Curran, Kassie L; Festa, Adam R; Goddard, Scott D; Harrigan, George G; Taylor, Mary L
2015-03-25
Monsanto Co. has developed two sweet corn hybrids, MON 88017 and MON 89034, that contain biotechnology-derived (biotech) traits designed to enhance sustainability and improve agronomic practices. MON 88017 confers benefits of glyphosate tolerance and protection against corn rootworm. MON 89034 provides protection against European corn borer and other lepidopteran insect pests. The purpose of this assessment was to compare the kernel compositions of MON 88017 and MON 89034 sweet corn with that of a conventional control that has a genetic background similar to the biotech sweet corn but does not express the biotechnology-derived traits. The sweet corn samples were grown at five replicated sites in the United States during the 2010 growing season and the conventional hybrid and 17 reference hybrids were grown concurrently to provide an estimate of natural variability for all assessed components. The compositional analysis included proximates, fibers, amino acids, sugars, vitamins, minerals, and selected metabolites. Results highlighted that MON 88017 and MON 89034 sweet corns were compositionally equivalent to the conventional control and that levels of the components essential to the desired properties of sweet corn, such as sugars and vitamins, were more affected by growing environment than the biotech traits. In summary, the benefits of biotech traits can be incorporated into sweet corn with no adverse effects on nutritional quality.
Directory of Open Access Journals (Sweden)
F. Faridi
2016-05-01
Full Text Available In order to evaluate the effects of planting pattern on morphological, Phonological, yield and yield components of sweet and super sweet corn (Zea mays L. varieties under saline conditions, a field experiment was conducted as split plots based on a randomized complete block design with four replications. Planting pattern in 3 levels included one row in ridge, two row in ridge and furrow planting, as a main plot and varieties in 4 levels sweet corn with 2 types (KSc 403 su, Merit and super sweet with two types (Basin, obsession as sub plots. The results showed that planting pattern had significant differences on plant height, ear height, leaf length, leaf width, number of kernel per row, number of rows per ear and 1000-kernel weight. but had no significant effects on the length of tassel, number of leaf/plant, number of leaf per plant above ear, stem diameter, time of anthesis, time of silking, anthesis silking interval ASI, grain yield, biological yield and harvest index. Different varieties had significant effects on the total characteristics studied except number of leaf above ear and stem diameter. Most of the conservable grain yield and harvest index was in Obsession variety (10 kg and 39%, respectively and the least was seen in Basin (4 kg and 20%, respectively. The result showed that use of furrow planting pattern for sweet and super sweet corn in saline conditions can effects result in higher yield.
Impact of transgenic sweet corn silks to two noctuid pests
Eight Bacillus thuringiensis (Bt) transgenic sweet corn hybrids were evaluated (with two controls) for their efficacy against two ear-feeding insects; the corn earworm [Helicoverpa zea (Boddie) (Lepidoptera: Noctuidae)], and the fall armyworm (Spodoptera frugiperda (J.E. Smith) (Lepidoptera: Noctuid...
Field-Evolved Resistance in Corn Earworm to Cry Proteins Expressed by Transgenic Sweet Corn
Dively, Galen P.; Finkenbinder, Chad
2016-01-01
Background Transgenic corn engineered with genes expressing insecticidal toxins from the bacterium Bacillus thuringiensis (Berliner) (Bt) are now a major tool in insect pest management. With its widespread use, insect resistance is a major threat to the sustainability of the Bt transgenic technology. For all Bt corn expressing Cry toxins, the high dose requirement for resistance management is not achieved for corn earworm, Helicoverpa zea (Boddie), which is more tolerant to the Bt toxins. Methodology/Major Findings We present field monitoring data using Cry1Ab (1996–2016) and Cry1A.105+Cry2Ab2 (2010–2016) expressing sweet corn hybrids as in-field screens to measure changes in field efficacy and Cry toxin susceptibility to H. zea. Larvae successfully damaged an increasing proportion of ears, consumed more kernel area, and reached later developmental stages (4th - 6th instars) in both types of Bt hybrids (Cry1Ab—event Bt11, and Cry1A.105+Cry2Ab2—event MON89034) since their commercial introduction. Yearly patterns of H. zea population abundance were unrelated to reductions in control efficacy. There was no evidence of field efficacy or tissue toxicity differences among different Cry1Ab hybrids that could contribute to the decline in control efficacy. Supportive data from laboratory bioassays demonstrate significant differences in weight gain and fitness characteristics between the Maryland H. zea strain and a susceptible strain. In bioassays with Cry1Ab expressing green leaf tissue, Maryland H. zea strain gained more weight than the susceptible strain at all concentrations tested. Fitness of the Maryland H. zea strain was significantly lower than that of the susceptible strain as indicated by lower hatch rate, longer time to adult eclosion, lower pupal weight, and reduced survival to adulthood. Conclusions/Significance After ruling out possible contributing factors, the rapid change in field efficacy in recent years and decreased susceptibility of H. zea to Bt
Analysis of Traits Related to Weed Competitiveness in Sweet Corn (Zea mays L.
Directory of Open Access Journals (Sweden)
Natalia de Leon
2012-03-01
Full Text Available Weed management in sweet corn can be costly; genetic improvements in sweet corn competitiveness may reduce this expense. Competitive ability can exist as weed suppressive ability (WSA, or crop tolerance (CT. Previous studies in corn have found year of hybrid release, maturity, plant height, leaf angle and leafiness may affect WSA, while hybrid era, maturity, and plant height may affect CT. However, many of these studies were limited to very few genotypes. The objective of this study was to assess the effects of phenomorphological traits on sweet corn competitiveness and the inheritance of these traits. An incomplete half-diallel from seven historic sweet corn inbred lines of varying morphologies was evaluated in a split-block randomized complete block design in three environments. Forage sorghum was interplanted in half of the blocks to act as a model weed. Significant differences among hybrids were generally found for both phenomorphological traits and traits measuring WSA and CT, such as sorghum biomass and yield stability, respectively. Crop plant height was most predictive of WSA and CT. In this set of genotypes, competitive ability may be passed with reasonable fidelity from parent to offspring, suggesting that sweet corn could be bred for competitive ability.
Shelton, A M; Olmstead, D L; Burkness, E C; Hutchison, W D; Dively, G; Welty, C; Sparks, A N
2013-10-01
Field tests in 2010-2011 were performed in New York, Minnesota, Maryland, Ohio, and Georgia to compare Bt sweet corn lines expressing Cry1A.105 + Cry2Ab2 and Cry1Ab with their non-Bt isolines, with and without the use of foliar insecticides. The primary insect pest in all locations during the trial years was Heliocoverpa zea (Boddie), which is becoming the most serious insect pest of sweet corn in the United States. At harvest, the ears were measured for marketability according to fresh market and processing standards. For fresh market and processing, least squares regression showed significant effects of protein expression, state, and insecticide frequency. There was a significant effect of year for fresh market but not for processing. The model also showed significant effects of H. zea per ear by protein expression. Sweet corn containing two genes (Cry1A.105 + Cry2Ab2) and a single gene (Cry1Ab) provided high marketability, and both Bt varieties significantly outperformed the traditional non-Bt isolines in nearly all cases regardless of insecticide application frequency. For pest suppression of H. zea, plants expressing Bt proteins consistently performed better than non-Bt isoline plants, even those sprayed at conventional insecticide frequencies. Where comparisons in the same state were made between Cry1A.105 + Cry2Ab2 and Cry1Ab plants for fresh market, the product expressing Cry1A.105 + Cry2Ab2 provided better protection and resulted in less variability in control. Overall, these results indicate Cry1A.105 + Cry2Ab2 and Cry1Ab plants are suitable for fresh market and processing corn production across a diversity of growing regions and years. Our results demonstrate that Bt sweet corn has the potential to significantly reduce the use of conventional insecticides against lepidopteran pests and, in turn, reduce occupational and environmental risks that arise from intensive insecticide use.
Parasitoids attacking fall armyworm (Lepidoptera: Noctuidae) in sweet corn habitats
Fall armyworm larvae, Spodoptera frugiperda (J. E. Smith), were collected from sweet corn plants (Zea mays L.) in fields located in three south Florida counties. Fields were sampled from 2010 – 2015 during the fall and spring seasons. Larvae were brought back to the laboratory to complete developme...
The primary Lepidopteran pests of sweet corn in Georgia are the corn earworm, Helicoverpa zea (Boddie), and the fall armyworm, Spodoptera frugiperda (J.E. Smith). Control of these pests typically requires multiple insecticide applications from first silking until harvest, with commercial growers fre...
Baozhu Guo; Ana Butrón; Brian T. Scully
2010-01-01
The flavor of sh2 super-sweet corn is preferred by consumers. Unfortunately, sh2 sweet corn has little genetic variation for insect resistance. In this paper we review the functions of two loci, p1 and a1. The P1 allele has a major role in sh2 sweet corn resistance to corn earworm, an allele that was lost in historical selection because of its pleiotropic effect on undesirable cob color and silk browning. The P1 allele has significant effects on biosyntheses of silk antibiotic compounds, mays...
Sweet corn (Zea mays L.: Fresh ear yield in dependance of genotype and the environment
Directory of Open Access Journals (Sweden)
Srdić Jelena
2016-01-01
Full Text Available Sweet corn is used as food in the milky stage of endosperm, when its kernel is tender, succulent and sweet. It is consumed in form of fresh ears, or it is industrially processed. Breeding of sweet corn has several equally important aims that are directed by the market demands and different modes of consumption. The ear yield, in sweet corn is the most important but not the only main goal of breeding. In the two year study (2013, 2014 we observed the effect of the genotype, year and their interactions on the yields of 8 sweet corn hybrids. Two of the hybrids were commercial and six were experimental hybrids. The field experiment was arranged according to the RCBD with four replications. Hybrids were harvested 23 days after pollination, i.e. silking. Average yield in 2013 was significantly higher (12.19 t ha-1 than in 2014 (11.49 t ha- 1. In 2013 it ranged from 10.21 t ha-1 for the experimental hybrid ZP 489/1su, up to 13.52 t ha-1 for the commercial hybrid ZP 355su. In 2014 the lowest yielding hybrid was ZP 485/1su (10.14 t ha-1 while the highest yielding was ZP 486/1su (13.41 t ha-1. On average those two were also the highest (13.19 t ha-1 and the lowest yielding (10.66 t ha-1 hybrids. Statistical analysis showed that the effect of genotype and the year, as well as their interactions had significant impact on the yield performances of sweet corn hybrids.
Effect of plant density and mixing ratio on crop yield in sweet corn/mungbean intercropping.
Sarlak, S; Aghaalikhani, M; Zand, B
2008-09-01
In order to evaluate the ear and forage yield of sweet corn (Zea mays L. var. Saccarata) in pure stand and intercropped with mung bean (Vigna radiata L.), a field experiment was conducted at Varamin region on summer 2006. Experiment was carried out in a split plot design based on randomized complete blocks with 4 replications. Plant density with 3 levels [Low (D1), Mean (D2) and High (D3) respecting 6, 8 and 10 m(-2) for sweet corn, cultivar S.C.403 and 10, 20 and 30 m(-2) for mung bean cultivar, Partow] was arranged in main plots and 5 mixing ratios [(P1) = 0/100, (P2) = 25/75, (P3) = 50/50, (P4) = 75/25, (P5) = 100/0% for sweet corn/mung bean, respectively] were arranged in subplots. Quantitative attributes such as plant height, sucker numbers, LER, dry matter distribution in different plant organs were measured in sweet corn economical maturity. Furthermore the yield of cannable ear corn and yield components of sweet corn and mung bean were investigated. Results showed that plant density has not any significant effect on evaluated traits, while the effect of mixing ratio was significant (p ratio of 75/25 (sweet corn/mung bean) could be introduced as the superior mixing ratio; because of it's maximum rate of total sweet corn's biomass, forage yield, yield and yield components of ear corn in intercropping. Regarding to profitability indices of intercropping, the mixing ratio 75/25 (sweet corn/mung bean) in low density (D1P2) which showed the LER = 1.03 and 1.09 for total crop yield before ear harvesting and total forage yield after ear harvest respectively, was better than corn or mung bean monoculture.
Directory of Open Access Journals (Sweden)
A Manzari-Tavakkoli
2016-10-01
Full Text Available Introduction Corn (Zea mays L. is one of the main cereals in the tropical and temperate regions of the world. Sweet corn obtained from a genetic mutation on chromosome 4 locus SU conventional maize resulting accumulation of sugars and polysaccharides which are soluble in seed endosperm. Unlike other types of corn, sweet corn endosperm contains a lot of sugar to starch, which is called Amylodextrin and it is soluble in water. Producing healthy and uniform plants is one of the requirements of modern agriculture. Considering the unsuitable climatic condition in Iran (arid and semiarid transplantation is one of the requirements for sustainable agriculture particularly in sweet corn production with high water requirement where transplantation is able to save at least 2-3 times of irrigations. Therefore, producing high quality transplants is an important practice for successful seedling establishment. Hence, the objective of this study was to evaluate the effects of seed priming and substrate types on the characteristics of sweet corn transplants. Materials and Methods This experiment was conducted as factorial based on a completely randomized design with three replications. Treatments were three levels of seeds pretreatment: no priming (p1, hydropriming (p2 and biopriming (p3, and another factor was seedbeds types in seven levels including: vermicompost (b1, perlite (b2, cocopeat(b3, vermicompost+perlite(b4, vermicompost+ cocopeat (b5, perlite+ cocopeat (b6 and vermicompost+ cocopeat +perlite (b7. Biopriming using bioaminopalis biological fertilizer applied on the seeds for 24hours in a solution containing micro-organisms such azotobacter and Pseudomonas. Then the non-primed and the primed seeds were sown in the plastic pots and grown in a greenhouse with average temperature of 22-25° C. Samples were taken three weeks after planting. Results and Discussion Mean emergence time Emergence is shoot elongation and growth leading the shoots out of the
Directory of Open Access Journals (Sweden)
William F. Tracy
2013-06-01
Full Text Available Planting sweet corn at higher densities may increase the canopy cover, reducing light transmission to the understory and suppressing weed growth. High planting densities can also negatively impact the crop, however, by decreasing ear size and overall yield. The objective of this study was to determine the potential for increased density tolerance of 15 sweet corn hybrids by estimating the general combining ability (GCA and specific combining ability (SCA for traits of interest. In 2010 and 2011, a half-diallel of six historic sweet corn inbreds was evaluated in a split-block randomized complete block design in four Wisconsin environments, with four replicates in each environment. Hybrids were planted at a low density of 29,936 plants ha−1, a medium density of 63,615 plants ha−1, and a high density of 97,293 plants ha−1. Significant differences between hybrids were found for phenomorphological traits and ear characteristics. Inbreds C68, C40 and Ia5125 produced the progeny most tolerant of the highest population density. Among these genotypes, tolerance to high density is a heritable trait, indicating the feasibility of breeding sweet corn for density tolerance and potential weed competitiveness.
Directory of Open Access Journals (Sweden)
Midranisiah
2017-01-01
Full Text Available Shallow lowland swamp area has significant potential for cultivation of sweet corn crop. This lowland swamp has rich natural resources such as organic fertilizers from chicken dunk, cow dunk, oil palm fresh bunches and legume cover crops (LCC that are not maximally utilized yet by farmers. These organic fertilizers can be utilized to increase the growth and production of sweet corn crop. The research objective was to determine organic fertilizer types that capable to increase the growth and production of sweet corn crop at shallow lowland swamp area. This research had been conducted from January to April 2015 in Pulau Semambu Village, North Indralaya Subdistrict, Ogan Ilir District, South Sumatra Province. The design used in this research was non-factorial Randomized Block Design (RBD with four treatments of organic fertilizer types with six replications for each treatment. The treatments were consisted of organic fertilizers from chicken dunk, cow dunk, oil palm fresh bunches and legume cover crops (LCC. The results showed that treatment of organic fertilizers from chicken dunk could increase the growth and production of sweet corn at shallow lowland swamp area with yield level of 4.37 kg.plot −1.
Guo, B Z; Zhang, Z J; Li, R G; Widstrom, N W; Snook, M E; Lynch, R E; Plaisted, D
2001-04-01
Maysin, a C-glycosylflavone in maize silk, has insecticidal activity against corn earworm, Helicoverpa zea (Boddie), larvae. Sweet corn, Zea mays L., is a vulnerable crop to ear-feeding insects and requires pesticide protection from ear damage. This study was conducted to identify maize chromosome regions associated with silk maysin concentration and eventually to transfer and develop high silk maysin sweet corn lines with marker-assisted selection (MAS). Using an F2 population derived from SC102 (high maysin dent corn) and B31857 (low maysin sh2 sweet corn), we detected two major quantitative trait loci (QTL). It was estimated that 25.6% of the silk maysin variance was associated with segregation in the genomic region of npi286 (flanking to p1) on chromosome 1S. We also demonstrated that a1 on chromosome 3L had major contribution to silk maysin (accounted for 15.7% of the variance). Locus a1 has a recessive gene action for high maysin with the presence of functional p1 allele. Markers umc66a (near c2) and umc105a on chromosome 9S also were detected in this analysis with minor contribution. A multiple-locus model, which included npi286, a1, csu3 (Bin 1.05), umc245 (Bin 7.05), agrr21 (Bin 8.09), umc105a, and the epistatic interactions npi286 x a1, a1 x agrr21, csu3 x umc245, and umc105a x umc245, accounted for 76.3% of the total silk maysin variance. Tester crosses showed that at the a1 locus, SC102 has functional A1 alleles and B31857 has homozygous recessive a1 alleles. Individuals of (SC102 x B31857) x B31857 were examined with MAS and plants with p1 allele from SC102 and homozygous a1 alleles from B31857 had consistent high silk maysin. Marker-assisted selection seems to be a suitable method to transfer silk maysin to sweet corn lines to reduce pesticide application.
Setiani, Wike
2014-01-01
Effect of Type and Bokashi Application Time on the Growth and Yield of Sweet Corn (Zea mays L. saccharata Sturt), Super Sweet variety. Objectives of the research were to know the effect of Bokashi types and application time as well as their interactions on the growth and yield of sweet maize. The research lasted for about four months, started from February 2013 to May 2013, carried out in Dempar Village, Nyuatan Sub-District of West Kutai District, East Kalimantan Province. The research em...
Effect of salt stress on some sweet corn (Zea mays L. var. saccharata genotypes
Directory of Open Access Journals (Sweden)
Shtereva Lydia A.
2015-01-01
Full Text Available An experiment was carried out hydroponically under laboratory conditions to investigate the effect of salt stress on several physiological and biochemical parameters of three sweet corn (Zea mays L. var. saccharata genotypes: lines 6-13, C-6 (pollen source and their heterotic F1 hybrid “Zaharina”. The degree of salinity tolerance among these genotypes was evaluated at three different sodium chloride (NaCl concentrations: 0 mM, 100 mM, 125 mM and 150 mM. Seed germination, plant growth and biochemical stress determining parameters such as malondialdehyde (MDA, proline content and hydrogen peroxide (H2O2 levels were compared between seedlings of lines and hybrid. The obtained results indicated that both lines and hybrid have similar responses at different salinity levels for all examined traits. All the seedlings’ growth parameters, such as germination percentage, root length, shoot length, root and shoot fresh and dry weight, decreased with increasing salinity level. MDA, proline and H2O2 increased at different saline conditions in comparison to the control. Based on the results, of the three genotypes examined, the hybrid Zaharina, followed by line C-6, was more salt-sensitive than line 6-13 in salt stress condition.
Effect of irradiation on sweet corn preservation
International Nuclear Information System (INIS)
Fu Junjie
2002-01-01
60 Co γ-ray was used to irradiate newly-harvested sweet corn and the results showed that the effects of irradiation on soluble solids, sucrose, starch and total sugar were not significant. The viscosity of starch decreased with the increasing of irradiation dose. The preservation duration of irradiated sweet corn was 7 days longer than that of CK, and the sweet, smell, taste of sweet corn had no abnormal change
Directory of Open Access Journals (Sweden)
Lihua Xie
2017-12-01
Full Text Available Sweet corn kernels were used in this research to study the dynamics of vitamin E, by evaluatingthe expression levels of genes involved in vitamin E synthesis, the accumulation of vitamin E, and the antioxidant activity during the different stage of kernel development. Results showed that expression levels of ZmHPT and ZmTC genes increased, whereas ZmTMT gene dramatically decreased during kernel development. The contents of all the types of vitamin E in sweet corn had a significant upward increase during kernel development, and reached the highest level at 30 days after pollination (DAP. Amongst the eight isomers of vitamin E, the content of γ-tocotrienol was the highest, and increased by 14.9 folds, followed by α-tocopherolwith an increase of 22 folds, and thecontents of isomers γ-tocopherol, α-tocotrienol, δ-tocopherol,δ-tocotrienol, and β-tocopherol were also followed during kernel development. The antioxidant activity of sweet corn during kernel development was increased, and was up to 101.8 ± 22.3 μmol of α-tocopherol equivlent/100 g in fresh weight (FW at 30 DAP. There was a positive correlation between vitamin E contents and antioxidant activity in sweet corn during the kernel development, and a negative correlation between the expressions of ZmTMT gene and vitamin E contents. These results revealed the relations amongst the content of vitamin E isomers and the gene expression, vitamin E accumulation, and antioxidant activity. The study can provide a harvesting strategy for vitamin E bio-fortification in sweet corn.
Xie, Lihua; Yu, Yongtao; Mao, Jihua; Liu, Haiying; Hu, Jian Guang; Li, Tong; Guo, Xinbo; Liu, Rui Hai
2017-12-20
Sweet corn kernels were used in this research to study the dynamics of vitamin E, by evaluatingthe expression levels of genes involved in vitamin E synthesis, the accumulation of vitamin E, and the antioxidant activity during the different stage of kernel development. Results showed that expression levels of Zm HPT and Zm TC genes increased, whereas Zm TMT gene dramatically decreased during kernel development. The contents of all the types of vitamin E in sweet corn had a significant upward increase during kernel development, and reached the highest level at 30 days after pollination (DAP). Amongst the eight isomers of vitamin E, the content of γ-tocotrienol was the highest, and increased by 14.9 folds, followed by α-tocopherolwith an increase of 22 folds, and thecontents of isomers γ-tocopherol, α-tocotrienol, δ-tocopherol,δ-tocotrienol, and β-tocopherol were also followed during kernel development. The antioxidant activity of sweet corn during kernel development was increased, and was up to 101.8 ± 22.3 μmol of α-tocopherol equivlent/100 g in fresh weight (FW) at 30 DAP. There was a positive correlation between vitamin E contents and antioxidant activity in sweet corn during the kernel development, and a negative correlation between the expressions of Zm TMT gene and vitamin E contents. These results revealed the relations amongst the content of vitamin E isomers and the gene expression, vitamin E accumulation, and antioxidant activity. The study can provide a harvesting strategy for vitamin E bio-fortification in sweet corn.
Wu, M. T.; Singh, B.; Salunkhe, D. K.
1971-01-01
Foliar applications of 2 milligrams per liter of 2-chloro-4,6-bis (ethylamino)-s-triazine, 2-methylmercapto-4-ethylamino-6-isobutylamino-s-triazine, and 2-methoxy-4-isopropylamino-6-butylamino-s-triazine caused increases in the activities of starch phosphorylase, pyruvate kinase, cytochrome oxidase, and glutamate dehydrogenase 5, 10, and 15 days after treatment in the leaves of 3-week-old seedlings of pea (Pisum sativum L.) and sweet corn (Zea mays L.). The results indicate that sublethal concentrations of s-triazine compounds affect the physiological and biochemical events in plants which favor more utilization of carbohydrates for nitrate reduction and synthesis of amino acids and proteins. PMID:16657830
Mucuna pruriens and its effect on the productivity of sweet corn (Zea mays L.
Directory of Open Access Journals (Sweden)
Oscar Eduardo Sanclemente Reyes
2013-10-01
Full Text Available The nitrogen contribution to the soil Typic Haplustalfs through the species Mucuna pruriens as a green manure and cover crop, and its effects on sweet corn yield were evaluated. There was a max fixation in the soil of 201 kg ha-1 which contrasted with the control. The treatment using the green manure and compost 2.5 t ha-1 and chemical fertilizer 125 kg ha-1 obtained the highest yield of dry corn grain 7 t ha-1 which is considered very high for this agro ecological zone. The use of compost and fertilizer synthesis as a cover had no significant effect on the corn yield, possibly due to its dynamic losses.
International Nuclear Information System (INIS)
Amin, M.; Razzaq, A.; Ullah, R.
2006-01-01
A field experiment was conducted to evaluate the effect of planting methods, seed density and nitrogen phosphorus (NP) fertilizer levels on emergence m/sup -2/ growth and grain yield of sweet corn. The fertilizer and interaction of fertilizer x seed density had significant negative effect with increasing level while seed density had a positive effect with increased density on emergence per m/sup 2/. Increased seed density significantly reduced plant growth which increased with application of higher fertilizer dose. The grain yield was improves by ridge planting methods, increased seed density and increased fertilizer levels. The highest grain yield (3,553.50 kg ha/sup-1/) of sweet corn plants was recorded in ridge planting method with highest NP fertilizer level of 300:150 kg ha/sup 1/ and 4 seeds hill/sup -1/. The lowest grain yield (3,493.75 kg ha/sup -1/) of sweet corn was observed in flat sowing planting method with 120:75 NP level and 2 seeds hill/sup -1/ seed density. The ridge planting rank first then furrow and flat planting methods on basis of grain yield per hectare. The sweet corn plant yield was high with 4 seeds hill/sup -1/ compared with 2 seeds hill/sup -1/. (author)
Selection indices for yield and quality traits in sweet corn
International Nuclear Information System (INIS)
Asghar, M.J.; Mehdi, S.S.
2010-01-01
The efficiency of three selection indices, viz., Smith-Hazel index (SHI), Desired gain index (DGI) and Base Index (BI) was compared for the improvement of an open pollinated sweet corn (Zea mays L. Saccharata) population. The data of genetic studies on various yield and quality traits among S1 families were used to construct these selection indices. Smith-Hazel index was found to be the most efficient in improving the aggregate genotype of yield traits for most of the selection strategies. Base index proved to be more efficient as compared to Smith-Hazel index in the improvement of aggregate genotype for five out of six selection strategies of quality traits. Both smith-hazel and Base indices were found useful for the improvement of sweetness and sweet flavour for all the selection strategies. When selection was confined to eight yield and four quality traits simultaneously, Base index proved to be more efficient as compared to Smith-Hazel index and desired gain index in improving the aggregate genotype for almost all the selection strategies. (author)
Impact of applying edible oils to silk channels on ear pests of sweet corn.
Ni, Xinzhi; Sparks, Alton N; Riley, David G; Li, Xianchun
2011-06-01
The impact of applying edible oils to corn silks on ear-feeding insects in sweet corn, Zea mays L., production was evaluated in 2006 and 2007. Six edible oils used in this experiment were canola, corn, olive, peanut, sesame, and soybean. Water and two commercial insecticidal oils (Neemix neem oil and nC21 Sunspray Ultrafine, a horticultural mineral oil) were used as the controls for the experiment. Six parameters evaluated in this experiment were corn earworm [Helicoverpa zea (Boddie) (Lepidoptera: Noctuidae)] damage rating, the number of sap beetle [Carpophilus spp. (Coleoptera: Nitidulidae)] adults and larvae, the number of corn silk fly (or picture-winged fly) (Diptera: Ulidiidae) larvae, common smut [Ustilago maydis (D.C.) Corda] infection rate, and corn husk coverage. Among the two control treatments, neem oil reduced corn earworm damage at both pre- and postpollination applications in 2006, but not in 2007, whereas the mineral oil applied at postpollination treatments reduced corn earworm damage in both years. The mineral oil also reduced the number of sap beetle adults, whereas the neem oil applied at postpollination attracted the most sap beetle adults in 2007. Among the six edible oil treatments, the corn and sesame oils applied at postpollination reduced corn earworm damage only in 2007. The application of the peanut oil at postpollination attracted more sap beetle adults in 2006, and more sap beetle larvae in 2007. Olive and neem oils significantly reduced husk coverage compared with the water control in both years. The mineral oil application consistently increased smut infection rate in both 2006 and 2007. Ramifications of using oil treatments in ear pest management also are discussed.
7 CFR 457.129 - Fresh market sweet corn crop insurance provisions.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Fresh market sweet corn crop insurance provisions. 457... sweet corn crop insurance provisions. The fresh market sweet corn crop insurance provisions for the 2008... Reinsured Policies Fresh Market Sweet Corn Crop Provisions 1. Definitions Allowable cost.—The dollar amount...
Xiang, Nan; Guo, Xinbo; Liu, Fengyuan; Li, Quan; Hu, Jianguang; Brennan, Charles Stephen
2017-06-10
Sweet corn is one of the most widely planted crops in China. Sprouting of grains is a new processes to increase the nutritional value of grain products. The present study explores the effects of light on the nutritional quality of sweet corn sprouts. Gene expression of phenolic biosynthesis, phytochemical profiles and antioxidant activity were studied. Two treatments (light and dark) were selected and the morphological structure of sweet corn sprouts, as well as their biochemical composition were investigated to determine the effects of light on the regulation of genes responsible for nutritional compounds. Transcription analyses for three key-encoding genes in the biosynthesis of the precursors of phenolic were studied. Results revealed a negative regulation in the expression of Zm PAL with total phenolic content (TPC) in the light group. TPC and total flavonoid content (TFC) increased during germination and this was correlated with an increase in antioxidant activity ( r = 0.95 and 1.0). The findings illustrate that the nutritional value of sweet corn for the consumer can be improved through germination to the euphylla stage.
