) coated conductor applications is the low engineering critical current density J e because of the low superconductor fill factor in a complicated layered structure that is crucial for REBa 2 Cu 3 O x to carry supercurrent. Recently, we have successfully achieved engineering critical current density beyond 2.0 kA/mm 2 at 4.2 K and 16 T, by growing thick REBa 2 Cu 3 O x layer, from ∼1.0 μm up to ∼3.2 μm, as well as controlling the pinning microstructure. Such high engineering critical current density, the highest value ever observed so far, establishes the essential role of REBa 2 Cu 3 O x coated conductors for very high field magnet applications. We attribute such excellent performance to the dense c-axis self-assembled BaZrO 3 nanorods, the elimination of large misoriented grains, and the suppression of big second phase particles in this ~3.2 μm thick REBa 2 Cu 3 O x film.

  1. Structure of N = 2 supergravity in N = 1 superfields

    Energy Technology Data Exchange (ETDEWEB)

    Awada, M.A.; Mokhtari, S. (Imperial Coll. of Science and Technology, London (UK). Blackett Lab.)

    1985-01-01

    A formulation of N = 2 supergravity in N = 1 superspace is presented. The authors solve up to all orders the N = 2 supergravity constraints in terms of unconstrained N = 1 superfields. The structure of the N = 2 action in N = 1 superspace is examined. The proposed action coincides in the quadratic limit of the spin (3/2,1) matter fields with the action given by previous workers.

  2. 26 CFR 1.41-0T - Table of contents (temporary).

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 1 2010-04-01 2010-04-01 true Table of contents (temporary). 1.41-0T Section 1... Credits Against Tax § 1.41-0T Table of contents (temporary). This section lists the table of contents for...) Election. (1) In general. (2) Time and manner of election. (3) Revocation. (4) Special rules for controlled...

  3. Combined curative radiation therapy alone in (T1) T2-3 rectal adenocarcinoma: a pilot study of 29 patients

    International Nuclear Information System (INIS)

    Gerard, J.P.; Roy, P.; Coquard, R.; Barbet, N.; Romestaing, P.; Ayzac, L.; Ardiet, J.M.; Thalabard, J.C.

    1996-01-01

    Aim: Analysis of a pilot study including 29 consecutive patients with high surgical risk or refusal of colostomy treated with radiation therapy alone with curative intent. Patients: Between 1986 and 1992, 29 patients were treated for infiltrating adenocarcinoma of the rectum. Median age was 72 years. Transrectal ultrasound staging was used in 24 patients (T1, 2; T2, 14; T3, 13; N0, 23; N1, 6). In 20 patients the lower border of the tumor was at 5 cm or less from the anal verge and in 19 patients the diameter exceeded 3 cm. CEA was elevated in seven cases. Treatment: Contact X-ray (50 kV) was given first (70 Gy/3 fractions). External beam radiation therapy used a three-field technique in the prone position. Accelerated schedule (39 Gy/13 fractions/17 days) with a concomitant boost 'field within the field' (4 Gy/4 fractions). Six weeks later an iridium-192 implant was performed in 21 (20 Gy/22 h). Results: Median follow-up time was 46 months. Overall and specific survival at 5 years was 68% (SE = 0.09) and 76% (SE = 0.08). Local control was obtained in (21(29)) patients (72%). There was one grade 2 rectal bleeding and five grade 2 rectal necroses. The overall tolerance was good in these frail patients. Discussion: For T2. T3 or T1 > 3 cm diameter rectal adenocarcinoma, where contact X-ray alone is not recommended, a combined treatment with radiation therapy alone is able to give good local control with acceptable toxicity. This treatment should be restricted to inoperable patients

  4. The (2, 0) superalgebra, null M-branes and Hitchin's system

    Science.gov (United States)

    Kucharski, P.; Lambert, N.; Owen, M.

    2017-10-01

    We present an interacting system of equations with sixteen supersymmetries and an SO(2) × SO(6) R-symmetry where the fields depend on two space and one null dimensions that is derived from a representation of the six-dimensional (2, 0) superalgebra. The system can be viewed as two M5-branes compactified on {S}-^1× T^2 or equivalently as M2-branes on R+× R^2 , where ± refer to null directions. We show that for a particular choice of fields the dynamics can be reduced to motion on the moduli space of solutions to the Hitchin system. We argue that this provides a description of intersecting null M2-branes and is also related by U-duality to a DLCQ description of four-dimensional maximally supersymmetric Yang-Mills.

  5. Magnetic and structural properties of the magnetic shape memory compound Ni2Mn1.48Sb0.52

    International Nuclear Information System (INIS)

    Brown, P J; Gandy, A P; Neumann, K U; Sheikh, A; Ziebeck, K R A; Ishida, K; Oikawa, K; Ito, W; Kainuma, R; Kanomata, T; Ouladdiaf, B

    2010-01-01

    Magnetization and high resolution neutron powder diffraction measurements on the magnetic shape memory compound Ni 2 Mn 1.48 Sb 0.52 have confirmed that it is ferromagnetic below 350 K and undergoes a structural phase transition at T M ∼310 K. The high temperature phase has the cubic L2 1 structure with a = 5.958 A, with the excess manganese atoms occupying the 4(b) Sb sites. In the cubic phase above ∼310 K the manganese moments are ferromagnetically aligned. The magnetic moment at the 4(a) site is 1.57(12) μ B and it is almost zero (0.15(9) μ B ) at the 4(b) site. The low temperature orthorhombic phase which is only fully established below 50 K has the space group Pmma with a cell related to the cubic one by a Bain transformation a orth = (a cub + b cub )/2; b orth = c cub and c orth = (a cub - b cub ). The change in cell volume is ∼2.5%. The spontaneous magnetization of samples cooled in fields less than 0.5 T decreases at temperatures below T M and at 2 K the magnetic moment per formula unit in fields up to 5.5 T is 2.01(5) μ B . Neutron diffraction patterns obtained below ∼132 K gave evidence for a weak incommensurate magnetic modulation with propagation vector (2/3, 1/3, 0).

  6. Wettability of Chalk and Argillaceous Sandstones Assessed from T1/T2 Ratio

    DEFF Research Database (Denmark)

    Katika, Konstantina; Saidian, M.; Fabricius, Ida Lykke

    ratio can quantify the affinity between the rock and wetting pore fluid. The affinity is a measure directly linked to wettability. In order to investigate the T2-shortening, we performed T1-T2 NMR experiments on different samples of chalk, Berea sandstone, and chloritic greensand, saturated either...... with water, oil or oil/water at irreducible water saturation. The T1/T2 ratio obtained from T1-T2 maps reflects the T2-shortening. We compare the T1/T2 ratio for the same type of rock, saturated with different fluids. The chalk shows high affinity for water, Berea sandstone has no clear preference for oil...

  7. On the formation of m = 1, n = 1 density snakes

    Energy Technology Data Exchange (ETDEWEB)

    Sugiyama, Linda E. [Laboratory for Nuclear Science, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139-4307 (United States)

    2013-03-15

    The m/n = 1/1 helical ion density 'snake' located near the q = 1 magnetic surface in a toroidal, magnetically confined plasma arises naturally in resistive MHD, when the plasma density evolves separately from pressure. Nonlinear numerical simulations show that a helical density perturbation applied around q = 1 can form a quasi-steady state over q Greater-Than-Or-Equivalent-To 1 with T(tilde sign) of opposite average sign to n. Two principal outcomes depend on the magnitude of n/n and the underlying stability of the 1/1 internal kink mode. For a small q<1 central region, a moderate helical density drives a new, slowly growing type of nonlinear 1/1 internal kink inside q<1, with small n and {nabla}p(tilde sign) Asymptotically-Equal-To {nabla}(nT(tilde sign)). The hot kink core moves away from, or perpendicular to, the high density region near q Asymptotically-Equal-To 1, preserving the snake density during a sawtooth crash. The mode resembles the early stage of heavy-impurity-ion snakes in ohmic discharges, including recent observations in Alcator C-Mod. For a larger, more unstable q<1 region, the helical density perturbation drives a conventional 1/1 kink where n aligns with T(tilde sign), leading to a rapid sawtooth crash. The crash redistributes the density to a localized helical concentration inside q Less-Than-Or-Equivalent-To 1, similar to experimentally observed snakes that are initiated by a sawtooth crash.

  8. Ring opening of 2-aza-3-borabicyclo[2.2.0]hex-5-ene, the Dewar form of 1,2-dihydro-1,2-azaborine: stepwise versus concerted mechanisms

    Directory of Open Access Journals (Sweden)

    Holger F. Bettinger

    2013-04-01

    Full Text Available The ring opening of the Dewar form of 1,2-dihydro-1,2-azaborine, 2-aza-3-borabicyclo[2.2.0]hex-5-ene (3 is investigated by theoretical methods by using multiconfiguration SCF (CASSCF and coupled cluster theory [CCSD(T] with basis sets up to polarised quadruple-zeta quality. The title compound was previously reported to form photochemically in cryogenic noble gas matrices from 1,2-dihydro-1,2-azaborine (4. Four reaction paths for the thermal ring opening of 3 to 4 could be identified. These are the conventional disrotatory and conrotatory electrocyclic ring-opening pathways where the BN unit is only a bystander. Two more favourable paths are stepwise and involve 1,3-boron–carbon interactions. The lowest energy barrier for the isomerisation reaction, 22 kcal mol−1, should be high enough for an experimental observation in solution. However, in solution the dimerisation of 3 is computed to have a very low barrier (3 kcal mol−1, and thus 3 is expected to be a short-lived reactive intermediate.

  9. Topotactic reduction and phase transitions in (T,T′ La1.8Pr0.2CuO4

    Directory of Open Access Journals (Sweden)

    M.I. Houchati

    2017-05-01

    The X-ray powder diffraction data have revealed that this cuprate is crystallized with the so-called “pseudo-S” type structure, showing a monoclinic symmetry and space group A2/m. Concerning the EPR measurements, they have shown the presence of Cu2+ cation and a hyperfine structure suggesting a pronounced hybridization of the copper–oxygen bond. Finally, X-ray diffraction has demonstrated that the obtained La1.8Pr0.2CuO3.5, heated in oxygen at 420 °C, turns topotactically into La1.8Pr0.2CuO4 with a T′-type structure (I4/mmm.

  10. Antipyretic action of the new hydrazides 2 - (5 - (adamantane-1-yl-4-r-1 ,2,4-triazol-3-ylthioacetate

    Directory of Open Access Journals (Sweden)

    E. S. Pruglo

    2013-06-01

    higher than antipyretic action of acetylsalicylic acid (ΔT 0,980 C, p <0.05. CONCLUSIONS. The most active among the studied compounds was 5 - (adamantane-1-yl-4-phenyl-4H-1,2,4-triazoles-3-yl-2-((5-nitrofurans-2-ylalilidenhydrazinekarbotiate . Its ability to inhibit the activity of hyperthermia was more than of acetylsalicylic acid in 35,7% (ΔT 1,330 C, p <0.01. Compounds 76, 86 and 87 exceed the activity of acetylsalicylic acid in 25,5% (ΔT 1,230 C, p <0,01, 16,32% (ΔT 1,140 C, p <0.001 and 3,06% (ΔT 1,010 C p <0.01, respectively. Introduction of phenyl methyl radical instead of N4 nitrogen atom in the molecule 5 - (adamantane-1-yl-4-R-4H-1 ,2,4-triazoles-3-yl 2 - (3-nitrobenzyliden-hidrazinekarbotiate associated with antipyretic effect.

  11. Current-voltage temperature characteristics of Au/n-Ge (1 0 0) Schottky diodes

    Energy Technology Data Exchange (ETDEWEB)

    Chawanda, Albert, E-mail: albert.chawanda@up.ac.za [Midlands State University, Bag 9055 Gweru (Zimbabwe); University of Pretoria, 0002 Pretoria (South Africa); Mtangi, Wilbert; Auret, Francois D; Nel, Jacqueline [University of Pretoria, 0002 Pretoria (South Africa); Nyamhere, Cloud [Nelson Mandela Metropolitan University, Port Elizabeth (South Africa); Diale, Mmantsae [University of Pretoria, 0002 Pretoria (South Africa)

    2012-05-15

    The variation in electrical characteristics of Au/n-Ge (1 0 0) Schottky contacts have been systematically investigated as a function of temperature using current-voltage (I-V) measurements in the temperature range 140-300 K. The I-V characteristics of the diodes indicate very strong temperature dependence. While the ideality factor n decreases, the zero-bias Schottky barrier height (SBH) ({Phi}{sub B}) increases with the increasing temperature. The I-V characteristics are analyzed using the thermionic emission (TE) model and the assumption of a Gaussian distribution of the barrier heights due to barrier inhomogeneities at the metal-semiconductor interface. The zero-bias barrier height {Phi}{sub B} vs. 1/2 kT plot has been used to show the evidence of a Gaussian distribution of barrier heights and values of {Phi}{sub B}=0.615 eV and standard deviation {sigma}{sub s0}=0.0858 eV for the mean barrier height and zero-bias standard deviation have been obtained from this plot, respectively. The Richardson constant and the mean barrier height from the modified Richardson plot were obtained as 1.37 A cm{sup -2} K{sup -2} and 0.639 eV, respectively. This Richardson constant is much smaller than the reported of 50 A cm{sup -2} K{sup -2}. This may be due to greater inhomogeneities at the interface.

  12. Rac2 controls tumor growth, metastasis and M1-M2 macrophage differentiation in vivo.

    Directory of Open Access Journals (Sweden)

    Shweta Joshi

    Full Text Available Although it is well-established that the macrophage M1 to M2 transition plays a role in tumor progression, the molecular basis for this process remains incompletely understood. Herein, we demonstrate that the small GTPase, Rac2 controls macrophage M1 to M2 differentiation and the metastatic phenotype in vivo. Using a genetic approach, combined with syngeneic and orthotopic tumor models we demonstrate that Rac2-/- mice display a marked defect in tumor growth, angiogenesis and metastasis. Microarray, RT-PCR and metabolomic analysis on bone marrow derived macrophages isolated from the Rac2-/- mice identify an important role for Rac2 in M2 macrophage differentiation. Furthermore, we define a novel molecular mechanism by which signals transmitted from the extracellular matrix via the α4β1 integrin and MCSF receptor lead to the activation of Rac2 and potentially regulate macrophage M2 differentiation. Collectively, our findings demonstrate a macrophage autonomous process by which the Rac2 GTPase is activated downstream of the α4β1 integrin and the MCSF receptor to control tumor growth, metastasis and macrophage differentiation into the M2 phenotype. Finally, using gene expression and metabolomic data from our Rac2-/- model, and information related to M1-M2 macrophage differentiation curated from the literature we executed a systems biologic analysis of hierarchical protein-protein interaction networks in an effort to develop an iterative interactome map which will predict additional mechanisms by which Rac2 may coordinately control macrophage M1 to M2 differentiation and metastasis.

  13. Examining "2"3"9"+"2"4"0Pu, "2"1"0Pb and historical events to determine carbon, nitrogen and phosphorus burial in mangrove sediments of Moreton Bay, Australia

    International Nuclear Information System (INIS)

    Sanders, Christian J.; Santos, Isaac R.; Maher, Damien T.; Breithaupt, Joshua L.; Smoak, Joseph M.; Ketterer, Michael; Call, Mitchell; Sanders, Luciana; Eyre, Bradley D.