Directory of Open Access Journals (Sweden)
MarÃa Cecilia Curis
2015-12-01
Full Text Available The "corn silk fly" of maize (Euxesta spp. Loew, 1868 appeared in 2005 in Santa Fe (Argentina, causing damage to the ears. The attacks are related to temperature, crop growth stage and previous attack of other pests. For this new pest, we determined the species present, the damage on Bt sweet corn plantings in two seasons (August and February, the association of attacks with Heliothis zea (Boddie, 1850 and the presence of parasitoids. Larvae counts of H. zea and Euxesta spp. began in the phenological stage of R2 and ended in R5 and consisted of removing at random from each batch (three for each planting season four ears. In laboratory we determined the percentage of damage on the ears and number of larvae of Euxesta spp. and H. zea, discriminated by size. Fly was identified as E. eluta, damage was greatest in the early spring planting corn. Attacks were correlated with H. zea.
Directory of Open Access Journals (Sweden)
A. Rahmani
2016-04-01
Full Text Available In order to evaluate the effect of sowing date and plant density on the morphological triats, yield and yield components of sweet corn (Zea mays L. var SC. 403 an experiment was conducted at the Khorasan Razavi Agricultural Research and Natural Resources Center, Mashhad, Iran during 2008. This experiment was carried out as split plot based on RCBD with four replications. The sowing date (14th June, 3th July and 24th July and plant densities (66600, 83300 and 111000 plants.ha-1 were arranged in main and sub plots, respectively. The results showed significant differences between different sowing dates for plant height, ear height, and no. of leaves/plant, no. of leaves above ear, stem diameter, dehusked ear yield, can grains yield, no. of grain rows/ear, ear length, ear diameter, kernel depth, no. of ear.plant-1, 1000 kernel weight, ear harvest index and plant harvest index. The highest and the lowest can grains yield with 18.27 and 0.930 ton ha-1 was belonged to 14th June and 24th July sowing date, respectively. Although, delay in sowing date, led to decrease of growth period and also decrease of temperature can lead to improper transfer of photosynthetic materials and cause to grains yield decrease. The plant density had significant effects on husked ear yield, dehusked ear yield and forage yield. The highest can grains yield was harvested from the highest plant density (8.862 t.ha-1 and the lowest can grains yield derived from the lowest plant density (66600 plants.ha-1 with 7.692 t.ha-1. Finally, the interaction of sowing date and plant density was significant only for harvest index. Therefore, the sowing date 14th June and the highest plant density (111000 plants.ha-1, is recommended for summer sowing date of sweet corn in Mashhad with maximum and better can grains production.
Characteristics and functional properties of purple corn (Zea mays L. var. subnigroviolaceo
Directory of Open Access Journals (Sweden)
Jhoseline Guillén-Sánchez
2014-09-01
Full Text Available Zea Mays L. variety purple (purple corn is a plant native of America, which has the episperm seeds (grains and the cobs (cob in purple, which gives special characteristics to the pigments that have (between 1.5% and 6.0%, called anthocyanins, which belong to the group of flavonoids. Due to its high content of anthocyanins (cianin C3G-3-glucose as its main color and phenolic compounds act as powerful natural antioxidant and anticancer, Further having functional properties due to these bioactive compounds. The purple corn also provides significant amounts of starch, about 80% (complex carbohydrate, 10% of sugars provide sweetness, up to 11% protein, up to 2% minerals and B vitamins and ascorbic acid, concentrated in endosperm (grain free envelope. Also the nutritional value, the purple corn has a rich composition of phytochemicals, which have beneficial effects on our body, such as neutralize free radicals and act as antimutagenic. His review paper aimed to collect information on the studies undertaken to purple corn as an alternative to artificial food dyes and health benefits when included in the diet. Benefits such as cardiovascular diseases (hypertension, lowering cholesterol, fighting diabetes, being the most remarkable antioxidant action (wrinkle.
Directory of Open Access Journals (Sweden)
Adrienne C. Shelton
2015-04-01
Full Text Available Organic growers face unique challenges when raising sweet corn, and benefit from varieties that maintain high eating quality, germinate consistently, deter insect pests, and resist diseases. Genotype by environment rank changes can occur in the performance of cultivars grown on conventional and organic farms, yet few varieties have been bred specifically for organic systems. The objective of this experiment was to evaluate the changes made to open-pollinated sweet corn populations using recurrent selection and a participatory plant breeding (PPB methodology. From 2008 to 2011, four cycles of two open-pollinated (OP sweet corn populations were selected on a certified organic farm in Minnesota using a modified ear-to-row recurrent selection scheme. Selections were made in collaboration with an organic farmer, with selection criteria based on traits identified by the farmer. In 2012 and 2013, the population cycles were evaluated in a randomized complete block design in two certified organic locations in Wisconsin, with multiple replications in each environment. Significant linear trends were found among cycles of selection for quantitative and qualitative traits, suggesting the changes were due to recurrent selection and PPB methodology for these populations. However, further improvement is necessary to satisfy the requirements for a useful cultivar for organic growers.
Complementation of sweet corn mutants: a method for grouping ...
Indian Academy of Sciences (India)
for sweet corn are now expanding and the demands are increasing due to ... tropical/tropical regions of India is amongst one of the factors ... Maize endosperm mutant genes that affect quality of sweet corn can ... Thus, the concept of comple-.
Directory of Open Access Journals (Sweden)
Ruly Eko Kusuma Kurniawan
2017-06-01
Full Text Available Research to determine of formulation humic subtance and Trichoderma sp to increase the production and growth of corn (zea mays,L. This research was conducted by extracting humic substance with fractionation organic matter method from cattle manure organic material. Trichoderma sp grow on corn medium and harvested after reaching a density of 1015 cfu. Created this compound formulation with mixing humic substance and Trichoderma sp. Indicator plant with F1 sweet corn Jago varieties. Aplication used humic substance in range 8%, 16%, and 32% on the recommended use NPK fertilizer for corn, as well as control without humic substance. The result showed application use 8% humic substance most good for plant growth and harvest. Additionally, nutrient uptake NPK fertilizer efficiency is increased and more effective than control and use of the formulation 16% and 32% humic substance.
Directory of Open Access Journals (Sweden)
Luana PĂCURAR
2017-11-01
Full Text Available Sweet corn (Zea mays L. belongs to the Gramineae family, var. rugosa (Bonof convar. Saccharate (Sturt. and can be distinguished from normal corn by presence of one or more mutant genes that affect carbohydrate metabolism in endosperm. Purpose of this research is to compare behavior of sweet corn hybrids created at SCDA Turda, but also foreign hybrids, in terms of quality elements and chemical composition, in conditions of Transylvania plateau, in two localities: Turda and Viişoara. As biological material following domestic sweet corn hybrids were chosen: ‘Prima’, ‘Estival’, ‘Deliciul verii’, ‘Dulcin’, ‘Delicios’, ‘Estival M’ and foreign hybrid ‘Jubilee’. These hybrids were also analyzed in terms of chemical composition. Weight of ‘Estival’ hybrid has the best behavior in both localities; as regards to cobs length, ‘Delicios’ hybrid has registered increases very significant positive, differences between plant height in the two localities confirm significant influence of environment on formation of this important typical qualitative characteristics, highest performances in terms of β-cryptoxanthin and zeaxanthin content, are recorded by ‘Jubilee’ in both localities, ‘Deliciul Verii’ hybrid records significant value for lutein content, also recording an important addition of carbohydrates in Turda, ‘Prima’ and ‘Estival’ hybrids recorded highest values of sucrose in both localities.
SWEET CORN FARMING: THE EFFECT OF PRODUCTION FACTOR, EFFICIENCY AND RETURN TO SCALE
Directory of Open Access Journals (Sweden)
Dwijatenaya I.B.M.A.
2017-10-01
Full Text Available This research aims to determine the effect of production factors on the sweet corn production, the efficiency of sweet corn farming, and the return to scale of sweet corn production. The sampling technique was taken by proportionate stratified random sampling method with the sample number of 57 people while the analyzer used was the program of Frointer 4.1c. The results show that the production factors of the land farm, seed, and fertilizer have a positive and significant effect on sweet corn production. On the other hand, labor production factors have a positive but not significant effect on sweet corn production. It also found that technical efficiency, price efficiency, and economic efficiency of sweet corn farming in Muara Wis Sub-district of Kutai Kartanegara Regency are not efficient yet. The return to scale of sweet corn yield has an increasing return to scale condition.
Lazcano, Cristina; Revilla, Pedro; Malvar, Rosa Ana; Domínguez, Jorge
2011-05-01
Vermicompost has been proposed as a valuable fertilizer for sustainable agriculture. The effects of vermicompost on yield and quality of sweet corn were evaluated in this study. In two field trials, sweet corn plants were grown under (i) a conventional fertilization regime with inorganic fertilizer, and integrated fertilization regimes in which 75% of the nutrients were supplied by the inorganic fertilizer and 25% of the nutrients were supplied by either (ii) rabbit manure, or (iii) vermicompost. All three types of fertilization regime were supplied at two doses. Two pairs of nearly isogenic sweet corn hybrids homozygous for sugary1 and shrunken2 mutants were included in the trials to explore fertilizer × genotype interactions. Growth, yield and ear quality of the plants were evaluated in relation to the three fertilization regimes. In general, the integrated regimes yielded the same productivity levels as the conventional treatment. Moreover, both vermicompost and manure produced significant increases in plant growth and marketable yield, and also affected the chemical composition and quality of the marketable ear. Nevertheless, most of the observed effects of the organic fertilizers were genotype-dependent. The results confirm that the use of organic fertilizers such as vermicompost has a positive effect on crop yield and quality. Nevertheless, these effects were not general, indicating the complexity of the organic amendment-plant interactions and the importance of controlling genetic variation when studying the effects of vermicompost on plant growth. Copyright © 2011 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Robert Rosa
2015-02-01
Full Text Available An experiment was carried out in east-central Poland (52°06’ N, 22°55’ E over 2008–2011 to study the effect of winter catch crops on the weed infestation, number, and fresh matter of weeds in sweet corn (Zea mays L. var. saccharata. The following winter catch crops were grown: hairy vetch (Vicia villosa Roth., white clover (Trifolium repens L., winter rye (Secale cereale L., Italian ryegrass (Lolium multiflorum L. and winter turnip rape (Brassica rapa var. typica Posp.. The catch crops were sown in early September and incorporated in early May. The effect of the catch crops was compared to the effect of FYM (30 t·ha-1 and control without organic manuring (NOM. Three methods of weed control were used: HW – hand weeding, twice during the growing period, GCM – the herbicide Guardian Complete Mix 664 SE, immediately after sowing of corn seeds, Z+T – a mixture of the herbicides Zeagran 340 SE and Titus 25 WG applied at the 3–4-leaf stage of sweet corn growth. Rye and turnip rape catch crops had least weeds in their fresh matter. Sweet corn following winter catch crops was less infested by weeds than corn following farmyard manure and non-manured corn. Least weeds and their lowest weight were found after SC, BRT and VV. LM and BRT reduced weed species numbers compared with FYM and NOM. The greatest weed species diversity, determined at the corn flowering stage, was determined after SC and FYM. The number and weight of weeds were significantly lower when chemically controlled compared with hand weeding. The best results were observed after a post-emergent application of the mixture Z+T. The weed species diversity on Z+T-treated plots was clearly lower compared with GCM and HW.
Ibrahim, Khalid E; Juvik, John A
2009-06-10
Among vegetables, sweet corn ( Zea mays L.) and broccoli ( Brassica oleracea L. ssp. italica) are important sources of dietary carotenoids and tocopherols. Because medical evidence suggests that carotenoid and tocopherol health-promoting activity acts in a dose-dependent manner, conventional breeding to develop elite sweet corn and broccoli germplasm with enhanced levels of these phytochemicals will potentially promote health among the consuming public. This investigation includes the quantitative analysis of carotenoid and tocopherol contents of 41 corn and 24 broccoli genotypes grown in multiple environments (years and seasons in one location) to partition the variation into genetic, environment, and genotype by environment interaction (GxE) components and measure the phenotypic stability of genotypes for these phytochemicals. The primary carotenoids and tocopherols in corn were lutein and gamma-tocopherol (65 and 73% of total carotenoid and tocopherol, respectively), whereas beta-carotene and alpha-tocopherol were dominant in broccoli (65 and 79% of total carotenoid and tocopherol, respectively). Partitioning of the variance indicated that genetic differences among the genotypes averaged for the primary compounds in corn (lutein, zeaxanthin, and alpha- and gamma-tocopherol) and broccoli (beta-carotene, lutein, and alpha- and gamma-tocopherol) accounted for the largest proportion of the variation (67 and 55% of total phenotypic variation averaged across the phytochemicals in sweet corn and broccoli, respectively). Stability analysis identified several corn (IL451b sh2 and IL2027-8 sh2) and broccoli ('Pirate' and 'Baccus') genotypes with relatively high mean concentrations for the various carotenoids and tocopherols that were comparatively stable across seasons and years. The results of this investigation suggest that sweet corn and broccoli germplasm with enhanced concentrations of carotenoids and tocopherols can be developed using conventional breeding protocols.
7 CFR 319.56-43 - Baby corn and baby carrots from Zambia.
2010-01-01
... § 319.56-43 Baby corn and baby carrots from Zambia. (a) Immature, dehusked “baby” sweet corn (Zea mays L... consignments only. (b) Immature “baby” carrots (Daucus carota L. ssp. sativus) for consumption measuring 10 to...
7 CFR 457.154 - Processing sweet corn crop insurance provisions.
2010-01-01
... policies: Processing Sweet Corn Crop Provisions If a conflict exists among the policy provisions, the order.... Processor. Any business enterprise regularly engaged in canning or freezing processing sweet corn for human... disease control measures or as otherwise limited by the Special Provisions; (5) Wildlife; (6) Earthquake...
[Super sweet corn hybrids adaptability for industrial processing. I freezing].
Alfonzo, Braunnier; Camacho, Candelario; Ortiz de Bertorelli, Ligia; De Venanzi, Frank
2002-09-01
With the purpose of evaluating adaptability to the freezing process of super sweet corn sh2 hybrids Krispy King, Victor and 324, 100 cobs of each type were frozen at -18 degrees C. After 120 days of storage, their chemical, microbiological and sensorial characteristics were compared with a sweet corn su. Industrial quality of the process of freezing and length and number of rows in cobs were also determined. Results revealed yields above 60% in frozen corns. Length and number of rows in cobs were acceptable. Most of the chemical characteristics of super sweet hybrids were not different from the sweet corn assayed at the 5% significance level. Moisture content and soluble solids of hybrid Victor, as well as total sugars of hybrid 324 were statistically different. All sh2 corns had higher pH values. During freezing, soluble solids concentration, sugars and acids decreased whereas pH increased. Frozen cobs exhibited acceptable microbiological rank, with low activities of mesophiles and total coliforms, absence of psychrophiles and fecal coliforms, and an appreciable amount of molds. In conclusion, sh2 hybrids adapted with no problems to the freezing process, they had lower contents of soluble solids and higher contents of total sugars, which almost doubled the amount of su corn; flavor, texture, sweetness and appearance of kernels were also better. Hybrid Victor was preferred by the evaluating panel and had an outstanding performance due to its yield and sensorial characteristics.
Directory of Open Access Journals (Sweden)
A. Rahmani
2014-12-01
Full Text Available Considering importance of baby corn, the study was consisted of sowing date (14th June, 3th July and 24th July as main Plots and plant densities (6.5, 8.5 and 10.5. plant m-2 as sub Plots and two harvest methods (baby corn, as first harvest sweet corn and next ear as baby corn on Growth parameter and yield of baby corn (Zea mays L. Var SC403su in agricultural Research Center and Natural Resources of Khorasan Razavi Province, Mashhad on 2009. The experiment was carried out in a factorial split plot design based on randomized completely block design with 4 replications. The results showed the highest plant height on sowing date 3thJuly with average 168.6 cm. Also the highest standard ear percentage that one of the important factors for food manufactory had on sowing date 24th July with plant density 10.5 plants plant m-2, by harvesting method baby corn with 63.9 percentages. Also The results showed the highest substandard ear percentage of baby corn was belonged to sowing date 24th July with 8.5 plant m-2, by harvesting method (baby corn sweet corn with 74.6%. The highest harvest ear index was belonged to sowing date14thJune, by harvesting method (baby corn sweet corn with 35.29 percentages. Therefore, sowing date 3thJuly for forage production with average 4 kg m-2 by harvesting method baby corn are recommended for lateral produce production. Considering to Mashhad weather conditions, producing the highest and best standard ear percentage, density, 10.5 plants per square meter and 24th July planting is recommended.
Effects of Plant Density on Sweet and Baby Corn (Hybrid KSC 403 Yield and Yield Components
Directory of Open Access Journals (Sweden)
H Bavi
2016-07-01
Full Text Available Introduction Sweet corn is the one of the most important types of corn. There is a high amount of sugar in the endosperm of sweet corn than dent corn. Baby corn is the ear of corn that is being harvested in the silking stage before the end of pollination. This crop has an interesting using methods as salad, conserve production and vegetative consumption. Both two sweet and baby corn is obtained from one plant in different growth stages and could be harvested from one corn hybrid. Best yield and quality of baby corn is obtained from sweet corn hybrids, because of high amounts of sugar in the grains and ears. Sweet corn and baby corn could be harvested at early dough stage (with about 30 % of humidity and early silking stage before the pollination is completed, respectively. Plant density is the most important factor in growing corn, especially in sweet and baby corn. Khuzestan province is one of the main regions of corn production in Iran. In Khuzestan, forage and silage corn have the most production among the summer crops. Corn is planted in two planting date in Khuzestan: early spring and early summer. Spring corn planting produces little grain yield due to Simultaneity of silking stage with hot early summer days. Because of little production and little research about sweet and baby corn, this study was performed and designed. Materials and Methods In order to investigate the effects of plant density and harvesting method on sweet corn and baby corn yield, an experiment was performed during 2012-13, in research farm of Ramin Agriculture and Natural Resources University of Khuzestan, located in southwest of Iran. In this experiment, four plant densities (7, 9, 11 and 13 plants.m-2 and two harvesting methods (baby corn and sweet corn were investigated in an RCB statistical design with four replications. The KSC 403 hybrid was used and investigated in the experiment, as a sweet corn hybrid. Statistical analysis was performed using SAS 9.1 through
Directory of Open Access Journals (Sweden)
H. Naraki,
2012-08-01
Full Text Available In order to evaluate the performance of spring sweet corn (Zea mays var saccharata at different planting dates under plastic cover, a split plot experiment based on RCBD with three replications was conducted in Gachsaran, in southwest of Iran, during 2009-2010 growing season. Four sweet corn hybrids (Merit, Challenger, Chase and Basin were used as main factor and five sowing date (15th and 25th Jan, 4th, 14th and 24th Feb as sub factor. The results showed that hybrid effect was significant on the days to tassel and ear emergence, days to harvest, ear harvest index, ear length, number of row per each ear, wet biological yield and 1000 grains weight, at 1%, and ear wet yield and grain yield harvest index at 5% probability levels. Also the effect of sowing date was significant on the days to tassel and ear emergence, days to harvest, ear wet yield, ear harvest index, ear diameter, ear length, biological yield, and 1000 grains weight at the 1% probability level. 'Basin' and 'Chase' hybrids were determined to have highest and lowest ear wet yield (17.09 and 15.13 t.ha-1 respectively. The highest and the lowest wet ear yield (16.81 and 15.06 t.ha-1 belonged to 15th Jan. and 24th Feb. respectively. 'Basin' hybrid and 'Challenger' with 8.39 and 7.59 t.ha-1 grain yield were found to be highest and lowest yields. The highest and the lowest grain yield (8.41 t.ha-1 7.45 t.ha-1 were recorded for 15th Jan. and 24th Feb. respectively.' Merit' and 'Chase' hybrids were determined to have longest and shortest days to ear harvest (94.3 and 86.2 days. Longest and shortest days to ear harvest (101.5 and 82 days were recorded in 4th Jan. and 24th Feb. Sowing date and hybrids interaction effects showed that the longest and shortest days to ear harvest (104.7 and 78.3 days were calculated in 4th Jan. of Merit and in 24th Feb. for Chase. Based on these results, it can be concluded that 'Basin' hybrid Feb. 24 is the most suitable cultivar to be produced in Gachsaran.
Preventive Effect of Zea mays L. (Purple Waxy Corn) on Experimental Diabetic Cataract
Thiraphatthanavong, Paphaphat; Wattanathorn, Jintanaporn; Muchimapura, Supaporn; Thukham-mee, Wipawee; Wannanon, Panakaporn; Tong-un, Terdthai; Suriharn, Bhalang; Lertrat, Kamol
2014-01-01
Recently, substances possessing antioxidant can prevent cataractogenesis of diabetic cataract. Therefore, this study was carried out to determine the anticataract effect of Zea mays L. (purple waxy corn), a flavonoids rich plant, in experimental diabetic cataract. Enucleated rat lenses were incubated in artificial aqueous humor containing 55 mM glucose with various concentrations of Zea mays L. (purple waxy corn) ranging between 2, 10, and 50 mg/mL at room temperature for 72 h. At the end of ...
Directory of Open Access Journals (Sweden)
ali mojab ghasroddashti
2017-09-01
Full Text Available Introduction Sweet corn (Zea mays L. saccharata is one of the tropical cereals of graminae which is cultivated in order to use for ear. Nitrogen is one of the most important nutrients and key factors to achieve desirable yield. Fertilizers play a major role in crop productivity. However, nowadays, excessive use of fertilizers have been found to have a negative impact on yield and environment. Introducing new management methods based on nitrogen and water use efficiency showed some improvements in the quality and quantity of crop production in association with the health of the community. In fact, soil organic matter content should be maintained in the appropriate level to improve fertility. Using municipal solid waste compost and poultry manure are appropriate solutions. They can increase soil organic matter, modify physicochemical properties and improve crop production. Moreover, they are able to solve problems caused by the accumulation of municipal solid waste compost and poultry manure. Material and Methods In order to investigate the impact of different sources of nitrogen on yield and yield components of sweet corn, a field experiment was conducted as a randomized complete block design with three replications in Marvdasht in 2013. Treatments included different resources of fertilizer: 200 kg.ha-1 net nitrogen (T1, 300 kg.ha-1 net nitrogen (T2, 8 ton.ha-1 poultry manure (T3, 24 ton.ha-1 municipal solid waste compost (T4, 150 kg net nitrogen + 2 ton municipal solid waste compost (T5, 100 kg net nitrogen + 4 ton poultry manure (T6, 150 kg net nitrogen + 6 ton municipal solid waste compost (T7, 100 kg.ha-1 net nitrogen + 12 ton municipal solid waste compost (T8 and fertilizer free (control (T9. At the time of crop maturity, two square meters from middle of each plot were harvested to measure yield and yield components. Statistical analysis was performed using the SAS statistical software. Least significant difference (LSD test at the five
Horner, T A; Dively, G P; Herbert, D A
2003-06-01
Helicoverpa zea (Boddie) development, survival, and feeding injury in MON810 transgenic ears of field corn (Zea mays L.) expressing Bacillus thuringiensis variety kurstaki (Bt) Cry1Ab endotoxins were compared with non-Bt ears at four geographic locations over two growing seasons. Expression of Cry1Ab endotoxin resulted in overall reductions in the percentage of damaged ears by 33% and in the amount of kernels consumed by 60%. Bt-induced effects varied significantly among locations, partly because of the overall level and timing of H. zea infestations, condition of silk tissue at the time of egg hatch, and the possible effects of plant stress. Larvae feeding on Bt ears produced scattered, discontinuous patches of partially consumed kernels, which were arranged more linearly than the compact feeding patterns in non-Bt ears. The feeding patterns suggest that larvae in Bt ears are moving about sampling kernels more frequently than larvae in non-Bt ears. Because not all kernels express the same level of endotoxin, the spatial heterogeneity of toxin distribution within Bt ears may provide an opportunity for development of behavioral responses in H. zea to avoid toxin. MON810 corn suppressed the establishment and development of H. zea to late instars by at least 75%. This level of control is considered a moderate dose, which may increase the risk of resistance development in areas where MON810 corn is widely adopted and H. zea overwinters successfully. Sublethal effects of MON810 corn resulted in prolonged larval and prepupal development, smaller pupae, and reduced fecundity of H. zea. The moderate dose effects and the spatial heterogeneity of toxin distribution among kernels could increase the additive genetic variance for both physiological and behavioral resistance in H. zea populations. Implications of localized population suppression are discussed.
Elevated carbon dioxide reduces emission of herbivore induced volatiles in Zea mays
Terpene volatiles produced by sweet corn (Zea mays) upon infestation with pests such as beet armyworm (Spodoptera exigua) function as part of an indirect defense mechanism by attracting parasitoid wasps; yet little is known about the impact of atmospheric changes on this form of plant defense. To in...
77 FR 27658 - Common Crop Insurance Regulations; Processing Sweet Corn Crop Insurance Provisions
2012-05-11
... farming operation. For instance, all producers are required to submit an application and acreage report to... price data from third party sources (e.g., Agricultural Marketing Service) for sweet corn grown under..., it was found that the base contract price more accurately reflects the value of processing sweet corn...
Water deficit stress effects on corn (Zea mays, L.) root: shoot ratio
A study was conducted at Akron, CO, USA, on a Weld silt loam in 2004 to quantify the effects of water deficit stress on corn (Zea mays, L.) root and shoot biomass. Corn plants were grown under a range of soil bulk density and water conditions caused by previous tillage, crop rotation, and irrigation...
Sparks, A N; Gadal, L; Ni, X
2015-08-01
The primary Lepidoptera pests of sweet corn (Zea mays L. convar. saccharata) in Georgia are the corn earworm, Helicoverpa zea (Boddie), and the fall armyworm, Spodoptera frugiperda (J. E. Smith). Management of these pests typically requires multiple insecticide applications from first silking until harvest, with commercial growers frequently spraying daily. This level of insecticide use presents problems for small growers, particularly for "pick-your-own" operations. Injection of oil into the corn ear silk channel 5-8 days after silking initiation has been used to suppress damage by these insects. Initial work with this technique in Georgia provided poor results. Subsequently, a series of experiments was conducted to evaluate the efficacy of silk channel injections as an application methodology for insecticides. A single application of synthetic insecticide, at greatly reduced per acre rates compared with common foliar applications, provided excellent control of Lepidoptera insects attacking the ear tip and suppressed damage by sap beetles (Nitidulidae). While this methodology is labor-intensive, it requires a single application of insecticide at reduced rates applied ∼2 wk prior to harvest, compared with potential daily applications at full rates up to the day of harvest with foliar insecticide applications. This methodology is not likely to eliminate the need for foliar applications because of other insect pests which do not enter through the silk channel or are not affected by the specific selective insecticide used in the silk channel injection, but would greatly reduce the number of applications required. This methodology may prove particularly useful for small acreage growers. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
A morel improved growth and suppressed Fusarium infection in sweet corn.
Yu, Dan; Bu, Fangfang; Hou, Jiaojiao; Kang, Yongxiang; Yu, Zhongdong
2016-12-01
A post-fire morel collected from Populus simonii stands in Mt. Qingling was identified as Morchella crassipes Mes-20 by using nuclear ribosomal DNA internal transcribed spacer phylogeny. It was inoculated into sweet corn to observe colonized roots in purified culture and in greenhouse experiments. The elongation and maturation zones of sweet corn were remarkably colonized at the cortex intercellular and intracellular cells, vessel cells, and around the Casparian strip, forming ectendomycorrhiza-like structures. Colonization was also observed in the zone of cell division proximal to the root cap. Greenhouse assays with sweet corn showed that this morel stimulated the development of the root system and significantly increased the dry root biomass. M. crassipes also significantly reduced the incidence of Fusarium verticillioides in the kernels of mature ears when inoculated into young ears before Fusarium inoculation and prevented Fusarium infection in corn ears compared with that of the control in the greenhouse. When grown under axenic conditions, M. crassipes produced the phytohormones abscisic acid, indole-3-acetic acid, and salicylic acid. The benefits to plants elicited by M. crassipes may result from these phytohormones which may improve the drought resistance, biomass growth and resistance to Fusarium.
Climate change, transgenic corn adoption and field-evolved resistance in corn earworm.
Venugopal, P Dilip; Dively, Galen P
2017-06-01
Increased temperature anomaly during the twenty-first century coincides with the proliferation of transgenic crops containing the bacterium Bacillus thuringiensis (Berliner) (Bt) to express insecticidal Cry proteins. Increasing temperatures profoundly affect insect life histories and agricultural pest management. However, the implications of climate change on Bt crop-pest interactions and insect resistance to Bt crops remains unexamined. We analysed the relationship of temperature anomaly and Bt adoption with field-evolved resistance to Cry1Ab Bt sweet corn in a major pest, Helicoverpa zea (Boddie). Increased Bt adoption during 1996-2016 suppressed H. zea populations, but increased temperature anomaly buffers population reduction. Temperature anomaly and its interaction with elevated selection pressure from high Bt acreage probably accelerated the Bt-resistance development. Helicoverpa zea damage to corn ears, kernel area consumed, mean instars and proportion of late instars in Bt varieties increased with Bt adoption and temperature anomaly, through additive or interactive effects. Risk of Bt-resistant H. zea spreading is high given extensive Bt adoption, and the expected increase in overwintering and migration. Our study highlights the challenges posed by climate change for Bt biotechnology-based agricultural pest management, and the need to incorporate evolutionary processes affected by climate change into Bt-resistance management programmes.
ECOLOGICAL FOOTPRINT ANALYSIS OF CANNED SWEET CORN
Directory of Open Access Journals (Sweden)
Phairat Usubharatana
2016-07-01
Full Text Available There has been a notable increase in both consumer knowledge and awareness regarding the ecological benefits of green products and services. Manufacturers now pay more attention to green, environmentally friendly production processes. Two significant tools that can facilitate such a goal are life cycle assessment (LCA and ecological footprint (EF. This study aimed to analyse and determine the damage to the environment, focusing on the canned fruit and vegetable processing. Canned sweet corn (340 g was selected for the case study. All inputs and outputs associated with the product system boundary were collected through field surveys. The acquired inventory was then analysed and evaluated using both LCA and EF methodology. The results were converted into an area of biologically productive land and presented as global hectares (gha. The ecological footprint of one can of sweet corn was calculated as 6.51E-04 gha. The three factors with the highest impact on ecological footprint value were the corn kernels used in the process, the packaging and steam, equivalent to 2.93E-04 gha, 1.19E-04 gha and 1.17E-04 gha respectively. To promote the sustainable development, the company should develop new technology or utilize better management techniques to reduce the ecological footprint of canned food production.
Genetic diversity assessed by microsatellite markers in sweet corn cultivars
Directory of Open Access Journals (Sweden)
Ana Daniela Lopes
2015-12-01
Full Text Available Information on genetic diversity is essential to the characterization and utilization of germplasm. The genetic diversity of twenty-two sweet corn cultivars (seventeen open-pollinated varieties, OPV, and five hybrids, H was investigated by applying simple sequence repeat markers. A total of 257 primers were tested, of which 160 were found to be usable in terms of high reproducibility for all the samples tested; 45 were polymorphic loci, of which 30 were used to assess the genetic diversity of sweet corn cultivars. We detected a total of 86 alleles using 30 microsatellite primers. The mean polymorphism was 82 %. The highest heterozygosity values (Ho = 0.20 were found in the PR030-Doce Flor da Serra and BR427 III OPVs, whereas the lowest values (0.14 were recorded in the MG161-Branco Doce and Doce Cubano OPVs. The polymorphism information content ranged from 0.19 (Umc2319 to 0.71 (Umc2205. The analysis of molecular variance revealed that most of the genetic variability was concentrated within the cultivars of sweet corn (75 %, with less variability between them (25 %. The consensus tree derived from the neighbor-joining (NJ algorithm using 1,000 bootstrapping replicates revealed seven genetically different groups. Nei’s diversity values varied between 0.103 (Doce do Hawai × CNPH-1 cultivars and 0.645 (Amarelo Doce × Lili cultivars, indicating a narrow genetic basis. The Lili hybrid was the most distant cultivar, as revealed by Principal Coordinates Analysis and the NJ tree. This study on genetic diversity will be useful for planning future studies on sweet corn genetic resources and can complement the breeding programs for this crop.
Effects of Methyl tert-butyl ether (MTBE) on the germination of seeds and growth of the plant were studied in some laboratory experiments. Test plants were wild oat (Avena sative), sweet corn (Zea mays), wheat (Triticum aestivum), and lettuce (Lactuca sativa). Seed germination,...
Directory of Open Access Journals (Sweden)
Lantian Ren
2015-06-01
Full Text Available This paper analyzes the rural Chinese biomass supply system and models supply chain operations according to U.S. concepts of logistical unit operations: harvest and collection, storage, transportation, preprocessing, and handling and queuing. In this paper, we quantify the logistics cost of corn stover and sweet sorghum in China under different scenarios. We analyze three scenarios of corn stover logistics from northeast China and three scenarios of sweet sorghum stalks logistics from Inner Mongolia in China. The case study estimates that the logistics cost of corn stover and sweet sorghum stalk to be $52.95/dry metric ton and $52.64/dry metric ton, respectively, for the current labor-based biomass logistics system. However, if the feedstock logistics operation is mechanized, the cost of corn stover and sweet sorghum stalk decreases to $36.01/dry metric ton and $35.76/dry metric ton, respectively. The study also includes a sensitivity analysis to identify the cost factors that cause logistics cost variation. Results of the sensitivity analysis show that labor price has the most influence on the logistics cost of corn stover and sweet sorghum stalk, with a variation of $6 to $12/dry metric ton.
Directory of Open Access Journals (Sweden)
Sh Ghazian Tafrishi
2013-08-01
Full Text Available A randomized complete block design with four replications and a split plot arrangement was conducted in 2010, in order to study the effect of limited irrigation on yield and yield component of sweet corn. Water levels were (100%, 80%, and 60% replacement of plant water requirement which served as main plots. Subplot was a factorial arrangement of three different sweet corn varieties (Merit, Obsession and KSC403 with two planting methods (raised bed and furrow planting. The evaluated traits were ear length, ear diameter, kernels number per row, seed rows per ear, kernel depth, seed thousands weight, kernel yield, shoot biomass, harvest index and Anthesis- silking interval. Results show that limited irrigation significantly decreased all measured characteristics but harvest index. Effect of varieties was significant on evaluated traits too. Kernel weight and seed depth were significantly affected by interaction between variety and planting method. The highest yield was found for 100% replacement of water requirement irrigation level whit 15.2 tones per hectare kernel weight and the lowest belongs to 60% replacement of water requirement by 8.6 tones per hectare kernel weight. Merit and KSC 403 produces the highest (15.9 ton/ha and lowest (8.8 ton/ha seed yield, respectively. Harvest index of different varieties were not affected by irrigation regime. Results show that, in whole, limited irrigation, decreased seed yield in all varieties by affecting diverse yield component.
Zhang, Hai-Yan
2013-06-01
Taking normal corn, waxy corn, pop corn, and sweet corn as test materials, this paper studied their seed germination and seedling growth under effects of simulated acid rain (pH 6.0, 5.0, 4.0, 3.0, 2.0, and 1.0). Simulated acid rain at pH 2.0-5.0 had no significant effects on the seed germination and seedling growth, but at pH 1.0, the germination rate of normal corn, waxy corn, pop corn, and sweet corn was 91.3%, 68.7%, 27.5%, and 11.7%, respectively. As compared with those at pH 6.0 (CK), the germination rate, germination index, vigor index, germination velocity, shoot height, root length, shoot and root dry mass, and the transformation rate of stored substances at pH 1.0 had significant decrease, and the average germination time extended apparently. At pH 1.0, the effects of acid rain were greater at seedling growth stage than at germination stage, and greater on underground part than on aboveground part. Due to the differences in gene type, normal corn and waxy corn had the strongest capability against acid rain, followed by pop corn, and sweet corn. It was suggested that corn could be categorized as an acid rain-tolerant crop, the injury threshold value of acid rain was likely between pH 1.0 and pH 2.0, and normal corn and waxy corn would be prioritized for planting in acid rain-stricken area.
Reproductive sink of sweet corn in response to plant density and hybrid
Improvements in plant density tolerance have played an essential role in grain corn yield gains for ~80 years; however, plant density effects on sweet corn biomass allocation to the ear (the reproductive ‘sink’) is poorly quantified. Moreover, optimal plant densities for modern white-kernel shrunke...
Directory of Open Access Journals (Sweden)
Marulak Simarmata
2015-10-01
Full Text Available The objectives of the research were to study the shift of weed compositions in sweet corn field treated with organic compost and chemical weed controls and to compare the effect of treatment combinations on weed growth, weed biomass and sweet corn biomass. The research was conducted in Bengkulu, Indonesia, from April to July 2014. Results showed that the number of weed species decreased after the trials from 14 to 13. There was a shift in weed compositions because 5 species of weeds did not emerge after the trials, but 4 new species were found. Chemical weed control used a herbiside mixture of atrazine and mesotrione applied during postemergence was the most effective method to control weeds, which was observed on decreased weed emergence and weed biomass down to 22.33 and 25.00 percent of control, respectively. Subsequently, biomass production of sweet corn increased up to 195.64 percent at the same trials. Biomass of weeds and sweet corn were also affected by the organic composts. Weed biomass was inhibited by treatment of composted empty fruith bunches of oil palm, whereas significantly increased of sweet corn biomass were observed in the plots of organic manure.
Directory of Open Access Journals (Sweden)
Mayta Novaliza Isda
2016-03-01
Full Text Available Sweet corn (Zea mays saccharata Struts a type of corn of high economic value, not only used for consumption also used to make syrup. Imperata is one of the weeds that interfere with crop cultivation, but efforts continue to be made use of weeds as an addition to soil organic matter. The study was conducted to determine the concentration of the extract Imperata (Imperata cylindrica L. appropriate in the sweet corn growth and determine the concentration of extract proper Imperata in the growth and production. The research method is a Completely Randomized Design (CRD with 9 treatments and 3 replicates. The results showed that treatment of Imperata extracts with varying concentrations significantly influenced the growth of plant height and leaf number. But not significantly to the growth of the leaf length, leaf width, stem diameter, number of rows per cob, number of seeds per row and plant dry weight. At a concentration of 200 g / 250 ml was able to reduce the vegetative and generative growth of sweet corn.
Lukiwati, D. R.; Pujaningsih, R. I.; Murwani, R.
2018-02-01
The experiment aimed to evaluate the effect of some manure enriched with phosphorus (P) and nitrogen (N) organic (‘manure plus’) on crude protein and mineral production of sweet corn (Zea mays saccharata)and quality of fermented stover as livestock feed. A field experiment was conducted on a vertisol soil (low pH, nitrogen and low available Bray II extractable P). Randomized block design with 9 treatments in 3 replicates was used in this experiment. The treatments were T1(TSP), T2 (SA), T3 (TSP+SA), T4 (manure), T5 (manure+PR), T6 (manure+guano), T7 (manure+N-legume), T8 (manure+PR+N-legume), T9 (manure +guano+N-legume). Data were analyzed using analysis of variance (ANOVA) and the differences between treatment means were examined by Duncan Multiple Range Test (DMRT). Results of the experiment showed that the treatment significantly affected to the crude protein and calcium production of stover and nutrient concentration of fermented stover, but it is not affected to P production of stover. The result of DMRT showed that the effect of ‘manure plus’ was not significantly different on CP and Ca production of stover, mineral concentration, in vitro DMD and OMD of fermented stover, compared to inorganic fertilization. Conclusion, manure enriched with organic NP, resulted in similar on CP and Ca production of stover and nutrient concentration of fermented stover compared to inorganic fertilizer. Thus, organic-NP enriched manure could be an alternative and viable technology to utilize low grade of phosphate rock, guano and Gliricidea sepium to produce sweet corn in vertisol soil.
Impact of applying edible oils to silk channels on ear pests of sweet corn
The impact of applying vegetable oils to corn silks on ear-feeding insects in sweet corn production was evaluated in 2006 and 2007. Six vegetable oils used in this experiment were canola, corn, olive, peanut, sesame, and soybean. Water and two commercial insecticidal oils (Neemix' neem oil and Sun...
Directory of Open Access Journals (Sweden)
Mário Puiatti
2000-03-01
Full Text Available Objetivando avaliar a viabilidade agronômica e econômica da associação inhame e milho doce, foi desenvolvido um trabalho em área da horta de pesquisas da Universidade Federal de Viçosa, em sistema de consórcio (associação aditiva, utilizando-se inhame (Colocasia esculenta 'Chinês' como cultura principal e milho doce (Zea mays 'Doce Cristal' como cultura contrastante. O inhame foi plantado em sulcos de 12 cm de profundidade, no espaçamento de 100 x 30 cm, e o milho doce em covas de 3 cm de profundidade, na fileira de plantio, entre as plantas de inhame, 40 dias após plantio do inhame. O delineamento experimental foi de blocos ao acaso, com quatro repetições, no esquema fatorial (3 x 2 + 2 (três arranjos de plantas: uma planta de milho a cada 30 cm; duas plantas de milho a cada 60 cm e três plantas de milho a cada 90 cm x dois manejos das plantas de milho: sem e com corte e retirada da parte aérea das plantas de milho no momento da colheita das espigas verdes + dois controles: monoculturas de inhame e de milho doce. Foram avaliadas características de crescimento e de produção das culturas, além dos índices de eficiência dos consórcios. As duas espécies são adequadas para plantio em sistema de consórcio. O arranjo com uma planta de milho a cada 30 cm propiciou maiores produtividades e índices de eficiência dos consórcios. Com exceção do arranjo com três plantas de milho/cova a cada 90 cm com corte da parte aérea das plantas de milho na colheita das espigas, no qual ocorreram menores índices de eficiência dos consórcios e rendimento financeiro total inferior ao da monocultura do inhame, as demais associações estudadas demonstraram-se viáveis agronômica e economicamente.An experiment was conducted to evaluate some crop production characteristics and economic viability of intercropping systems using taro (Colocasia esculenta 'Chinês', as major crop, and sweet corn (Zea mays 'Doce Cristal' as minor crop. Taro
Uptake of three isotopes of plutonium from soil by sweet corn grown in a growth chamber
International Nuclear Information System (INIS)
Hersloff, L.W.; Corey, J.C.
1978-01-01
The use of 237 Pu as a tracer for 238 Pu and 239 Pu was studied in a plant--soil system. Sandy clay--loam soil was spiked with approx. 240 pCi/g of 237 Pu, 14.3 pCi/g of 238 Pu, and 33 pCi/g of 239 Pu in the form of Pu(NO 3 ) 4 . The uptake of these three isotopes of plutonium was measured in the standing vegetation of sweet corn (Zea mays L. var. Silver Queen) after 30 and 50 days of growth. The mean concentrations in the standing crop and the concentration ratios of each isotope decreased from 30 to 50 days. There was an apparent differential availability of the three isotopes: 237 Pu was more available than 238 Pu, which was more available than 239 Pu. The quantity of 237 Pu in the standing crop, on a mass basis, closely approximated that of 238 Pu for both sampling times. Factors influencing these results are discussed
Directory of Open Access Journals (Sweden)
matin haghighi khah
2017-08-01
Full Text Available Introduction Corn (Zea mays L. is the third most important cereal crop in the world after wheat and rice (Lashkari et al., 2011. Corn production has been extended in to the whole world during the course of the last century due to its compatibility. It has more diversity compare to other cereal. Many corn types are cultivated, including field corn, ornamental corn, popcorn, sweet corn and several different supersweet corns. Sweet corn, considered a vegetable, is a special type of corn with particular characteristics, such as sweet taste, thin pericarp and endosperm with delicate texture, and high nutritional value. It is destined exclusively for human consumption, in fresh form or in processed foods, whereas the straw can be used for silage after harvest (Santos et al., 2014. Sweet corn seeds germinate slowly and exhibit poor seedling vigour. Poor germination in sweet corn has been attributed to low seed vigour and susceptibility to seed and soilborne diseases (Ratin et al., 2006. Seed priming is the one of efficient method to improve germination and emergence. In addition, transplanting provides optimal environmental conditions for seed germination and avoids planting seeds in disease-contaminated soil (Khalid et al., 2012. Materials and methods To investigate the effect of seed priming and transplanting on morphological characteristics, yield and yield components of supersweet corn a series of greenhouse and field experiments were conducted in a factorial based design on a randomized complete block in 2013. This experiment was conducted in the greenhouse to determine the best seed priming treatments. The treatments were hydro priming, Poly ethylene glycol (6000 -0.4 and -0.8 MPa, Sodium Sulphate 0.1 and 0.5%, Zinc Sulphate 1 and 0.5%, Copper Sulphate 0.1 and 0.5% and Control for 36 hours. After that the seeds washed by distillated water and dried back in laboratory conditions. Then treated seeds were sown in trays that contained by cocopeatand
Several Pesticides Influence the Nutritional Content of Sweet Corn.
Cutulle, Matthew A; Armel, Gregory R; Kopsell, Dean A; Wilson, Henry P; Brosnan, James T; Vargas, Jose J; Hines, Thomas E; Koepke-Hill, Rebecca M
2018-03-28
Herbicides are pesticides used to eradicate unwanted plants in both crop and non-crop environments. These chemistries are toxic to weeds due to inhibition of key enzymes or disruption of essential biochemical processes required for weedy plants to survive. Crops can survive systemic herbicidal applications through various forms of detoxification, including metabolism that can be enhanced by safeners. Field studies were conducted near Louisville, Tennessee and Painter, Virginia to determine how the herbicides mesotrione, topramezone, nicosulfuron, and atrazine applied with or without the safener isoxadifen-ethyl would impact the nutritional quality of "Incredible" sweet corn ( Zea mays L. var. rugosa). Several herbicide treatments increased the uptake of the mineral elements phosphorus, magnesium, and manganese by 8-75%. All herbicide treatments increased protein content by 4-12%. Applied alone, nicosulfuron produced similar levels of saturated, monounsaturated, and polyunsaturated fatty acids when compared to the nontreated check, but when applied with isoxadifen-ethyl, fatty acids increased 8 to 44% relative to the check or control. Nicosulfuron plus isoxadifen-ethyl or topramezone or the combination of all three actives increased the concentrations of fructose and glucose (40-68%), whereas reducing levels of maltose or sucrose when compared to the nontreated check (-15 to -21%). Disruptions in biochemical pathways in plants due to the application of herbicides, safeners, or other pesticides have the potential to alter the nutrient quality, taste, and overall plant health associated with edible crops.
Westgate, P J; Schultz, B B; Hazzard, R V
2017-04-01
In the northeastern United States, control of Lepidopteran pests of sweet corn, particularly corn earworm [Helicoverpa zea (Boddie)], is difficult using organic methods. The direct application of corn oil and Bacillus thuringiensis (Bt) to corn silk has been shown to reduce ear damage from corn earworm in past studies; these studies sought to optimize this method by evaluating additional carrier and biopesticide mixtures that comply with the United States Federal Insecticide, Fungicide, and Rodenticide Act and National Organic Standards. Carriers, which are liquids used to dissolve the biopesticide and deliver it into the tip of the ear, may have phytotoxic or insecticidal properties. Experiments conducted from 2001 to 2005 evaluated caterpillar damage and ear development effects from carriers (vegetable and paraffinic oils and carrageenan), biopesticides (Bt, spinsosad, and neem), and three emulsifiers in various combinations when applied directly to the tips of the ears 5-7 d after silk initiation. There were no effects of emulsifiers on ear quality, except for slight reduction in caterpillar damage in one of the two years. There were no differences among corn, soy, canola, and safflower oils in corn earworm control or tip development. The carrageenan carrier had the least effect upon ear development as measured by the length of nonpollinated kernels at the tip, compared to corn oil or paraffinic oil (JMS Stylet Oil), which caused the greatest tip damage as well as an oily discoloration. The carrier-pesticide combinations with the best ear quality overall were spinosad in carrageenan or corn oil, and Bt in carrageenan. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Seed reserve utilization and hydrolytic enzyme activities in germinating seeds of sweet corn
International Nuclear Information System (INIS)
Cheng, X.; Xiong, F.; Wang, C.; He, S.; Zhou, Y.
2018-01-01
In this study, two sh2 sweet corn cultivars (i.e., the initial seed dry weight for FT018 and TB010 was 0.16+-0.02 g/grain and 0.09+-0.01 g/grain, respectively) were used to determine the physiological characteristics of seed reserve utilization in germination. The data implied that the weight of mobilized seed reserve (WMSR) and seed reserve utilization efficiency (SRUE) increased with seed germination. FT018 exhibited higher SRUE than TB010 due to its sufficient energy production for growth. Sugar (sucrose and fructose) contents were at different levels in the germinating seed of sh2 sweet corn. The protein content and number of protein species were highest in the early stage of germination. Enzyme activity in the germinating seed indicated that enzymes for starch and sugar hydrolysis were important and that enzyme activities significantly differed at each germination stage and between the cultivars under dark conditions. Succinate dehydrogenase, sucrose synthase, and glucose-6-phosphate dehydrogenase accumulated in the late germination stage. Thus, appropriate efforts should be focused on improving the seed reserve utilization in sweet corn by identifying the physiological mechanism of germinating seed. (author)
Quality control of fresh sweet corn in controlled freezing-point storage
African Journals Online (AJOL)
Jane
2011-10-24
Oct 24, 2011 ... preservation technology in subzero non-frozen tempera- ture range to ... method for sweet corn which possessed high respiration rate and sugar ..... to extend the shelf life of fresh cod (Gadus morhua) loins. J. Food Sci.
Goss’s wilt incidence in sweet corn is independent of transgenic traits and glyphosate
Recently claims have been made that the use of glyphosate and transgenic crop traits increases the risk of plant diseases. Transgenic traits used widely for years in dent corn are now available in commercial sweet corn cultivars, specifically, the combination of glyphosate resistance (GR) and Lepid...
Compounds formed by treatment of corn (Zea mays) with nitrous acid.
Archer, M C; Hansen, T J; Tannenbaum, S R
1980-01-01
Nitrohexane has been identified as a major product formed following treatment of corn (Zea mays) with nitrous acid. Preliminary evidence suggests that another compound isolated from the nitrosated corn is an unsaturated nitrolic acid. As an aid to the analysis of N-nitro compounds, we have characterized the response of a chemiluminescence detector (Thermal Energy Analyzer) as a function of pyrolysis chamber temperature for several nitrosamines and for an aliphatic C-nitroso compound, an aromatic C-nitro compound, a nitramine and an alkyl nitrite. The response-temperature profiles are valuable in distinguishing among the various compounds and in optimizing the sensitivity of the detector for use in chromatography. Other tests, including photolysis and stability toward nitrite-scavenging reagents, further aid in distinguishing among the various compounds.
Inducing salt tolerance in sweet corn by magnetic priming
Directory of Open Access Journals (Sweden)
Soheil Karimi
2017-01-01
Full Text Available This study evaluates seed germination and growth of sweet corn under NaCl stress (0, 50, and 100 mM, after exposing the seeds to weak (15 mT or strong (150 mT magnetic fields (MF for different durations (0, 6, 12, and 24 hours. Salinity reduced seed germination and plant growth. MF treatments enhanced rate and percentage of germination and improved plant growth, regardless of salinity. Higher germination rate was obtained by the stronger MF, however, the seedling were more vigorous after priming with 15 mT MF. Proline accumulation was observed in parallel with the loss of plant water content under 100 mM NaCl stress. MF prevented proline accumulation by improving water absorption. Positive correlation between H2O2 accumulation and membrane thermostability (MTI was found after MF treatments, which revealed that MF primed the plant for salinity by H2O2 signaling. However, over-accumulation of H2O2 after prolonged MF exposure adversely affected MTI under severe salt stress. In conclusion, magnetic priming for 6 hours was suggested for enhancing germination and growth of sweet corn under salt stress.
Directory of Open Access Journals (Sweden)
S. Habibi
2014-04-01
Full Text Available In order to investigate the effect of source and rate of nitrogen fertilizer on yield and quality of sweet corn, a field study was conducted in 2011 cropping season in Agriculture Experiment Station of College of Agriculture, University of Guilan. A randomized complete block design with three replications was used. Treatment consisted of four levels of nitrogen fertilizer (0, 46, 92 and 138 kg N ha-1 and integrated N of chemical and biological (23 kg N ha-1 + 1 ton ha-1 Vermi-compost, 46 kg N ha-1 + 2 ton ha-1 Vermi-compost, and 69 kg N ha-1 +3 ton ha-1 Vermi-compost and organic sources (2, 4 and 6 ton ha-1. Effect of source and rate of nitrogen fertilizer on fresh ear yield, grain yield canned, grain protein amount and dry matter digestibility percent had significant. With increscent nitrogen at treatments nitrogen fertilizer, organic ant integrated farming yield fresh ear, grain yield, grain protein amount and dry matter digestibility percent increased. Maximum yield fresh ear was obtained with 69 kg N ha-1 + 3 ton ha-1 Vermi-compost with an average 14595.9 kg ha-1. Maximum forage yield and dry forage yield obtained with an average 18619.5 and 3593 kg ha-1 at treatment with 69 kg N ha-1 + 3 ton ha-1 Vermi-compost. Results of this research showed that the best grain yield and quality, and forage yield and quality of sweet corn were obtained in integrated farming and organic methods in Rasht region conditions and same climatology conditions.
Directory of Open Access Journals (Sweden)
Robert Rosa
2016-09-01
Full Text Available The aim of the study was to determine the effect of weather components (air temperature, precipitation on the growth, yield and the length of the growing season of sweet corn cultivated in eastern Poland. The results come from a field experiment conducted in 2006–2011. Weather conditions in the successive years of the study significantly modified the yield of ears, weight and number of formatted ears, high of plants and the length of the growing season of sweet corn. Good yielding of sweet corn favoured years with moderate air temperatures in July and uniform distribution of precipitation during the growing season. The highest yield of ears was found in 2011, the lowest in the very difficult in terms of weather 2006. The shortest growing season was characterized corn grown in the years 2006 and 2010 with the high air temperatures in July and August, the longest in the years 2009 and 2011, in which the temperatures in the period June-August were the lowest of all the years of research. Irrespective of the year of study, cv ‘Sheba F1’ was formatted eras with higher weight than cv ‘Sweet Nugget F1’.
López, Juan D.; Latheef, M. A.; Hoffmann, W. C.
2010-01-01
Newly emerged corn earworm adults, Helicoverpa zea (Boddie) (Lepidoptera: Noctuidae) require a carbohydrate source from plant or other exudates and nectars for dispersal and reproduction. Adults actively seek and forage at feeding sites upon eclosion in the habitat of the larval host plant or during dispersal to, or colonization of, a suitable reproductive habitat. This nocturnal behavior of H. zea has potential for exploitation as a pest management strategy for suppression using an adult fee...
Aphrodisiac Activity of the Aqueous Crude Extract of Purple Corn ( Zea mays) in Male Rats.
Carro-Juárez, Miguel; Rodríguez-Santiago, Magdalena G; Franco, Miguel Angel; Hueletl-Soto, María Eugenia
2017-10-01
In the present study, the aphrodisiac properties of the purple corn ( Zea mays) in male rats were analyzed. The aqueous crude extract of purple corn (at 25, 50, and 75 mg/kg) was administered to ( a) copulating male rats and ( b) anesthetized and spinal cord transected male rats. Behavioral parameters of copulatory behavior and parameters of the genital motor pattern of ejaculation previous to its inhibition, under the influence of the purple corn extract, are described. Administration of the aqueous crude extract of purple corn significantly facilitates the arousal and execution of male rat sexual behavior without significant influences on the ambulatory behavior. In addition, purple corn extract elicit a significant increase in the number of discharges of the ejaculatory motor patterns and in the total number of genital motor patterns evoked in spinal rats. The present findings show that the aqueous crude extract of purple corn possesses aphrodisiac activity.
Energy Technology Data Exchange (ETDEWEB)
Ziska, Lewis H.; Tomecek, Martha; Sicher, Richard [United States Department of Agriculture, Agricultural Research Service, Crop Systems and Global Change Lab, 10300 Baltimore Avenue, Building 1, Beltsville, MD 20705 (United States); Runion, G. Brett; Prior, Stephen A.; Torbet, H. Allen [United States Department of Agriculture, Agricultural Research Service, National Soil Dynamics Laboratory, 411 South Donahue Drive, Auburn, AL 36832 (United States)
2009-11-15
The recent emphasis on corn production to meet the increasing demand for bioethanol has resulted in trepidation regarding the sustainability of the global food supply. To assess the potential of alternative crops as sources of bioethanol production, we grew sweet potato (Ipomoea batatas) and cassava (Manihot esculentum) at locations near Auburn, Alabama and Beltsville, Maryland in order to measure root carbohydrate (starch, sucrose, glucose) and root biomass. Averaged for both locations, sweet potato yielded the highest concentration of root carbohydrate (ca 80%), primarily in the form of starch (ca 50%) and sucrose (ca 30%); whereas cassava had root carbohydrate concentrations of (ca 55%), almost entirely as starch. For sweet potato, overall carbohydrate production was 9.4 and 12.7 Mg ha{sup -1} for the Alabama and Maryland sites, respectively. For cassava, carbohydrate production in Maryland was poor, yielding only 2.9 Mg ha{sup -1}. However, in Alabama, carbohydrate production from cassava averaged {proportional_to}10 Mg ha{sup -1}. Relative to carbohydrate production from corn in each location, sweet potato and cassava yielded approximately 1.5 x and 1.6 x as much carbohydrate as corn in Alabama; 2.3 x and 0.5 x for the Maryland site. If economical harvesting and processing techniques could be developed, these data suggest that sweet potato in Maryland, and sweet potato and cassava in Alabama, have greater potential as ethanol sources than existing corn systems, and as such, could be used to replace or offset corn as a source of biofuels. (author)
Directory of Open Access Journals (Sweden)
Eni Maftu’ah
2013-10-01
Full Text Available This study was aimed to determine the effectiveness of several of ameliorant formulas to increase plant growthand NPK uptake on sweet corn (Zea mays L. var. saccharata on degraded peatlands. The research was conducted in thegreenhouse of Balittra during May to July 2011. Sweet corn was planted in pot with soil taken from previously burnt peatin Kalampangan, Palangkaraya. The treatment consisted of two factors, i.e., combination of ameliorant (A1=80% chicken manure + 20% dolomite, A2=80% agricultural weeds + 20% dolomite, A3=80% mineral soil (Spodosol + 20% dolomite,A4=20% chicken manure + 20% agricultural weeds + 20% Eleocharis dulcis + 20% mineral soil + 20% dolomite, andA5=19% chicken manure + 71.5% mineral soil + 9.5% dolomite and application rates at 5, 10, 15, 20 and 25 ton ha-1, arranged in a randomized complete block design, with 3 replications. The results showed that ameliorants and application rates affected growth and NPK uptake of sweet corn. Application of 20 ton ameliorant (80% chicken manure + 20% dolomite ha-1 produced the highest dry weight of root and shoot, and NPK uptake.Keywords: ameliorants, degraded peatland, nitrogen, phosphate, potassium
Directory of Open Access Journals (Sweden)
Abdelaziz HIRICH
2014-07-01
Full Text Available Several experiments were conducted in the south of Morocco (IAV-CHA, Agadir during two seasons 2010 and 2011 in order to evaluate the effect of deficit irrigation with treated wastewater on several crops (quinoa, sweet corn, faba bean and chickpeas. During the first season (2010 three crops were tested, quinoa, chickpeas and sweet corn applying 6 deficit irrigation treatments during all crop stages alternating 100% of full irrigation as non-stress condition and 50% of full irrigation as water deficit condition applied during vegetative growth, flowering and grain filling stage. For all crops, the highest water productivity and yield were obtained when deficit irrigation was applied during the vegetative growth stage. During the second season (2011 two cultivars of quinoa, faba bean and sweet corn have been cultivated applying 6 deficit irrigation treatments (rainfed, 0, 25, 50, 75 and 100% of full irrigation only during the vegetative growth stage, while in the rest of crop cycle full irrigation was provided except for rainfed treatment. For quinoa and faba bean, treatment receiving 50% of full irrigation during vegetative growth stage recorded the highest yield and water productivity, while for sweet corn applying 75% of full irrigation was the optimal treatment in terms of yield and water productivity.