    2016-01-01

    Two sediment cores were collected in a mangrove forest to construct geochronologies for the previous century using natural and anthropogenic radionuclide tracers. Both sediment cores were dated using "2"3"9"+"2"4"0Pu global fallout signatures as well as "2"1"0Pb, applying both the Constant Initial Concentration (CIC) and the Constant Rate of Supply (CRS) models. The "2"3"9"+"2"4"0Pu and CIC model are interpreted as having comparable sediment accretion rates (SAR) below an apparent mixed region in the upper ∼5 to 10 cm. In contrast, the CRS dating method shows high sediment accretion rates in the uppermost intervals, which is substantially reduced over the lower intervals of the 100-year record. A local anthropogenic nutrient signal is reflected in the high total phosphorus (TP) concentration in younger sediments. The carbon/nitrogen molar ratios and δ"1"5N values further support a local anthropogenic nutrient enrichment signal. The origin of these signals is likely the treated sewage discharge to Moreton Bay which began in the early 1970s. While the "2"3"9"+"2"4"0Pu and CIC models can only produce rates averaged over the intervals of interest within the profile, the "2"1"0Pb CRS model identifies elevated rates of sediment accretion, organic carbon (OC), nitrogen (N), and TP burial from 2000 to 2013. From 1920 to 2000, the three dating methods provide similar OC, N and TP burial rates, ∼150, 10 and 2 g m"−"2 year"−"1, respectively, which are comparable to global averages. - Highlights: • Lead-210 dating models indicate that the high phosphorous import to the tidal creek may increase mangrove OC burial. • Combinations of sediment dating models ("2"3"9"+"2"4"0Pu, "2"1"0Pb) are ideal in determining sediment accretion in marine sediments during the previous century. • Decadal accretion rates, derived from the "2"3"9"+"2"4"0Pu and "2"1"0Pb dating models, are important to interpret anthropogenic effects on coastal systems. • Carbon and nitrogen stable

  14. E2F1 regulates cellular growth by mTORC1 signaling.

    Directory of Open Access Journals (Sweden)

    Sebastian Real

    2011-01-01

    Full Text Available During cell proliferation, growth must occur to maintain homeostatic cell size. Here we show that E2F1 is capable of inducing growth by regulating mTORC1 activity. The activation of cell growth and mTORC1 by E2F1 is dependent on both E2F1's ability to bind DNA and to regulate gene transcription, demonstrating that a gene induction expression program is required in this process. Unlike E2F1, E2F3 is unable to activate mTORC1, suggesting that growth activity could be restricted to individual E2F members. The effect of E2F1 on the activation of mTORC1 does not depend on Akt. Furthermore, over-expression of TSC2 does not interfere with the effect of E2F1, indicating that the E2F1-induced signal pathway can compensate for the inhibitory effect of TSC2 on Rheb. Immunolocalization studies demonstrate that E2F1 induces the translocation of mTORC1 to the late endosome vesicles, in a mechanism dependent of leucine. E2F1 and leucine, or insulin, together affect the activation of S6K stronger than alone suggesting that they are complementary in activating the signal pathway. From these studies, E2F1 emerges as a key protein that integrates cell division and growth, both of which are essential for cell proliferation.

  15. Figure 1. T. tor species. Figure 2. Long PCR products of ...

    Indian Academy of Sciences (India)

    Annam

    Figure 2. Long PCR products of mitochondrial DNA from the fish T. tor. Lane 1, amplified product using L-12321-Leu and S-LA-16S-H primers. Lane 2, amplified product using H-12321 –Leu and S-LA-16S-L primers. Lane M, 1-Kb DNA ladder. 8 kb ...

  16. Sugar-induced cephalic-phase insulin release is mediated by a T1r2+T1r3-independent taste transduction pathway in mice.

    Science.gov (United States)

    Glendinning, John I; Stano, Sarah; Holter, Marlena; Azenkot, Tali; Goldman, Olivia; Margolskee, Robert F; Vasselli, Joseph R; Sclafani, Anthony

    2015-09-01

    Sensory stimulation from foods elicits cephalic phase responses, which facilitate digestion and nutrient assimilation. One such response, cephalic-phase insulin release (CPIR), enhances glucose tolerance. Little is known about the chemosensory mechanisms that activate CPIR. We studied the contribution of the sweet taste receptor (T1r2+T1r3) to sugar-induced CPIR in C57BL/6 (B6) and T1r3 knockout (KO) mice. First, we measured insulin release and glucose tolerance following oral (i.e., normal ingestion) or intragastric (IG) administration of 2.8 M glucose. Both groups of mice exhibited a CPIR following oral but not IG administration, and this CPIR improved glucose tolerance. Second, we examined the specificity of CPIR. Both mouse groups exhibited a CPIR following oral administration of 1 M glucose and 1 M sucrose but not 1 M fructose or water alone. Third, we studied behavioral attraction to the same three sugar solutions in short-term acceptability tests. B6 mice licked more avidly for the sugar solutions than for water, whereas T1r3 KO mice licked no more for the sugar solutions than for water. Finally, we examined chorda tympani (CT) nerve responses to each of the sugars. Both mouse groups exhibited CT nerve responses to the sugars, although those of B6 mice were stronger. We propose that mice possess two taste transduction pathways for sugars. One mediates behavioral attraction to sugars and requires an intact T1r2+T1r3. The other mediates CPIR but does not require an intact T1r2+T1r3. If the latter taste transduction pathway exists in humans, it should provide opportunities for the development of new treatments for controlling blood sugar. Copyright © 2015 the American Physiological Society.

  17. Experimental infection of clade 1.1.2 (H5N1), clade 2.3.2.1c (H5N1) and clade 2.3.4.4 (H5N6) highly pathogenic avian influenza viruses in dogs.

    Science.gov (United States)

    Lyoo, K S; Na, W; Phan, L V; Yoon, S W; Yeom, M; Song, D; Jeong, D G

    2017-12-01

    Since the emergence of highly pathogenic avian influenza (HPAI) H5N1 in Asia, the haemagglutinin (HA) gene of this virus lineage has continued to evolve in avian populations, and H5N1 lineage viruses now circulate concurrently worldwide. Dogs may act as an intermediate host, increasing the potential for zoonotic transmission of influenza viruses. Virus transmission and pathologic changes in HPAI clade 1.1.2 (H5N1)-, 2.3.2.1c (H5N1)- and 2.3.4.4 (H5N6)-infected dogs were investigated. Mild respiratory signs and antibody response were shown in dogs intranasally infected with the viruses. Lung histopathology showed lesions that were associated with moderate interstitial pneumonia in the infected dogs. In this study, HPAI H5N6 virus replication in dogs was demonstrated for the first time. Dogs have been suspected as a "mixing vessel" for reassortments between avian and human influenza viruses to occur. The replication of these three subtypes of the H5 lineage of HPAI viruses in dogs suggests that dogs could serve as intermediate hosts for avian-human influenza virus reassortment if they are also co-infected with human influenza viruses. © 2017 Blackwell Verlag GmbH.

  18. A randomized trial of tamoxifen with or without breast radiation in women over 50 years of age with T1/2 N0 disease

    International Nuclear Information System (INIS)

    Fyles, A.; Manchul, L.; McCready, D.; Merante, P.; Pintilie, M.; Trudeuau, M.; Olivotto, I.; Weir, L.

    2003-01-01

    To determine the effect of breast radiation (RT) on disease-free survival (DFS) and ipsilateral breast relapse (IBR) in women over 50 with T1 and T2 node negative breast cancer. Between December 1992 and June 2000, 769 women were randomized to RT and Tamoxifen (Tam) 20 mg daily for 5 years or Tam alone. Median age was 68 years, 639 patients had pT1 lesions and ER/PR were positive in 700 patients. Six hundred and thirty-four patients had pathologically negative nodes and 135 over age 65 were clinically node negative. Median follow-up was 5.6 years and patient and tumour characteristics were well balanced between the two arms. Overall, there were 54 relapses from breast cancer in the Tam arm and 27 in the Tam + RT arm. IBR at 5 years was 7.7% in the Tam arm compared to 0.6% in the Tam + RT group (p<0.0001). Significant factors for breast relapse and DFS at 5 years included tumour size (p=0.02 and 0.0001 respectively), hormone-receptor status (p=0.0008 and 0.0001), grade (p=0.001 and 0.003) and treatment arm (p=0.0001 and 0.004). Four-hundred and nineteen patients with low-risk features (T1, receptor-positive and grade 1/2) treated with Tam alone had a 5% risk of IBR at 5 years, increasing to 10% at 8 years. There was no difference in relapse at regional or distant sites, or in the contralateral breast. No difference was seen in the number of deaths due to breast cancer (13 and 11 for Tam + RT and Tam, respectively), nor in OS (93% at 5 years in both arms). Tamoxifen and breast RT results in a significantly lower rate of breast relapse than Tam alone in women over 50 with node-negative breast cancer. There does not appear to be a low-risk group who can be treated with Tamoxifen without breast radiation

  19. Positronium formation and hydrated positron reactions in H2O, D2O, 1.74 M PPS/H2O and 1.74 M PPS/D2O solutions of Cl−, Br− and I−

    DEFF Research Database (Denmark)

    Mogensen, O. E.; Pedersen, Niels Jørgen

    1986-01-01

    Angular correlation of annihilation photons were measured for H2O, D2O, 1.74 M PPS/H2O and 1.74 M PPS/D2O solutions of Cl−, Br− and I−. The three components of the angular correlation spectra for D2O and H2O were nearly identical in shape. The positronium (Ps) yields for the H2O and D2O solutions...... before annihilation (lifetime 400 ps) was determined for the three halides in the four solvents. Simple kinetic equations (“trapping model”) with time dependent rate constant, solved analytically, could explain the [X−, e+] formation in H2O fairly well for concentrations below 0.03 M X−, if a diffusion...... controlled reaction with positron diffusion constant D = 5 × 10−5 cm2/s and reaction radius R = 1 nm were assumed. The three halides gave roughly identical [X−, e+] formation below 0.03 M X−. The difference between the four solutions could be explained partly only in terms of viscosity change for the model...

  20. Distinct human and mouse membrane trafficking systems for sweet taste receptors T1r2 and T1r3.

    Science.gov (United States)

    Shimizu, Madoka; Goto, Masao; Kawai, Takayuki; Yamashita, Atsuko; Kusakabe, Yuko

    2014-01-01

    The sweet taste receptors T1r2 and T1r3 are included in the T1r taste receptor family that belongs to class C of the G protein-coupled receptors. Heterodimerization of T1r2 and T1r3 is required for the perception of sweet substances, but little is known about the mechanisms underlying this heterodimerization, including membrane trafficking. We developed tagged mouse T1r2 and T1r3, and human T1R2 and T1R3 and evaluated membrane trafficking in human embryonic kidney 293 (HEK293) cells. We found that human T1R3 surface expression was only observed when human T1R3 was coexpressed with human T1R2, whereas mouse T1r3 was expressed without mouse T1r2 expression. A domain-swapped chimera and truncated human T1R3 mutant showed that the Venus flytrap module and cysteine-rich domain (CRD) of human T1R3 contain a region related to the inhibition of human T1R3 membrane trafficking and coordinated regulation of human T1R3 membrane trafficking. We also found that the Venus flytrap module of both human T1R2 and T1R3 are needed for membrane trafficking, suggesting that the coexpression of human T1R2 and T1R3 is required for this event. These results suggest that the Venus flytrap module and CRD receive taste substances and play roles in membrane trafficking of human T1R2 and T1R3. These features are different from those of mouse receptors, indicating that human T1R2 and T1R3 are likely to have a novel membrane trafficking system.

  1. ARGUS laser plasma experiments at 1.06 μm, 0.53 μm and 0.35 μm

    International Nuclear Information System (INIS)

    Turner, R.E.; Campbell, E.M.; Mead, W.C.; Ze, F.; Max, C.; Phillion, D.W.; Lee, P.; Pruett, B.; Tirsell, G.; Lasinski, B.F.

    1982-01-01

    ARGUS wavelength scaling experiments have been performed on low (Be) and high (Au) Z disk targets, with laser wavelengths of 1.06 μm, 0.53 μm and 0.35 μm. The laser provided a 700 psec pulse, with up to 100J and 1.06 μm; 200J at 0.53 μm; and 40J at 0.35 μm. Laser intensities on target ranged from 3 x 10 13 to over 3 x 10 15 W/cm 2 , using an f/2.2 focusing system. Box calorimeter measurements show the expected increasing fractional absorption at shorter laser wavelengths; absolutely calibrated hard x-ray detectors show the number of suprathermal electrons to be greatly decreased. Scattered light measurements concentrated on stimulated Raman scattering, and the 3/2 harmonic. The SRS was spectrally and temporally resolved during 0.53 μm irradiations; our measurements showed the scattering to be principally from the convective instability, near tenth critical density. Near ω/2, a double peaked spectral feature is observed. The time resolved data show a number of interesting features, which are discussed

  2. Neutron investigation of Ru-doped Nd1/2Ca1/2MnO3. Comparison with Cr-doped Nd1/2Ca1/2MnO3

    International Nuclear Information System (INIS)

    Moritomo, Yutaka; Nonobe, Toshihiko; Machida, Akihiko; Ohoyama, Kenji

    2002-01-01

    Lattice and magnetic properties are investigated for 3% Ru- and Cr-doped Nd 1/2 Ca 1/2 MnO 3 . The parent Nd 1/2 Ca 1/2 MnO 3 is a charge-ordered insulator (T CO =250K). With decreasing temperature below ≅210K, these compounds are separated into two perovskite phases, that is, the long-c and short-c phases. The long-c region shows a ferromagnetic transition at T C ≅210K for the Ru-doped compound and ≅130K for the Cr-doped compound, while the short-c region shows antiferromagnetic transition at T N ≅150K for Ru and ≅110K for Cr. We discuss the origin of the enhanced T C for the Ru-doped compound in terms of the effective one-electron bandwidth W of the e g -band. (author)

  3. A new magnet material with ThMn{sub 12} structure: (Nd{sub 1−x}Zr{sub x})(Fe{sub 1−y}Co{sub y}){sub 11+z}Ti{sub 1−z}N{sub α} (α=0.6–1.3)

    Energy Technology Data Exchange (ETDEWEB)

    Suzuki, S.; Kuno, T.; Urushibata, K. [Shizuoka Institute of Science and Technology, 2200-2 Toyosawa, Fukuroi, Shizuoka 437-8555 (Japan); Kobayashi, K., E-mail: koba@ms.sist.ac.jp [Shizuoka Institute of Science and Technology, 2200-2 Toyosawa, Fukuroi, Shizuoka 437-8555 (Japan); Sakuma, N.; Washio, K.; Yano, M.; Kato, A.; Manabe, A. [Toyota Mortor Corporation, 1 Toyota-cho, Toyota 471-8572, Aichi (Japan)

    2016-03-01

    We previously reported a new compound for permanent magnets, (Nd{sub 0.7}Zr{sub 0.3})(Fe{sub 0.75}Co{sub 0.25}){sub 11.5}Ti{sub 0.5}N{sub 0.56}, which has a high saturation polarization (J{sub s}) of 1.68 T and a high magnetocrystalline anisotropy field (H{sub a}) of 2.88–4.0 MA/m. Here, we examined the effects of substituting Co and Ti at the Fe sites and Zr at the Nd sites. J{sub s} increased with Co substitution at the Fe sites, and higher Fe and Co content could be achieved by decreasing the Ti content to −Ti{sub 0.5}. The ThMn{sub 12} structure with high Fe and Co content (i.e. low Ti content) was stabilized mainly by −Zr{sub 0.3} substitution at the Nd sites. The Zr substitution resolves the local mismatch in atomic size in the structure. Specifically, the atomic radius of Zr is about 88% that of Nd, so the local structure surrounding Nd (2a site) shrinks as a result of the substitution and resolves the size mismatch in the three types of local Fe six-fold symmetric hexagons in the structure. The effect of the α-(Fe, Co) phase on J{sub s} was evaluated from the phase's volume fraction measurement of 7.7% (8.1 wt%) by electron backscatter diffraction. Nitrogenation of the starting alloy also resulted in augmentation of the c-axis magnetocrystalline anisotropy. Finally, we confirmed a high J{sub s}(−N{sub 1.3}) of 1.71T (=1.67 T, −0.04 T for the α-(Fe, Co) phase) and H{sub a} of 2.9–5.25 MA/m (H{sub a}(−N{sub 1.3})=5.25 MA/m) in the (Nd{sub 0.7}Zr{sub 0.3})(Fe{sub 0.75}Co{sub 0.25}){sub 11.5}Ti{sub 0.5}N{sub α} (α=0.60–1.30) compounds. - Highlights: • We found a new compound of composition of (Nd,Zr)(Fe,Co){sub 11.5}Ti{sub 0.5}N{sub x} (x=0.6–1.3). • The compound shows high saturation polarization of 1.67T. • The Curie temperature of compound is above 840K, and anisotropy field is nearly 6.6 T. • The basic physical properties such as inner fields of each Fe site were measured. • The reasons of stabilization of 1–12