Guo, B Z; Zhang, Z J; Butrón, A; Widstrom, N W; Snook, M E; Lynch, R E; Plaisted, D
2004-12-01
In the United States, insecticide is used extensively in the production of sweet corn due to consumer demand for zero damage to ears and to a sweet corn genetic base with little or no resistance to ear-feeding insects. Growers in the southern United States depend on scheduled pesticide applications to control ear-feeding insects. In a study of quantitative genetic control over silk maysin, AM-maysin (apimaysin and methoxymaysin), and chlorogenic acid contents in an F2 population derived from GE37 (dent corn, P1A1) and 565 (sh2 sweet corn, p1a1), we demonstrate that the P1 allele from field corn, which was selected against in the development of sweet corn, has a strong epistatic interaction with the a1 allele in sh2 sweet corn. We detected that the p1 gene has significant effects (P silk maysin concentrations but also on AM-maysin, and chlorogenic acid concentrations. The a1 gene also has significant (P silk antibiotic chemicals. Successful selection from the fourth and fifth selfed backcrosses for high-maysin individuals of sweet corn homozygous for the recessive a1 allele (tightly linked to sh2) and the dominant P1 allele has been demonstrated. These selected lines have much higher (2 to 3 times) concentrations of silk maysin and other chemicals (AM-maysin and chlorogenic acid) than the donor parent GE37 and could enhance sweet corn resistance to corn earworm and reduce the number of applications of insecticide required to produce sweet corn.
International Nuclear Information System (INIS)
Rothenberg, S.E.; Du, X.; Zhu, Y.-G.; Jay, J.A.
2007-01-01
The impact of sewage irrigation on the uptake and translocation of mercury (Hg) in corn plants (Zea mays) was investigated. Corn plants were harvested the same day from two nearby fields in suburban Beijing, one irrigated historically with sewage effluent, and one irrigated solely with groundwater. Hg content was analyzed in the soil, roots and stems, while percent moisture and soil organic content were analyzed in the soil samples. The concentration of Hg in the soil and roots, and the soil organic content were not significantly different between the two fields, despite the historic practice of sewage irrigation. Hg content in roots was positively correlated with soil Hg concentration (r = 0.95, n = 6). The transfer coefficients between roots and stems were significantly higher in the control site (control: 2.06, sewage-irrigated: 0.44, p < 0.05), indicating that the barrier effect of the roots was not consistent between the two fields. - Hg content in the roots of corn plants (Zea mays) was positively correlated with soil Hg content, but negatively correlated with Hg content in stems
Energy Technology Data Exchange (ETDEWEB)
Rothenberg, S.E. [Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing, 100085 (China); Environmental Science and Engineering Program, Box 951772 CHS, University of California, Los Angeles, CA 90095-1772 (United States)], E-mail: srothenb@ucla.edu; Du, X.; Zhu, Y.-G. [Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, 18 Shuangqing Road, Beijing, 100085 (China); Jay, J.A. [Department of Civil and Environmental Engineering, Box 951593 Boelter Hall, University of California, Los Angeles, CA 90095-1593 (United States)
2007-09-15
The impact of sewage irrigation on the uptake and translocation of mercury (Hg) in corn plants (Zea mays) was investigated. Corn plants were harvested the same day from two nearby fields in suburban Beijing, one irrigated historically with sewage effluent, and one irrigated solely with groundwater. Hg content was analyzed in the soil, roots and stems, while percent moisture and soil organic content were analyzed in the soil samples. The concentration of Hg in the soil and roots, and the soil organic content were not significantly different between the two fields, despite the historic practice of sewage irrigation. Hg content in roots was positively correlated with soil Hg concentration (r = 0.95, n = 6). The transfer coefficients between roots and stems were significantly higher in the control site (control: 2.06, sewage-irrigated: 0.44, p < 0.05), indicating that the barrier effect of the roots was not consistent between the two fields. - Hg content in the roots of corn plants (Zea mays) was positively correlated with soil Hg content, but negatively correlated with Hg content in stems.
The diapause hormone (DH) in the heliothine moth has shown its activity in termination of pupal diapause, while the orthology in the silkworm is known to induce embryonic diapause. In the current study, we cloned the diapause hormone receptor from the corn earworm Helicoverpa zea (HzDHr) and tested ...
Zhong, H; Srinivasan, C; Sticklen, M B
1992-07-01
In-vitro methods have been developed to regenerate clumps of multiple shoots and somatic embryos at high frequency from shoot tips of aseptically-grown seedlings as well as from shoot apices of precociously-germinated immature zygotic embryos of corn (Zea mays L.). About 500 shoots were produced from a shoot tip after eight weeks of culture (primary culture and one subculture of four weeks) in darkness on Murashige and Skoog basal medium (MS) supplemented with 500 mg/L casein hydrolysate (CH) and 9 μM N(6)-benzyladenine (BA). In this medium, shoots formed in shoot tips as tightly packed "multiple shoot clumps" (MSC), which were composed of some axillary shoots and many adventitious shoots. When the shoot tips were cultured on MS medium containing 500 mg/L CH, 9 μM BA and 2.25 μM 2,4-dichlorophenoxyacetic acid (2,4-D), most of the shoots in the clumps were adventitious in origin. Similar shoot tips cultured on MS medium containing 500 mg/L CH, 4.5 μM BA and 2.25 μM 2,4-D regenerated many somatic embryos within eight weeks of culture. Somatic embryos were produced either directly from the shoot apical meristems or from calli derived from the shoots apices. Both the MSC and the embryos produced normal shoots on MS medium containing 2.25 μM BA and 1.8 μM indole-3-butyric acid (IBA). These shoots were rooted on MS medium containing 3.6 μM IBA, and fertile corn plants were grown in the greenhouse. The sweet-corn genotype, Honey N Pearl, was used for the experiments described above, but shoot-tip cultures from all of 19 other corn genotypes tested also formed MSC on MS medium containing 500 mg/L CH and 9 μM BA.
The effect of different sowing depths on fresh ear yield and some ear characteristics of sweet corn
Directory of Open Access Journals (Sweden)
Bekir Atar
2017-12-01
Full Text Available The research was conducted with aim to investigate effect on fresh ear yield and some ear characteristics of sweet corn of sowing at different depths during 2015 and 2016 years in Isparta. The experiments were set up according to randomized complete block design with three replicates using BATEM TATLI sweet corn cultivar. Furrows were opened at depths of 10 and 20 cm after the soil preparation, and seeds were sown in the 4-5 cm depth in to these furrows. According to means of years, while furrow sowing increased ear diameter, ear weigh, number of kernels per ear and fresh ear yield compared to control, it was not effect on ear length. In the research, between 10 cm and 20 cm furrow sowing wasn’t significant statistically. Fresh ear yield in control, 10 cm and 20 cm furrow sowing were measured as 1110.9 kg ha-1 , 1228.4 kg ha-1 and 1289.4 kg ha-1 , respectively. According to results of research, 5 cm deep sowing in 10 cm furrows should be advised in sweet corn cultivation.
Directory of Open Access Journals (Sweden)
Dermiyati
2017-01-01
Full Text Available Efforts to increase the production of sweet corn can be done, among others, by the application of fertilizers, either inorganic, organic or its combination. In addition, the application of soil amendments such as biochar is expected to improve soil fertility that will further increase the production of sweet corn. Organonitrophos fertilizer is an organic fertilizer developed by lecturers of Faculty of Agriculture, University of Lampung. The research was aimed to study the effect of the combination of organonitrophos and inorganic fertilizers, biochar and the interaction between fertilizer combination and biochar on soil respiration and soil microbial biomass.The research was conducted at the Agriculture Experimental Field of University of Lampung using a Randomized Block Design with 6×2 factorials and 3 replications. The first factor was six levels of combination of organonitrophos and inorganic fertilizers (P0, P1, P2, P3, P4, and P5. The second factor was two levels of biochar dosage (B0 and B1. The data were analyzed using Analysis of Variance and further tested using the Least Significant Difference (LSD Test at 5% significance level. The variables measured were soil respiration and soil microbial biomass carbon (SMBC. The results showed that the highest soil respiration was observed in the plots with P3B1 treatment (300 kg Urea ha-1, 125 kg SP-36 ha-1, 100 kg KCl ha-1 + 2500 kg organonitrophos ha-1 at 60 days after planting (DAP. Among other treatments, the highest SMBC was observed in the plots with P5 treatment (5,000 kg Organonitrophos ha-1 at 60 and 90 DAP. Soil respiration and SMBC were higher in the plots with B1 treatment (5,000 kg biochar ha-1 compared to that in the plots with B0 treatment (0 kg biochar ha-1. There was an interaction effect between combination of organonitrophos and inorganic fertilizers, and biochar on soil respiration at 90 DAP. However, there was no interaction effect between fertilizer combination and biochar
Fertilizer residence time affects nitrogen uptake efficiency and growth of sweet corn
Zotarelli, L.; Scholberg, J.M.S.; Dukes, M.D.; Munoz-Carpena, R.
2008-01-01
Understanding plant N uptake dynamics is critical for increasing fertilizer N uptake efficiency (FUE) and minimize the risk of N leaching. The objective of this research was to determine the effect of residence time of N fertilizer on N uptake and FUE of sweet corn. Plants were grown in 25 L columns
Assessment of the physiological potential of super sweet corn seeds
Alvarenga,Renata Oliveira; Marcos-Filho,Julio; Timóteo,Tathiana Silva
2013-01-01
The assessment of physiological potential is essential in seed quality control programs. This study compared the sensitivity of different procedures for evaluating super sweet corn seed vigor, focusing on the primary root protrusion test. Six seed lots, each of the SWB 551 and SWB 585 hybrids, were used. Seed physiological potential was evaluated by germination and vigor tests (speed of germination, traditional and saturated salt accelerated aging, cold test, seedling length, seedling emergen...
Comparative transcriptome analysis of sweet corn seedlings under low-temperature stress
Directory of Open Access Journals (Sweden)
Jihua Mao
2017-10-01
Full Text Available Stress induced by low temperature, which represents a widespread environmental factor, strongly affects maize growth and yield. However, the physiological characteristics and molecular regulatory mechanisms of maize seedlings in response to cold remain poorly understood. In this study, using RNA-seq, we investigated the transcriptome profiles of two sweet corn inbred lines, “Richao” (RC and C5, under cold stress. A total of 357 and 455 differentially expressed genes (DEGs were identified in the RC and C5 lines, respectively, 94 DEGs were detected as common DEGs related to cold response in both genotypes, and a total of 589 DEGs were detected as cold tolerance-associated genes. By combining protein function clustering analysis and significantly enriched Gene Ontology (GO terms analysis, we suggest that transcription factors may play a dominating role in the cold stress response and tolerance of sweet corn. Furthermore, 74 differentially expressed transcription factors were identified, of those many genes involved in the metabolism and regulation of hormones. These results expand our understanding of the complex mechanisms involved in chilling tolerance in maize, and provide a set of candidate genes for further genetic analyses.
Directory of Open Access Journals (Sweden)
Robert Rosa
2014-10-01
Full Text Available Organic manuring is suggested to be necessary in sweet corn cultivation. It is not always possible to use farmyard manure due to economic, production or technical reasons. Catch crops used as green manures can be an alternative source of organic matter. The experiment was carried out in central-east Poland (52°06’N, 22°55’E, in years 2008–2011. The successive effect of winter catch crops (hairy vetch, white clover, winter rye, Italian ryegrass, winter turnip rape and the type of weed control on the growth and yielding of sweet corn was examined. The catch crops were sown in early September, incorporated in early May. The effect of the winter catch crops on yield was compared to the effect of FYM at a rate of 30 t·ha-1 and the control without organic manuring. The sweet corn was grown directly after organic fertilization. Three methods of weed control was used: Hw – hand weeding, twice during the growing period, GCM – herbicide Guardian CompleteMix 664 SE, immediately after sowing the seed corn, Z+T – a mixture of herbicides Zeagran 340 SE + Titus 25 WG, in the 3–4 leaf stage sweet corn. The highest yields of biomass were found for winter rye (35.5 t·ha-1 FM and 7.3 t·ha-1 DM, the most of macroelements accumulated winter turnip rape (480.2 kg N+P+K+Ca+Mg·ha-1. Generally, leguminous catch crops had similar to the FYM and better than non-leguminous catch crops yield-forming effect. The highest yield of marketable ears of sweet corn was obtained after FYM (14.4 t·ha-1 and after hairy vetch catch crop (14.0 t·ha-1. A similar yield-forming effect also had white clover and Italian ryegrass. The most of ears from 1 ha was achieved after white clover catch crop (59.3 tausend, similar after FYM and hairy vetch catch crop. The highest kernel yields were found after FYM (10.7 t·ha-1. The yields of kernel after hairy vetch and white clover catch crops were significantly higher than after non-leguminous catch crops. Z+T weed control
Value of Neonicotinoid Insecticide Seed Treatments in Mid-South Corn (Zea mays) Production Systems.
North, J H; Gore, J; Catchot, A L; Stewart, S D; Lorenz, G M; Musser, F R; Cook, D R; Kerns, D L; Leonard, B R; Dodds, D M
2018-02-09
Neonicotinoid seed treatments are one of several effective control options used in corn, Zea mays L., production in the Mid-South for early season insect pests. An analysis was performed on 91 insecticide seed treatment trials from Arkansas, Louisiana, Mississippi, and Tennessee to determine the value of neonicotinoids in corn production systems. The analysis compared neonicotinoid insecticide treated seed plus a fungicide to seed only with the same fungicide. When analyzed by state, corn yields were significantly higher when neonicotinoid seed treatments were used compared to fungicide only treated seed in Louisiana and Mississippi. Corn seed treated with neonicotinoid seed treatments yielded 111, 1,093, 416, and 140 kg/ha, higher than fungicide only treatments for Arkansas, Louisiana, Mississippi, and Tennessee, respectively. Across all states, neonicotinoid seed treatments resulted in a 700 kg/ha advantage compared to fungicide only treated corn seed. Net returns for corn treated with neonicotinoid seed treatment were $1,446/ha compared with $1,390/ha for fungicide only treated corn seed across the Mid-South. Economic returns for neonicotinoid seed treated corn were significantly greater than fungicide-only-treated corn seed in 8 out of 14 yr. When analyzed by state, economic returns for neonicotinoid seed treatments were significantly greater than fungicide-only-treated seed in Louisiana. In some areas, dependent on year, neonicotinoid seed treatments provide significant yield and economic benefits in Mid-South corn. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Ahmed, Hiwa M
2018-03-01
Allelopathic effects of corn (Zea mays) extracts was studied, against seed germination and seedling growth of Phalaris minor, Helianthus annuus, Triticumaestivum, Sorghum halepense, Z. mays. Bioassay results showed that aqueous extracts of corn root and shoot, markedly affected seed germination, and other parameters compared with related controls. Preliminary phytochemical screening revealed the presence of various phytochemicals such as tannins, phlobatannins, flavonoids, terpenoids and alkaloids in both roots and shoot aqueous extracts. However, saponins were only present in the shoot aqueous extract, while in shoot ethanol extracts, only terpenoids and alkaloids were detected. Additionally, total polyphenolic (TPC) content in aqueous extracts of corn root and shoot, plus ethanol extracts of corn shoot were determined using an Ultraviolet-visible spectroscopy. Results revealed TPC content of the corn shoot aqueous extract showed the highest yield, compared to other extracts. These findings suggest that phytochemicals present in Z. mays extracts may contribute to allelopathy effect.
Extending the shelf life of fresh sweet corn by shrink-wrapping, refrigeration, and irradiation
International Nuclear Information System (INIS)
Deak, T.
1987-01-01
Chemical, physical, sensory, and microbiological changes were monitored during storage of unwrapped and shrink-wrapped fresh sweet corn at 10 degree and 20 degree C. Wrapping essentially eliminated moisture loss and resulted in elevated carbon dioxide and decreased oxygen concentrations within packages. These effects, together with refrigeration markedly reduced the changes associated with senscence and post harvest deterioration, and hence resulted in at least a threefold extension in shelf life. The water-saturated atmosphere, however, enhanced microbial growth on shrink-wrapped corn. The initial microbial population was effectively decreased by treating the wrapped corn with 0.5 or 1.0 kGy (Co 60 ) irradiation
Korompis, Olga S; Mamuaja, Christine F; Mandey, Lucia C
2016-01-01
Potato (Solanum tuberosum L.), corn (Zea mays L.) and sago (Arenga microcarpa Beccari) are crops containing high carbohydrate, as source of calory food, and those can be made into rice analog. This study aimed: (1) to determine the formulations by organoleptic test in manufacture analog rice from potato flour, corn flour and sago flour, and (2) to analyze the physical properties, chemical properties of rice analog from potato flour with the addition of corn flour and sago flour. The research ...
Corn earworm is a major pest of sweet corn, especially when grown organically. Aerial application of insecticides is important for both conventionally- and organically-grown sweet corn production as sweet corn is frequently irrigated to assure return on investment given the high production costs. ...
International Nuclear Information System (INIS)
Li, W.; Zhang, X.; Li, G.; Suo, H.; Ashraf, U.; Mo, Z.
2017-01-01
Stress induced variations in seed germination of various crops has been well reported but germination potential of sweet corn seeds under osmotic stress with relation to time dynamics is still elusive. Present study explored the water absorption, germination potential and physiological indices and of sweet corn seeds exposed to five different levels of PEG-induced water stress i.e., 0, -0.3, -0.6, -0.9 and -1.2 M Pa water potential (Psi /sub w/) with respect to time dynamics. Results showed that enhanced water stress for prolonged time period (96 h) led to substantial reduction in water absorption and seed moisture contents, seed germination and vigor index as well as seedlings growth and fresh and dry biomass. Osmotic stress triggered antioxidant defense system like super-oxide dismutase (SOD), peroxidase (POD) and catalase (CAT) and accumulation of soluble sugars, proline and protein contents considerably. Initially, activities of SOD and CAT were higher but then reduced as stress persisted, however, POD showed a linear increase with respect to stress exposure time. Water stress also increased MDA contents up to 36 h then declined. Further, alpha-amylase activity and soluble protein showed significant correlations with maize seed germination. Overall, germination potential decreased with increase in osmotic stress in sweet corn seeds. (author)
Steckel, S; Stewart, S D
2015-06-01
Ear-feeding larvae, such as corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), can be important insect pests of field corn, Zea mays L., by feeding on kernels. Recently introduced, stacked Bacillus thuringiensis (Bt) traits provide improved protection from ear-feeding larvae. Thus, our objective was to evaluate how injury to kernels in the ear tip might affect yield when this injury was inflicted at the blister and milk stages. In 2010, simulated corn earworm injury reduced total kernel weight (i.e., yield) at both the blister and milk stage. In 2011, injury to ear tips at the milk stage affected total kernel weight. No differences in total kernel weight were found in 2013, regardless of when or how much injury was inflicted. Our data suggested that kernels within the same ear could compensate for injury to ear tips by increasing in size, but this increase was not always statistically significant or sufficient to overcome high levels of kernel injury. For naturally occurring injury observed on multiple corn hybrids during 2011 and 2012, our analyses showed either no or a minimal relationship between number of kernels injured by ear-feeding larvae and the total number of kernels per ear, total kernel weight, or the size of individual kernels. The results indicate that intraear compensation for kernel injury to ear tips can occur under at least some conditions. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Blair, Amy C.; Peters, Brenda J.; Bendixen, Conrad W.
2014-01-01
The AAAS Vision and Change report (2011) recommends incorporating student research experiences into the biology curriculum at the undergraduate level. This article describes, in detail, how "Zea mays" (corn) cultivars were used as a model for a hypothesis-driven short-term research project in an introductory biology course at a small…
Spray particle drift mitigation using field corn (Zea mays L.) as a drift barrier.
Vieira, Bruno C; Butts, Thomas R; Rodrigues, Andre O; Golus, Jeffrey A; Schroeder, Kasey; Kruger, Greg R
2018-04-24
Herbicide particle drift reduces application efficacy and can cause severe impacts on nearby vegetation depending on the herbicide mode-of-action, exposure level, and tolerance to the herbicide. A particle drift mitigation effort placing windbreaks or barriers on the field boundaries to reduce off-target movement of spray particles has been utilized in the past. The objective of this research was to evaluate the effectiveness of field corn (Zea mays L.) at different heights as a particle drift barrier. Applications with a non-air inclusion flat fan nozzle (ER11004) resulted in greater particle drift when compared to an air inclusion nozzle (TTI11004). Eight rows of corn were used as barriers (0.91, 1.22, and 1.98 m height) which reduced the particle drift for both nozzles, especially at shorter downwind distances. Applications with the ER11004 nozzle without corn barriers had 1% of the applied rate (D 99 ) predicted to deposit at 14.8 m downwind, whereas this distance was reduced (up to 7-fold) when applications were performed with corn barriers. The combination of corn drift barriers and nozzle selection (TTI11004) provided satisfactory particle drift reduction when the D 99 estimates were compared to applications with the ER11004 nozzle without corn barriers (up to 10-fold difference). The corn drift barriers were effective in reducing particle drift from applications with the ER11004 and the TTI11004 nozzles (Fine and Ultra Coarse spray classifications, respectively). The corn drift barrier had appropriate porosity and width as the airborne spray was captured within its canopy instead of deflecting up and over it. This article is protected by copyright. All rights reserved.
Extração de corantes de milho (Zea mays L. Extraction of corn colorants (Zea mays L.
Directory of Open Access Journals (Sweden)
Felix Martin Cabajal Gamarra
2009-03-01
Full Text Available Os corantes naturais foram amplamente utilizados de forma artesanal até antes do surgimento dos corantes sintéticos. O estudo e uso dos corantes naturais voltaram a ter importância nestes últimos anos devido aos questionamentos dos organismos internacionais da saúde e dos consumidores pelo uso indiscriminado dos corantes sintéticos, ligados ao desenvolvimento de doenças degenerativas e ao impacto ambiental. O corante extraído do milho roxo (Zea mays L. tem sido utilizado ao longo da história pela civilização Inca na preparação de alimentos e no tingimento de fibras têxteis. Neste trabalho, os pigmentos do grupo das antocianinas foram extraídos das variedades de milho roxo e do milho vermelho (Z. mays L. e depois foram caracterizados. Três métodos de extração foram utilizados: imersão, lixiviação com algumas modificações e extração supercrítica (ESC. O melhor método para extração foi o da lixiviação que alcançou 88% (m/m de rendimento, em função da massa do corante extraído e da matéria-prima. Também utilizando a lixiviação modificada, foi possível concentrar em 3% os compostos acilados, assim como recuperar 85% dos solventes utilizados. Um indicador de pH foi obtido pela fixação das antocianinas num papel de filtro, com base na estabilidade das antocianinas, ferramenta que pode ser utilizada em laboratórios de ensino de química.Natural colorants were craftly made and widely used before the discovery of the synthetic colorants. The study and the use of natural colorants have become important again in the last few years due to questions raised by the international health organizations and consumers related to the indiscriminate use of synthetic colorants which were linked to the development of degenerative illnesses and environmental impact. The colorant extracted from purple corn (Zea Mays L. was used by the Inca civilization to prepare food and to dye textile fibers. In this work, pigments from the
Directory of Open Access Journals (Sweden)
Magda Narváez Castillo
2010-04-01
Full Text Available Se evaluó el efecto de la aplicación de vinazas en algunas propiedades físicas y en la actividad de las deshidrogenasas en un Entic dystropept y en un Fluventic haplustoll del Valle de Cauca, Colombia. Para suplir los requerimientos de K+ del cultivo de maíz dulce (Zea mays L. se utilizaron seis tratamientos (T1 = 100% de K+ como vinaza, T2 = 100% de K+ con KCl; T3 = 50% de K+ como vinaza y KCl, T4 = 75% de K+ con vinaza y 25% de K+ como KCl, T5 = testigo absoluto sin planta, T6 = testigo más planta que fueron dispuestos en un diseño completamente al azar con cinco repeticiones. En el Entic dystropept la densidad aparente disminuyó y en consecuencia la porosidad total aumentó, mientras que en el Fluventic haplustoll sucedió lo contrario. La actividad de las deshidrogenasas fue significativamente mayor (P The effect of vinasse application was assessed on physical properties and dehydrogenases activity in Entic Dystropept and Fluventic Haplustoll of Valle del Cauca, Colombia. To meet the requirements of K+ in sweet corn (Zea mays L. six treatments were used (T1 = 100% of K+ as vinasse; T2 = 100% of K+ with KCl; T3 = 50% of K+ as vinasse and KCl; T4 = 75% of K+ with vinasse and 25% of K+ as KCl; T5 = absolute control without plants; T6 = control plus plants arranged in a completely randomized design with five replications. In Dystropept Entic bulk density decreased and consequently the total porosity increased, while the opposite happened in Haplustoll Fluventic. The dehydrogenase activity was significantly higher (P <0.05 in the Dystropept Entic than in Haplustoll Fluventic presenting low values. The results showed that the changes that are generated as a result of the application of vinasse are different for each type of soil.
International Nuclear Information System (INIS)
Kumar, Sanjeev; Gautam, Satyendra
2015-01-01
Shelled sweet corn kernels are prone to microbial contaminations due to high moisture and nutrient contents. Post harvest handling further aggravates the condition and makes the product highly perishable and unsafe. In freshly shelled kernels total aerobic plate count, yeast mold count and presumptive coliforms were found to be ∼ 8, 7, and 4 log cfu/g, respectively. IMViC analysis confirmed presence of opportunistic pathogens like Escherichia coli and Enterobacteraerogenes in these samples. Besides, occurrence of mycotoxin such as ochratoxin A (OTA), classified as a possible carcinogenic compound, was found to be high in sweet corn samples spiked with toxigenic strain. To address this issue, a combination process including NaOCl washing (200 ppm for 5 min), hot water blanching (60℃ for 5 min), air drying, LDPE packaging, and finally gamma radiation (5 kGy) treatment was developed. The developed combination process was found to reduce microbial load to below detectable level and quite effectively inactivated Aspergillusochraceus spores as well as pre-formed toxin. These treatments were not found to affect the contents of biochemical constituents such as total and reducing sugars, proteins, phenolics, and flavonoids during storage. Prophylactic properties in terms of antioxidant capacity and potential to suppress chemical induced mutagenesis were not affected in these samples. Physical properties and sensory qualities were also found to be similar to fresh (control). Thus, the developed combination process ensured microbiological safety and extended shelf life of sweet corn kernels up to 30 days at 4℃ . (author)
Directory of Open Access Journals (Sweden)
Pedram Kashiani
2012-01-01
Full Text Available A study of genetic variation among 10 pairs of chromosomes extracted from 13 tropical sweet corn inbred lines, using 99 microsatellite markers, revealed a wide range of genetic diversity. Allelic richness and the number of effective alleles per chromosome ranged from 2.78 to 4.33 and 1.96 to 3.47, respectively, with respective mean values of 3.62 and 2.73. According to the Shannon's information index (I and Nei's gene diversity coefficient (Nei, Chromosome 10 was the most informative chromosome (I = 1.311 and Nei = 0.703, while Chromosome 2 possessed the least (I = 0.762 and Nei = 0.456. Based on linkage disequilibrium (LD measurements for loci less than 50 cM apart on the same chromosome, all loci on Chromosomes 1, 6 and 7 were in equilibrium. Even so, there was a high proportion of genetic variation in Chromosomes 4, 5, 8, 9 and 10, thereby revealing their appropriateness for use in the genetic diversity investigations among tropical sweet corn lines. Chromosome 4, with the highest number of loci in linkage disequilibrium, was considered the best for marker-phenotype association and QTL mapping, followed by Chromosomes 5, 8, 9 and 10.
Directory of Open Access Journals (Sweden)
mahdi arab
2009-06-01
Full Text Available It has been years that Azospirillum is known to promote plant growth. Phytohormone (especially Auxin production has the most important role in increasing the yield of inoculated plants. According to this, 60 strains of this genus were isolated, identified, and purified. This ability was evaluated in both qualitative and quantitative assays using colorimetric method and the effects of superior isolate on sweet corn were measured. Results revealed that the abundance and probability of the bacteria isolation is low and 17%. About 31.2% and 100% of Azospirillum strains were capable of producing IAA in qualitative and quantitative methods respectively. In greenhouse experiment, bacteria treatments had significant effects on corn fresh weight, total dry weight, root dry weight and total nitrogen and phosphorus content of the plant. This was considered to be as the result of more lateral root formation which enhances nutrition uptake. In conclusion, the green house results in respect to in vitro achievements show that fortunately it can be claimed that bacteria of the genus Azospirillum can be used widely for not only strategic gramineous plants like: corn, wheat, barely etc. but also for other useful plants. Key words: Azospirillum, Auxin, qualitative and quantitative methods, sweet corn.
Directory of Open Access Journals (Sweden)
Surtinah Surtinah
2018-04-01
Full Text Available Research conducted experiments using a completely randomized design environment with three replications, and design of treatment that is the time of planting silk kale as secondary crops to the cultivation of sweet corn (K consisting of: k1 = planting at the same time; k2 = time of planting silk kale 1 week after planting sweet corn; k3 = time of planting silk kale 2 weeks after planting sweet corn; k4 = time of planting silk kale 3 weeks after planting sweet corn; K5 = single planting sweet corn planting time = k1; k6 = single silk kale planting time = k1. The results showed that silk kale can be planted together with sweet corn planting time, up to three weeks after planting sweet corn. Results of sweet corn is not influenced by the timing of planting different silk kale. Land values in the cropping system Equality sweet corn with silk kale is 1.83. Competition index between sweet corn and silk kale is 1.73.
Directory of Open Access Journals (Sweden)
Sompong Sruamsiri
2007-07-01
Full Text Available This experiment was carried out to determine the nutritive value of agro-industrial by-products and nutrient digestibility of ensiled sweet corn cob and husk with different levels of Ipil - Ipil leaves (Leucaena leucocephala. Four native cattle were assigned by Latin Square Design to receive all dietary treatments in four experimental periods i.e. ensiled sweet corn cob and husk (ESCH, ensiled sweet corn cob and husk + 10 % Ipil - Ipil leaves (ESCH + 10% IL, ensiled sweet corn cob and husk + 20% Ipil - Ipil leaves (ESCH + 20% IL and ensiled sweet corn cob and husk + 30% Ipil - Ipil leaves (ESCH + 30% IL, respectively. Total collection method was used to determine the digestibility coefficients. Results showed that digestibility coefficients in ESCH were low (P>0.05 in all the nutrients. Supplementation of Ipil - Ipil leaves in ESCH increased digestibility coefficients. Total digestible nutrients (TDN and digestible energy were higher in the silages supplemented with Ipil - Ipil leaves. Average TDN contents of ESCH, ESCH + 10% IL, 20% IL and 30% IL were 62.78 + 6.14, 70.41 + 4.04, 72.73 + 2.78 and 63.07 + 4.06 %DM, respectively.
Arbaoui, Sarra; Evlard, Aricia; Mhamdi, Mohamed El Wafi; Campanella, Bruno; Paul, Roger; Bettaieb, Taoufik
2013-07-01
The potential of kenaf (Hibiscus cannabinus L.) and corn (Zea mays L.) for accumulation of cadmium and zinc was investigated. Plants have been grown in lysimetres containing dredging sludge, a substratum naturally rich in trace metals. Biomass production was determined. Sludge and water percolating from lysimeters were analyzed by atomic absorption spectrometry. No visible symptoms of toxicity were observed during the three- month culture. Kenaf and corn tolerate trace metals content in sludge. Results showed that Zn and Cd were found in corn and kenaf shoots at different levels, 2.49 mg/kg of Cd and 82.5 mg/kg of Zn in kenaf shoots and 2.1 mg/kg of Cd and 10.19 mg/kg in corn shoots. Quantities of extracted trace metals showed that decontamination of Zn and Cd polluted substrates is possible by corn and kenaf crops. Tolerance and bioaccumulation factors indicated that both species could be used in phytoremediation.
Pertumbuhan Vegetatif dan Kadar Gula Biji Jagung Manis (Zea mays saccharata, Sturt di Pekanbaru
Directory of Open Access Journals (Sweden)
Surtinah Surtinah
2017-04-01
Full Text Available Research conducted an experiment using a completely randomized design environment with four replications, and the design of treatment used is six varieties of sweet corn. Analysis of data using polynomial regression, the parameters measured were plant height, leaf number, leaf length, leaf width, and sugar beans, followed by analyzing the relationship between the growth of plants with a sugar content of sweet corn kernels. The results showed that leaf width gives a weak relationship to the sugar content of sweet corn seed, and leaf length, number of leaves and plant height had a close relationship to the sugar content of sweet corn kernels. Keywords: varieties, sweet corn, correlation, sugar content
ent-Kaurane Diterpenoids with Neuroprotective Properties from Corn Silk ( Zea mays).
Qi, Xiao-Li; Zhang, Ying-Ying; Zhao, Peng; Zhou, Le; Wang, Xiao-Bo; Huang, Xiao-Xiao; Lin, Bin; Song, Shao-Jiang
2018-05-25
Thirteen new ent-kaurane diterpenoids, stigmaydenes A-M (1-13), together with two known compounds (14, 15), were isolated from the crude extract of corn silk ( Zea mays). The structures of the compounds were confirmed by comprehensive spectroscopic analyses. The absolute configuration of compound 1 was defined by single-crystal X-ray diffraction. The absolute configurations of the compounds were also confirmed by comparison of experimental and calculated specific rotations. The compounds were evaluated for their neuroprotective effects against H 2 O 2 -induced SH-SY5Y cell injury, and compound 8 was active at 100 μM, as determined by flow cytometry (annexin V-FITC/PI staining) and Hoechst 33258 staining. The results suggested that compound 8 could protect neuronal cells from H 2 O 2 -induced injury by inhibiting apoptosis in SH-SY5Y cells.
Directory of Open Access Journals (Sweden)
Mukhlis
2013-10-01
Full Text Available This research aims to test the effectiveness of biofertilizer “M-Star” in increasing land productivity, growth of sweet corn and the efficiency of inorganic fertilizer used in acid sulphate soil of swampland. Research was conducted from May – July, 2012 in acid sulphate soil of Barambai, Barito Kuala Regency, South Kalimantan. The treatments involved (B1 Biofertilizer 25 kg/ha, (B2 Biofertilizer 15 kg/ha, (P1 NPK (recommendation dose, (P2 NPK (1/2 recommendation dose, (B1P1 Biofertilizer 25 kg/ha + NPK (recommended dose, (B1P2 Biofertilizer 25 kg/ha + NPK (1/2 recommended dose, (B2P1 Biofertilizer 15 kg/ha + NPK (recommended dose, (B2P2 Biofertilizer 15 kg/ha + NPK (1/2 recommended dose, and (K No fertilizer. The treatments were arranged by randomized completely block design with 3 replications. Recommended dose of NPK fertilizer was at 90-60-50 NPK kg/ha. Observations were conducted on soil pH, soil and plant nutrients, growth of sweet corn (plant height and biomass weight, and microbial population. Research results showed that 15 kg/ha biofertilizer “M-Star” combined with inorganic NPK fertilizer could increase soil nutrients and sweet corn growth. This biofertilizer also increased the efficiency of inorganic fertilizer by 50%.
Examination of the pest status of corn-infesting Ulidiidae (Diptera).
Goyal, Gaurav; Nuessly, Gregg S; Seal, Dakshina R; Steck, Gary J; Capinera, John L; Meagher, Robert L
2012-10-01
Larvae of 11 species of picture-winged flies (Diptera: Ulididae) are known to feed on corn plants (Zea mays L.) in the western hemisphere. Larvae emerge from eggs deposited in leaf axils and corn silk to feed mostly within ears, but the primary versus secondary nature (i.e., pest status) of their infestation is not known for all of these species. Choice and no-choice tests by using a split-plot design were conducted in greenhouse and field trials to determine the pest status on sweet corn of three of these species found in Florida: Chaetopsis massyla (Walker), Euxesta eluta Loew, and E. stigmatias Loew. The main treatments (uninfested ears and ears experimentally infested with either Spodoptera frugiperda [Lepidoptera: Noctuidae] or E. eluta larvae) were applied at first silk. The subtreatments (C. massyla, E. eluta, or E. stigmatias adults caged on ears) were applied 7 d later and maintained for 10 d. All three fly species were reared from uninfested and experimentally infested ears in both choice and no-choice tests in greenhouse and field trials confirming both primary and secondary modes of ear infestation. More flies of all three species emerged from ears that were preinfested with S. frugiperda compared with uninfested ears suggesting either preference for or greater survival within ears previously infested by S. frugiperda. Fewer E. eluta and E. stigmatias emerged from ears preinfested with E. eluta in no-choice field tests, suggesting that previous infestation by this fly may negatively affect oviposition or that older fly larvae affect survival of neonate larvae. All three species studied here should be considered primary pests that can render unprotected sweet corn ears unmarketable.
Directory of Open Access Journals (Sweden)
Sutardi*
2010-12-01
Full Text Available The aim of this research was to determine the effects of type and amount of binder on the chemical and physical properties of sweet corn milk-like powder. Sweet corn milk-like powder was prepared from sweet corn kernel extracted with water with ratio of water and kernel of 2:1 (v/w, then dehydrated by spray dryer. Dextrin and arabic gum in various amount i.e. 2.5; 5.0; and 7.5% (w/v, respectively were added to the sweet corn milk-like before drying, and control was also made. The reducing sugar and total sugar, protein, fat, and moisture content, and as well as bulk density, colour, and solubility of the powder were then analyzed. The chemical and physical properties of sweet corn milk-like powder with addition of dextrin and arabic gum in the amount of 2.5; 5.0; and 7.5% (w/v were significantly different (p > 0.05. According to all aspects studied, sweet corn milk-like powder with addition of dextrin in the amount of 2.5% was the best product of all, which had reducing sugar of 5.00% (db; total sugar 17.01% (db; protein13.67% (db; fat 5.97% (db; moisture 5.38%; bulk density 0.47 g/cm3; and solubility of 93.70%.
Directory of Open Access Journals (Sweden)
S. A. Siadat
2015-06-01
Full Text Available In order to investigate the effect of Filter Cake application on some morpho-physiological characteristics and yield of sweet corn (Zea mays var saccharata under different irrigation regimes, an experiment was conducted in Ramin Agriculture and Natural Resources University, Khuzestan, in 2012. The experiment was arranged in split-plot design in RCBD (Completely Randomized Block Design with three replications. Treatments were drought stress (irrigation after 25, 50 and 75% depletion of available water content in main plots and Filter Cake (0, 10, 20 and 30 tonha-1 arranged in sub-plots. Results showed that drought stress increased electrolyte leakage (EL and proline content (PC while height of plant, relative water content (RWC, chlorophyll stability index and ear and grain yield were decreased. The intensive drought stress had the greatest effect on EL and PC (54% increase, and decreased ear and grain yield by21 and 37% compared to control, respectively. Application of filter cake on non-stress condition increased height of plant and economic yield. But Filter Cake in intensive stress reduced RWC and yield and increased EL compared to control. Also, the application of 30 tonha-1 of Filter Cake in intensive stress condition decreased ear and grain yield by 14.5 and 10.7% respectively. Thus, positive effect of Filter Cake application was clear on non-stress condition, but on drought stress condition it decreased the economic yield.
López, Juan D; Latheef, M A; Hoffmann, W C
2010-01-01
Newly emerged corn earworm adults, Helicoverpa zea (Boddie) (Lepidoptera: Noctuidae) require a carbohydrate source from plant or other exudates and nectars for dispersal and reproduction. Adults actively seek and forage at feeding sites upon eclosion in the habitat of the larval host plant or during dispersal to, or colonization of, a suitable reproductive habitat. This nocturnal behavior of H. zea has potential for exploitation as a pest management strategy for suppression using an adult feeding approach. This approach entails the use of a feeding attractant and stimulant in combination with a toxicant that when ingested by the adult will either reduce fecundity/fertility at sub-lethal dosages or kill the adult. The intent of this study was to assess reproductive inhibition and toxicity of emamectin benzoate on H. zea when ingested by the adults when mixed in ppm active ingredient (wt:vol) with 2.5 M sucrose as a feeding stimulant. Because the mixture has to be ingested to function, the effect of emamectin benzoate was also evaluated at sub-lethal and lethal concentrations on proboscis extension and gustatory response of H. zea in the laboratory. Feral males captured in sex pheromone-baited traps in the field were used for toxicity evaluations because they were readily available and were more representative of the field populations than laboratory-reared adults. Laboratory-reared female moths were used for reproduction effects because it is very difficult to collect newly emerged feral females from the field. Emamectin benzoate was highly toxic to feral H. zea males with LC(50) values (95% CL) being 0.718 (0.532-0.878), 0.525 (0.316-0.751), and 0.182 (0.06-0.294) ppm for 24, 48 and 72 h responses, respectively. Sub-lethal concentrations of emamectin benzoate did not significantly reduce proboscis extension response of feral males and gustatory response of female H. zea. Sublethal concentrations of emamectin benzoate significantly reduced percent larval hatch of
Directory of Open Access Journals (Sweden)
Rita Khatir
2015-09-01
Full Text Available Sweet corn has short shelf life at room temperature storage in the tropical countries (28-33°C. The quality deterioration of sweet corn can be determined by the decrease of its sugar content. The study aimed to estimate the shelf life of sweet corn based on the reduction of its total soluble solid (TSS by using Arrhenius model. The samples were prepared from fresh harvested corn stored for 10 days at 3 different temperatures of 5, 15 and 28 °C. Total soluble solid (TSS were analyzed every day by using abbe refractrometer. Organoleptic analysis was used by using hedonic scales from 1 to 7. The analysis was conducted until respondents had graded the samples at score 5 (dislike slightly, 6 (dislike and approaches can be used to calculate the shelf life of sweet corn. The acceleration factor for the TSS degradation at null approach, it was estimated that if the sweet corn were stored at temperature of 30, 25, 20, 15, 10 and 5°C, the shelf temperatures, the shelf life of sweet corn would be 3.7, 4.5, 5.6, 6.8, 8.4, and 10.3 days. In conclusion, the shelf life predictions of sweet corn were valid well with the experimental results. Keywords: Sweet corn, shelf life, total soluble solid ABSTRAK Umur simpan jagung manis relatif singkat apalagi kalau disimpan pada suhu ruang di negara-negara tropis (28-32°C. Kerusakan jagung manis dapat diindikasikan dengan penurunan kandungan gulanya. Penelitian ini bertujuan untuk menduga umur simpan jagung manis berdasarkan reaksi penurunan kandungan total padatan terlarutnya (TPT dengan pendekatan model Arrhenius. Jagung manis segar yang baru siap panen segera disimpan selama 10 hari pada 3 kombinasi suhu yaitu 5, 15 dan 28°C. Setiap hari dilakukan analisis kandungan TPT dengan . Uji organoleptik dilakukan dengan skala hedonik 1-7. Proses pengamatan dihentikan apabila responden telah memberikan nilai 5 (agak tidak suka, 6 (tidak suka dan 7 (sangat tidak suka. Pendekatan model Arrhenius dilakukan dengan dua
Banding urea and lignosulfonate in corn (Zea mays L.) production and 15N recovery
International Nuclear Information System (INIS)
Alkanani, T.; MacKenzie, A.F.
1996-01-01
The use of urea in corn (Zea mays L.) production is common. Under current N fertilizer recommendations for corn, urea may have adverse effects on corn growth when applied in a band. The effects of ammonium lignosulfonate (LS) on corn growth and on N uptake from the banded application of urea and diammonium phosphate (DAP) mixtures were investigated on two soils from eastern Quebec. Field experiments were initiated in the first week of May 1991 on an Ormstown silty clay and a Ste. Rosalie clay soils (fine, mixed, nonacid, mesic Typic Humaquepts). Treatments were two rates of urea (30 and 90 kg urea-N ha -1 ) in a combination with DAP (14kg N ha 1 ), with or without banded fertilizer solutions of LS (8 kg N ha -1 ) applied at planting 5 cm to the side and 3 cm below the seed. A no treatment control was included. The low rate of urea compared with the unfertilized plots. When compared with the unfertilized treatment, the high rate of urea and DAP (no LS added) caused 10% increase in grain yield. However, addition of LS to the high rate of urea and DAP increase grain yield by band 20%. In general, LS significantly increased corn N uptake from urea on both soils. Separate 15 N field experiments were initiated in June 1991. Mean recovery of 15 N ranged from 17.8% to 30.9% of the applied labelled urea. The rate of urea-N banded had no significant effect on immobilization, but LS resulted in significantly less 15 N immobilized. These observations suggest that LS can reduce the biological immobilization of urea-N and increase the efficiency of urea fertilizer by reducing the negative effects of banding high levels of urea, while attaining benefits of band placement. (author). 29 refs., 6 tabs
Directory of Open Access Journals (Sweden)
Juan David Rivera
2017-05-01
Full Text Available Corn (Zea mays L. is the second most cultivated cereal in the world and is use as raw material for different kind of industries. To date no reports about obtaining giberellic acid (GA3 from corn have been found. In the present study two methods for extracting solid samples were evaluated: lixiviation and dynamic sonication-assisted solvent extraction (DSASE, for obtaining giberellic acid from corn germinated seeds. In lixiviation, the physical method (agitation and sonication, solvent, and time were the parameters analyzed; while in DSASE the variables were: solvent, flow, and time. The most efficient technique was DSASE employing acetonitrile-formic acid 5% (80:20, v:v as solvent at a flow of 0.4 mL/min for 25,0 min, obtaining a concentration 30.012 mg/kg giberellic acid. The identification and quantification were performed by high performance liquid chromatography (HPLC with diode array detector (DAD. These results showed that dynamic sonication-assisted solvent extraction (DSASE is a novel and powerful alternative technique for obtaining giberellic acid, because of its high efficiency; low solvent consumption and simplicity in obtaining the extract.
Aerial spray deposition on corn silks applied at high and low spray rates
Corn earworm is a major pest of sweet corn, especially when grown organically. Aerial application of insecticides is important for both conventionally- and organically-grown sweet corn production as sweet corn is frequently irrigated to assure return on investment given the high production costs. ...
Directory of Open Access Journals (Sweden)
Yudi Sastro
2011-05-01
Full Text Available Several research has proven the role of dairy cattle effluents in improving the growth and yield of some crops. However, its role in supporting the growth and yield of sweet corn, especialy in Inceptisols, has not been reported. The study aims to determine the effect of dairy cattle effluents on growth and yield of sweet corn in Inceptisols. The pot study was conducted in a greenhouse of the Assessment Institute for Agriculture Technology of Jakarta. The treatments were fertilization using dairy cattle effluents (without dilution, dilution with water 1:1 and 1:2, a mixture of Urea, SP-36 and KCl (NPK, and without fertilizer. The experimental design was a completely randomized design with five replications. Compared to a without fertilizer treatment, dairy cattle effluents were significantly increased plant height (114%, leaf number (136%, cob weight (131%, cob length (124%, and cob diameters (128%. Base on cob weight, relative agronomic effectiveness (RAE of dairy cattle effluents reached 38.4% (without dilution, 47.5% (dilution with water 1:1, and 62.1% (dilution with water 1:2.
Kim, Min Jeong; Shim, Chang Ki; Kim, Yong Ki; Hong, Sung Jun; Park, Jong Ho; Han, Eun Jung; Kim, Jin Ho; Kim, Suk Chul
2015-09-01
This study investigated the chemical characteristics and microbial population during incubation of four kinds of aerated compost teas based on oriental medicinal herbs compost, vermicompost, rice straw compost, and mixtures of three composts (MOVR). It aimed to determine the effects of the aerated compost tea (ACT) based on MOVR on the growth promotion of red leaf lettuce, soybean and sweet corn. Findings showed that the pH level and EC of the compost tea slightly increased based on the incubation time except for rice straw compost tea. All compost teas except for oriental medicinal herbs and rice straw compost tea contained more NO(-) 3-N than NH(+) 4-N. Plate counts of bacteria and fungi were significantly higher than the initial compost in ACT. Microbial communities of all ACT were predominantly bacteria. The dominant bacterial genera were analyzed as Bacillus (63.0%), Ochrobactrum (13.0%), Spingomonas (6.0%) and uncultured bacterium (4.0%) by 16S rDNA analysis. The effect of four concentrations, 0.1%, 0.2%, 0.4% and 0.8% MOVR on the growth of red leaf lettuce, soybean and sweet corn was also studied in the greenhouse. The red leaf lettuce with 0.4% MOVR had the most effective concentration on growth parameters in foliage part. However, 0.8% MOVR significantly promoted the growth of root and shoot of both soybean and sweet corn. The soybean treated with higher MOVR concentration was more effective in increasing the root nodule formation by 7.25 times than in the lower MOVR concentrations Results indicated that ACT could be used as liquid nutrient fertilizer with active microorganisms for culture of variable crops under organic farming condition.
Directory of Open Access Journals (Sweden)
Marlina Neni
2017-01-01
Full Text Available This study objective was to determine the dose of organic and inorganic fertilizers which can increase N, P and K nutrients uptake as well as the growth and yield of sweet corn on inceptisol soil of lowland swamp. Inceptisol soil has low soil fertility and relatively low to moderate levels of organic matter content. Application of organic fertilizer on inceptisol soil of lowland swampis expected capable to increase N, P and K nutrients as well as yield of sweet corn. This research was conducted from April to July 2014 at Experimental Farm Area of Pulau Semambu Village, Indralaya Utara Subdistrict, Ogan Ilir District, South Sumatra Province. The method used in this research was randomized block design consisting treatments as follows: 75% inorganic fertilizer + 5 ton.ha−1organic fertilizer, 50% inorganic fertilizer + 5 ton.ha−1organic fertilizer, 25% inorganic fertilizer + 5 ton.ha−1 organic fertilizer, 0% inorganic fertilizer + 5 ton.ha−1organic fertilizer with six replications. The recommended dose of inorganic fertilizerswas 200 kg.ha−1 urea, 100 kg.ha−1 SP-36 and 100 kg. ha−1 KCl. The results showed that treatment of 75% of inorganic fertilizer + 5 ton.ha−1organic fertilizer had produced N, P and K nutrients uptake with magnitude of 1.850, 0.418 and 2.374 g.plant−1 respectively as well as good growth and yield of sweet corn with magnitude of 356.36 g. plant−1or 15.21 ton ha−1.
7 CFR 810.401 - Definition of corn.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Definition of corn. 810.401 Section 810.401... GRAIN United States Standards for Corn Terms Defined § 810.401 Definition of corn. Grain that consists of 50 percent or more of whole kernels of shelled dent corn and/or shelled flint corn (Zea mays L...
Bibb, Jenny L; Cook, Donald; Catchot, Angus; Musser, Fred; Stewart, Scott D; Leonard, Billy Rogers; Buntin, G David; Kerns, David; Allen, Tom W; Gore, Jeffrey
2018-05-28
Corn earworm, Helicoverpa zea (Boddie), commonly infests field corn, Zea mays (L.). The combination of corn plant biology, corn earworm behavior in corn ecosystems, and field corn value renders corn earworm management with foliar insecticides noneconomical. Corn technologies containing Bacillus thuringiensis (Bt) Berliner (Bacillales: Bacillaceae) were introduced that exhibit substantial efficacy against corn earworm and may reduce mycotoxin contamination in grain. The first generation Bt traits in field corn demonstrated limited activity on corn earworm feeding on grain. The pyramided corn technologies have greater cumulative protein concentrations and higher expression throughout the plant, so these corn traits should provide effective management of this pest. Additionally, reduced kernel injury may affect physical grain quality. Experiments were conducted during 2011-2012 to investigate corn earworm impact on field corn yield and grain quality. Treatments included field corn hybrids expressing the Herculex, YieldGard, and Genuity VT Triple Pro technologies. Supplemental insecticide treatments were applied every 1-2 d from silk emergence until silk senescence to create a range of injured kernels for each technology. No significant relationship between the number of corn earworm damaged kernels and yield was observed for any technology/hybrid. In these studies, corn earworm larvae did not cause enough damage to impact yield. Additionally, no consistent relationship between corn earworm damage and aflatoxin contamination was observed. Based on these data, the economic value of pyramided Bt corn traits to corn producers, in the southern United States, appears to be from management of other lepidopteran insect pests including European and southwestern corn borer.
Geographic information systems in corn rootworm management
Corn rootworms (Diabrotica spp. Coleoptera: Chrysomelidae) are serious pests of corn (Zea mays) in the United States and Europe. Control measures for corn rootworms (CRW) were historically based upon chemical pesticides and crop rotation. Pesticide use created environmental and economic concerns. In...
Directory of Open Access Journals (Sweden)
Hakime Ziaei
2016-05-01
Full Text Available In order to evaluate the intercropping of corn (Zea mays L. and bean cultivars (Phaseolus spp. an experiment was carried out in a randomized complete block design with three replicaties at Sari Agricultural Sciences and Natural Resources University during growing season of 2010. The experimental treatments consisted of sole cropping of corn, white bean, bush bean, red bean, pinto bean and sword bean and 50:50 ratio of corn and bean types. In this experiment, the corn-bush bean and corn-pinto bean intercropping had the highest seed yield (5734.4 and 5674.3 kg/ha-1, respectively and land equivalent ratio (LER=1.13 and 1.21, respectively. Evaluated intercropping indices indicated that red bean (k= 1.85, pinto bean (k= 2.41 and sword bean (k= 2.80 had the highest crowding coefficient whereas the maximum aggressivity value was belonged to pinto bean intercropped with corn (A= -0.02. Also, both the red bean and pinto bean (CR=0.75 and CR=0.98, respectively had the maximum competitive ratio. Furthermore, the most corn crowding coefficient (K=1.15 was belonged to corn and sword bean intercropping and maximum corn aggressivity value was observed in corn intercropped with white bean (A=+0.60 and bush bean (A=+0.69. In conclusion, according to competition indices, intercropping of 50% corn + 50 % red bean and pinto bean plants were superior as compared to other combinations.Also, both the red bean and pinto bean (CR=0.75 and CR=0.98, respectively had the maximum competitive ratio. Furthermore, the most corn crowding coefficient (K=1.15 was belonged to corn and sword bean intercropping and maximum corn aggressivity value was observed in corn intercropped with white bean (A=+0.60 and bush bean (A=+0.69. In conclusion, according to competition indices, intercropping of 50% corn + 50 % red bean and pinto bean plants were superior as compared to other combinations.
Effects of mulch practices on fresh ear yield and yield components of sweet corn
KARA, Burhan; ATAR, Bekir
2013-01-01
The experiment was carried out in the vegetation seasons of 2010 and 2011. The main purpose of the study was to determine the effects of mulch practices (a control-unmulched treatment, a plastic mulch treatment, and a straw mulch treatment) on fresh ear yield and some yield-related traits of sweet corn according to 3 sowing dates: 1 April, 15 April, and 1 May, respectively. The main effects of sowing dates were significant for the harvest period, the emerging rate from soil, the fresh ear yie...
Directory of Open Access Journals (Sweden)
Min Jeong Kim
2015-09-01
Full Text Available This study investigated the chemical characteristics and microbial population during incubation of four kinds of aerated compost teas based on oriental medicinal herbs compost, vermicompost, rice straw compost, and mixtures of three composts (MOVR. It aimed to determine the effects of the aerated compost tea (ACT based on MOVR on the growth promotion of red leaf lettuce, soybean and sweet corn. Findings showed that the pH level and EC of the compost tea slightly increased based on the incubation time except for rice straw compost tea. All compost teas except for oriental medicinal herbs and rice straw compost tea contained more NO⁻₃-N than NH⁺₄-N. Plate counts of bacteria and fungi were significantly higher than the initial compost in ACT. Microbial communities of all ACT were predominantly bacteria. The dominant bacterial genera were analyzed as Bacillus (63.0%, Ochrobactrum (13.0%, Spingomonas (6.0% and uncultured bacterium (4.0% by 16S rDNA analysis. The effect of four concentrations, 0.1%, 0.2%, 0.4% and 0.8% MOVR on the growth of red leaf lettuce, soybean and sweet corn was also studied in the greenhouse. The red leaf lettuce with 0.4% MOVR had the most effective concentration on growth parameters in foliage part. However, 0.8% MOVR significantly promoted the growth of root and shoot of both soybean and sweet corn. The soybean treated with higher MOVR concentration was more effective in increasing the root nodule formation by 7.25 times than in the lower MOVR concentrations Results indicated that ACT could be used as liquid nutrient fertilizer with active microorganisms for culture of variable crops under organic farming condition.
Directory of Open Access Journals (Sweden)
N Farid
2017-11-01
Full Text Available This study was carried out to assess the effect of coated urea fertilizer on yield and yield components of sweet corn (KSC 403 under different irrigation regimes, in Ramin Agriculture and Natural Sciences University, Iran by using strip split plot in a randomized complete block design with four replications. Three levels of deficit irrigation (100%, 80 and 60% of calculated water requirement of sweet corn were assigned as vertical factor and six sources of urea fertilizer (without urea, un-coated urea, sulfur-coated urea fertilizer, starch-coated urea, agar-coated urea and chitin-coated urea were assigned to horizontal factor. Effects of deficit water and source of fertilizer were statistically significant on plant height, 1000 kernel weight, ear diameter, and number of rows per ear, ear yield, biological yield and harvest index. Maximum of plant height (153.23 cm, 1000 kernel weight (104.51 g, grain yield (9853.3 kg/ha and biological yield (12471.6 kg/ha were obtained in chitin coated urea fertilizer. Maximum of ear diameter (4.67 cm and number of row per ear (13.22 were achieved in agar coated urea fertilizer and that of harvest index (45.79% was indicated by starch-coated urea. Maximum of length of ear, number of kernels per row and grain yield were 23.65cm, 25.83 and 7142 kg/ha, respectively, and were obtained with the using of chitin-coated urea fertilizer and 100% water requirement. Minimum values of these traits were 13.54 cm, 5.56 and 871 kg/ha, respectively, and were obtained by using of control (no urea application and 60% water requirement. Results showed that biopolymer coated urea is potent to improve some morphological characteristics and increase grain yield of sweet corn.