  4. TNP [N2-(m-Trifluorobenzyl, N6-(p-nitrobenzylpurine] ameliorates diet induced obesity and insulin resistance via inhibition of the IP6K1 pathway

    Directory of Open Access Journals (Sweden)

    Sarbani Ghoshal

    2016-10-01

    Full Text Available Objective: Obesity and type 2 diabetes (T2D lead to various life-threatening diseases such as coronary heart disease, stroke, osteoarthritis, asthma, and neurodegeneration. Therefore, extensive research is ongoing to identify novel pathways that can be targeted in obesity/T2D. Deletion of the inositol pyrophosphate (5-IP7 biosynthetic enzyme, inositol hexakisphosphate kinase-1 (IP6K1, protects mice from high fat diet (HFD induced obesity (DIO and insulin resistance. Yet, whether this pathway is a valid pharmacologic target in obesity/T2D is not known. Here, we demonstrate that TNP [N2-(m-Trifluorobenzyl, N6-(p-nitrobenzylpurine], a pan-IP6K inhibitor, has strong anti-obesity and anti-diabetic effects in DIO mice. Methods: Q-NMR, GTT, ITT, food intake, energy expenditure, QRT-PCR, ELISA, histology, and immunoblot studies were conducted in short (2.5-week- and long (10-week-term TNP treated DIO C57/BL6 WT and IP6K1-KO mice, under various diet and temperature conditions. Results: TNP, when injected at the onset of HFD-feeding, decelerates initiation of DIO and insulin resistance. Moreover, TNP facilitates weight loss and restores metabolic parameters, when given to DIO mice. However, TNP does not reduce weight gain in HFD-fed IP6K1-KO mice. TNP specifically enhances insulin sensitivity in DIO mice via Akt activation. TNP decelerates weight gain primarily by enhancing thermogenic energy expenditure in the adipose tissue. Accordingly, TNP's effect on body weight is partly abolished whereas its impact on glucose homeostasis is preserved at thermoneutral temperature. Conclusion: Pharmacologic inhibition of the inositol pyrophosphate pathway has strong therapeutic potential in obesity, T2D, and other metabolic diseases. Author Video: Author Video Watch what authors say about their articles Keywords: IP6K, Inositol pyrophosphate, Obesity, Energy expenditure, Diabetes, Akt

  5. Understanding the stability of Fe incorporation within Mn{sub 3}N{sub 2}(0 0 1) surfaces: An ab-initio study

    Energy Technology Data Exchange (ETDEWEB)

    Guerrero-Sánchez, J., E-mail: guerrero@ifuap.buap.mx [Department of Physics and Astronomy, Nanoscale and Quantum Phenomena Institute, Ohio University, Athens, OH 45701 (United States); Benemérita Universidad Autónoma de Puebla, Instituto de Física “Ing Luis Rivera Terrazas”, Apartado Postal J-48, Puebla 72570, México (Mexico); Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autónoma de México, Apartado Postal 14, Ensenada, Baja California Codigo Postal 22800, México (Mexico); Mandru, Andrada-Oana [Department of Physics and Astronomy, Nanoscale and Quantum Phenomena Institute, Ohio University, Athens, OH 45701 (United States); Takeuchi, Noboru [Department of Physics and Astronomy, Nanoscale and Quantum Phenomena Institute, Ohio University, Athens, OH 45701 (United States); Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autónoma de México, Apartado Postal 14, Ensenada, Baja California Codigo Postal 22800, México (Mexico); Cocoletzi, Gregorio H. [Benemérita Universidad Autónoma de Puebla, Instituto de Física “Ing Luis Rivera Terrazas”, Apartado Postal J-48, Puebla 72570, México (Mexico); Smith, Arthur R. [Department of Physics and Astronomy, Nanoscale and Quantum Phenomena Institute, Ohio University, Athens, OH 45701 (United States)

    2016-02-15

    Graphical abstract: - Highlights: • The Fe incorporation into inner layers of the Mn{sub 3}N{sub 2} surfaces is stable in all range of chemical potential. • Displaced Mn atoms forming cluster-like structures induce the stability of incorporated Fe atoms. • Antiferromagnetic alignment in the [0 0 1] direction and in-plane Ferromagnetic Fe–Fe and Fe–Mn alignments are the same as in Mn{sub 3}N{sub 2} bulk structure. • Incorporated Fe layers contribute to the metallic character of these surfaces. - Abstract: We present first principles spin-polarized calculations of the adsorption and incorporation of iron in the Mn{sub 3}N{sub 2}(0 0 1) surfaces. By means of a surface formation energy criterion, it is demonstrated that Fe incorporation is energetically stable for all studied surfaces. An Fe bilayer formation is achieved after Fe atoms displace Mn atoms in the sub-surface N-vacancy layers. An analysis of the magnetic coupling shows an antiferromagnetic alignment along the [0 0 1] direction as in the clean, ideal surfaces. Also, the in-plane magnetic coupling between Fe–Fe and Fe–Mn shows a ferromagnetic tendency, similar to the clean, ideally terminated surfaces. These results clearly indicate that Fe behaves like Mn when adsorbed into the Mn{sub 3}N{sub 2} surface. Density of states calculations of the stable structures show a slight deviation from the antiferromagnetic-like behavior, with the most important contribution around the Fermi level coming from the Fe-d and Mn-d orbitals.

  6. 26 CFR 1.401(m)-2 - ACP test.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 5 2010-04-01 2010-04-01 false ACP test. 1.401(m)-2 Section 1.401(m)-2 Internal... TAXES Pension, Profit-Sharing, Stock Bonus Plans, Etc. § 1.401(m)-2 ACP test. (a) Actual contribution percentage (ACP) test—(1) In general—(i) ACP test formula. A plan satisfies the ACP test for a plan year only...

  7. The transient M/G/1/0 queue: some bounds and approximations for light traffic with application to reliability

    Directory of Open Access Journals (Sweden)

    J. Ben Atkinson

    1995-01-01

    Full Text Available We consider the transient analysis of the M/G/1/0 queue, for which Pn(t denotes the probability that there are no customers in the system at time t, given that there are n(n=0,1 customers in the system at time 0. The analysis, which is based upon coupling theory, leads to simple bounds on Pn(t for the M/G/1/0 and M/PH/1/0 queues and improved bounds for the special case M/Er/1/0. Numerical results are presented for various values of the mean arrival rate λ to demonstrate the increasing accuracy of approximations based upon the above bounds in light traffic, i.e., as λ→0. An important area of application for the M/G/1/0 queue is as a reliability model for a single repairable component. Since most practical reliability problems have λ values that are small relative to the mean service rate, the approximations are potentially useful in that context. A duality relation between the M/G/1/0 and GI/M/1/0 queues is also described.

  8. On the simultaneous Pell equations x 2 - (4m 2 - 1)y 2 = y 2 - pz 2 ...

    African Journals Online (AJOL)

    Let m be a positive integer, and let p be an odd prime. By using certain properties of Pell and quartic diophantine equations with some elementary number theory methods, we prove that the system of equations x2 - (4m2 - 1)y2 = 1 and y2 - pz2 = 1 has positive integer solutions (x, y, z) if and only if p ≡ 7(mod 8) and m = 1/4 ...

  9. Buffer standards for the physiological pH of N-[2-hydroxy-1,1-bis(hydroxymethyl)ethyl]glycine (TRICINE) from T = (278.15 to 328.15) K

    International Nuclear Information System (INIS)

    Roy, Rabindra N.; Roy, Lakshmi N.; Henson, Isaac B.; Stegner, Jessica M.; Dinga, John J.; Summers, Clark E.; Suhrheinrich, Gregory L.; Veliz, Jaime A.; Dieterman, Lauren A.

    2012-01-01

    Highlights: ► This work reports pH values of TRICINE buffer. ► Liquid junction potential correct is applied. ► These values will be used by clinical and biomedical scientists. ► The pH values lie within 6.8 to 7.5. - Abstract: The pH values of two buffer solutions without NaCl and seven buffer solutions with added NaCl, having ionic strengths (I = 0.16 mol · kg −1 ) similar to those of physiological fluids, have been evaluated at 12 temperatures from T = (278.15 to 328.15) K by way of the extended form of the Debye–Hückel equation of the Bates–Guggenheim convention. The residual liquid junction potentials (δE j ) between the buffer solutions of TRICINE and saturated KCl solution of the calomel electrode at T = (298.15 and 310.15) K have been estimated by measurement with a flowing junction cell. For the buffer solutions with the molality of TRICINE(m 1 ) = 0.06 mol · kg −1 , NaTRICINE(m 2 ) = 0.02 mol · kg −1 , and NaCl(m 3 ) = 0.14 mol · kg −1 , the pH values at T = 310.15 K obtained from the extended Debye–Hückel equation and the inclusion of the liquid junction correction are 7.342 and 7.342, respectively. These are in excellent agreement. The zwitterionic buffer TRICINE is recommended as a secondary pH standard in the region for clinical application.

  10. Influence of Zr substitution on the stabilization of ThMn{sub 12}-type (Nd{sub 1−α}Zr{sub α})(Fe{sub 0.75}Co{sub 0.25}){sub 11.25}Ti{sub 0.75}N{sub 1.21.4} (α = 00.3) compounds

    Energy Technology Data Exchange (ETDEWEB)

    Sakuma, N.; Yano, M.; Kato, A. [Toyota Motor Corporation, 1200 Mishuku, Susono, Shizuoka 410-1193 (Japan); Technology Research Association of Magnetic Materials for High-Efficiency Motors (MagHEM) Higashifuji-Branch, 1200 Mishuku, Susono, Shizuoka 410-1193 (Japan); Suzuki, S.; Kuno, T.; Urushibata, K.; Kobayashi, K. [Shizuoka Institute of Science and Technology, 2200-2 Toyosawa, Fukuroi, Shizuoka 437-8555 (Japan); Manabe, A. [Technology Research Association of Magnetic Materials for High-Efficiency Motors (MagHEM) Higashifuji-Branch, 1200 Mishuku, Susono, Shizuoka 410-1193 (Japan)

    2016-05-15

    The influence of Zr substitution in ThMn{sub 12} compounds was investigated using strip casting alloys. It was found that Zr substitution stabilized (Nd{sub 1−α}Zr{sub α})(Fe{sub 0.75}Co{sub 0.25}){sub 11.25}Ti{sub 0.75}N{sub 1.21.4} (α = 00.3) compounds. Specifically, a reduction in the lattice constant along the a-axis was observed. Energy-dispersive X-ray spectroscopy mapping combined with Cs-corrected scanning transmission electron microscopy indicated that Zr atoms preferentially occupied Nd 2a sites. Both the magnetic anisotropy field and saturation polarization were maximum at Zr substitution ratio α = 0.1. The (Nd{sub 1−α}Zr{sub α})(Fe{sub 0.75}Co{sub 0.25}){sub 11.25}Ti{sub 0.75}N{sub 1.21.4} (α = 00.3) compounds displayed higher saturation polarization than Nd{sub 2}Fe{sub 14}B at high temperatures.

  11. Chemical stabilization and high pressure synthesis of Ba-free Hg-based superconductors, (Hg,M)Sr{sub 2}Ca{sub n-1}Cu{sub n}O{sub y}(N=1{approximately}3)

    Energy Technology Data Exchange (ETDEWEB)

    Kishio, K. [Univ. of Tokyo (Japan)]|[Kyoto Univ. (Japan); Shimoyama, J.; Hahakura, S. [Univ. of Tokyo (Japan)] [and others

    1994-12-31

    A homologous series of new Hg-based HTSC compounds, (Hg,M)Sr{sub 2}Ca{sub n-1}Cu{sub n}O{sub y} with n=1 to 3, have been synthesized. The stabilization of the pure phases have been accomplished by chemical doping of third elements such as M=Cr, Mo and Re. While the Hg1201(n=1) phase was readily obtained in this way, it was necessary to simultaneously dope Y into the Ca site to stabilize the Hg1212(n=2) phase. On the other hand, single-phase Y-free Hg1212(n=2) and Hg1223(n=3) samples were synthesized only under a high pressure of 6 GPa. In sharp contrast to the Ba-containing compounds, all the samples prepared in the present study have been quite stable during the synthesis and no deterioration in air has been observed after the preparation.

  12. 3-[2-(5H-Indolo[2,3-b]quinoxalin-5-ylethyl]-1,3-oxazolidin-2-one

    Directory of Open Access Journals (Sweden)

    Abdussalam Alsubari

    2010-09-01

    Full Text Available The title compound, C19H16N4O2, has an almost planar fused N-heterocyclic system (r.m.s. deviation = 0.031 Å and an almost planar five-membered 1,3-oxazolidine ring (r.m.s. deviation = 0.015 Å at the ends of an ethylene chain [N—C—C—N torsion angle = −65.6 (2°]. The ring systems are inclined at 38.1 (1° to one another.

  13. Merging different interactivity perspectives: 1.0 and 2.0 frameworks = Combinando diferentes perspectivas de interatividade: estruturas 1.0 e 2.0

    Directory of Open Access Journals (Sweden)

    Taddeo, Gabriella

    2009-01-01

    Full Text Available Meu objetivo neste trabalho é apresentar uma análise do conceito de interatividade audiovisual e sua evolução em relação à web 2. 0 e à cultura participativa. Um breve referencial teórico sobre o conceito de interatividade e sua evolução nas últimas décadas será seguido por uma análise do conceito tradicional de interatividade baseado em uma relação usuário-meio fechada. Ao final vou ainda articular a minha reflexão sobre novas formas de interatividade que se baseiam em um modelo mais participativo no qual os usuários interagem entre si e criam comunidades dentro e através dos ambientes de mídia interativos. Utilizando o referencial teórico de Thompson (1995 sobre interação mediada, meu objetivo será definir como novas estratégias participativas da TV 2. 0 estão criando não apenas novas formas de conteúdo e de linguagem, como também "interações quase-mediadas" entre produtores de mídia e seu público. Esses ambientes são, então, caracterizados por um diálogo indireto e uma complexa competição para o domínio do imaginário midiático

  14. Structural, electronic and magnetic properties of Mn{sub 3}N{sub 2}(0 0 1) surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Guerrero-Sánchez, J., E-mail: guerrero@ifuap.buap.mx [Department of Physics and Astronomy, Nanoscale and Quantum Phenomena Institute, Ohio University, Athens, OH 45701 (United States); Benemérita Universidad Autónoma de Puebla, Instituto de Física “Ing Luis Rivera Terrazas”, Apartado Postal J-48, Puebla 72570 (Mexico); Mandru, Andrada-Oana; Wang, Kangkang [Department of Physics and Astronomy, Nanoscale and Quantum Phenomena Institute, Ohio University, Athens, OH 45701 (United States); Takeuchi, Noboru [Department of Physics and Astronomy, Nanoscale and Quantum Phenomena Institute, Ohio University, Athens, OH 45701 (United States); Centro de Nanociencias y Nanotecnologia, Universidad Nacional Autónoma de México, Apartado Postal 14, Ensenada, Baja California, Codigo Postal 22800 (Mexico); Cocoletzi, Gregorio H. [Benemérita Universidad Autónoma de Puebla, Instituto de Física “Ing Luis Rivera Terrazas”, Apartado Postal J-48, Puebla 72570 (Mexico); Smith, Arthur R. [Department of Physics and Astronomy, Nanoscale and Quantum Phenomena Institute, Ohio University, Athens, OH 45701 (United States)

    2015-11-15

    Graphical abstract: - Abstract: Spin-polarized first-principles total energy calculations have been performed to study the structural, electronic and magnetic properties of Mn{sub 3}N{sub 2}(0 0 1) surfaces. It is found that three surface terminations are energetically stable, in agreement with previous scanning tunneling microscopy experiments that have found three different electronic contrasts in their images. It is also found that in all three cases, the topmost layer has a MnN stoichiometry. Density of states calculations show a metallic behavior for all the stable structures with the most important contribution close to the Fermi level coming from the Mn-d orbitals. Our Tersoff–Hamann scanning tunneling microscopy simulations are in good agreement with previous experimental results.