Directory of Open Access Journals (Sweden)
Angela Kwiatkowski
2011-12-01
Full Text Available In Brazil, the greengrocery market of sweet corn has been expanding along the country. In contrast, there have been few agri-industries canning sweet corn (Zea mays because of the lack of cultivars with agronomic characteristics proper to industrial purposes. The purpose of this study was to evaluate the general combining ability (GCA of seven inbred lines of sweet corn, and the specific combining ability (SCA of their hybrid combinations based on their agronomic traits, and the chemical composition of the grain. In the growing season 2006/2007, twenty-one single hybrids were evaluated in the Iguatemi Research Station, Maringá County, Northwestern Paraná, in Brazil using a complete randomized block design with four replications. Data were subjected to the analysis of variance and the genotypes were clustered by the Scott-Knott test. We estimated the GCA and SCA effects using the Griffing's method IV with the fixed model for plant height (PH, height of ear (EH, dehusked ears yield (DEY, reducing (RS and total sugars (TS, starch (ST, proteins (PTN, ether extract (EE and fibers (FB. The inbred line L4, which was originated from the 'Doce de Cuba', had the best GCA for crop yield and grain quality and therefore should be used in the next hybrid combinations. The hybrids L4xL5 and L3xL7 were the most promising with regard to crop yield and grain quality.No Brasil, poucas indústrias envazam o milho doce (Zea mays por causa da falta de cultivares para o processamento industrial. Em compensação, o mercado de milho verde doce aumentou. O objetivo deste estudo foi avaliar a capacidade geral de combinação (CGC de sete linhagens de milho doce e da capacidade específica de combinação (CEC das combinações híbridas, com base em características agronômicas e composição química dos grãos. Os vinte e um híbridos simples foram avaliados em blocos casualizados, com quatro repetições, durante o ano agrícola 2006/2007, no distrito de Iguatemi
Analysis of the genetic diversity of super sweet corn inbred lines using SSR and SSAP markers.
Ko, W R; Sa, K J; Roy, N S; Choi, H-J; Lee, J K
2016-01-22
In this study, we compared the efficiency of simple sequence repeat (SSR) and sequence specific amplified polymorphism (SSAP) markers for analyzing genetic diversity, genetic relationships, and population structure of 87 super sweet corn inbred lines from different origins. SSR markers showed higher average gene diversity and Shannon's information index than SSAP markers. To assess genetic relationships and characterize inbred lines using SSR and SSAP markers, genetic similarity (GS) matrices were constructed. The dendrogram using SSR marker data showed a complex pattern with nine clusters and a GS of 53.0%. For SSAP markers, three clusters were observed with a GS of 50.8%. Results of combined marker data showed six clusters with 53.5% GS. To analyze the genetic population structure of SSR and SSAP marker data, the 87 inbred lines were divided into groups I, II, and admixed based on the membership probability threshold of 0.8. Using combined marker data, the population structure was K = 3 and was divided into groups I, II, III, and admixed. This study represents a comparative analysis of SSR and SSAP marker data for the study of genetic diversity and genetic relationships in super sweet corn inbred lines. Our results would be useful for maize-breeding programs in Korea.
Corn Culture: A Story of Intelligent Design
Todd, Jude
2008-01-01
Scientists are not sure of how corn was created. There were two competing genetic theories about how corn came to be. One theory maintains that corn had been teased out of a wheatlike grass called teosinte (genus Zea), and the other contends that one now-extinct ancestor of corn had crossed with another grass, "Tripsacum," several millennia ago.…
Directory of Open Access Journals (Sweden)
Surtinah Surtinah
2016-03-01
Full Text Available Penelitian dilaksanakan secara eksperimen dengan menggunakan rancangan lingkungan acak lengkap dengan 3 kali ulangan, dan rancangan perlakuan yaitu waktu tanam kangkung sebagai tanaman tumpangsari pada budidaya jagung manis ( K yang terdiri dari : k1 = waktu tanam bersamaan; k2 = waktu tanam kangkung 1 minggu setelah tanam jagung manis; k3 = waktu tanam kangkung 2 minggu setelah tanam jagung manis; k4 = waktu tanam kangkung 3 minggu setelah tanam jagung manis; k5= penanaman jagung manis tunggal dengan waktu tanam = k1; k6 = penanaman kangkung tunggal dengan waktu tanam = k1. Hasil penelitian menunjukan bahwa kangkung sutera dapat ditanam bersamaan dengan waktu tanam jagungmanis, sampai dengan tiga minggu setelah tanam jagung manis. Hasil jagung manis tidak dipengaruhi oleh waktu tanam kangkung sutera yang berbeda. Nilai Kesetaraan Lahan pada sistem tumpangsari jagung manis dengan kangkung sutera adalah 1,83. Indeks Persaingan antara jagung manis dan kangkung sutera adalah 1,73. Kata kunci : Jagung manis, Kangkung sutera, Tumpangsari, NKL, Indeks Persaingan. Research conducted experiments using a completely randomized design environment with three replications, and design of treatment that is the time of planting silk kale as secondary crops to the cultivation of sweet corn (K consisting of: k1 = planting at the same time; k2 = time of planting silk kale 1 week after planting sweet corn; k3 = time of planting silk kale 2 weeks after planting sweet corn; k4 = time of planting silk kale 3 weeks after planting sweet corn; K5 = single planting sweet corn planting time = k1; k6 = single silk kale planting time = k1. The results showed that silk kale can be planted together with sweet corn planting time, up to three weeks after planting sweet corn. Results of sweet corn is not influenced by the timing of planting different silk kale. Land values in the cropping system Equality sweet corn with silk kale is 1.83. Competition index between
Szilagyi-Zecchin, Vivian Jaskiw; Ikeda, Angela Cristina; Hungria, Mariangela; Adamoski, Douglas; Kava-Cordeiro, Vanessa; Glienke, Chirlei; Galli-Terasawa, Lygia Vitória
2014-01-01
Six endophytic bacteria of corn roots were identified as Bacillus sp. and as Enterobacter sp, by sequencing of the 16S rRNA gene. Four of the strains, CNPSo 2476, CNPSo 2477, CNPSo 2478 and CNPSo 2480 were positive for the nitrogen fixation ability evaluated through the acetylene reduction assay and amplification of nifH gene. Two Bacillus strains (CNPSo 2477 and CNPSo 2478) showed outstanding skills for the production of IAA, siderophores and lytic enzymes, but were not good candidates as growth promoters, because they reduced seed germination. However, the same strains were antagonists against the pathogenic fungi Fusarium verticillioides, Colletotrichum graminicola, Bipolaris maydis and Cercospora zea-maydis. As an indication of favorable bacterial action, Enterobacter sp. CNPSo 2480 and Bacillus sp. CNPSo 2481 increased the root volume by 44% and 39%, respectively, and the seed germination by 47% and 56%, respectively. Therefore, these two strains are good candidates for future testing as biological inoculants for corn.
Directory of Open Access Journals (Sweden)
Eni Maftu’ah
2014-04-01
Full Text Available Peat soil is characterized by poor nitrogen (N availability. Ameliorants are expected to rectify this problem. This research aimed to study the effect of ameliorant on N availability and N uptake by sweet corn plant in degraded peatland. The experiment was conducted in the greenhouse in May-July 2011 and on peatland of Kalampangan Village, Palangkaraya, Central Kalimantan in September-December 2011. Burnt peat soil of Kalampangan was used in the greenhouse experiment and sweet corn was used as an indicator plant. The treatments consisted of two factors, i.e. compositions of ameliorants by weight (A1 = 80% chicken manure + 20% dolomite; A2 = 80% local farm weed + 20% dolomite; A3 = 80% mineral soil + 20% dolomite; A4 = 20% chicken manure + 20% local farm weed + 20% residue of Chinese water chestnut (Eleocharis dulcis + 20% mineral soil + 20% dolomite; and A5 = 19% chicken manure + 71.5% mineral soil + 9.5% dolomite and rates of those ameliorants (5, 10, 15, 20 and 25 t ha-1. The experiment was arranged in a completely randomized block design with three replications. Data were collected every two weeks for five times. Observations were made on soil pH, available N (NH4+, NO3-, plant height, and N uptake in root and shoot. The results showed that treatment A1 increased soil pH and availability of NH4+ and NO3- in peat soils at the maximum vegetative stage. Treatment A1 provided the highest N availability and N uptake by the plant. Field experiment showed that N uptake increased with the plant yield. Optimum yield of fresh corn cob was obtained from treatment A1 at the rate of 20 t ha-1. This research reconfirms the effectiveness of chicken manure and dolomite as peat soil ameliorant.
DEFF Research Database (Denmark)
Hirich, A.; Rami, A.; Laajaj, K.
2012-01-01
Yield and Crop Water Productivity are crucial issues in sustainable agriculture, especially in high-demand resource crops such as sweet corn. This study was conducted to investigate agronomic responses such as plant growth, yield and soil parameters (EC and Nitrate accumulation) to several deficit...
Tanakorn Rachapila; Dr. Sittha Jansirisak
2013-01-01
The competition in Thailand sweet corn industry relatively high: Bargaining power of suppliers: supplier concentration, availability of substitute input, importance of suppliers’ input to buyer and importance of industry to supplier; Intensity of Rivalry of rivalry among existing competitors: number of competitors, augmented capacity in large increments, value of fixed costs and exit barriers; Threat of entrants or potential competitors: economical scale; Determinant of buyer power: product d...
Determination of the genotoxic effects of Convolvulus arvensis extracts on corn (Zea mays L.) seeds.
Sunar, Serap; Yildirim, Nalan; Aksakal, Ozkan; Agar, Guleray
2013-06-01
In this research, the methanolic extracts of Convolvulus arvensis were tested for genotoxic and inhibitor activity on the total soluble protein content and the genomic template stability against corn Zea mays L. seed. The methanol extracts of leaf, stem and root of C. arvensis were diluted to 50, 75 and 100 μl concentrations and applied to corn seed. The total soluble protein and genomic template stability results were compared with the control. The results showed that especially 100 μl extracts of diluted leaf, stem and root had a strong inhibitory activity on the genomic template stability. The changes occurred in random amplification of polymorphic DNA (RAPD) profiles of C. arvensis extract treatment included variation in band intensity, loss of bands and appearance of new bands compared with control. Also, the results obtained from this study revealed that the increase in the concentrations of C. arvensis extract increased the total soluble protein content in maize. The results suggested that RAPD analysis and total protein analysis could be applied as a suitable biomarker assay for the detection of genotoxic effects of plant allelochemicals.
Corn residue utilization by livestock in the USA
Corn (Zea mays L.) residue grazing or harvest provides a simple and economical practice to integrate crops and livestock. Limited information is available on how widespread corn residue utilization is practiced by US producers. In 2010, the USDA-ERS surveyed producers from 19 states on corn grain ...
Directory of Open Access Journals (Sweden)
A. Mojab Ghasrodashti
2016-05-01
Full Text Available This experiment was conducted in order to study the influence of different levels of municipal solid waste compost and nitrogen rate on grain quality of sweet corn (Zea mays L. saccharata and some soil properties under Marvdasht conditions during growing season of 2008-2009. The experiment was arranged as split plots based on a randomized complete block design with two factors and three replications. Main plot included five levels of nitrogen fertilizer (100, 150, 200, 250 and 300 kg N.ha-1 and sub plots included four levels of municipal solid waste compost (10, 20, 30 and 40 t.ha-1. The Results showed that the highest fresh ear and grain yield resulted from application of 200 kg N.ha-1 and 40 t.ha-1 compost. The grain quality analysis showed that nitrogen had significant effect on grain nitrogen percent and had not significant effect on grain phosphorus and nitrogen content. Also, compost had significant effect on grain nitrogen and phosphorus percent but had no significant effect on grain potassium percent. Soil analysis results showed that effect of compost on organic matter, EC and pH and interactions between nitrogen and compost were significant only on soil nitrogen, potassium and phosphorus percent. Nitrogen had no significant effect only on soil nitrogen percent. Also, the results showed that optimum amount of grain nitrogen and phosphorus percent were gained by using 40 t.ha-1 municipal solid waste compost and optimum amount of grain potassium percent was achieved by using 30 t.ha-1 municipal solid waste compost. Application of 250 kg N.ha-1 and 40 t.ha-1 municipal solid waste compost consequences to optimum amount of soil nitrogen and potassium was gained and optimum amount of soil phosphorus was gained in 150 kg N.ha-1 and 40 t.ha-1 municipal solid waste compost treatments. In general, to achieve the optimum growth of this crop in similar soils, application of 250 kg N.ha-1 and 40 t.ha-1 municipal solid waste compost treatments could
Directory of Open Access Journals (Sweden)
M. Nasrolah Alhossini
2012-04-01
Full Text Available Sweet corn is one of the most important crops in Iran and due to its short period of growth, it has been an important position after wheat and barley in khorasane Razavi Province. In this study two methods of planting (one raised bed and furrow planting and 3 plant densities (65000, 75000 and 85000 plant/ha was evaluated on some of Morphological Traits, harvest index and conservable grain yield of sweet Corn(Chase and KSC403su Varieties in Torbat-e-Heidarie in saline (4.060ds/m condition on 2009. The experimental design was factorial based on RCBC with 4 replications. The result of ANOVA showed significant differences between Anthesis silking interval (ASI, tassel length, plant height, ear height, stem diameter, harvest index, and conservable grain yield of sweet corn varieties that effected by planting methods. the highest harvest index was belonged to Chase in 75000 Plant/ha on one raised bed planting method with 31.75% and the lowest mean was belonged to KSC403su in 85000 Plant/ha on furrow planting method with 14.93%. In addition the highest grain yield was belonged to chase variety at 75000 plant/ha and furrow planting method with 11.912 ton/ha, while the lowest grain yield was belonged to KSC403su variety at 85000 plant/ha and raised bed planting (3.610 ton/ha. The Chase variety was better than KSC403su Due to its canopy and photo period is shorter than KSC403su. The superiority of Chase variety can be related to better distribution of leaves, highest harvest index, conservable grain yield and plant arrangement in the row.
Soper, Alysha M; Whitworth, R Jeff; McCornack, Brian P
2013-01-01
Corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), and fall armyworm, Spodoptera frugiperda J.E. Smith, are occasional pests in sorghum, Sorghum bicolor L. Moench (Poales: Poaceae), and can be economically damaging when conditions are favorable. Despite the frequent occurrence of mixed-species infestations, the quantitative data necessary for developing yield loss relationships for S. frugiperda are not available. Although these species share similar biological characteristics, it is unknown whether their damage potentials in developing grain sorghum panicles are the same. Using no-choice feeding assays in the laboratory, this study examined larval growth and feeding duration for H. zea and S. frugiperda in the absence of competition. Each species responded positively when exposed to sorghum seed in the soft-dough stage, supporting evidence for the interactions between host-quality and larval growth and development. The results of this study also confirmed the suitability of using laboratory-reared H. zea to develop sorghum yield loss estimates in the field, and provided insights into the biological responses of S. frugiperda feeding on developing sorghum seed.
Soper, Alysha M.; Whitworth, R. Jeff; McCornack, Brian P.
2013-01-01
Corn earworm, Helicoverpa zea Boddie (Lepidoptera: Noctuidae), and fall armyworm, Spodoptera frugiperda J.E. Smith, are occasional pests in sorghum, Sorghum bicolor L. Moench (Poales: Poaceae), and can be economically damaging when conditions are favorable. Despite the frequent occurrence of mixed-species infestations, the quantitative data necessary for developing yield loss relationships for S. frugiperda are not available. Although these species share similar biological characteristics, it is unknown whether their damage potentials in developing grain sorghum panicles are the same. Using no-choice feeding assays in the laboratory, this study examined larval growth and feeding duration for H. zea and S. frugiperda in the absence of competition. Each species responded positively when exposed to sorghum seed in the soft-dough stage, supporting evidence for the interactions between host-quality and larval growth and development. The results of this study also confirmed the suitability of using laboratory-reared H. zea to develop sorghum yield loss estimates in the field, and provided insights into the biological responses of S. frugiperda feeding on developing sorghum seed. PMID:24219328
Effects of salt stress and mycorrhiza fungi on morpho-physiological characteristics of sweet corn
Directory of Open Access Journals (Sweden)
seyed Abdolreza kazemeini
2017-06-01
Full Text Available In order to investigate the interaction of mycorrhizal fungi and salinity on growth and physiological characteristics of sweet corn, a greenhouse experiment was conducted at College of Agriculture, Shiraz University, in 2014. The experimental design was factorial based on Completely Randomized Design in three replications. Treatments included salinity at four levels (0.4 (control, 4, 7, 10 dS m-1, and the fungi at three levels (no fungi (control, Glomus mosseae, Glomus intraradices. Results indicated that at flowering stage, with increasing salinity levels, leaf chlorophyll a, b and a+b content and carotenoid decreased at a rate of 18.9, 52.4, 33.1, and 34.5 respectively. Application of mycorrhiza under salinity, partially offset the negative impacts and increased tolerance of maize to NaCl by enhancing SOD and CAT activities, chlorophyll contents, carotenoid and K concentrations in leaves, plant height, leaf area, and total dry weight at flowering stage significantly, compared to control. The Na/K ratio at salinity level of 10 dS m-1 in treatments inoculated with GIN and GM fungi decreased by 39.69 and 40.45 percentage, respectively. Increases plant height, leaf area, total dry weight, concentrations of chlorophyll a, b, chlorophyll a+b and carotenoid and K, the activity of antioxidant enzymes compared with the control. Moreover, GIN type fungi had a greater advantage over GM and reduced the negative effects of salinity. Results indicated that application of mycorrhiza alleviated the adverse effect of salinity stress and improve the sweet corn dry weight up to 38 percentage at salinity level of 10 dS m-1.
Effect of eastern gamagrass on fall armyworm and corn earworm development
The fall armyworm, Spodoptera frugiperda (J.E. Smith) and the corn earworm, Helicoverpa zea (Boddie) are two important corn pests in the southern U.S. states. Effect of the leaves from the corn relative, the Eastern gamagrass (Tripsacum dactyloides L.) on fall armyworm and corn earworm development ...
Myresiotis, Charalampos K; Vryzas, Zisis; Papadopoulou-Mourkidou, Euphemia
2015-09-01
Corn (Zea mays L.) is one of the most important cereal crops in the world and is used for food, feed and energy. Inoculation with plant-growth-promoting rhizobacteria (PGPR) would reduce the use of chemical fertilisers and pesticides and could be suggested as an alternative practice for sustainable production of corn in modern agricultural systems. In this study, the effect of two Bacillus PGPR formulated products, Companion (B. subtilis GB03) and FZB24 (B. subtilis FZB24), on corn growth and root uptake of insecticide thiamethoxam was investigated. All bacterial treatments enhanced root biomass production by 38-65% compared with the uninoculated control, with no stimulatory effect of PGPR on above-ground biomass of corn. The uptake results revealed that, in plants inoculated with the PGPR B. subtilis FZB24 and B. subtilis GB03, singly or in combination, the uptake and/or systemic translocation of thiamethoxam in the above-ground corn parts was significantly higher at the different growth ages compared with the control receiving no bacterial treatment. The findings suggest that the PGPR-elicited enhanced uptake of thiamethoxam could lead to improved efficiency of thiamethoxam using reduced rates of pesticides in combination with PGPR as an alternative crop protection technique. © 2014 Society of Chemical Industry.
Deliza, R; Sgarbieri, V C; Rosenthal, A
1990-12-01
The objective of the present work was to develop a formulation for complementary infant and child feeding employing linear programing as a mathematical model for optimization. High lysine/high tryptophan sweet corn pulp in the dehydrated form was used as the main ingredient. The restrictions imposed on the model were nutrient requirements, adequate protein/energy ratio and minimum cost. The formula derived by the computer (FC) matched the amino acid requirements, the protein/energy ratio (NDPCal%) and was rated high in laboratory tests in terms of sensory qualities. The cost determined for this formula was competitive in relation to commercial products used for the same purpose. Formula A, which contained 5% more sweet corn pulp and 10% less whole powdered milk, did not differ in nutritional, sensorial and functional properties from the formula FC and was chosen for the field acceptability trial because of its lower cost. Formula A had protein efficiency ratio and Biological Value similar to casein for the rat but protein digestibility and net protein utilization were statistically lower (p less than 0.05) for formula A than for casein. Acceptability tested on children who were 8-18 months of age ranged from 80-90%, average value 87%.
Radio-induced inherited sterility in Heliothis zea (Boddie)
International Nuclear Information System (INIS)
Carpenter, J.E.
1985-01-01
Heliothis zea (Boddie) (Lepidoptera: Noctuidae) males and females were irradiated with substerilizing doses of radiation. These moths were inbred and outcrossed and observed for their ability to reproduce. The inherited deleterious effects resulting from the irradiated P 1 males were recorded for several generations. Larvae from both irradiated (10 krad) and normal parents were compared for their ability to survive under field conditions on whole-stage sweet corn and these results were compared with those from a laboratory study using meridic diet. Irradiated males and females and F 1 males from an irradiated (10 krad) male x normal female cross were released in the field and in field cages and observed for their ability to search/attract and secure a mate. Females that had mated with normal and irradiated (10 krad) males were studied to determine the effect of different mating histories on the subsequent mating propensity of the females. A 10-krad dose of radiation induced deleterious effects which were inherited through the F 2 generation. These radiation-induced deleterious effects were similar to those reported in other species of Lepidoptera. The relationship between the survival of normal larvae and larvae from irradiated parents was similar under laboratory and field rearing conditions. Females mated to normal males and males irradiated with 10 krad had the same mating propensity and experienced the same intermating interval. These effects of substerilizing doses of radiation and inherited sterility on the reproductive ability and behavior of H. zea suggest that a great potential exists for population suppression
Directory of Open Access Journals (Sweden)
L. Rostami
2016-05-01
Full Text Available In order to determinate the effects of plant densities in intercropped corn (Zea mays L. and bean (Phaseolus vulgaris L. on radiation absorption and use efficiency, an experiment was conducted at the Agricultural Research Station, Ferdowsi University of Mashhad, Iran during growing season of 2007-2008. This experiment was conducted in low input system. A randomized complete block design with three replications was used. Treatments were included bean intercropping with corn in normal density of bean plus 10%, 20% and 30% excess bean C (B+10%, C (B+20%, C (B+30%, increasing in density bean intercropping with corn in normal density of corn plus 10%, 20% and 30% excess corn B (C+10%, B (C+20%, B (C+30% and sole crops of corn (C and bean (B. Results indicated that leaf area index, radiation absorption, total dry matter and radiation use efficiency of corn increased in all intercropped treatments compared to sole cropping, but it reversed for bean. It seems that complementary and facilitative effects of intercropping were more for corn. Range of corn and bean radiation use efficiency was from 1.92 g.MJ-1 (in sole cropping and 0.72 g.MJ-1 {in (C+30% (B+30%} to 2.30 g.MJ-1 {in C (B+30%} and 1.45 g.MJ-1 (in sole cropping, respectively.
Zhang, Ruichang; Zhang, Haibo; Tu, Chen; Hu, Xuefeng; Li, Lianzhen; Luo, Yongming; Christie, Peter
2015-07-01
Toxicity of engineered nanoparticles on organisms is of concern worldwide due to their extensive use and unique properties. The impacts of ZnO nanoparticles (ZnO NPs) on seed germination and root elongation of corn (Zea mays L.) and cucumber (Cucumis sativus L.) were investigated in this study. The role of seed coats of corn in the mitigation toxicity of nanoparticles was also evaluated. ZnO NPs (1,000 mg L(-1)) reduced root length of corn and cucumber by 17 % (p < 0.05) and 51 % (p < 0.05), respectively, but exhibited no effects on germination. In comparison with Zn(2+), toxicity of ZnO NPs on the root elongation of corn could be attributed to the nanoparticulate ZnO, while released Zn ion from ZnO could solely contribute to the inhibition of root elongation of cucumber. Zn uptake in corn exposed to ZnO NPs during germination was much higher than that in corn exposed to Zn(2+), whereas Zn uptake in cucumber was significantly correlated with soluble Zn in suspension. It could be inferred that Zn was taken up by corn and cucumber mainly in the form of ZnO NPs and soluble Zn, respectively. Transmission electron microscope confirmed the uptake of ZnO NPs into root of corn. Although isolation of the seed coats might not be the principal factor that achieved avoidance from toxicity on germination, seed coats of corn were found to mitigate the toxicity of ZnO NPs on root elongation and prevent approximately half of the Zn from entering into root and endosperm.
Energy Technology Data Exchange (ETDEWEB)
Crepeau, M.; Khelifi, M.; Vanasse, A. [Laval Univ., Quebec City, PQ (Canada). Dept. of Soil Science and Agri-Food Engineering
2010-07-01
Corn is the main source for biofuel production in North America. However, both sweet pearl millet and sweet sorghum crops represent an interesting alternative to corn for ethanol production because of their high biomass yield under a wide range of environmental conditions and high concentration of readily fermentable sugars. Coproducts such as pressing residues can be also be utilized so that nothing is lost in the process. However, in order to improve the extraction of juice for ethanol production, the pressing process of this biomass must be optimized. Preliminary experiments were therefore conducted to optimize the juice extraction from sweet pearl millet and sweet sorghum using 2 different presses, notably a screw press and a manually operated hydraulic press. Both types of biomass were either chopped finely or coarsely and were exposed to various pressures with the hydraulic press. The volume of juice extracted from both crops increased linearly with increasing pressure. Sweet sorghum appeared to be a better feedstock for ethanol production because it produced about 0.03 to 0.06 litre of juice per kg of biomass more than sweet pearl millet. Juice extraction was more effective with the screw press, but only a small difference was noted between the 2 chopping modes.
International Nuclear Information System (INIS)
McMurtrey, J.E. III; Chappelle, E.W.; Kim, M.S.; Meisinger, J.J.; Corp, L.A
1994-01-01
Laser-induced fluorescence (LIF) is an active sensing technique capable of capturing immediate and specific indications of changes in plant physiology and metabolism as they relate to the concentration and photosynthetic activity of the plant pigments. Reflectance is a passive sensing technique that can capture differences in the concentration of the primary plant pigments. Fluorescence and reflectance were compared for their ability to measure levels of plant stress that are of agronomic importance in corn (Zea mays L.) crops. Laboratory LIF and reflectance spectra were made on excised leaves from field grown corn. Changes in the visible region of the spectrum were compared between groups of plants fertilized with seven different levels of nitrogen (N) fertilization. A pulsed nitrogen laser emitting photons at a wavelength of 337 nm was used as a fluorescence excitation source. Differences in maximum intensity of fluorescence occurred at 440 nm, 525 nm, 685 nm, and 740 nm. Significant separations were found between levels of N fertilization at several LIF wavelength ratios. Several reflectance algorithms also produced significant separations between certain levels of N fertilization
Directory of Open Access Journals (Sweden)
J. Mahmoodi,
2013-06-01
Full Text Available This research was conducted to evaluate the effects different concentrations of zinc sulfate applications at different growth stages on sweet corn at the Research Station of Faculty of Agriculture in Islamic Azad University, Tabriz branch in 2012. The study was conducted in split plot experiment based on Randomized Complete Block Design with three replications. Treatments were seven levels of zinc sulfate application methods: (control, soil application, foliar application at 6-8 leaf growth stage, tasseling, grain filling stage, foliar application at three stages, soil application with foliar application at three stages as main plot, three levels of foliar and soil application of zinc sulfate: (0.003, 0.005 and 0.007 for foliar application and 15, 25 and 35 kg/ha for soil application as sub plot. Results showed that the highest grain yield correlated characters were obtained in foliar application at three stages and soil application with foliar application at three stages. In these conditions increasing of dry grain yield and ear were more than 50%. The higher values for grain production were obtained in Zn foliar application with 0.005 concentration (25 kg/ha soil application. Zinc sulfate increased Zn content of grains produced more than 100%. Thus, using Zn not only increases sweet corn grain and ear yield but also increased quality of products.
Penyakit Layu Bakteri Stewart pada Jagung di Bali
I Gede Rai Maya Temaja; G.N. Alit Susanta Wirya; Ni Made Puspawati; Khairun Nisak Syahdu
2018-01-01
Stewart’s wilt is a serious disease of sweet corn (Zea mays). The typical symptoms of the disease are pale-green to yellow linear streaks parallel to the veins. The symptoms were observed on sweet corn in Denpasar, Tabanan, Gianyar, and Karangasem areas during a survey in 2015. Pathogen detection based on a polymerase chain reaction was carried out using total DNA obtained from symptomatic leaf samples and the pairs of primers, CPSL1/CPSR2c. The expected sized (~1100 bp) amplicon was detected...
Biofuel production in the Midwestern United States has largely focused on corn (Zea mays L.) grain for ethanol production and more recently, corn stover for lignocellulosic ethanol. As an alternative to conventional corn, tropical corn populations have been evaluated. Tropical corn is the term used ...
Bioethanol production from cassava peels using different microbial ...
African Journals Online (AJOL)
collynz
2016-07-27
Jul 27, 2016 ... (Manihot esculentum), corn (Zea mays) and sweet potato ... Ethanol concentration (v/v) was determined by extrapolation using ... carbohydrate composition can also lead to increase in the ... with the work of Sulfahri et al.
Directory of Open Access Journals (Sweden)
Zahra Zinati
2017-05-01
Full Text Available Carotenoids, a diverse group of colorful pigments, contribute to the development, light harvesting and photoprotection in plants as well as human health. Due to the interesting properties of carotenoids, enhanced carotenoid biosynthesis has been of ongoing interest. Recent advances in computational biology and bioinformatics make it more feasible to understand the transcriptional regulatory network underlying carotenoid biosynthesis. Studies on carotenoid biosynthesis in corn ( Zea mays L. have indicated the pivotal role of the phytoene synthase gene PSY1 (accession: GRMZM2G300348 in endosperm color and carotenoid accumulation in corn kernels. Computational approaches such as Genomatix, PlantPAN, PlantCARE, PlantTFDB and IGDE6 have been used for promoter prediction, regulatory features and transcription factor identification, as well as pairwise promoter comparisons. Four transcripts have been identified for the PSY1 gene. Based on Genomatix and PlantPAN, the promoter predicted for GRMZM2G300348_T01 was different from that predicted for the other three transcripts (GRMZM2G300348_T02, GRMZM2G300348_T03 and GRMZM2G300348_T04. The results indiated that the promoter of GRMZM2G300348_T01 has more diverse motifs involved in hormonal/environmental stress responses. The most significant result obtained from this study is the discovery of two transcription factors belonging to the HB family that are co-expressed with all four transcripts of PSY1 under environmental stresses. It is, therefore, likely that these transcription factors may act as critical regulators of PSY1 gene expression in corn. Identification of the proteins acting upstream of PSY1 within corn will shed light on the fine tuning of PSY1 expression regulation. Such an understanding would also contribute to metabolic engineering aimed at enhanced carotenoid biosynthesis.
Evaluation of growth traits and yield of new forage corn (Zea mays L. single cross combinations
Directory of Open Access Journals (Sweden)
S. Khavari Khorasani
2016-04-01
Full Text Available In this study 18 forage corn (Zea mays L. hybrid varieties were evaluated based on RCBD with four replications in Khorasan Razavi Agricultural and Natural Resources Research Centre, Iran, on 2008-2009. Result of analysis of variance showed that there was significantly difference between hybrids in forage yield, ear weight and ear to biomass ratio. Results of hybrids mean comparison with Duncan’s multiple range test showed that SC700 was higher than other investigated hybrids in forage yield trait. But hybrid 3 with 85.31 forage yield was the best hybrid in weight of ear and ear to biomass ratio. Though the SC704 hybrid was better than others for stem dry weight, ear dry weight and leaf area but there was not any significant difference between this hybrid and hybrid 3.
Evaluating Corn (Zea Mays L.) N Variability Via Remote Sensed Data
Sullivan, D. G.; Shaw, J. N.; Mask, P. L.; Rickman, D.; Luvall, J.; Wersinger, J. M.
2003-01-01
Transformations and losses of nitrogen (N) throughout the growing season can be costly. Methods in place to improve N management and facilitate split N applications during the growing season can be time consuming and logistically difficult. Remote sensing (RS) may be a method to rapidly assess temporal changes in crop N status and promote more efficient N management. This study was designed to evaluate the ability of three different RS platforms to predict N variability in corn (Zea mays L.) leaves during vegetative and early reproductive growth stages. Plots (15 x 15m) were established in the Coastal Plain (CP) and Appalachian Plateau (AP) physiographic regions each spring from 2000 to 2002 in a completely randomized design. Treatments consisted of four N rates (0, 56, 112, and 168 kg N/ha) applied as ammonium nitrate (NH4N03) replicated four time. Spectral measurements were acquired via spectroradiometer (lambda = 350 - 1050 nm), Airborne Terrestrial Applications Sensor (ATLAS) (lambda = 400 - 12,500 nm), and the IKONOS satellite (lambda = 450 - 900 nm). Spectroradiometer data were collected on a biweekly basis from V4 through R1. Due to the nature of - satellite and aircraft acquisitions, these data were acquired per availability. Chlorophyll meter (SPAD) and tissue N were collected as ancillary data along with each RS acquisition. Results showed vegetation indices derived from hand-held spectroradiometer measurements as early as V6-V8 were linearly related to yield and tissue N content. ATLAS data was correlated with tissue N at the AP site during the V6 stage (r2 = 0.66), but no significant relationships were observed at the CP site. No significant relationships were observed between plant N and IKONOS imagery. Using a combination of the greenness vegetation index (GNDVI) and the normalized difference vegetation index (NDVI), RS data acquired via ATLAS and the spectroradiometer could be used to evaluate tissue N variability and estimate corn yield variability
Quantitative analysis of allantoin in Iranian corn silk
E. Khanpour*; M. Modarresi
2017-01-01
Background and objectives: Zea mays is cultivated in different parts of Iran and corn silk is used in traditional medicine. Allantoin is one of the major compounds in corn silk. The purpose of this research was the quantitatve analysis of allantoin in corn silks belonging to several regions of Iran. Methods: The samples of corn silk were prepared from three provinces of Iran (Kermanshah, Fars and Razavi Khorasan). The dried plant materials were infused in boiling distilled water with a temper...
Visual responses of corn silk flies (Diptera: Ulidiidae)
Corn silk flies are major pests impacting fresh market sweet corn production in Florida and Georgia. Control depends solely on well-times applications of insecticides to protect corn ear development. Surveillance depends on visual inspection of ears with no effective trapping methods currently ava...
Kołodziejczyk, Izabela; Dzitko, Katarzyna; Szewczyk, Rafał; Posmyk, Małgorzata M
2016-04-01
Melatonin (MEL; N-acetyl-5-methoxytryptamine) plays an important role in plant stress defense. Various plant species rich in this indoleamine have shown a higher capacity for stress tolerance. Moreover, it has great potential for plant biostimulation, is biodegradable and non-toxic for the environment. All this indicates that our concept of seed enrichment with exogenous MEL is justified. This work concerns the effects of corn (Zea mays L.) seed pre-sowing treatments supplemented with MEL. Non-treated seeds (nt), and those hydroprimed with water (H) or with MEL solutions 50 and 500 μM (HMel50, HMel500) were compared. Positive effects of seed priming are particularly apparent during germination under suboptimal conditions. The impact of MEL applied by priming on seed protein profiles during imbibition/germination at low temperature has not been investigated to date. In order to identify changes in the corn seed proteome after applying hydropriming techniques, purified protein extracts of chilling stressed seed embryos (14 days, 5°C) were separated by two-dimensional electrophoresis. Then proteome maps were graphically and statistically compared and selected protein spots were qualitatively analyzed using mass spectrometry techniques and identified. This study aimed to analyze the priming-induced changes in maize embryo proteome and at identifying priming-associated and MEL-associated proteins in maize seeds subjected to chilling. We attempt to explain how MEL expands plant capacity for stress tolerance. Copyright © 2016 Elsevier GmbH. All rights reserved.
Costs of jasmonic acid induced defense in aboveground and belowground parts of corn (Zea mays L.).
Feng, Yuanjiao; Wang, Jianwu; Luo, Shiming; Fan, Huizhi; Jin, Qiong
2012-08-01
Costs of jasmonic acid (JA) induced plant defense have gained increasing attention. In this study, JA was applied continuously to the aboveground (AG) or belowground (BG) parts, or AG plus BG parts of corn (Zea mays L.) to investigate whether JA exposure in one part of the plant would affect defense responses in another part, and whether or not JA induced defense would incur allocation costs. The results indicated that continuous JA application to AG parts systemically affected the quantities of defense chemicals in the roots, and vice versa. Quantities of DIMBOA and total amounts of phenolic compounds in leaves or roots generally increased 2 or 4 wk after the JA treatment to different plant parts. In the first 2 wk after application, the increase of defense chemicals in leaves and roots was accompanied by a significant decrease of root length, root surface area, and root biomass. Four weeks after the JA application, however, no such costs for the increase of defense chemicals in leaves and roots were detected. Instead, shoot biomass and root biomass increased. The results suggest that JA as a defense signal can be transferred from AG parts to BG parts of corn, and vice versa. Costs for induced defense elicited by continuous JA application were found in the early 2 wk, while distinct benefits were observed later, i.e., 4 wk after JA treatment.
Directory of Open Access Journals (Sweden)
Tanakorn Rachapila
2013-07-01
Full Text Available The competition in Thailand sweet corn industry relatively high: Bargaining power of suppliers: supplier concentration, availability of substitute input, importance of suppliers’ input to buyer and importance of industry to supplier; Intensity of Rivalry of rivalry among existing competitors: number of competitors, augmented capacity in large increments, value of fixed costs and exit barriers; Threat of entrants or potential competitors: economical scale; Determinant of buyer power: product differentiation, switching costs to use other products, switching costs to use other products and buyers’ use of multiple sources, threat of substitute products or services relatively low.
The effect of different sowing patterns and deficit irrigation ...
African Journals Online (AJOL)
. The responses of sweet corn (Zea mays) to irrigation frequency and sowing patterns were studied in the field from December 2005 to December 2006. This research was laid out in split plot, with water quantity as main plot and sowing ...
International Nuclear Information System (INIS)
Zaharah, A.R.; Sharifuddin, H.A.H.; Anular, R.; Bah, A.R.; Mwange, K.Nk.; Kathuli, P.; Juma, P.
1998-01-01
Nitrogen fixation by Gliricidia sepium subjected to three pruning regimes (one, two or four cuts per year) was measured using the 15 N-dilution technique with Cassia siamea as the reference species. Over a 4-year period, estimates of the fraction of N derived from fixation, generally 2 fixer. Gliricidia sepium leaves were placed in litter-bags, buried in an ultisol and sampled at intervals over 70 days. The half-life for dry matter was 17 days, and about 60% of the N was lost within 10 days; K and Ca were the most rapidly released nutrients, with half-lives of only 1 and 3 days, respectively. The N contributions from G. sepium leaves and roots to alley-cropped sweet corn were quantified by the 15 N-dilution technique over three growing seasons. The application of leaves with roots resulted in increased N uptake and dry matter yield in corn. Below-ground competition between hedgerow and corn, assessed using 32 P with the third crop, occurred under conditions of low nutrient-availability. The data imply that there is no advantage of the cut-and-carry system over permanent hedgerows, provided that prunings are applied at the time of nutrient demand in the crop. (author)
Directory of Open Access Journals (Sweden)
A. Hedayatipour
2012-10-01
Full Text Available The chemical and fermentative parameters of three fresh forages and silages of sorghum including Sweet, Pegah and Speedfeed varieties were compared with corn using in vitro method, also degradability coefficients of forages and silages were determined by in situ method. Forages were planted in the same condition and harvested in soft dough stage, then ensilaged in four replicates for each time of 30, 60 and 90 days of preservation in mini silos. Buffering capacity in green Sweet sorghum was lower than corn and Speedfeed, and acid detergent fiber and water soluble carbohydrates respectively were significantly highest and lowest in fresh forage of Speedfeed sorghum. In time of 60 days, percent of acid detergent lignin of corn silage was lower than Sweet and Speedfeed sorghum silages; similarly, residual water soluble carbohydrate was lowest in corn silage. The lactate Concentration in corn and Pegah sorghums was higher than Sweet and Speedfeed silages. In corn and Sweet sorghum silages, Contents of acetic acid and ammonium nitrogen were highest and lowest, respectively. In nylon bag experiment, Degradation rate of corn and Pegah sorghum forages were significantly higher than Sweet and Speedfeed sorghums that cause to more effective degradability with passage rate of 0.08 in this forages. Also, the slowly degradation coefficient of corn silage was higher than sorghums silages. In conclusion, Speedfeed sorghum forage is not suitable for making silage in comparison others, and corn silage had more potential of degradability.
Biological control is known to be effective in reducing aflatoxin contamination of corn and some transgenic corn hybrids incur greatly reduced damage from corn earworm (Helicoverpa zea). We conducted seven field trials over two years to test the hypothesis that transgenic insect protection and biol...
Aracnidae diversity in soil cultivated with corn (Zea mays
Directory of Open Access Journals (Sweden)
Lígia Vanessa da Silva
2014-09-01
Full Text Available Studies carried out on the diversity and abundance of spiders may provide a rich information base on the degree of integrity of agricultural systems where they are found. In transgenic corn, Bacillus thuringiensis proteins are expressed in great amounts in plant tissues and may affect arthropod communities. Thus, the main goal of this work was to identify the spider diversity associated to transgenic and conventional corn hybrids. Pitfall collections were performed in conventional and transgenic corn plots during the 2010/2011 crop season, at the experimental field of the Agronomy Course of the University of Cruz Alta, RS. A total of 559 spiders were collected, from which 263 were adults and 296 young individuals. In the transgenic corn 266 spiders were collected and in the conventional one 293. Eleven families were determined and the adult individuals grouped in 27 morphospecies. Families with the largest number of representatives were Linyphiidae (29.70%, Theridiidae (5.72% and Lycosidae (5.01%. The most abundant morphospecies were Lyniphiidae sp. with 77 individuals, Erigone sp. with 40 individuals, Lynyphiidae sp. with 33 individuals, Theridiidae sp. with 21 individuals, Lycosa erythrognatha with 14 individuals and Lycosidae sp. with 13 individuals. The Shannon Diversity Index was higher for transgenic corn (H” =1.01 in February and smaller (H’=0.54 in the December collection in the conventional corn, and the Margaleff Richness Index showed higher diversity in December and February for the conventional corn (M=18.3, and smaller diversity for the transgenic corn in November (M=11.3. Families were classified in five guilds; two weavers: Irregular web builders and sheet web builders, and three hunter guilds: Night soil runners, ambush spiders and aerial night runners. The relative proportion of the spiders morphospecies found in this research, as well as the guilds, suggest that this group may not have been affected by the genetically
Liu, Kailin; Cao, Zhengya; Pan, Xiong; Yu, Yunlong
2012-08-01
The phytotoxicity of an herbicide in soil is typically dependent on the soil characteristics. To obtain a comparable value of the concentration that inhibits growth by 50% (IC50), 0.01 M CaCl(2) , excess pore water (EPW) and in situ pore water (IPW) were used to extract the bioavailable fraction of nicosulfuron from five different soils to estimate the nicosulfuron phytotoxicity to corn (Zea mays L.). The results indicated that the phytotoxicity of nicosulfuron in soils to corn depended on the soil type, and the IC50 values calculated based on the amended concentration of nicosulfuron ranged from 0.77 to 9.77 mg/kg among the five tested soils. The range of variation in IC50 values for nicosulfuron was smaller when the concentrations of nicosulfuron extracted with 0.01 M CaCl(2) and EPW were used instead of the amended concentration. No significant difference was observed among the IC50 values calculated from the IPW concentrations of nicosulfuron in the five tested soils, suggesting that the concentration of nicosulfuron in IPW could be used to estimate the phytotoxicity of residual nicosulfuron in soils. Copyright © 2012 SETAC.
Cliff, Margaret A; Law, Jessica R; Lücker, Joost; Scaman, Christine H; Kermode, Allison R
2016-01-15
Seedling roots of anthocyanin-rich corn (Zea mays) cultivars contain high levels of phenylalanine ammonia lyase (PAL) activity. The development of a natural dietary supplement containing corn roots could provide the means to improve the restrictive diet of phenylketonuria (PKU) patients by increasing their tolerance to dietary phenylalanine (Phe). Therefore this research was undertaken to explore the sensory characteristics of roots of four corn cultivars as well as to develop and evaluate food products (cereal bar, beverage, jam-like spread) to which roots had been added. Sensory profiles of corn roots were investigated using ten trained judges. Roots of Japanese Striped corn seedlings were more bitter, pungent and astringent than those of white and yellow cultivars, while roots from the Blue Jade cultivar had a more pronounced earthy/mushroom aroma. Consumer research using 24 untrained panelists provided hedonic (degree-of-liking) assessments for products with and without roots (controls). The former had lower mean scores than the controls; however, the cereal bar had scores above 5 on the nine-point scale for all hedonic assessments compared with the other treated products. By evaluating low-Phe food products containing corn roots, this research ascertained that the root-containing low-Phe cereal bar was an acceptable 'natural' dietary supplement for PKU-affected individuals. © 2015 Her Majesty the Queen in Right of Canada. Journal of the Science of Food and Agriculture © 2015 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
R. Amini
2017-08-01
Full Text Available Introduction: Corn (Zea mays L. is cultivated widely throughout the world and has the highest production among the cerealsafter rice and wheat. In Iran the total production of corn in 2013 was more than 2540000 tons. Weeds are one of the greatest limiting factors to decrease corn yield in Iran as the average yield loss due to weeds in the fields of Kermanshah in 2009 was 17.32 %. The herbicides are the main weed control method in conventional cropping systems but their application has been increased herbicide resistant weeds and environmental pollution. Integrated weed management combines all applicable including chemical and non-chemical methods to reduce the effect of weeds in the cropping systems. Thus, Weed control strategies such as tillage, mulch, cover crops and intercropping could be used for integrated weed management of corn. Previous studies showed that crop residues such as rye (Secale sereal L., wheat (Triticum aestivum L., barley (Hordeum vulgare L. and clover (Trifolium sp., cover crops and living mulch could inhibit weed germination and growth. Therefore the objective of this study was evaluating the effects of some integrated weed management treatments on weed characteristics, yield components and grain yield of corn. Materials and methods: In order to evaluate the effect of some weed management treatments on corn (Zea mays L. yield an experiment was conducted in 2014 in Ravansar, Kermanshah, Iran. This study was arranged based on randomized complete block design with 10 treatments and three replications. The weed management treatments were including 1-chemical control followed by mechanical control (application of nicosulfuron at a dose of 80 g.a.i.ha-1 + cultivator 40 days after emergence 2- chemical control followed by mechanical control (application of 2,4-D+MCPA at a dose of 675 g.a.i.ha-1 + cultivator 40 days after emergence 3- cultural control followed by mechanical control (planting hairy vetch (Vicia villosa in the fall
Directory of Open Access Journals (Sweden)
A.A.A.S. Trisnadewi
2011-08-01
Full Text Available The experiment that aimed to study the types and various levels of manure for improving growth and production of sweet corn was conducted for 9 weeks. Completely randomized design (CRD arranged with nested model was used in this experiment. The main plot consisted of three kind of manures, there were broiler manure (A, horse manure (K, and pig manure (B. As sub plot were levels of manure: without manure D0 (0 ton/ha, D1 (10 ton/ha = 87.51 g/pot, D2 (20 ton/ha = 175 g/pot, D3 (30 ton/ha = 262.5 g/pot, with three replication in each combination treatment. Variables measured in this experiment were plant high, stem diameter, fresh and dry weight of leaf, stem and maize-ear of corn, total dry weight of forage production (stem + leaf and dry weight ratio of stem and leaf of sweet corn. The result of the experiment showed that the effect of broiler, horse, and pig manure on all variables which measured in the experiment were not significantly different (P>0,05. The highest growth and production of sweet corn were obtained at 20 ton/ha level for all kind of manures that used in this experiment with total dry weight of forage production 48.88; 51.11; and 48.30 g/pot and dry weight of maize-ear production 23.80; 23.30 and 22.00 g/pot for broiler, horse and pig manure respectively. Based on results of the experiment it can be concluded that no different effect on type of manure (broiler, horse and pig to the growth and production of sweet corn and the using manure at 20 ton/ha level give the highest growth and production of sweet corn.
Mukhlis, Mukhlis; Lestari, Yuli
2013-01-01
This research aims to test the effectiveness of biofertilizer “M-Star” in increasing land productivity, growth of sweet corn and the efficiency of inorganic fertilizer used in acid sulphate soil of swampland. Research was conducted from May – July, 2012 in acid sulphate soil of Barambai, Barito Kuala Regency, South Kalimantan. The treatments involved (B1) Biofertilizer 25 kg/ha, (B2) Biofertilizer 15 kg/ha, (P1) NPK (recommendation dose), (P2) NPK (1/2 recommendation dose), (B1P1) Biofertiliz...
International Nuclear Information System (INIS)
Araujo Silva, J.C. de.
1982-01-01
In an oxid Paleudalf (Terra Roxa Estruturada) the nitrogen leaching losses are studied in a corn crop (Zea mays, L.) during one growing cycle (from 1979 October to 1980 February), through the study of soil water dynamics. The complete crop water balance is established using Hg manometer tensiometers. The variations of the NO - 3 -N concentration with the time and soil depth (60, 90 and 120cm) were followed by ceramic porous cup samples, some suggestions about the use of tensiometers and oil solutions samplers are presented, as well as, an apendice methodology used to determine the soil water conduction coefficients. (M.A.C.) [pt
Habtemariam, S
1998-05-01
Treatment of human endothelial cells with cytokines such as tumour necrosis factor-alpha (TNF) or E. coli lipopolysaccharide (LPS) induces the expression of several adhesion molecules and enhances leukocyte adhesion to endothelial cell surface. Interfering with this leukocyte adhesion or adhesion molecules upregulation is an important therapeutic target for the treatment of bacterial sepsis and various inflammatory diseases. In the course of screening marketed European anti-inflammatory herbal drugs for TNF antagonistic activity, a crude ethanolic extract of corn silk (stigma of Zea mays) exhibited significant activity. The extract at concentrations of 9-250 micrograms/ml effectively inhibited the TNF- and LPS-induced adhesiveness of EAhy 926 endothelial cells to monocytic U937 cells. Similar concentration ranges of corn silk extract did also block the TNF and LPS but not the phorbol 12-myristate 13-acetate-induced ICAM-1 expression on EAhy 926 endothelial cell surface. The extract did not alter the production of TNF by LPS-activated macrophages and failed to inhibit the cytotoxic activity of TNF. It is concluded that corn silk possesses important therapeutic potential for TNF- and LPS-mediated leukocyte adhesion and trafficking.
IDENTIFICATION OF LECTINS OF ZEA MAYS RAW MATERIAL AND THE STUDY OF LECTIN ACTIVITY
Directory of Open Access Journals (Sweden)
Karpiuk UV
2013-03-01
Full Text Available The aime of the study was to identify lectins in the Zea mays raw material: roots, stems, heads, leaves and corn silk and study their activity. Lectins activity has been studied using the biological method of ratuserytroagglutination. This method is based on formation of aggregates of lectins and rats erythrocytes. The activity unit was the floor amount of lectins that agglutinate erythrocytes. The protein nature of extracts that agglutinate has been determined using Bradford method. The lectins activity of Zea mays roots was 6,21±0,11 unit/mg of protein; of heads – 2,61±0,17 unit/mg of protein; of leaves – 0,62 ±0,05 unit/mg of protein; of corn silk – 1,06±0,08 unit/mg of protein; of stems – 0,97±0,09 unit/mg of protein. The greatest lectins activity was in leaves, stems and corn silk.
Comparison of corn, grain sorghum, soybean, and sunflower under limited irrigation.
Corn (Zea mays L.) and soybean [Glycine max (L.) Merr.] constitute a large share of the annual total irrigated planted area in the central Great Plains. This study aimed to determine the effect of limited irrigation on grain yield, water use, and profitability of corn and soybean in comparison with ...
Seed of sweet sorghum: studies on fermentation
Energy Technology Data Exchange (ETDEWEB)
Amaro, F A; Onetto, E; Angeloro, H; Victorio Gugliucci, S
1961-01-01
Both the percentage of starch transformed by saccharification with malt and the alcohol fermentation efficiency for four varieties of sweet sorghum is determined, and it is compared with those of a corn sample. Seeds of the varieties with low peel content yield values comparable to those of corn. Seeds of the varieties with high peel content give values lower than those of the low peel content, but, if they are previously peeled, the yield of both, in terms of transformed starch and alcohol produced, is improved, the values approaching those obtained with corn.
PROTECTION OF SWEET CORN FROM OSTRINIA NUBILALIS HBN. AND HELICOVERPA ARMIGERA HBN.
Vuković, S; Indić, D; Grahovac, M; Franeta, F
2015-01-01
O. nubilalis and H. armigera regularly occur and cause significant damages in corn crops in Serbia, particularly under global warming conditions. Several measures are applied against these pests (crop rotation, tolerant and resistant hybrids, monitoring, forecast, chemical measures). Larvae damage stem, panicle and ear, which favour development of saprophytes and secondary infections by mycotoxin producing, pathogenic fungi. The aim of the paper was to test the efficacy of the insecticides azadirachtin and indoxacarb in sweet corn protection against the mentioned pests. The trials were conducted in 2014 at two localities (Becej B. and PoIjanice P.) on sweet corn, hybrid Enterprise according to standard OEPP methods (PP1/13; 1/152; 1/135). Products on the basis of azadirachtin (10 g a.i./I of product) at a rate of 0.4 and 0.5% and indoxacarb (150 g a.i./I of product) at a rate of 0.25 I/ha, were applied. Treatments were conducted on the 5th of August with tractor sprayers (high clearance). The plot size was 5000 m². Three assessments were made. The first one prior to treatment, on 25 randomly selected plants per replicate, and the number of O. nubilalis and H. armigera egg masses and larvae on silk was registered. In the second assessment (18th of August), on 20 randomly selected plants per replicate, the number of damaged plants and the number of vital larvae was registered. In the third assessment, immediately before harvest (28th of August, i.e. 12th of September) on 20 randomly selected plants per replicate, the number of plants broken below ear (fallen on the ground), damaged ears and vital larvae, was determined. Results are presented as means, efficacy (E%) according to Abbott and significance of differences by LSD test (5%). At B locality egg masses of O. nubilalis were registered on ear silk on 13-19% of plants and larvae on 3-7%, and larvae of H. armigera on 2-4%. At P locality egg masses of O. nubilalis were present on 34-40.8% of plants. After 13 days
International Nuclear Information System (INIS)
Mostafa, A.Z.; Amato, M.; Hamdi, A.; Mostafa, A.Z.; Galal, Y.G.M.; Lotfy, S.M.
2012-01-01
Germination and early growth of maize Sweet Maize (Zea mays L.), var. (SEL. CONETA) under irrigation with saline water were investigated in a pot experiment with different soil types. Seven salinity levels of irrigation water up to 12 dS/m were used on a Clay soil (C) and a Sandy-Loam (SL). Emergence of maize was delayed under irrigation with saline water, and the final percentage of germination was reduced only at 8 dS/m or above. Seedling shoot and root growth were reduced starting at 4 dS/m of irrigation water. Salts accumulated more in the C soil but reductions in final germination rate and seedling growth were larger in the SL soil, although differences were not always significant. Data indicate that germination is rather tolerant to salinity level in var. SEL. CONETA whereas seedling growth is reduced at moderate salinity levels, and that soil type affects plant performance under irrigation with saline water
genome-wide association and metabolic pathway analysis of corn earworm resistance in maize
Marilyn L. Warburton; Erika D. Womack; Juliet D. Tang; Adam Thrash; J. Spencer Smith; Wenwei Xu; Seth C. Murray; W. Paul Williams
2018-01-01
Maize (Zea mays mays L.) is a staple crop of economic, industrial, and food security importance. Damage to the growing ears by corn earworm [Helicoverpa zea (Boddie)] is a major economic burden and increases secondary fungal infections and mycotoxin levels. To identify biochemical pathways associated with native resistance mechanisms, a genome-wide...
Leznicki, A. J.; Bandurski, R. S.
1988-01-01
The first enzyme-catalyzed reaction leading from indole-3-acetic acid (IAA) to the myo-inositol esters of IAA is the synthesis of indole-3-acetyl-1-O-beta-D-glucose from uridine-5'-diphosphoglucose (UDPG) and IAA. The reaction is catalyzed by the enzyme, UDPG-indol-3-ylacetyl glucosyl transferase (IAA-glucose-synthase). This work reports methods for the assay of the enzyme and for the extraction and partial purification of the enzyme from kernels of Zea mays sweet corn. The enzyme has an apparent molecular weight of 46,500 an isoelectric point of 5.5, and its pH optimum lies between 7.3 and 7.6. The enzyme is stable to storage at zero degrees but loses activity during column chromatographic procedures which can be restored only fractionally by addition of column eluates. The data suggest either multiple unknown cofactors or conformational changes leading to activity loss.
Directory of Open Access Journals (Sweden)
Hartati Chairunnisa*
2009-12-01
Full Text Available The aims of this study were to determine the effect of full cream milk powder addition to the quality of fermented drink from sweet corn extract. The quality examined were total bacteria, total solid, lactic acid content, and acceptability including colour, texture, flavor, and overall acceptance. The experiment was set up in a Completly Randomized Design with five levels of full cream milk powder (8, 10, 12, 14, 16% and four replications. The results showed that addition 12% of full cream milk powder in sweet corn extract resulted in acceptable fermented drink containing of 11.2 x 109 cfu/g lactic acid bacteria, 17.8% total solid, and 0.95% lactic acid. This formula had yellow color, desired texture & flavor and recieived the highest score of overall acceptance.
International Nuclear Information System (INIS)
McMurtrey, J.E. III; Chappelle, E.W.; Kim, M.S.; Corp, L.A.; Daughtry, C.S.T.
1996-01-01
The sensing of spectral attributes of corn (Zea mays L.) grain from site specific areas of the field during the harvest process may be useful in managing agronomic inputs and production practices on those areas of the field in subsequent growing seasons. Eight levels of nitrogen (N) fertilization were applied to field grown corn at Beltsville, Maryland. These N treatments produced a range of chlorophyll levels, biomass and physiological condition in the live plant canopies. After harvest, spectra were obtained in the laboratory on whole grain samples. Fluorescence emissions were acquired from 400 to 600 nm and percent reflectance were measured in the visible (VIS) near infrared (NIR) and mid-infrared (MIR) regions from 400 nm to 2400 nm. A ultraviolet (UV) excitation band centered at 385 nm was the most effective in producing fluorescence emission differences in the blue-green region of the fluorescence spectrum with maxima centered from 430-470nm in the blue and with an intense shoulder centered at around 530-560 nm in the green region. Reflectance showed the most spectral differences in the NIR and MIR (970-2330 nm) regions
Induction of infection in Teosinte (Zea diploperennis through the phytopathogen Ustilago maydis.