  15. Palladium-103 brachytherapy for clinical T1/T2 prostate carcinomas

    International Nuclear Information System (INIS)

    Dattoli, M.J.; Wallner, K.E.; Cash, J.C.; Ross, R.E.; Koval, J.M.; Sorace, R.A.

    1997-01-01

    Purpose: To evaluate the efficacy of Pd-103 brachytherapy as sole modality for patients having clinical T1/T2 prostate carcinomas Materials and Methods: The initial 103 consecutive patients treated at our hospital are available for biochemical failure and toxicity data following Pd-103 brachytherapy. Minimum peripheral target dose of 11,500cGy (median) was prescribed. Follow-up range: 4-6 years (56 months median). Mean pre-treatment PSA = 11.7ng/ml. All patients have been followed in prospective fashion with respect to PSA response, clinical evidence of disease progression and complications. Criteria for biochemical failure was relatively strict, and was analyzed using PSA>1.0. Patients whose PSA was still decreasing at last follow-up were censored at that time. Freedom from failure rates were calculated by the method of Kaplan and Meier. Differences between groups were determined by the Log-rank method. Sexual potency was defined as the ability to attain and maintain an erection sufficient for intercourse. Results: Actuarial freedom from biochemical failure at 6 years after treatment is 68%. Toxicity has been low with no patient developing rectal ulceration or incontinence (despite 16 pts having prior TURP). The impotency rate is 12%. Of the 33 pts with a post treatment PSA >1.0, 29 pts actually had one or more adverse features determined to be PSA>10 (26 pts), Gleason's score ≥ 7 (5 pts), AJC clinical stage≥T2b (10 pts). Mean pre-treatment PSA's of the 33 failures = 18.3ng/ml. For the 74 pts without high risk features, the actuarial 6 years biochemical freedom from progression rate using PSA<1.0 as an endpoint for success is 93%. Conclusion: This biochemical freedom from progression rate compares favorably to other modalities and supports the use of Pd-103 brachytherapy as sole modality in properly selected patients. Morbidity has been relatively low. Pd-103 implant alone is currently being used in patients having PSA<10, Gleason's score<7, and clinical stage

  16. Crystallographic structure and magnetic properties of pseudobrookite Fe2-xNixTiO5 system (x = 0, 0.1, 0.2, 0.3, 0.5 and 1)

    International Nuclear Information System (INIS)

    Yosef Sarwanto and Wisnu Ari Adi

    2018-01-01

    Crystallographic structure and magnetic properties of pseudobrookite Fe 2-x Ni x TiO 5 system (x=0, 0.1, 0.2, 0.3 ,0.5 and 1)have been performed through solid state reaction. Pseudobrookite Fe 2-x Ni x TiO 5 system was synthesized by mixing of Fe 2 O 3 , NiO, and TiO 2 with stoichiometry composition using wet mill. The mixture was milled for 5 hours and sintered in the electric chamber furnace at 1000 °C in the air at atmosphere pressure for 5 hours. The refinement against of X-ray diffraction data shows that the samples with composition of (x = 0) and (x = 0.1) have a single phase with Fe 2 TiO 5 structure. How ever the samples with composition of (x > 0.1) consist of multiple phases, namely Fe 2-x Ni x TiO 5 , FeTiO 3 , Fe 2 NiO 4 and NiO. Particle morphologies of the composition x = 0 and x =0.1 are homogenous and uniform on the sample surface with a polygonal particle shape and particle size varies. At room temperature, the sample with x =0 is paramagnetic and that with x =0.1 is ferromagnetic. Magnetic phase transformation of this study is the caused by the present of Ni substituted Fe in the system. Thus substitution Ni into Fe on the system pseudobrookite Fe 2 TiO 5 only capable of 0.1 at.% without changing the crystal structure of the material. It means that there is an interaction between the magnetic spin Fe 3+ on the 3d 5 configurations and Ni 2 + on the 3d 3 configurations through the mechanism of double exchange. Double exchange mechanism is a magnetic type of exchange that appears between the ions Fe 3+ and Ni 2+ adjacent in different oxidation states. (author)

  17. Audio zesilovač 2.1 ve třídě D pro laboratorní výuku

    OpenAIRE

    Kolečková, Klára

    2016-01-01

    Práce se zabývá návrhem zapojení a konstrukcí audio zesilovače ve třídě D s pulsně šířkovou modulací. Výsledné zapojení je tvořeno ochranou napájení, aktivní výhybkou a samotným koncovým zesilovacím stupněm. Zesilovač je vytvořen v konfiguraci 2.1, středovýškový zesilovač má výstupní výkon 2 × 30 W na zátěži 8 , subwoofer 1 × 100 W na zátěži 2 . Řídicím centrem celého zapojení je integrovaný obvod TPA3116D2 od firmy Texas Instruments. Výsledný audio zesilovač bude využit jako přípravek pro la...

  18. Impact and relationship of anterior commissure and time-dose factor on the local control of T1N0 glottic cancer treated by 6 MV photons

    Directory of Open Access Journals (Sweden)

    Fu Yiu-Tung

    2011-05-01

    Full Text Available Abstract Background To evaluate prognostic factors that may influence local control (LC of T1N0 glottic cancer treated by primary radiotherapy (RT with 6 MV photons. Methods We retrospectively reviewed the medical records of 433 consecutive patients with T1N0 glottic cancer treated between 1983 and 2005 by RT in our institution. All patients were treated with 6 MV photons. One hundred and seventy seven (41% patients received 52.5 Gy in 23 fractions with 2.5 Gy/fraction, and 256 (59% patients received 66 Gy in 33 fractions with 2 Gy/fraction. Results The median follow-up time was 10.5 years. The 10-year LC rates were 91% and 87% for T1a and T1b respectively. Multivariate analysis showed LC rate was adversely affected by poorly differentiated histology (Hazard Ratio [HR]: 7.5, p = 0.035; involvement of anterior commissure (HR: 2.34, p = 0.011; fraction size of 2.0 Gy (HR: 2.17, p = 0.035 and tumor biologically effective dose (BED 15 (HR: 3.38, p = 0.017. Conclusions The negative impact of anterior commissure involvement could be overcome by delivering a higher tumor BED through using fraction size of > 2.0 Gy. We recommend that fraction size > 2.0 Gy should be utilized, for radiation schedules with five daily fractions each week.

  19. (3-Methylbenzonitrile-1κN-cis-tetrakis(μ-N-phenylacetamidato-1:2κ4N:O;1:2κ4O:N-dirhodium(II(Rh—Rh

    Directory of Open Access Journals (Sweden)

    Cassandra T. Eagle

    2014-08-01

    Full Text Available The complex molecule of the title compound, [Rh2{N(C6H5COCH3}4(NCC7H7], has crystallographically-imposed mirror symmetry. The four acetamide ligands bridging the dirhodium core are arranged in a 2,2-cis manner with two N atoms and two O atoms coordinating to the unique RhII atom cis to one another. The Neq—Rh—Rh—Oeq torsion angles on the acetamide bridge are 0.75 (7 and 1.99 (9°. The axial nitrile ligand completes the distorted octahedral coordination sphere of one RhII atom and shows a nonlinear coordination, with an Rh—N—C bond angle of 162.8 (5°; the N—C bond length is 1.154 (7 Å.

  20. BROAD N2H+ EMISSION TOWARD THE PROTOSTELLAR SHOCK L1157-B1

    International Nuclear Information System (INIS)

    Codella, C.; Fontani, F.; Gómez-Ruiz, A.; Vasta, M.; Viti, S.; Ceccarelli, C.; Lefloch, B.; Podio, L.; Benedettini, M.; Busquet, G.; Caselli, P.

    2013-01-01

    We present the first detection of N 2 H + toward a low-mass protostellar outflow, namely, the L1157-B1 shock, at ∼0.1 pc from the protostellar cocoon. The detection was obtained with the IRAM 30 m antenna. We observed emission at 93 GHz due to the J = 1-0 hyperfine lines. Analysis of this emission coupled with HIFI CHESS multiline CO observations leads to the conclusion that the observed N 2 H + (1-0) line originated from the dense (≥10 5 cm –3 ) gas associated with the large (20''-25'') cavities opened by the protostellar wind. We find an N 2 H + column density of a few 10 12 cm –2 corresponding to an abundance of (2-8) × 10 –9 . The N 2 H + abundance can be matched by a model of quiescent gas evolved for more than 10 4 yr, i.e., for more than the shock kinematical age (≅2000 yr). Modeling of C-shocks confirms that the abundance of N 2 H + is not increased by the passage of the shock. In summary, N 2 H + is a fossil record of the pre-shock gas, formed when the density of the gas was around 10 4 cm –3 , and then further compressed and accelerated by the shock

  1. Preparation and assessment of [{sup 99m}Tc]technetium aquacarbonyl complexes with 1,2-diaminoethane-N-substituted ligands for tumor detection; Preparo e avaliacao de complexos de [{sup 99m}Tc]tecnecio aquacarbonil com ligantes 1,2-diaminoetano-N-substituidos para deteccao de tumores

    Energy Technology Data Exchange (ETDEWEB)

    Radin, Adriano

    2010-07-01

    Over least 15 years the complex [[{sup 99m}Tc](H{sub 2}0){sub 3}(CO){sub 3}]{sup +} has been used as an intermediary to obtain technetium radiopharmaceuticals for applications in cardiology, neurology and oncology. Two important characteristics of this molecule are: the facility for obtaining that compound from aqueous solutions and the easiness of substituting H{sub 2}O molecules by atoms of other ligand molecules. In this project we prepared new complexes [[{sup 99m}Tc](CMN{sup S001-3})(H{sub 2}O)(CO){sub 3}]{sup +}, where (CMNS001) = N-[(4-methoxy) benzyl]-1,2-diaminoethane, (CMNS003) = N,N'-bis-[(4-methoxy)benzyl]-1,2-diaminoethane, and assessed the uptake of these complexes in murine melanoma cancer cell B16F10 and breast cells MCF-7 and MDA-MD-231, and compared with [[{sup 99m}](MIBI){sub 6}]{sup +} uptake. In vitro uptake for both new technetium complex reached values close to 5%, for all cell lines, whereas the [[{sup 99m}Tc](MIBI){sub 6}]{sup +} uptake was close to 1 %. The assessment of subcellular distribution showed high accumulation of the new complex in the membrane fraction, for MDAMB-231, while for B16F10 accumulation occurred both in membrane and cytoplasm; the concentration of [[{sup 99m}Tc](MIBI){sub 6}]{sup +} was mainly in the cytoplasm portion. Biodistribution study in mice allowed to observe the capture of up to 1.6% of the administered dose per gram of tumor tissue for the complex [[{sup 99m}Tc](CMNS001)(H{sub 2}O)(CO){sub 3}]{sup +}, whereas other organs such as heart, lung and muscle, showed uptake of about 5.6%, 6.4% and 2%, respectively. The complexes in this work showed a high rate of uptake in vitro, but was not reproduced in vivo model, which can be related to low concentration of the complexes inside the cells and reduced vascularity of tumor tissue, with lower intake of complex through the blood system. (author)

  2. The growth of Zn on a Si(1 0 0)-2x1 surface

    International Nuclear Information System (INIS)

    Xie Zhaoxiong; Tanaka, Ken-ichi

    2005-01-01

    Adsorption of Zn atoms on a Si(1 0 0)-2x1 surface was studied by scanning tunneling microscopy at room temperature. Narrow lines are grown perpendicular to the Si-dimer rows of the [1 1 0] direction at low coverage. The narrow line is formed by arraying rectangular Zn 3 dots, where a dot is composed of one Zn atom on a Si dimer and the other two in the neighboring two hollow sites. When the Si(1 0 0)-2x1 surface is covered with one monolayer of Zn, a 4x1 structure is established. More deposition of Zn on the 4x1 monolayer grows into three-dimensional Zn islands

  3. Coating effect of LiFePO4 and Al2O3 on Li1.2Mn0.54Ni0.13Co0.13O2 cathode surface for lithium ion batteries

    Science.gov (United States)

    Seteni, Bonani; Rapulenyane, Nomasonto; Ngila, Jane Catherine; Mpelane, Siyasanga; Luo, Hongze

    2017-06-01

    Lithium-manganese-rich cathode material Li1.2Mn0.54Ni0.13Co0.13O2 is prepared by combustion method, and then coated with nano-sized LiFePO4 and nano-sized Al2O3 particles via a wet chemical process. The as-prepared Li1.2Mn0.54Ni0.13Co0.13O2, LiFePO4-coated Li1.2Mn0.54Ni0.13Co0.13O2 and Al2O3-coated Li1.2Mn0.54Ni0.13Co0.13O2 are characterized by X-ray diffraction, scanning electron microscopy and transmission electron microscopy. The scanning electron microscopy shows the agglomeration of the materials and their nanoparticle size ∼100 nm. The transmission electron microscopy confirms that LiFePO4 forms a rough mat-like surface and Al2O3 remain as islandic particles on the surface of the Li1.2Mn0.54Ni0.13Co0.13O2 material. The Li1.2Mn0.54Ni0.13Co0.13O2 coated with LiFePO4 and Li1.2Mn0.54Ni0.13Co0.13O2 coated with Al2O3 exhibits improved electrochemical performance. The initial discharge capacity is enhanced to 267 mAhg-1 after the LiFePO4 coating and 285 mAhg-1 after the Al2O3 coating compared to the as-prepared Li1.2Mn0.54Ni0.13Co0.13O2 material that has an initial discharge capacity of 243 mAhg-1. Galvanostatic charge-discharge tests at C/10 display longer activation of Li2MnO3 phase and higher capacity retention of 88% after 20 cycles for Li1.2Mn0.54Ni0.13Co0.13O2-LiFePO4 compared to Li1.2Mn0.54Ni0.13Co0.13O2-Al2O3 of 80% after 20 cycles and LMNC of 80% after 20 cycles. Meanwhile Li1.2Mn0.54Ni0.13Co0.13O2-LiFePO4 also shows higher rate capability compared to Li1.2Mn0.54Ni0.13Co0.13O2-Al2O3.

  4. 2,2-Dimethyl-2,3-dihydro-1H-perimidine

    Directory of Open Access Journals (Sweden)

    Sarah Maloney

    2013-02-01

    Full Text Available The title compound, C13H14N2, was obtained from reaction of diaminonaphthalene with acetone. In both independent molecules in the asymmetric unit, the tricyclic perimidine consists of a planar (r.m.s. deviations = 0.0125 and 0.0181 Å naphthalene ring system and an envelope conformation C4N2 ringwith the NCN group hinged with respect to the naphthalene backbone by 36.9 (2 and 41.3 (2° in the two independent molecules. The methyl substituents are arranged approximately axial and equatorial on the apical C atom. In the crystal, one of the N—H groups of one independent molecule is involved in classical N—H...N hydrogen bonding. Short intermolecular (C/N—H...π(arene interactions, near the short T-shaped limit, link molecules in the absence of strong acceptors.

  5. SSR240612 [(2R)-2-[((3R)-3-(1,3-benzodioxol-5-yl)-3-[[(6-methoxy-2-naphthyl)sulfonyl]amino]propanoyl)amino]-3-(4-[[2R,6S)-2,6-dimethylpiperidinyl]methyl]phenyl)-N-isopropyl-N-methylpropanamide hydrochloride], a new nonpeptide antagonist of the bradykinin B1 receptor: biochemical and pharmacological characterization.

    Science.gov (United States)

    Gougat, Jean; Ferrari, Bernard; Sarran, Lionel; Planchenault, Claudine; Poncelet, Martine; Maruani, Jeanne; Alonso, Richard; Cudennec, Annie; Croci, Tiziano; Guagnini, Fabio; Urban-Szabo, Katalin; Martinolle, Jean-Pierre; Soubrié, Philippe; Finance, Olivier; Le Fur, Gérard

    2004-05-01

    The biochemical and pharmacological properties of a novel non-peptide antagonist of the bradykinin (BK) B(1) receptor, SSR240612 [(2R)-2-[((3R)-3-(1,3-benzodioxol-5-yl)-3-[[(6-methoxy-2-naphthyl)sulfonyl]amino]propanoyl)amino]-3-(4-[[2R,6S)-2,6-dimethylpiperidinyl]methyl]phenyl)-N-isopropyl-N-methylpropanamide hydrochloride] were evaluated. SSR240612 inhibited the binding of [(3)H]Lys(0)-des-Arg(9)-BK to the B(1) receptor in human fibroblast MRC5 and to recombinant human B(1) receptor expressed in human embryonic kidney cells with inhibition constants (K(i)) of 0.48 and 0.73 nM, respectively. The compound selectivity for B(1) versus B(2) receptors was in the range of 500- to 1000-fold. SSR240612 inhibited Lys(0)-desAr(9)-BK (10 nM)-induced inositol monophosphate formation in human fibroblast MRC5, with an IC(50) of 1.9 nM. It also antagonized des-Arg(9)-BK-induced contractions of isolated rabbit aorta and mesenteric plexus of rat ileum with a pA(2) of 8.9 and 9.4, respectively. Antagonistic properties of SSR240612 were also demonstrated in vivo. SSR240612 inhibited des-Arg(9)-BK-induced paw edema in mice (3 and 10 mg/kg p.o. and 0.3 and 1 mg/kg i.p.). Moreover, SSR240612 reduced capsaicin-induced ear edema in mice (0.3, 3 and 30 mg/kg p.o.) and tissue destruction and neutrophil accumulation in the rat intestine following splanchnic artery occlusion/reperfusion (0.3 mg/kg i.v.). The compound also inhibited thermal hyperalgesia induced by UV irradiation (1 and 3 mg/kg p.o.) and the late phase of nociceptive response to formalin in rats (10 and 30 mg/kg p.o.). Finally, SSR240612 (20 and 30 mg/kg p.o.) prevented neuropathic thermal pain induced by sciatic nerve constriction in the rat. In conclusion, SSR240612 is a new, potent, and orally active specific non-peptide bradykinin B(1) receptor antagonist.

  6. Repeatability of magnetic resonance fingerprinting T1 and T2 estimates assessed using the ISMRM/NIST MRI system phantom.

    Science.gov (United States)

    Jiang, Yun; Ma, Dan; Keenan, Kathryn E; Stupic, Karl F; Gulani, Vikas; Griswold, Mark A

    2017-10-01

    The purpose of this study was to evaluate accuracy and repeatability of T 1 and T 2 estimates of a MR fingerprinting (MRF) method using the ISMRM/NIST MRI system phantom. The ISMRM/NIST MRI system phantom contains multiple compartments with standardized T 1 , T 2 , and proton density values. Conventional inversion-recovery spin echo and spin echo methods were used to characterize the T 1 and T 2 values in the phantom. The phantom was scanned using the MRF-FISP method over 34 consecutive days. The mean T 1 and T 2 values were compared with the values from the spin echo methods. The repeatability was characterized as the coefficient of variation of the measurements over 34 days. T 1 and T 2 values from MRF-FISP over 34 days showed a strong linear correlation with the measurements from the spin echo methods (R 2  = 0.999 for T 1 ; R 2  = 0.996 for T 2 ). The MRF estimates over the wide ranges of T 1 and T 2 values have less than 5% variation, except for the shortest T 2 relaxation times where the method still maintains less than 8% variation. MRF measurements of T 1 and T 2 are highly repeatable over time and across wide ranges of T 1 and T 2 values. Magn Reson Med 78:1452-1457, 2017. © 2016 International Society for Magnetic Resonance in Medicine. © 2016 International Society for Magnetic Resonance in Medicine.

  7. Structure re-determination and superconductivity observation of bulk 1T MoS{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Fang, Yuqiang; He, Jianqiao; Bu, Kejun [State Key Laboratory of High Performance Ceramics and Superfine Microstructure, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai (China); University of Chinese Academy of Sciences, Beijing (China); State Key Laboratory of Rare Earth Materials Chemistry and Applications, College of Chemistry and Molecular Engineering, Peking University, Beijing (China); Pan, Jie; Wang, Dong; Che, Xiangli; Zhao, Wei; Lin, Tianquan [State Key Laboratory of High Performance Ceramics and Superfine Microstructure, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai (China); Luo, Ruichun; Liu, Pan [State Key Laboratory of Metal Matrix Composites, School of Materials Science and Engineering, Shanghai Jiao Tong University, Shanghai (China); Mu, Gang; Zhang, Hui [State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Chinese Academy of Sciences, Shanghai (China); Huang, Fuqiang [State Key Laboratory of High Performance Ceramics and Superfine Microstructure, Shanghai Institute of Ceramics, Chinese Academy of Sciences, Shanghai (China); State Key Laboratory of Rare Earth Materials Chemistry and Applications, College of Chemistry and Molecular Engineering, Peking University, Beijing (China)

    2018-01-26

    2H MoS{sub 2} has been intensively studied because of its layer-dependent electronic structures and novel physical properties. Though the metastable 1T MoS{sub 2} with a [MoS{sub 6}] octahedron was observed over the microscopic area, the true crystal structure of 1T phase has not been strictly determined. Moreover, the true physical properties have not been demonstrated from experiments owing to the challenge for the preparation of pure 1T MoS{sub 2} crystals. 1T MoS{sub 2} single crystals were successfully synthesized and the crystal structure of 1T MoS{sub 2} re-determined from single-crystal X-ray diffraction. 1T MoS{sub 2} crystallizes in the space group P anti 3m1 with a cell of a=b=3.190(3) Aa and c=5.945(6) Aa. The individual MoS{sub 2} layer consists of MoS{sub 6} octahedra sharing edges with each other. More surprisingly, the bulk 1T MoS{sub 2} crystals undergo a superconducting transition of T{sub c}=4 K, which is the first observation of superconductivity in pure 1T MoS{sub 2} phase. (copyright 2018 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  8. Interobserver and test-retest reproducibility of T1ρ and T2 mesurements of lumber intervertebral discs by 3t magnetic resonance imaging

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Yeon Hwa; Yoon, Choon Sik; Eun, Na Lae; Kim, Sung Jin; Chung, Tae Sub [Dept. of Radiology, Gangnam Severance Hospital, Yonsei University College of Medicine, Seoul (Korea, Republic of); Hwang, Moon Jung [GE Health Care, Seoul (Korea, Republic of); Yoo, Hanna [Biostatistics Collaboration Lab, Yonsei University College of Medicine, Seoul (Korea, Republic of); Peter, Robert D. [GE Health Care, Milwaukee (United States); Lee, Young Han; Suh, Jin Suck [Dept. of Radiology, Severance Hospital, Yonsei University College of Medicine, Seoul (Korea, Republic of)

    2016-11-15

    To investigate the interobserver and test-retest reproducibility of T1ρ and T2 measurements of lumbar intervertebral discs using 3T magnetic resonance imaging (MRI). This study included a total of 51 volunteers (female, 26; male, 25; mean age, 54 ± 16.3 years) who underwent lumbar spine MRI with a 3.0 T scanner. Amongst these subjects, 40 underwent repeat T1ρ and T2 measurement acquisitions with identical image protocol. Two observers independently performed the region of interest measurements in the nuclei pulposi of the discs from L1-2 through L5-S1 levels. Statistical analysis was performed using intraclass correlation coefficient (ICC) with a two-way random model of absolute agreement. Comparison of the ICC values was done after acquisition of ICC values using Z test. Statistical significance was defined as p value < 0.05. The ICCs of interobserver reproducibility were 0.951 and 0.672 for T1ρ and T2 mapping, respectively. The ICCs of test-retest reproducibility (40 subjects) for T1ρ and T2 measurements were 0.922 and 0.617 for observer A and 0.914 and 0.628 for observer B, respectively. In the comparison of the aforementioned ICCs, ICCs of interobserver and test-retest reproducibility for T1ρ mapping were significantly higher than T2 mapping (p < 0.001). The interobserver and test-retest reproducibility of T1ρ mapping were significantly higher than those of T2 mapping for the quantitative assessment of nuclei pulposi of lumbar intervertebral discs.

  9. Electronic structures of B1 MoN, fcc Mo2N, and hexagonal MoN

    International Nuclear Information System (INIS)

    Ihara, H.; Kimura, Y.; Senzaki, K.; Kezuka, H.; Hirabayashi, M.

    1985-01-01

    The electronic structures of B1 MoN, fcc Mo 2 N, and hexagonal MoN were observed by photoelectron spectroscopic measurement. The B1-MoN phase has been predicted to be a high-T/sub c/ superconductor because of a large density of states at Fermi level. The observed electronic structure of the stoichiometric B1-MoN phase is different from that of the real B1-MoN type. The nitrogen excess B1-MoN/sub x/ (x> or =1.3) phase, however, shows the B1-type electronic structure. This is explained by the occurrence of a nitrogen vacancy in the apparent stoichiometric B1 phase and the occupation of the nitrogen vacancy in the nitrogen-excess B1 phase. This property is related to the previously reported low T/sub c/ of the B1-MoN crystals

  10. Infrared Spectra of the 10-μm Bands of 1,2-Difluoroethane and 1,1,2-Trifluoroethane: Vibrationally Mediated Torsional Tunneling in 1,1,2-Trifluoroethane

    Science.gov (United States)

    Stone, Stephen C.; Miller, C. Cameron; Philips, Laura A.; Andrews, A. M.; Fraser, G. T.; Pate, B. H.; Xu, Li-Hong

    1995-12-01

    The 3-MHz-resolution infrared spectra of the 10-μm bands of thegaucheconformer of 1,2-difluoroethane (HFC152) and theC1-symmetry conformer of 1,1,2-trifluoroethane (HFC143) have been measured using a molecular-beam electric-resonance optothermal spectrometer with a tunable microwave-sideband CO2laser source. For 1,2-difluoroethane, two bands have been studied, the ν17B-symmetry C-F stretch at 1077.3 cm-1and the ν13B-symmetry CH2rock at 896.6 cm-1. Both bands are well fit to a asymmetric-rotor Hamiltonian to better than 0.5 MHz. The ν13band is effectively unperturbed, while the ν17band is weakly perturbed, as shown by the large change in centrifugal distortion constants from the ground state values. Two bands have also been studied for 1,1,2-trifluoroethane, the ν11symmetric CF2stretch at 1077.2 cm-1and the ν13C-C stretch at 905.1 cm-1. One of the two bands, ν11, is unperturbed and fit to near the experimental precision. The ν13vibration, on the other hand, is weakly perturbed by an interaction with a nearby state. This perturbation leads to a doubling or splitting of the lines, due to a perturbation-induced lifting of the degeneracy of the symmetric and antisymmetric tunneling states associated with tunneling between the two equivalentC1forms. For theJ,Kastates studied, the splittings are as large as 37 MHz. Combining this observation with published low-resolution far-infrared measurements of torsional sequence-band and hot-band frequencies and calculations from an empirical torsional potential allows us to identify the perturbing state as ν17+ 6ν18. Here, ν17is the CF2twist and ν18is the torsion. The matrix element responsible for this interaction exchanges eight vibrational quanta!

  11. Ab initio Study of Alkyl-oxonium Cations CnH2n+1OH2+, n=1,2,3,4

    Directory of Open Access Journals (Sweden)

    Francis F. Muguet

    2004-08-01

    Full Text Available ABSTRACT: Within the framework of the itinerant radical model, the solvated electron in liquid alcohols is understood as an itinerant alkyl-oxonium ROH2. radical. As a first step in the investigation of those radicals, this study deals with the optimization of related ROH2+ alky-oxonium cations: CnH2n+1OH2+,n=1,2,3,4. The structures were optimized at the MP2/6-31G**++ level with the help of the GAMESS ab initio package. Optimized structures are reported for the following cations: MethylOxonium; EthylOxonium; 1-PropylOxonium, 2-PropylOxonium and 1-ButylOxonium, 2-ButylOxonium, IsoButylOxonium, TertButylOxonium. Optimized geometries are displayed with the help of the ChemApp Java applet. Vibrational frequencies and ZPEs have been computed, and visual depictions of expected experimental IR spectra have been simulated with the help of Lorentzian functions.

  12. London penetration depth measurements in Ba (Fe1-xTx)2As2(T=Co,Ni,Ru,Rh,Pd,Pt,Co+Cu) superconductors

    Energy Technology Data Exchange (ETDEWEB)

    Gordon, Ryan T. [Iowa State Univ., Ames, IA (United States)

    2011-01-01

    The London penetration depth has been measured in various doping levels of single crystals of Ba(Fe1-xTx)2As2 (T=Co,Ni,Ru,Rh,Pd,Pt,Co+Cu) superconductors by utilizing a tunnel diode resonator (TDR) apparatus. All in-plane penetration depth measurements exhibit a power law temperature dependence of the form Δλab(T) = CTn, indicating the existence of low-temperature, normal state quasiparticles all the way down to the lowest measured temperature, which was typically 500 mK. Several different doping concentrations from the Ba(Fe1-xTx)2As2 (T=Co,Ni) systems have been measured and the doping dependence of the power law exponent, n, is compared to results from measurements of thermal conductivity and specific heat. In addition, a novel method has been developed to allow for the measurement of the zero temperature value of the in-plane penetration depth, λab(0), by using TDR frequency shifts. By using this technique, the doping dependence of λab(0) has been measured in the Ba(Fe1-xCox)2As2 series, which has allowed also for the construction of the doping-dependent superfluid phase stiffness, ρs(T) = [λ(0)/λ(T)]2. By studying the effects of disorder on these superconductors using heavy ion irradiation, it has been determined that the observed power law temperature dependence likely arises from pair-breaking impurity scattering contributions, which is consistent with the proposed s±-wave symmetry of the superconducting gap in the dirty scattering limit. This hypothesis is supported by the measurement of an exponential temperature dependence of the penetration depth in the intrinsically clean LiFeAs, indicative of a nodeless superconducting gap.

  13. N1-(Thiophen-2-ylmethyl-N3,N3-bis[3-(thiophen-2-ylmethylammoniopropyl]propane-1,3-diammonium hexafluoridosilicate methanol trisolvate

    Directory of Open Access Journals (Sweden)

    Md. Alamgir Hossain

    2013-12-01

    Full Text Available In the title compound, C24H40N4S34+·2SiF62−·3CH3OH, the central tertiary amine function is protonated and is connected to three thiophen-2-ylmethylamino-n-propyl groups, forming the arms of a T-shaped cation that has two pockets. Each arm contains one protonated secondary amine function, and each pocket is occupied by one SiF62− anion bonded via two N—H...F interactions with the protonated amine group on the middle arm, while two methanol solvent molecules are N—H...O hydrogen-bonded with the other secondary protonated amine groups on the side arms. Weak O—H...O and O—H...F hydrogen bonds between the solvent molecules and between the solvent molecules and the anions, respectively, are also observed. All three thiophene groups in the arms are disordered over two sets of sites, with occupancy ratios of 0.828 (3:0.172 (3, 0.910 (2:0.090 (2 and 0.890 (3:0.110 (3.

  14. Application of Quantitative MRI for Brain Tissue Segmentation at 1.5 T and 3.0 T Field Strengths

    Science.gov (United States)

    West, Janne; Blystad, Ida; Engström, Maria; Warntjes, Jan B. M.; Lundberg, Peter

    2013-01-01

    Background Brain tissue segmentation of white matter (WM), grey matter (GM), and cerebrospinal fluid (CSF) are important in neuroradiological applications. Quantitative Mri (qMRI) allows segmentation based on physical tissue properties, and the dependencies on MR scanner settings are removed. Brain tissue groups into clusters in the three dimensional space formed by the qMRI parameters R1, R2 and PD, and partial volume voxels are intermediate in this space. The qMRI parameters, however, depend on the main magnetic field strength. Therefore, longitudinal studies can be seriously limited by system upgrades. The aim of this work was to apply one recently described brain tissue segmentation method, based on qMRI, at both 1.5 T and 3.0 T field strengths, and to investigate similarities and differences. Methods In vivo qMRI measurements were performed on 10 healthy subjects using both 1.5 T and 3.0 T MR scanners. The brain tissue segmentation method was applied for both 1.5 T and 3.0 T and volumes of WM, GM, CSF and brain parenchymal fraction (BPF) were calculated on both field strengths. Repeatability was calculated for each scanner and a General Linear Model was used to examine the effect of field strength. Voxel-wise t-tests were also performed to evaluate regional differences. Results Statistically significant differences were found between 1.5 T and 3.0 T for WM, GM, CSF and BPF (p3.0 T. The mean differences between 1.5 T and 3.0 T were -66 mL WM, 40 mL GM, 29 mL CSF and -1.99% BPF. Voxel-wise t-tests revealed regional differences of WM and GM in deep brain structures, cerebellum and brain stem. Conclusions Most of the brain was identically classified at the two field strengths, although some regional differences were observed. PMID:24066153

  15. Plane-wave impulse approximation extraction of the neutron magnetic form factor from Quasi-Elastic 3(rvec H)e((rvec e),e(prime)) at Q2 = 0.3 to 0.6 (GeV/c)2

    International Nuclear Information System (INIS)

    Xu, W.; Anderson, B.; Auberbach, L.; Averett, T.; Bertozzi, W.; Black, T.; Calarco, J.; Cardman, L.; Cates, G.D.; Chai, Z.W.; Chen, J.P.; Choi, S.; Chudakov, E.; Churchwell, S.; Corrado, G.S.; Crawford, C.; Dale, D.; Deur, A.; Djawotho, P.; Donnelly, T.W.; Dutta, D.; Finn, J.M.; Gao, H.; Gilman, R.; Glamazdin, A.V.; Glashausser, C.; Gloeckle, Walter; Golak, J.; Gomez, J.; Gorbenko, V.G.; Hansen, J.O.; Hersman, F.W.; Higinbotham, D.W.; Holmes, R.; Howell, C.R.; Hughes, E.; Humensky, B.; Incerti, S.; Jager, C.W. de; Jensen, J.S.; Jiang, X.; Jones, C.E.; Jones, M.; Kahl, R.; Kamada, H.; Kievsky, A.; Kominis, I.; Korsch, W.; Kramer, K.; Kumbartzki, G.; Kuss, M.; Lakuriqi, E.; Liang, M.; Liyanage, N.; LeRose, J.; Malov, S.; Margaziotis, D.J.; Martin, J.W.; McCormick, K.; McKeown, R. D.; McIlhany, K.; Meziani, Z.E.; Michaels, R.; Miller, G.W.; Mitchell, J.; Nanda, S.; Pace, E.; Pavlin, T.; Petratos, G.G.; Pomatsalyuk, R.I.; Pripstein, D.; Prout, D.; Ransome, R.D.; Roblin, Y.; Rvachev, M.; Saha, A.; Salme, G.; Schnee, M.; Shin, T.; Slifer, K.; Souder, P.A.; Strauch, S.; Suleiman, R.; Sutter, M.; Tipton, B.; Todor, L.; Viviani, M.; Vlahovic, B.; Watson, J.; Williamson, C.F.; Witala, H.; Wojtsekhowski, B.; Xiong, F.; Yeh, J.; Zolnierczuk, P.

    2003-01-01

    A high precision measurement of the transverse spin-dependent asymmetry A T in 3 (rvec H)e((rvec e),e(prime)) quasielastic scattering was performed in Hall A at Jefferson Lab at values of the squared four-momentum transfer, Q 2 , between 0.1 and 0.6 (GeV/c) 2 . A T is sensitive to the neutron magnetic form factor, G M n . Values of G M n at Q 2 = 0.1 and 0.2 (GeV/c) 2 , extracted using Faddeev calculations, were reported previously. Here, we report the extraction of G M n for the remaining Q 2 -values in the range from 0.3 to 0.6 (GeV/c) 2 using a Plane-Wave Impulse Approximation calculation. The results are in good agreement with recent precision data from experiments using a deuterium target

  16. Manipulation of polar order in the “empty” tetragonal tungsten bronzes: Ba{sub 4-x}Sr{sub x}Dy{sub 0.67}□{sub 1.33}Nb{sub 10}O{sub 30}, x = 0, 0.25, 0.5, 1, 2, 3

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, Jonathan; Morrison, Finlay D., E-mail: finlay.morrison@st-andrews.ac.uk [EaStCHEM School of Chemistry, University of St Andrews, North Haugh, St Andrews KY16 9ST (United Kingdom)

    2016-08-15

    A series of “empty” tetragonal tungsten bronze (TTB) ferroelectrics, Ba{sub 4-x}Sr{sub x}Dy{sub 0.67}□{sub 1.33}Nb{sub 10}O{sub 30} (x = 0, 0.25, 0.5, 1, 2, 3; □ = vacancy), is reported. With increasing x the unit cell contracts in both the ab plane and c-axis; x ≤ 1 compounds are normal ferroelectrics (FE) with decreasing T{sub C} as x increases, while x ≥ 2 are relaxor ferroelectrics (RFE) with associated frequency dependent permittivity peaks and with similar T{sub m} and T{sub f} (Vogel-Fulcher freezing temperatures) values. This observation is rationalised by differing cation occupancies: for x ≤ 1, Sr{sup 2+} principally occupies the A2-site (co-occupied by Ba{sup 2+} with the A1-site occupied by Dy{sup 3+} and vacancies); for x ≥ 2 significant Sr A1-site occupation leads to the observed RFE characteristics. This FE to RFE crossover is consistent with a previously proposed TTB crystal chemical framework where both a decrease in average A-site size and concurrent increase in A1-site tolerance factor (t{sub A1}) favour destabilization of long range polar order and relaxor behaviour. The effect of increasing t{sub A1} as a result of Sr occupancy at the A1 site is dominant in the compounds reported here.

  17. Theoretical study for the reduction of N2O with CO Mediated by alkaline-earth metal oxide cations 2MO+(M=Ca, Sr, Ba)

    International Nuclear Information System (INIS)

    Zhang Jianhui; Leng Yanli; Wang Yongcheng

    2013-01-01

    The reaction mechanism of the reaction N 2 O( 0 Σ + ) + CO ( 1 Σ + )→N 2 ( 1 Σ g + ) + CO 2 ( 1 Σ g + ) mediated by alkaline-earth metal oxide cations 2 MO + (m=Ca, Sr, Ba) have been investigated by using the UB3LYP and CCSD (T) levels of theory. The O-atom affinities (OA) testified that only the 2 CaO + can capture O from N 2 O and transfer O to CO is thermodynamically allowed in three ions. The processes can be expressed as channels l and 2 for the reaction of N 2 O and CO mediated by 2 MO + (M=Ca, Sr, Ba). For the former, the main reaction processes in a two-step manner to products, the 2 MO + , as a catalyzer, transports an oxygen atom from N 2 O to CO. For the latter, firstly, the N 2 O interact with the 2 MO + to form IM1, then IM1 interact with the CO to form IM2', along the reaction pathway the intermediate species convert into products 2 1MO + , N 2 and CO 2 . From above results, the following conclusion was drawn. The channel 2 is kinetically and thermodynamically feasible. Our calculated results show the title reactions are accord with the experiment. (authors)

  18. Detailed profile of m=2 islands with TVTS on JFT-2M

    International Nuclear Information System (INIS)

    Yamauchi, T.; Grek, B.; Hoshino, K.; Le Blanc, B.; Johnson, D.; Felt, J.; Shiina, T.; Kurita, G.; Ishige, Y.; Kozawa, H.

    1996-01-01

    The detailed electron temperature profile (spatial resolution: 0.86 cm) of a low density JFT-2M plasma is measured with the TV Thomson scattering system (TVTS). Flat profiles showing the electron temperature shapes of m=2/n=1 islands are presented, which are in contrast to that without islands. On the other hand, the m=2/n=1 islands are effectively suppressed with local ECRH heating. (orig.)

  19. (1R,2R-N,N′-Bis(ferrocenylmethyl-1,2-diphenylethane-1,2-diamine

    Directory of Open Access Journals (Sweden)

    Yi Guo

    2010-08-01

    Full Text Available The title compound, [Fe2(C5H52(C26H26N2], was synthesized from a chiral diamine and ferrocenecarboxaldehyde and subsequent reduction with NaBH4. It has two chiral centers which both exhibit an R configuration. Two ferrocene groups are present in the molecular structure, with their cyclopentadienyl ring planes showing an almost perpendicular arrangement [dihedral angle 88.6 (1°].

  20. Stable Sheave Moduli of Rank 2 with Chern Classes c 1 = -1; c2 = 2; c3 = 0 on Q3

    Directory of Open Access Journals (Sweden)

    A. D. Uvarov

    2012-01-01

    Full Text Available In this paper we consider the scheme MQ( 21; 2; 0 of stable torsion free sheaves of rank 2 with Chern classes c1 = -1, c2 = 2, c3 = 0 on a smooth 3-dimensional projective quadric Q. The manifold MQ(-1; 2 of moduli bundles of rank 2 with Chern classes c1 = -1, c2 = 2 on Q was studied by Ottaviani and Szurek in 1994. In 2007 the author described the closure MQ (-1; 2 in the scheme MQ(21; 2; 0. In this paper we prove that in MQ(21; 2; 0 there exists a unique irreducible component diferent from MQ (¡1; 2 which is a rational variety of dimension 10.

  1. Magnetocaloric properties of Eu{sub 1−x}La{sub x}TiO{sub 3} (0.01 ≤ x ≤ 0.2) for cryogenic magnetic cooling

    Energy Technology Data Exchange (ETDEWEB)

    Rubi, Km; Midya, A.; Mahendiran, R., E-mail: phyrm@nus.edu.sg [Physics Department, Faculty of Science, National University of Singapore, 2 Science Drive 3, Singapore, Singapore 117551 (Singapore); Maheswar Repaka, D. V.; Ramanujan, R. V. [School of Materials Science and Engineering, Nanyang Technological University, 50 Nanyang Avenue, Singapore, Singapore 639798 (Singapore)

    2016-06-28

    We report magnetic and magnetocaloric (MCE) properties of polycrystalline Eu{sub 1−x}La{sub x}TiO{sub 3} samples over a wide composition range (0.01 ≤ x ≤ 0.20). It is found that the ground state changes from antiferromagnetic for x = 0.01 (T{sub N} = 5.2 K) to ferromagnetic for x ≥ 0.03 and the ferromagnetic Curie temperature increases from T{sub C} = 5.7 K for x = 0.03 to T{sub C} = 7.9 K for x = 0.20. The x = 0.01 sample shows a large reversible isothermal magnetic entropy change of −ΔS{sub m} = 23 (41.5) J/kg K and adiabatic temperature change of ΔT{sub ad} = 9 (17.2) K around 6.7 K for a field change of μ{sub 0}ΔH = 2 (5) Tesla. Although the peak value of −ΔS{sub m} decreases as La content increases, it is impressive in x = 0.2(−ΔS{sub m} = 31.41 J/kg K at T = 7.5 K for μ{sub 0}ΔH = 5 T). The large value of MCE arises from suppression of the spin entropy associated with the localized moment (J = 7/2) of Eu{sup 2+}:4f{sup 7} ions. This large MCE over a wide compositional range suggests that the Eu{sub 1−x}La{sub x}TiO{sub 3} series could be useful for magnetic cooling below 40 K.

  2. Electronic and magnetic structure of RENi{sub 2}Mn{sub x}-compounds (RE = rare earth, x = 0, 0.25, 0.5, 0.75, 1, 1.25) with respect to ErNi{sub 2}Mn{sub x}

    Energy Technology Data Exchange (ETDEWEB)

    Balinski, Kamil; Kuepper, Karsten [Department of Physics, Osnabrueck University (Germany); Chrobak, Artur [Department of Physics, University of Silesia in Katowice (Poland); Kuznetzsova, T.V.; Mushnikov, N.V.; Marchenkov, V.V. [Institute of Metal Physics, 620990 Ekaterinburg (Russian Federation)

    2015-07-01

    Rare earth (RE) and transition metal (T) compounds are research field since the 1960s. Because of huge magnetocalorical effect and giant magnetostriction the RE-T-compounds are excellent for applications like magnetic cooling or hydrogen storage devices. Besides of that RE-Ni{sub 2}-type of alloys are, due to the relatively simple crystal structure and the fact that Ni{sub 2} does not indicate any %behavior with result in an magnetic moment, excellent candidates for studies of magnetic behavior of RE's and their binding partners. The electronic structure of ErNi{sub 2}Mn{sub x} (x = 0, 0.25, 0.5, 0.75, 1, 1.25) is characterized by XPS and ResPES, the magnetic structure is investigated by SQUID and PPMS techniques, and resistivity measurements are made. Variation in Mn concentration revealed the position of Mn 3d-states at 1.7 eV. The XPS intensity at 1.7 eV can be correlated with the behavior of the Curie temperature and the resistivity. While similar RENi{sub 2}Mn{sub x}-systems, where RE had been replaced by Gd and Tb, highest resistivity, Curie temperature and the highest Mn 3d-valence band state intensity were observed at x = 0.5. ErNi{sub 2}Mn{sub x}-system behave different and show the mentioned maxima at x = 1.25.

  3. Simultaneous T1 and T2 Brain Relaxometry in Asymptomatic Volunteers using Magnetic Resonance Fingerprinting.

    Science.gov (United States)

    Badve, Chaitra; Yu, Alice; Rogers, Matthew; Ma, Dan; Liu, Yiying; Schluchter, Mark; Sunshine, Jeffrey; Griswold, Mark; Gulani, Vikas

    2015-12-01

    Magnetic resonance fingerprinting (MRF) is a method of image acquisition that produces multiple MR parametric maps from a single scan. Here, we describe the normal range and progression of MRF-derived relaxometry values with age in healthy individuals. 56 normal volunteers (ages 11-71 years, M:F 24:32) were scanned. Regions of interest were drawn on T 1 and T 2 maps in 38 areas, including lobar and deep white matter, deep gray nuclei, thalami and posterior fossa structures. Relaxometry differences were assessed using a forward stepwise selection of a baseline model including either gender, age, or both, where variables were included if they contributed significantly (p<0.05). Additionally, differences in regional anatomy, including comparisons between hemispheres and between anatomical subcomponents, were assessed by paired t-tests. Using this protocol, MRF-derived T 1 and T 2 in frontal WM regions were found to increase in with age, while occipital and temporal regions remained relatively stable. Deep gray nuclei, including substantia nigra, were found to have age-related decreases in relaxometry. Gender differences were observed in T 1 and T 2 of temporal regions, cerebellum and pons. Males were also found to have more rapid age-related changes in frontal and parietal WM. Regional differences were identified between hemispheres, between genu and splenium of corpus callosum, and between posteromedial and anterolateral thalami. In conclusion, MRF quantification can measure relaxometry trends in healthy individuals that are in agreement with current understanding of neuroanatomy and neurobiology, and has the ability to uncover additional patterns that have not yet been explored.

  4. Relaxation times T1, T2, and T2* of apples, pears, citrus fruits, and potatoes with a comparison to human tissues

    International Nuclear Information System (INIS)

    Werz, Karin; Braun, Hans; Vitha, Dominik; Bruno, Graziano; Martirosian, Petros; Steidle, Guenter; Schick, Fritz

    2011-01-01

    The aim of the project was a systematic assessment of relaxation times of different fruits and vegetables and a comparison to values of human tissues. Results provide an improved basis for selection of plant phantoms for development of new MR techniques and sequences. Vessels filled with agar gel are mostly used for this purpose, preparation of which is effortful and time-consuming. In the presented study apples, (malus, 8 species), pears, (pyrus, 2 species), citrus fruits (citrus, 5 species) and uncooked potatoes (solanum tuberosum, 8 species) from the supermarket were examined which are easily available nearly all-the-year. T1, T2 and T2 * relaxation times of these nature products were measured on a 1.5 Tesla MR system with adapted examination protocols and mono-exponential fitting, and compared to literature data of human parenchyma tissues, fatty tissue and body fluid (cerebrospinal fluid). Resulting values were as follows: apples: T1: 1486 - 1874 ms, T2: 163 - 281 ms, T2 * : 2,3 - 3,2 ms; pears: T1: 1631 - 1969 ms, T2: 119 - 133 ms, T2 * : 10,1 - 10,6 ms, citrus fruits (pulp) T1: 2055 - 2632 ms, T2: 497 - 998 ms, T2 * : 151 - 182 ms; citrus fruits (skin) T1: 561 - 1669 ms, T2: 93 - 119 ms; potatoes: T1: 1011 - 1459 ms, T2: 166 - 210 ms, T2 * : 20 - 30 ms. All T1-values of the examined objects (except for potatoes and skins of citrus fruits) were longer than T1 values of human tissues. Also T2 values (except for pears and skins of citrus fruits) of the fruits and the potatoes tended to be longer. T2 * values of apples, pears and potatoes were shorter than in healthy human tissue. Results show relaxation values of many fruits to be not exactly fitting to human tissue, but with suitable selection of the fruits and optionally with an adaption of measurement parameters one can achieve suitable contrast and signal characteristics for some purposes. (orig.)

  5. Crystal structure of bis(azido-κNbis[2,5-bis(pyridin-2-yl-1,3,4-thiadiazole-κ2N2,N3]cobalt(II

    Directory of Open Access Journals (Sweden)

    Abdelhakim Laachir

    2015-05-01

    Full Text Available In the mononuclear title complex, [Co(N32(C12H8N4S2], the cobalt(II atom is located on an inversion centre and displays an axially weakly compressed octahedral coordination geometry. The equatorial positions are occupied by the N atoms of two 2,5-bis(pyridin-2-yl-1,3,4-thiadiazole ligands, whereas the axial positions are occupied by N atoms of the azide anions. The thiadiazole and pyridine rings linked to the metal are almost coplanar, with a maximum deviation from the mean plane of 0.0273 (16 Å. The cohesion of the crystal is ensured by weak C—H...N hydrogen bonds and by π–π interactions between pyridine rings [intercentroid distance = 3.6356 (11 Å], forming a layered arrangement parallel to (001. The structure of the title compound is isotypic with that of the analogous nickel(II complex [Laachir et al. (2013. Acta Cryst. E69, m351–m352].

  6. First-principles study on the strain effect of the Cu(0-bar 0-bar 1)-c(2x2)N self-organized structure

    International Nuclear Information System (INIS)

    Yoshimoto, Yoshihide; Tsuneyuki, Shinji

    2004-01-01

    Nitrogen atoms adsorbed on Cu(0-bar 0-bar 1) surface are known to form a self-organized structure, in which islands of nitrogen-adsorbed region are arranged into a square lattice. To clarify the mechanism of the self-organization, the strain effect in this surface is investigated by first-principles theoretical calculations. The difference between the calculated surface stress of Cu(0-bar 0-bar 1)-c(2x2)N surface and that of clean Cu(0-bar 0-bar 1) surface is in good agreement with the value estimated from experiments. In the stripe model of the self-organized surface, the top-most Cu atoms are largely displaced in lateral directions, while the nitrogen atoms at the edge of its nitrogen-adsorbed region slightly protrude in the surface normal. These results are consistent with observations. Spontaneous formation of the clean Cu region is also confirmed by calculating the formation energy within the stripe model. The formation energy is fitted well by a function deduced from the theory of elasticity. Nevertheless, the parameter of the fitting cannot be explained only by the difference of the surface stresses

  7. Role of Adjuvant Chemotherapy in ypT0-2N0 Patients Treated with Preoperative Chemoradiation Therapy and Radical Resection for Rectal Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Park, In Ja [Department of Colon and Rectal Surgery, University of Ulsan College of Medicine and Asan Medical Center, Seoul (Korea, Republic of); Kim, Dae Yong [Center for Colorectal Cancer, National Cancer Center, Goyang-si (Korea, Republic of); Kim, Hee Cheol [Department of Surgery, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Kim, Nam Kyu [Section of Colon and Rectal Surgery, Department of Surgery, Yonsei University College of Medicine, Seoul (Korea, Republic of); Kim, Hyeong-Rok [Department of Surgery, Chonnam National University Hwansun Hospital, Gwangju (Korea, Republic of); Kang, Sung-Bum [Department of Surgery, Seoul National University Bungdang Hospital, Bundang (Korea, Republic of); Choi, Gyu-Seog [Division of Colorectal Cancer Center, Kyungpook National University Medical Center, Daegu (Korea, Republic of); Lee, Kang Young [Department of Surgery, Gangnam Severance Hospital, Yonsei University College of Medicine, Seoul (Korea, Republic of); Kim, Seon-Hahn [Department of Surgery, Korea University Anam Hospital, Seoul (Korea, Republic of); Oh, Seung Taek [Department of Surgery, Seoul St. Mary Hospital, Catholic University, Seoul (Korea, Republic of); Lim, Seok-Byung; Kim, Jin Cheon [Department of Colon and Rectal Surgery, University of Ulsan College of Medicine and Asan Medical Center, Seoul (Korea, Republic of); Oh, Jae Hwan; Kim, Sun Young [Center for Colorectal Cancer, National Cancer Center, Goyang-si (Korea, Republic of); Lee, Woo Yong [Department of Surgery, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Lee, Jung Bok [Department of Clinical Epidemiology and Biostatistics, University of Ulsan College of Medicine and Asan Medical Center, Seoul (Korea, Republic of); Yu, Chang Sik, E-mail: csyu@amc.seoul.kr [Department of Colon and Rectal Surgery, University of Ulsan College of Medicine and Asan Medical Center, Seoul (Korea, Republic of)

    2015-07-01

    Objective: To explore the role of adjuvant chemotherapy for patients with ypT0-2N0 rectal cancer treated by preoperative chemoradiation therapy (PCRT) and radical resection. Patients and Methods: A national consortium of 10 institutions was formed, and patients with ypT0-2N0 mid- and low-rectal cancer after PCRT and radical resection from 2004 to 2009 were included. Patients were categorized into 2 groups according to receipt of additional adjuvant chemotherapy: Adj CTx (+) versus Adj CTx (−). Propensity scores were calculated and used to perform matched and adjusted analyses comparing relapse-free survival (RFS) between treatment groups while controlling for potential confounding. Results: A total of 1016 patients, who met the selection criteria, were evaluated. Of these, 106 (10.4%) did not receive adjuvant chemotherapy. There was no overall improvement in 5-year RFS as a result of adjuvant chemotherapy [91.6% for Adj CTx (+) vs 87.5% for Adj CTx (−), P=.18]. There were no differences in 5-year local recurrence and distant metastasis rate between the 2 groups. In patients who show moderate, minimal, or no regression in tumor regression grade, however, possible association of adjuvant chemotherapy with RFS would be considered (hazard ratio 0.35; 95% confidence interval 0.14-0.88; P=.03). Cox regression analysis after propensity score matching failed to show that addition of adjuvant chemotherapy was associated with improved RFS (hazard ratio 0.81; 95% confidence interval 0.39-1.70; P=.58). Conclusions: Adjuvant chemotherapy seemed to not influence the RFS of patients with ypT0-2N0 rectal cancer after PCRT followed by radical resection. Thus, the addition of adjuvant chemotherapy needs to be weighed against its oncologic benefits.

  8. Role of Adjuvant Chemotherapy in ypT0-2N0 Patients Treated with Preoperative Chemoradiation Therapy and Radical Resection for Rectal Cancer.

    Science.gov (United States)

    Park, In Ja; Kim, Dae Yong; Kim, Hee Cheol; Kim, Nam Kyu; Kim, Hyeong-Rok; Kang, Sung-Bum; Choi, Gyu-Seog; Lee, Kang Young; Kim, Seon-Hahn; Oh, Seung Taek; Lim, Seok-Byung; Kim, Jin Cheon; Oh, Jae Hwan; Kim, Sun Young; Lee, Woo Yong; Lee, Jung Bok; Yu, Chang Sik

    2015-07-01

    To explore the role of adjuvant chemotherapy for patients with ypT0-2N0 rectal cancer treated by preoperative chemoradiation therapy (PCRT) and radical resection. A national consortium of 10 institutions was formed, and patients with ypT0-2N0 mid- and low-rectal cancer after PCRT and radical resection from 2004 to 2009 were included. Patients were categorized into 2 groups according to receipt of additional adjuvant chemotherapy: Adj CTx (+) versus Adj CTx (-). Propensity scores were calculated and used to perform matched and adjusted analyses comparing relapse-free survival (RFS) between treatment groups while controlling for potential confounding. A total of 1016 patients, who met the selection criteria, were evaluated. Of these, 106 (10.4%) did not receive adjuvant chemotherapy. There was no overall improvement in 5-year RFS as a result of adjuvant chemotherapy [91.6% for Adj CTx (+) vs 87.5% for Adj CTx (-), P=.18]. There were no differences in 5-year local recurrence and distant metastasis rate between the 2 groups. In patients who show moderate, minimal, or no regression in tumor regression grade, however, possible association of adjuvant chemotherapy with RFS would be considered (hazard ratio 0.35; 95% confidence interval 0.14-0.88; P=.03). Cox regression analysis after propensity score matching failed to show that addition of adjuvant chemotherapy was associated with improved RFS (hazard ratio 0.81; 95% confidence interval 0.39-1.70; P=.58). Adjuvant chemotherapy seemed to not influence the RFS of patients with ypT0-2N0 rectal cancer after PCRT followed by radical resection. Thus, the addition of adjuvant chemotherapy needs to be weighed against its oncologic benefits. Copyright © 2015 Elsevier Inc. All rights reserved.

  9. Role of Adjuvant Chemotherapy in ypT0-2N0 Patients Treated with Preoperative Chemoradiation Therapy and Radical Resection for Rectal Cancer

    International Nuclear Information System (INIS)

    Park, In Ja; Kim, Dae Yong; Kim, Hee Cheol; Kim, Nam Kyu; Kim, Hyeong-Rok; Kang, Sung-Bum; Choi, Gyu-Seog; Lee, Kang Young; Kim, Seon-Hahn; Oh, Seung Taek; Lim, Seok-Byung; Kim, Jin Cheon; Oh, Jae Hwan; Kim, Sun Young; Lee, Woo Yong; Lee, Jung Bok; Yu, Chang Sik

    2015-01-01

    Objective: To explore the role of adjuvant chemotherapy for patients with ypT0-2N0 rectal cancer treated by preoperative chemoradiation therapy (PCRT) and radical resection. Patients and Methods: A national consortium of 10 institutions was formed, and patients with ypT0-2N0 mid- and low-rectal cancer after PCRT and radical resection from 2004 to 2009 were included. Patients were categorized into 2 groups according to receipt of additional adjuvant chemotherapy: Adj CTx (+) versus Adj CTx (−). Propensity scores were calculated and used to perform matched and adjusted analyses comparing relapse-free survival (RFS) between treatment groups while controlling for potential confounding. Results: A total of 1016 patients, who met the selection criteria, were evaluated. Of these, 106 (10.4%) did not receive adjuvant chemotherapy. There was no overall improvement in 5-year RFS as a result of adjuvant chemotherapy [91.6% for Adj CTx (+) vs 87.5% for Adj CTx (−), P=.18]. There were no differences in 5-year local recurrence and distant metastasis rate between the 2 groups. In patients who show moderate, minimal, or no regression in tumor regression grade, however, possible association of adjuvant chemotherapy with RFS would be considered (hazard ratio 0.35; 95% confidence interval 0.14-0.88; P=.03). Cox regression analysis after propensity score matching failed to show that addition of adjuvant chemotherapy was associated with improved RFS (hazard ratio 0.81; 95% confidence interval 0.39-1.70; P=.58). Conclusions: Adjuvant chemotherapy seemed to not influence the RFS of patients with ypT0-2N0 rectal cancer after PCRT followed by radical resection. Thus, the addition of adjuvant chemotherapy needs to be weighed against its oncologic benefits

  10. Fabrication of Au_n_a_n_o_p_a_r_t_i_c_l_e@mSiO_2@Y_2O_3:Eu nanocomposites with enhanced fluorescence

    International Nuclear Information System (INIS)

    Li, Huiqin; Kang, Jianmiao; Yang, Jianhui; Wu, Biao

    2016-01-01

    Herein, Au_n_a_n_o_p_a_r_t_i_c_l_e@mSiO_2@Y_2O_3:Eu nanocomposites are synthesized through layer-by-layer assembly technology. Au_n_a_n_o_p_a_r_t_i_c_l_e@mSiO_2 core–shell nanospheres were prepared at first in the presence of CTAB in aqueous solution system by the modified one-pot method. A chemical precipitation method and a succeeding calcination process were adopted to the growth of Y_2O_3:Eu shells on the surfaces of Au_n_a_n_o_p_a_r_t_i_c_l_e@mSiO_2 core–shell nanospheres. The structure, morphology and composition of the nanocomposites were confirmed by XRD, TEM and UV–vis absorption spectrum. The prepared Au_n_a_n_o_p_a_r_t_i_c_l_e@mSiO_2@Y_2O_3:Eu nanocomposites have showed the emission intensity enhances to 6.23 times at 30 nm thickness of the silica spacer between the core of Au nanoparticle and the shell of Y_2O_3:Eu. According to the observations of fluorescent lifetime and the modeling of local electric field, the metal-enhanced and quenched fluorescence is closely related with the enhancement of excitation and radiative decay rate and the quenching by NRET comes as a result of competition between the distance-dependent mechanisms. This kind of multifunctional inorganic material will be widely used in electronics, biology and medical drug loading, etc. - Highlights: • Fabrication of Au_n_a_n_o_p_a_r_t_i_c_l_e@mSiO_2@Y_2O_3:Eu nanocomposites with core-spacer-shell structure. • The controllable fluorescence is achieved by adjusting the spacer thickness of silica. • The fluorescence enhancement is 6.23-fold at an optimal spacer thickness about 30 nm. • The metal-enhanced fluorescence mechanism is proposed.

  11. Cancer of the urinary bladder category T2, T3, (N/sub x/M/sub o/) treated by interstitial radium implant: second report

    International Nuclear Information System (INIS)

    Werf-Messing, B.; Menon, R.S.; Hop, W.C.J.

    1983-01-01

    Three-hundred-twenty-eight patients with bladder cancer category T 2 N/sub x/M/sub o/ have been treated by 3 times 3.5 Gy external irradiation followed by a radium implant. Overall 5- and 10-year survival in the T 2 category are 56% adn 37%. In the T 3 category they are 39% adn 13%, respectively. The intercurrent death (i.e. without evidence of bladder malignancy) corrected acuarial survival percentage in the T 2 category is 75% at 5 years and 69% at 10 years. The corresponding percentages in the T 3 category are 62% and 59%. Prognosis is worsened by the following factors: more than 1 diagnostic transurethral resection, a pathological intravenous pyelography, non-papillary structure and poor degree of differentiation of the growth. Prognosis in category T 3 , as compared with category T 2 , is worse because of the prevalence of bad prognosticators in this T 3 category. Therapeutic adaptation to thesse findings might improve prognosis in the future

  12. Tensor analysing power T{sub 2}0 in inelastic (d, d`) X scattering at 0{sup 0} on {sup 1}H and {sup 12}C from 4.5 to 9.0 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Azhgirej, L S; Chernykh, E V [Laboratory of High Energies, Joint Institute for Nuclear Research, Dubna (Russian Federation); Kobushkin, A P [Institute of Theoretical Physics, Ukrainian Academy of Sciences, Kiev (Ukraine); and others

    1998-12-01

    Tensor analysing power T{sub 20} for inelastic (d, d`) X reaction at deuteron momentum from 4.2 to 9 GeV/c is presented. It is observed that T{sub 20} taken as a function of the four-momentum transfer squared t demonstrates an approximate scaling; its absolute value is small at |t| <{approx_equal} (0.05 - 0.1) GeV{sup 2}/c{sup 2} and has a maximum at -t {approx_equal}0.3 GeV{sup 2}/c{sup 2}. No significant dependence on the type of the target was observed 10 refs., 4 figs., 4 tabs.

  13. Preparation and assessment of [99mTc]technetium aquacarbonyl complexes with 1,2-diaminoethane-N-substituted ligands for tumor detection

    International Nuclear Information System (INIS)

    Radin, Adriano

    2010-01-01

    Over least 15 years the complex [[ 99m Tc](H 2 0) 3 (CO) 3 ] + has been used as an intermediary to obtain technetium radiopharmaceuticals for applications in cardiology, neurology and oncology. Two important characteristics of this molecule are: the facility for obtaining that compound from aqueous solutions and the easiness of substituting H 2 O molecules by atoms of other ligand molecules. In this project we prepared new complexes [[ 99m Tc](CMN S001-3 )(H 2 O)(CO) 3 ] + , where (CMNS001) = N-[(4-methoxy) benzyl]-1,2-diaminoethane, (CMNS003) = N,N'-bis-[(4-methoxy)benzyl]-1,2-diaminoethane, and assessed the uptake of these complexes in murine melanoma cancer cell B16F10 and breast cells MCF-7 and MDA-MD-231, and compared with [[ 99m ](MIBI) 6 ] + uptake. In vitro uptake for both new technetium complex reached values close to 5%, for all cell lines, whereas the [[ 99m Tc](MIBI) 6 ] + uptake was close to 1 %. The assessment of subcellular distribution showed high accumulation of the new complex in the membrane fraction, for MDAMB-231, while for B16F10 accumulation occurred both in membrane and cytoplasm; the concentration of [[ 99m Tc](MIBI) 6 ] + was mainly in the cytoplasm portion. Biodistribution study in mice allowed to observe the capture of up to 1.6% of the administered dose per gram of tumor tissue for the complex [[ 99m Tc](CMNS001)(H 2 O)(CO) 3 ] + , whereas other organs such as heart, lung and muscle, showed uptake of about 5.6%, 6.4% and 2%, respectively. The complexes in this work showed a high rate of uptake in vitro, but was not reproduced in vivo model, which can be related to low concentration of the complexes inside the cells and reduced vascularity of tumor tissue, with lower intake of complex through the blood system. (author)

  14. Santa Ana River Design Memorandum Number 1. Phase 2 GDM on the Santa Ana River Mainstem Including Santiago Creek. Volume 2. Prado Dam.

    Science.gov (United States)

    1988-08-01

    to minimize disturbance during preparation for testing. After sample preparation, the samples were allowed to thaw completely in the triaxial cell ...T.75-26 T.75-27 L. PI-6-2 N 17.46 IC LLI-4-200N EL4 * MCLL P I 4-ZW0i ,ff. ,~SAWY CLAY. fight Arviro. wilr1 s tf 2 OfM 1 i AMI IL lgt - . .f 9 INI

  15. Enhanced M1/M2 macrophage ratio promotes orthodontic root resorption.

    Science.gov (United States)

    He, D; Kou, X; Luo, Q; Yang, R; Liu, D; Wang, X; Song, Y; Cao, H; Zeng, M; Gan, Y; Zhou, Y

    2015-01-01

    Mechanical force-induced orthodontic root resorption is a major clinical challenge in orthodontic treatment. Macrophages play an important role in orthodontic root resorption, but the underlying mechanism remains unclear. In this study, we examined the mechanism by which the ratio of M1 to M2 macrophage polarization affects root resorption during orthodontic tooth movement. Root resorption occurred when nickel-titanium coil springs were applied on the upper first molars of rats for 3 to 14 d. Positively stained odontoclasts or osteoclasts with tartrate-resistant acid phosphatase were found in resorption areas. Meanwhile, M1-like macrophages positive for CD68 and inducible nitric oxide synthase (iNOS) persistently accumulated on the compression side of periodontal tissues. In addition, the expressions of the M1 activator interferon-γ and the M1-associated pro-inflammatory cytokine tumor necrosis factor (TNF)-α were upregulated on the compression side of periodontal tissues. When the coil springs were removed at the 14th day after orthodontic force application, root resorption was partially rescued. The number of CD68(+)CD163(+) M2-like macrophages gradually increased on the compression side of periodontal tissues. The levels of M2 activator interleukin (IL)-4 and the M2-associated anti-inflammatory cytokine IL-10 also increased. Systemic injection of the TNF-α inhibitor etanercept or IL-4 attenuated the severity of root resorption and decreased the ratio of M1 to M2 macrophages. These data imply that the balance between M1 and M2 macrophages affects orthodontic root resorption. Root resorption was aggravated by an enhanced M1/M2 ratio but was partially rescued by a reduced M1/M2 ratio. © International & American Associations for Dental Research 2014.

  16. 3-[2-(1,3-Benzothiazol-2-ylsulfanylethyl]-1,3-oxazolidin-2-one

    Directory of Open Access Journals (Sweden)

    Yong-Hong Wen

    2010-10-01

    Full Text Available The title compound, C12H12N2S2O2, consists of a benzothiazole group and a oxazolidin-1-one linked via a flexible ethane-1,2-diyl spacer. The benzothiazole group and the oxazolidine ring are each almost planar [with maximum deviations of 0.007 (2 and 0.044 (3 Å, respectively] and make a dihedral angle of 9.35 (10°. In the crystal structure, adjacent molecules were connected through C—H...O and C—H...N hydrogen bonds, and further extended into a three-dimensional network structure through intermolecular aromatic π–π stacking interactions in which the centroid–centroid distance is 3.590 (1 Å.

  17. Cartilage quality in rheumatoid arthritis: comparison of T2* mapping, native T1 mapping, dGEMRIC, ΔR1 and value of pre-contrast imaging

    International Nuclear Information System (INIS)

    Buchbender, Christian; Scherer, Axel; Kroepil, Patric; Quentin, Michael; Reichelt, Dorothea C.; Lanzman, Rotem S.; Mathys, Christian; Blondin, Dirk; Wittsack, Hans-Joerg; Antoch, Gerald; Miese, Falk; Koerbl, Birthe; Bittersohl, Bernd; Zilkens, Christoph; Hofer, Matthias; Schneider, Matthias; Ostendorf, Benedikt

    2012-01-01

    To prospectively evaluate four non-invasive markers of cartilage quality - T2* mapping, native T1 mapping, dGEMRIC and ΔR1 - in healthy volunteers and rheumatoid arthritis (RA) patients. Cartilage of metacarpophalangeal (MCP) joints II were imaged in 28 consecutive subjects: 12 healthy volunteers [9 women, mean (SD) age 52.67 (9.75) years, range 30-66] and 16 RA patients with MCP II involvement [12 women, mean (SD) age 58.06 (12.88) years, range 35-76]. Sagittal T2* mapping was performed with a multi-echo gradient-echo on a 3 T MRI scanner. For T1 mapping the dual flip angle method was applied prior to native T1 mapping and 40 min after gadolinium application (delayed gadolinium-enhanced MRI of cartilage, dGEMRIC, T1 Gd ). The difference in the longitudinal relaxation rate induced by gadolinium (ΔR1) was calculated. The area under the receiver operating characteristic curve (AROC) was used to test for differentiation of RA patients from healthy volunteers. dGEMRIC (AUC 0.81) and ΔR1 (AUC 0.75) significantly differentiated RA patients from controls. T2* mapping (AUC 0.66) and native T1 mapping (AUC 0.66) were not significantly different in RA patients compared to controls. The data support the use of dGEMRIC for the assessment of MCP joint cartilage quality in RA. T2* and native T1 mapping are of low diagnostic value. Pre-contrast T1 mapping for the calculation of ΔR1 does not increase the diagnostic value of dGEMRIC. (orig.)

  18. Cartilage quality in rheumatoid arthritis: comparison of T2* mapping, native T1 mapping, dGEMRIC, {delta}R1 and value of pre-contrast imaging

    Energy Technology Data Exchange (ETDEWEB)

    Buchbender, Christian; Scherer, Axel; Kroepil, Patric; Quentin, Michael; Reichelt, Dorothea C.; Lanzman, Rotem S.; Mathys, Christian; Blondin, Dirk; Wittsack, Hans-Joerg; Antoch, Gerald; Miese, Falk [University Duesseldorf, Department of Diagnostic and Interventional Radiology, Medical Faculty, Duesseldorf (Germany); Koerbl, Birthe [Heinrich-Heine-University, Department of Endocrinology, Diabetology and Rheumatology, Medical Faculty, Duesseldorf (Germany); Heinrich-Heine-University, Leibniz Centre for Diabetes Research, Institute of Biometrics and Epidemiology, German Diabetes Centre, Duesseldorf (Germany); Bittersohl, Bernd; Zilkens, Christoph [Heinrich-Heine-University, Department of Orthopaedics, Medical Faculty, Duesseldorf (Germany); Hofer, Matthias [Heinrich-Heine-University, Medical Education Group, Medical School, Duesseldorf (Germany); Schneider, Matthias; Ostendorf, Benedikt [Heinrich-Heine-University, Department of Endocrinology, Diabetology and Rheumatology, Medical Faculty, Duesseldorf (Germany)

    2012-06-15

    To prospectively evaluate four non-invasive markers of cartilage quality - T2* mapping, native T1 mapping, dGEMRIC and {delta}R1 - in healthy volunteers and rheumatoid arthritis (RA) patients. Cartilage of metacarpophalangeal (MCP) joints II were imaged in 28 consecutive subjects: 12 healthy volunteers [9 women, mean (SD) age 52.67 (9.75) years, range 30-66] and 16 RA patients with MCP II involvement [12 women, mean (SD) age 58.06 (12.88) years, range 35-76]. Sagittal T2* mapping was performed with a multi-echo gradient-echo on a 3 T MRI scanner. For T1 mapping the dual flip angle method was applied prior to native T1 mapping and 40 min after gadolinium application (delayed gadolinium-enhanced MRI of cartilage, dGEMRIC, T1{sub Gd}). The difference in the longitudinal relaxation rate induced by gadolinium ({delta}R1) was calculated. The area under the receiver operating characteristic curve (AROC) was used to test for differentiation of RA patients from healthy volunteers. dGEMRIC (AUC 0.81) and {delta}R1 (AUC 0.75) significantly differentiated RA patients from controls. T2* mapping (AUC 0.66) and native T1 mapping (AUC 0.66) were not significantly different in RA patients compared to controls. The data support the use of dGEMRIC for the assessment of MCP joint cartilage quality in RA. T2* and native T1 mapping are of low diagnostic value. Pre-contrast T1 mapping for the calculation of {delta}R1 does not increase the diagnostic value of dGEMRIC. (orig.)

  19. Crystal structures of bis[2-(pyridin-2-ylphenyl-κ2N,C1]rhodium(III complexes containing an acetonitrile or monodentate thyminate(1− ligand

    Directory of Open Access Journals (Sweden)

    Mika Sakate

    2016-04-01

    Full Text Available The crystal structures of bis[2-(pyridin-2-ylphenyl]rhodium(III complexes with the metal in an octahedral coordination containing chloride and acetonitrile ligands, namely (OC-6-42-acetonitrilechloridobis[2-(pyridin-2-ylphenyl-κ2N,C1]rhodium(III, [RhCl(C11H8N2(CH3CN] (1, thyminate(1− and methanol, namely (OC-6-42-methanol(5-methyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-1-ido-κN1bis[2-(pyridin-2-ylphenyl-κ2N,C1]rhodium(III, [Rh(C11H8N2(C5H5N2O2(CH3OH]·CH3OH·0.5H2O (2, and thyminate(1− and ethanol, namely (OC-6-42-ethanol(5-methyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-1-ido-κN1bis[2-(pyridin-2-ylphenyl-κ2N,C1]rhodium(III, [Rh(C11H8N2(C5H5N2O2(C2H5OH]·C2H5OH (3, are reported. The acetonitrile complex, 1, is isostructural with the IrIII analog. In complexes 2 and 3, the monodeprotonated thyminate (Hthym− ligand coordinates to the RhIII atom through the N atom, and the resulting Rh—N(Hthym bond lengths are relatively long [2.261 (2 and 2.252 (2 Å for 2 and 3, respectively] as compared to the Rh—N bonds in the related thyminate complexes. In each of the crystals of 2 and 3, the complexes are linked via a pair of intermolecular N—H...O hydrogen bonds between neighbouring Hthym− ligands, forming an inversion dimer. A strong intramolecular O—H...O hydrogen bond between the thyminate(1− and alcohol ligands in mutually cis positions to each other is also observed.

  20. Random walk generated by random permutations of {1, 2, 3, ..., n + 1}

    International Nuclear Information System (INIS)

    Oshanin, G; Voituriez, R

    2004-01-01

    We study properties of a non-Markovian random walk X (n) l , l = 0, 1, 2, ..., n, evolving in discrete time l on a one-dimensional lattice of integers, whose moves to the right or to the left are prescribed by the rise-and-descent sequences characterizing random permutations π of [n + 1] = {1, 2, 3, ..., n + 1}. We determine exactly the probability of finding the end-point X n = X (n) n of the trajectory of such a permutation-generated random walk (PGRW) at site X, and show that in the limit n → ∞ it converges to a normal distribution with a smaller, compared to the conventional Polya random walk, diffusion coefficient. We formulate, as well, an auxiliary stochastic process whose distribution is identical to the distribution of the intermediate points X (n) l , l < n, which enables us to obtain the probability measure of different excursions and to define the asymptotic distribution of the number of 'turns' of the PGRW trajectories