Directory of Open Access Journals (Sweden)
Martha Concepción Pérez Díaz
2017-01-01
Full Text Available Introduction: The corn and teosinte share morphological and molecular similarities latter being those that support the theory of teosinte (Zea parviglumis as its predecessor, both species are attacked by specific pathogens like Ustilago maydis. Objective: To analyze the infectious process that presents U. maydis on the variety of the teosinte Zea diploperennis. Materials and Methods: We used the strain of U. maydis FB-D12, which was kept a culture media rich in nutrients (CPES pH 7.0. Viable cells without morphological alterations to the inoculation method of puncture in teosinte seedlings were used. Monitoring of infection was carried out every 24 hours by measuring concentration of chlorophyll and plant tissue through microscopic observation Results: In the seedlings of Zea diploperennis inoculated with U. maydis the symptoms of the infection were presented, wilt and chlorosis in the leaves; The chlorosis was confirmed with the low concentration of chlorophyll 12 days later to the inoculation. In the microscopic observation of cuts of the tissue plant was found mycelium long and branched from the third day of the inoculation, until the appearance of tumors in seedlings of 45 days. Conclusions: The typical signs of infection with Ustilago maydis in the variety of teosinte Zea diploperennis do not differ from those reported for corn. Ustilago maydis presents its full life cycle within the plant, confirming that the diploperennis variety is susceptible.
The use of corn (ZEA MAYS) biomass in drying process
International Nuclear Information System (INIS)
Kricka, T.; Pliestic, S.
1996-01-01
The most important agricultural crop in the world, besides wheat and rice is corn. In the last 10 years, Republic of Croatia has produced about 2000000 tons of corn. Most of that is used for food and feed and for seed production and it is 1000000 tons in quantity. This quantity demands between 35000 to 40000 tons of oil. For the reason, this paper describes the possibilities of the substitution of oil with corn biomass after harvesting. (author)
Asian corn borer (ACB) and non-ACB pests in GM corn (Zea mays L.) in the Philippines.
Afidchao, Miladis M; Musters, C J M; de Snoo, Geert R
2013-07-01
The Asian corn borer (ACB), Ostrinia furnacalis (Guenée), has become the most damaging pest in corn in south-east Asia. Corn farmers in the Philippines have incurred great yield losses in the past decades because of ACB infestation. Bacillus thuringiensis (Bt) and Bt herbicide-tolerant (BtHT) corns have been developed to reduce borer attacks worldwide. This study assessed the extent of ACB and non-ACB pest infestations in both GM and non-GM corn in Isabela Province, the Philippines. Specific aims were to reinvestigate the efficacy of Bt corn in controlling ACB, to evaluate what parts of Bt corn plants are susceptible to ACB, to monitor the potential development of ACB resistance and to evaluate whether secondary pests dominate in an ACB-free Bt corn environment. The study involved preparatory interviews with farmers, site selection, field scouting and visual inspection of 200 plants along 200 m transect lines through 198 cornfields. Bt corn can efficiently reduce the ACB pest problem and reduce borer damage by 44%, to damage levels in Bt and BtHT corn of 6.8 and 7% respectively. The leaves of Bt corn were more susceptible, while cobs of Bt corn were less affected by ACB. Non-ACB pests were common in Bt toxin-free cornfields and reduced in non-GM cornfields where ACB was abundant. No secondary pest outbreaks were found in ACB-free Bt cornfields. Bt and BtHT corn hybrids containing the Cry1Ab protein performed well in Isabela Province. Reduced cob damage by ACB on Bt fields could mean smaller economic losses even with ACB infestation. The occurrence of ACB in Bt and BtHT cornfields, although at a moderate and insignificant level, could imply the potential development of resistance to Bt toxin. © 2012 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Fabiana E. Gallardo
2017-02-01
Full Text Available Euxestophaga Gallardo, a new genus of Eucoilinae (Hymenoptera, Cynipoidea, Figitidae and Euxestophaga argentinensis Gallardo, sp. n. from Argentina, are described and illustrated. This new genus belongs to the Ganaspini and morphologically resembles Epicoela Borgmeier and Striatovertex Schick, Forshage and Nordlander. A key to differentiate these genera is given. Specimens were reared from pupae of Euxesta eluta Loew (Diptera: Otitidae, attacked Bt sweet corn in Santa Fe province and other in Tucumán province (Argentina.
Results of mycological and mycotoxicological investigations of corn-based feed for dairy cow diet
Directory of Open Access Journals (Sweden)
Škrinjar Marija
2011-01-01
Full Text Available In this study, fungal contamination was determined as well as total aflatoxin B1(AB1, ochratoxin A (OTA and zearalenon (ZEA levels in corn-based feed samples obtained from four different farms in Serbia (n=35 during one year. Mycotoxins were detected in feed using the VICAM fluorometric method. It was determined that 97.14% of all samples were contaminated with moulds which belonged to following genera: Absidia, Acremonium, Aspergillus, Cladosporium, Geotrichum, Eurotium, Fusarium, Mucor, Mortierella, Oidiodendron, Penicillium, Rhizopus, Scopulariopsis, Syncephalastrum, Trichoderma, Ulocladium and Wallrothiella. A total of 58 different species were identified. Total mould count per 1 g ranged from 1.00 log cfu/g (dried corn silage - autumn, fresh corn silage - summer and corn grain silage - spring to 7.32 log cfu/g (dried corn silage - winter. Mycotoxins were isolated from 28.5% of samples: ZEA was found in summer (220-240 μg/kg and in spring (240 μg/kg in concentrate samples; OTA was detected in winter in dried corn silage (16 μg/kg and in spring (12 μg/kg; all samples were AB1 free.
Caractérisation de la mycoflore de grains de maïs ( Zea mays ...
African Journals Online (AJOL)
English Title: Characterization of the fungal flora of maize grains (Zea mays) ... Corn kernels disinfected with alcohol were seeded in sterile Petri dishes with ... Fusarium oxysporum (22.05%) and Aspergillus niger (17.78%) are the most ...
Directory of Open Access Journals (Sweden)
Dayane Rosalyn Izidoro
2007-10-01
Full Text Available In this work, it was used starch obtained from green banana (Musa cavendishii and commercial corn (Zea mays starch in order to compare the granule morphology and the rheological behavior of these gel-starches. Images of starch granules morphology were obtained from scanning electron microscope (SEM. The banana starch granules presented an oval and ellipsoidal shape with irregular diameters. Neverthless, the granules of corn starch showed a poliedric shape, with different sizes. The rheological behavior of gel starch solutions showed a non-newtonian character with a pseudoplastic behavior. Herschel-Bulkley model gave a good description on the rheological behavior of the gel starch. Banana gel-starch solutions showed higher values of shear stress and apparent viscosity when compared with corn gel-starch solutions. A progressive decrease in shear stress and viscosity occurred with the addition of sodium chloride and sucrose.No presente trabalho foi utilizado amido obtido de banana verde (Musa cavendishii e amido de milho (Zea mays comercial, com o objetivo de comparar a morfologia dos grânulos e o comportamento reológico dos géis. As imagens da morfologia dos grânulos foram obtidas por microscopia eletrônica de varredura. Os grânulos de amido da banana apresentaram forma oval e elipsoidal com diâmetros irregulares, todavia, os grânulos do amido de milho mostraram forma poliédrica e diferentes tamanhos. As análises reológicas dos géis das soluções de amido mostraram caráter não-newtoniano, pseudoplástico. O modelo de Herschel-Bulkley foi o que melhor representou comportamento reológico dos géis. O gel de amido de banana verde obteve maiores valores de tensão de cisalhamento e viscosidade aparente quando comparada ao gel de amido de milho. Ocorreu um decréscimo progressivo na tensão de cisalhamento e na viscosidade com a adição de cloreto de sódio e sacarose aos géis.
Physicochemical, Thermal, and Sensory Properties of Blue Corn (Zea Mays L.).
Mutlu, Ceren; Arslan-Tontul, Sultan; Candal, Cihadiye; Kilic, Ozlem; Erbas, Mustafa
2018-01-01
The aim of this study was to investigate some physicochemical and sensory properties of blue corn cultivated in Turkey. The length and width of the cob with kernels, hectoliter, and 1000-kernel weight of blue corn were measured as 7.66, 2.02 mm, 84.40 kg/100 L, and 44.27 g, respectively. The gelatinization onset, peak, and end temperatures were measured as 61.12 °C, 64.35 °C, and 75.65 °C, respectively. The water activity, moisture content, total protein, lipid, and crude fiber contents of the blue corn sample were detected as 0.44, 9.39%, 13.13%, 4.30%, and 2.68%, respectively. Total starch and resistant starch contents of blue corn were determined as 63.94% and 8.89%, respectively. Also, total monomeric anthocyanin content and antioxidant capacity of blue corn were detected as 915.43 mg CGE/kg and 7.99 μmol TE/g, respectively. Additionally, the major fatty acids detected in blue corn samples were palmitic, stearic, oleic, and linoleic acids. Blue corn can be utilized in the production of enjoyable and healthier snacks, such as popcorn and chips, because of its color and high phenolic, anthocyanin, and fiber contents. © 2017 Institute of Food Technologists®.
(Zea mays L.) GENOTYPES BY LEPIDOPTEROUS STEM BORERS
African Journals Online (AJOL)
Admin
The three maize endosperm types used in the experiment were susceptible to stem borer infestation, but there was no statistical difference with respect to stem borer infestation and severity of damage for July and August cropping, although, sweet corn tended to be more susceptible than the other endosperm types (flint and.
Milk line as an indicator of the harvesting time of three hybrid seeds of corn (Zea mays L.
Directory of Open Access Journals (Sweden)
Célio Trzeciak dos Santos
2005-03-01
Full Text Available The experiment was carried out to evaluate the time for harvesting seeds of three hybrids of corn (Zea mays L. at their best physiological quality and the use of the milk line as an indicator of the physiological seed maturity. Single hybrids CD 1723 and CD 5501 and double hybrid OC 705 seeds were collected for 59 days, every four days, starting 23 days after female flowering. Seed dry weight, moisture content, germination, vigour (cold and accelerated aging tests, black layer formation and seed milk line development were analysed. The harvesting time started 47 days after female flowering with high physiological quality of the seeds identified by a joint analysis of those seven characteristics of them. The milk line at stage 4 proved to be the best indicator of the time to harvest corn seeds for maximum physiological quality, because different stages of milk line development in corn seeds could be easily identified in the filed without any special equipment.O experimento foi conduzido durante o ano agrícola de 1996/97 em área experimental da Cooperativa de Desenvolvimento Econômico e Tecnológico (Coodetec, em Cascavel, Paraná, com o objetivo de avaliar o efeito da época de colheita de três híbridos de milho (Zea mays L. na qualidade fisiológica das sementes e o uso da linha de solidificação do endosperma como indicativo da maturidade fisiológica das sementes. O plantio foi realizado em 30 de setembro de 1996. Amostras de sementes dos híbridos simples CD 1723 e CD 5501, bem como do híbrido duplo OC 705, foram colhidas em intervalos de quatro dias, durante 59 dias, iniciando-se a colheita no vigésimo terceiro dia após o florescimento feminino. As características avaliadas nas sementes foram o acúmulo de matéria seca, o conteúdo de umidade, a germinação, o vigor (pelos testes de frio e de envelhecimento acelerado, a formação da camada preta e o desenvolvimento da linha de solidificação do endosperma. A colheita dos tr
Uptake of Zn++ and aflatoxin from perlite and liquid culture by Zea mays seedlings
International Nuclear Information System (INIS)
Llewellyn, G.C.; Reynolds, J.D.; Hurst, L.; Vance, R.A.; Dashek, W.V.
1982-01-01
The present paper reports our attempts to determine whether in inclusion of 0.0014 mM Zn ++ within a hydroponic culture medium affects the ability of 12-day-old Zea mays, cv. 'SS-522' to take-up [ 3 H]-aflatoxin B 1 . Data from the corollary experiment., i.e., whether inclusion of aflatoxin affects the ability of Zea mays, cvs. 'Truckers White', 'X-Sweet' and 'Merit' to take-up 65 ZnCl 2 are presented also. This report is a preliminary to one regarding an in-progress analysis of whether pollutant levels of Zn ++ affect aflatoxin uptake and distribution. In the absence of irrigating seedlings, which were grown in Perlite containing 65 ZnCl 2 , with a solution containing mixed aflatoxins, the stem contained the greatest amount of label with root plus seed the next highest and the leaf the least for each of the cvs. In contrast, when the seedlings were irrigated with a solution containing mixed aflatoxins, the root plus seed contained either an amount nearly identical to (cv. 'Truckers White') or in excess of that within the stem (cvs. 'X-Sweet' and 'Merit'). Calculation of the percentages of aflatoxin-induced diminutions in leaf, stem and root label suggested that the aflatoxins interfered with the translocation of 65 ZnCl 2 from the root to the stem and leaf, at least for cvs 'X-Sweet' and 'Merit'. (orig./AJ)
Owens, D; Nuessly, G S; Kendra, P E; Colquhoun, T A; Seal, D R
2017-08-01
Fresh market sweet corn (Zea mays L., convar. saccharata var. rugosa, Poales: Poaceae) ears produced in Florida are damaged by the larvae of Euxesta stigmatias Loew, Euxesta eluta Loew, and Chaetopsis massyla Walker (Diptera: Ulidiidae) that renders ears unmarketable. No standard lure exists for monitoring these pests. Oviposition substrate and attractant bioassays were designed to identify attractive substrates for further semiochemical investigation. Frass from the fall armyworm, Spodoptera frugiperda J.E. Smith (Lepidoptera: Noctuidae), was more attractive than other ovipositional substrates tested for E. eluta and C. massyla, and resulted in greater ovipositional output. Tassel-derived armyworm frass was more attractive than leaf-derived frass for oviposition. Frass also resulted in greater oviposition output by two species. In attraction bioassays, frass was generally preferred over the corresponding corn tissue, and only C. massyla demonstrated a preference for silk-frass over tassel-frass. The most promising substrates were then evaluated by electroantennography (EAG) to quantify olfactory responses. Frass volatiles also elicited greater antennal responses than corn volatiles. With tassel-frass, greater amplitude EAG responses were recorded from immature E. eluta female antennae, while mature female E. stigmatias exhibited greater responses. Equivalent antennal response to silk-frass was observed from E. eluta. Overall, silk-frass elicited the greatest EAG responses among all three fly species. Our results indicate that armyworm frass is an important resource in the chemical ecology of corn-infesting silk flies, and this substrate warrants further investigation for potential attractants that may facilitate development of novel management tools for these pests. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Uptake and distribution of cadmium in corn
International Nuclear Information System (INIS)
Peel, J.W.; Vetter, R.J.; Christian, J.E.; Kessler, W.V.; McFee, W.W.
1978-01-01
The uptake and distribution of cadmium in corn (Zea mays) treated at various time intervals after planting and sampled at various times after treatment were measured. Cadmium was found to accumulate in all parts sampled. As shown in field studies, stems and leaves generally concentrated more cadmium than did husks, cobs, kernels, silks, or tassels. Samples of stems and leaves from corn treated 23 days after planting and sampled 5 days later exhibited higher concentrations of cadmium than samples taken 25, 45, 65, or 85 days after treatment. Concentrations generally decreased with time. Greenhouse studies showed that corn exposed to cadmium for the longest period of time accumulated the greatest total cadmium. The highest cadmium concentrations were found in the base or lowest leaves sampled 45 days after planting; this suggests a useful technique for quick screening corn crops for cadmium pollution
Energy Technology Data Exchange (ETDEWEB)
Kricka, T; Pliestic, S [Agronomski fakultet, Zavod za poljoprivrednu tehnologiju, skladistenje i transport, Zagreb (Croatia)
1997-12-31
The most important agricultural crop in the world, besides wheat and rice is corn. In the last 10 years, Republic of Croatia has produced about 2000000 tons of corn. Most of that is used for food and feed and for seed production and it is 1000000 tons in quantity. This quantity demands between 35000 to 40000 tons of oil. For the reason, this paper describes the possibilities of the substitution of oil with corn biomass after harvesting. (author). 3 tabs., 13 refs.
Derivation of a regional active-optical reflectance sensor corn algorithm
Active-optical reflectance sensor (AORS) algorithms developed for in-season corn (Zea mays L.) N management have traditionally been derived using sub-regional scale information. However, studies have shown these previously developed AORS algorithms are not consistently accurate when used on a region...
Directory of Open Access Journals (Sweden)
Renan Soares de Souza
2013-06-01
Full Text Available The objective of this study was to evaluate the plant population density effect upon yield components and the chemical composition of grains in two sweet corn hybrids in “Winter-Spring” cultivation. The experimental design used was the complete randomized blocks with four replications. The treatments were based on the combination between two sweet corn hybrids (Tropical Plus e RB-6324 and five plant populations (40,000, 55.000, 70,000, 85,000 and 100,000 plants ha-1, in a factorial scheme 2 x 5, evaluated in two “winter-spring” growing seasons (2009 and 2010. The increment in the population of 40,000 to 100,000 plants ha-1 resulted in higher husked commercial corn ear productivity in both hybrids, Tropical Plus and RB-6324. The increase of plant population reduced the length and diameter of corn ears in Tropical Plus and RB-6324. The mass of the corn ears from Tropical Plus also reduced; however, it did not affect the commercial standard and industrial use. In larger plant populations the hybrid RB-6324 produced corn ears with grains that were sweeter and with lower starch content. The hybrid Tropical Plus presented higher mass, length, productivity, sugar content and lower diameter of corn ears when compared to RB-6324.O objetivo do presente estudo foi avaliar o efeito da população de plantas sobre os componentes de produção e a composição química de grãos de dois híbridos de milho doce no cultivo de “Inverno – Primavera”. O delineamento experimental utilizado foi o de blocos completos casualizados com quatro repetições. Os tratamentos constituíram-se da combinação entre híbridos de milho doce (Tropical Plus e RB-6324 e populações de plantas (40.000, 55.000, 70.000, 85.000 e 100.000 plantas ha-1, no esquema fatorial 2 x 5, avaliados em dois anos agrícolas (2009 e 2010, em cultivo de Inverno-Primavera. O incremento na população de plantas de 40.000 até 100.000 plantas ha-1 resultou em maiores produtividades de
Ramos-Escudero, Fernando; Muñoz, Ana María; Alvarado-Ortíz, Carlos; Alvarado, Ángel
2012-01-01
Abstract This study was designed to determine the contents of total polyphenols, flavonoids, flavonols, flavanols, and anthocyanins of purple corn (Zea mays L.) extracts obtained with different methanol:water concentrations, acidified with 1% HCl (1 N). Another objective was to determine the antioxidant activity by 1,1-diphenyl-2-picrylhydrazyl (DPPH), 2,2′-azinobis(3-ethylbenzothiazoline-6-sulfonic acid) (ABTS), ferric reducing antioxidant power (FRAP), and deoxyribose assay, individual phenolic compounds by high-performance liquid chromatography (HPLC), and endogenous antioxidant enzyme (superoxide dismutase [SOD], catalase [CAT], and total peroxidase [TPX]) activity and lipid peroxidation activity (thiobarbituric acid–reactive substances [TBARS] assay) in isolated mouse organs. Overall, the highest total content of polyphenols, anthocyanins, flavonoids, flavonols, and flavanols was obtained with the 80:20 methanol:water extract, acidified with 1% HCl (1 N). The 50% inhibitory concentration values obtained by the DPPH and ABTS assays with this extract were 66.3 μg/mL and 250 μg/mL, respectively. The antioxidant activity by the FRAP assay was 26.1 μM Trolox equivalents/g, whereas the deoxyribose assay presented 93.6% inhibition. Because of these results, the 80:20 methanol:water extract, acidified with 1% HCl (1 N), was used for the remaining tests. Eight phenolic compounds were identified by HPLC: chlorogenic acid, caffeic acid, rutin, ferulic acid, morin, quercetin, naringenin, and kaempferol. Furthermore, it was observed that the purple corn extract was capable of significantly reducing lipid peroxidation (lower malondialdehyde [MDA] concentrations by the TBARS assay) and at the same time increasing endogenous antioxidant enzyme (CAT, TPX, and SOD) activities in isolated mouse kidney, liver, and brain. On the basis of the results, it was concluded that the purple corn extract contained various bioactive phenolic compounds that exhibited
Ramos-Escudero, Fernando; Muñoz, Ana María; Alvarado-Ortíz, Carlos; Alvarado, Ángel; Yáñez, Jaime A
2012-02-01
This study was designed to determine the contents of total polyphenols, flavonoids, flavonols, flavanols, and anthocyanins of purple corn (Zea mays L.) extracts obtained with different methanol:water concentrations, acidified with 1% HCl (1 N). Another objective was to determine the antioxidant activity by 1,1-diphenyl-2-picrylhydrazyl (DPPH), 2,2'-azinobis(3-ethylbenzothiazoline-6-sulfonic acid) (ABTS), ferric reducing antioxidant power (FRAP), and deoxyribose assay, individual phenolic compounds by high-performance liquid chromatography (HPLC), and endogenous antioxidant enzyme (superoxide dismutase [SOD], catalase [CAT], and total peroxidase [TPX]) activity and lipid peroxidation activity (thiobarbituric acid-reactive substances [TBARS] assay) in isolated mouse organs. Overall, the highest total content of polyphenols, anthocyanins, flavonoids, flavonols, and flavanols was obtained with the 80:20 methanol:water extract, acidified with 1% HCl (1 N). The 50% inhibitory concentration values obtained by the DPPH and ABTS assays with this extract were 66.3 μg/mL and 250 μg/mL, respectively. The antioxidant activity by the FRAP assay was 26.1 μM Trolox equivalents/g, whereas the deoxyribose assay presented 93.6% inhibition. Because of these results, the 80:20 methanol:water extract, acidified with 1% HCl (1 N), was used for the remaining tests. Eight phenolic compounds were identified by HPLC: chlorogenic acid, caffeic acid, rutin, ferulic acid, morin, quercetin, naringenin, and kaempferol. Furthermore, it was observed that the purple corn extract was capable of significantly reducing lipid peroxidation (lower malondialdehyde [MDA] concentrations by the TBARS assay) and at the same time increasing endogenous antioxidant enzyme (CAT, TPX, and SOD) activities in isolated mouse kidney, liver, and brain. On the basis of the results, it was concluded that the purple corn extract contained various bioactive phenolic compounds that exhibited considerable in vitro
Nuessly, G S; Scully, B T; Hentz, M G; Beiriger, R; Snook, M E; Widstrom, N W
2007-12-01
Field trials using Spodoptera frugiperda (J. E. Smith) (Lepidoptera: Noctuidae) and Euxesta stigmatias Loew (Diptera: Ulidiidae) were conducted to evaluate resistance and potential damage interactions between these two primary corn, Zea mays L., pests against Lepidoptera-resistant corn varieties derived from both endogenous and exogenous sources. The endogenous source of resistance was maysin, a C-glycosyl flavone produced in high concentrations in varieties 'Zapalote Chico 2451' and 'Zapalote Chico sh2'. The exogenous resistance source was the Bacillus thuringiensis (Bt)11 gene that expresses Cry1A(b) insecticidal protein found in 'Attribute GSS-0966'. Damage by the two pests was compared among these resistant varieties and the susceptible 'Primetime'. Single-species tests determined that the Zapalote Chico varieties and GSS-0966 effectively reduced S. frugiperda larval damage compared with Primetime. E. stigmatias larval damage was less in the Zapalote Chico varieties than the other varieties in single-species tests. E. stigmatias damage was greater on S. frugiperda-infested versus S. frugiperda-excluded ears. Ears with S. frugiperda damage to husk, silk and kernels had greater E. stigmatias damage than ears with less S. frugiperda damage. Reversed phase high-performance liquid chromatography analysis of nonpollinated corn silk collected from field plots determined that isoorientin, maysin, and apimaysin plus 3'-methoxymaysin concentrations followed the order Zapalote Chico sh2 > Zapalote Chico 2451 > Attribute GSS-0966 = Primetime. Chlorogenic acid concentrations were greatest in Zapalote Chico 2451. The two high maysin Zapalote Chico varieties did as well against fall armyworm as the Bt-enhanced GSS-0966, and they outperformed GSS-0966 against E. stigmatias.
Fumonisins in corn (Zea mays L.) from Southern Brazil.
Scussel, Vildes M; Savi, Geovana D; Costas, Lea Luzia Freitas; Xavier, José Junior Mendonça; Manfio, Daniel; Bittencourt, Karoline O; Aguiar, Kin; Stein, Stephanie M
2014-01-01
A total of 232 samples of corn commercialised in Santa Catarina state, Southern Brazil (temperate zone climate), were evaluated from 2007 to 2012 for fumonisins (FBs: FB1 and FB2). Before performing this study, a FBs method with liquid chromatography and fluorescence detection (ex. 335; em. 440 nm) was validated first. FBs were detected in 46.6% (108 samples), with values ranging from 66 to 7832 µg kg(-1) for FB1 and 110 to 1201 µg kg(-1) for FB2. The number of contaminated corn samples for FB1 and FB2 varied and often presented contamination of FB1 only. Per year of analysis, the numbers were: n = 22/8(FB1/FB2), 44/5(FB1/FB2), 25/12(FB1/FB2), 4(FB1), 6(FB1) and 7(FB1) in 2007, 2008, 2009, 2010, 2011 and 2012, respectively. The contamination percentage was 42.3/15.4, 59.5/6.8, 43.8/21.1, 36.4, 35.3 and 33.3%, respectively, during these years. Consumers can be exposed to these mycotoxins and their health can be at risk through the consumption of contaminated corn.
Establishment and function of cover crops interseeded into corn
Cover crops can provide ecological services and improve the resiliency of annual cropping systems; however, cover crop use is low in corn (Zea mays L.)-soybean [Glycine max (L.) Merr.] rotations in the upper Midwest due to challenges with establishment. Our objective was to compare three planting me...
Directory of Open Access Journals (Sweden)
Agus Hermawan
2014-06-01
Full Text Available Low P availability is the main constraint for crops on acidic soil such as an Ultisols due to high soil P sorption. The objective of current research was to determine the effect of coal fly ash-chicken manure mixture application on P use efficiency by corn (Zea mays L. in Ultisols. The research were arranged according to Factorial Completely Randomized Design with three replicates. The treatments tested were the rates of FA-CM mixture (w/w of 1:1 that consisted of 0, 15, 30, 45 and 60 tons ha-1, and P fertilizer rates that consisted of 0, 0.5, 1.0, 1.5 and 2.0 times of P requirement to achieve of 0.2 μg P mL-1 in soil solution (equivalence to 0, 87, 174, 261 and 348 kg P2O5 ha-1. Results of current research showed that P use efficiency by corn on Ultisols had been increased through the addition of FA-CM in combination with P fertilization at the rate of 87 kg P2O5 ha-1. The optimum rate of FA-CM in combination with P fertilizer at the rate of 87 kg P2O5 ha-1 is 28.60 tons ha-1, with P uptake efficiency of 42.41 % and agronomic P efficiency of 82.53 mg shoot dry weight/mg P from fertilizer.
Caractérisation de neuf échantillons de farine de maïs Zea mays (L ...
African Journals Online (AJOL)
SARAH
31 juil. 2017 ... Adjamé, Aspergillus niger est respectivement présent à 41, 45 et 33 ... Objective : The aim of this work is to characterize the fungal flora of nine samples of maize flour [Zea ..... and mycotoxins production in Nigerian corn and.
Ni, Xinzhi; Xu, Wenwei; Krakowsky, Matthew D; Buntin, G David; Brown, Steve L; Lee, R Dewey; Coy, Anton E
2007-10-01
Identifying and using native insect resistance genes is the core of integrated pest management. In this study, 10 experimental corn, Zea mays L., hybrids and 10 inbred lines were screened for resistance to major ear-feeding insects in the southeastern Coastal Plain region of the United States during 2004 and 2005. Ear-feeding insect damage was assessed at harvest by visual damage rating for the corn earworm, Helicoverpa zea (Boddie), and by the percentage of kernels damaged by the maize weevil, Sitophilus zeamais Motschulsky, and stink bugs [combination of Euschistus servus (Say) and southern green stink bug, Nezara viridula (L.)]. Among the eight inbred lines and two control populations examined, C3S1B73-5b was resistant to corn earworm, maize weevil, and stink bugs. In contrast, C3S1B73-4 was resistant to corn earworm and stink bugs, but not to maize weevil. In a similar manner, the corn hybrid S1W*CML343 was resistant to all three ear-feeding insects, whereas hybrid C3S1B73-3*Tx205 was resistant to corn earworm and maize weevil in both growing seasons, but susceptible to stink bugs in 2005. The silk-feeding bioassay showed that corn earworm developed better on corn silk than did fall armyworm. Among all phenotypic traits examined (i.e., corn ear size, husk extension, and husk tightness), only corn ear size was negatively correlated to corn earworm damage in the inbred lines examined, whereas only husk extension (i.e., coverage) was negatively correlated to both corn earworm and maize weevil damage on the experimental hybrids examined. Such information could be used to establish a baseline for developing agronomically elite corn germplasm that confers multiple ear-feeding insect resistance.
Corn Cultivation to Reduce the Mycotoxin Contamination
Directory of Open Access Journals (Sweden)
Yangseon Kim
2017-09-01
Full Text Available The effects of insecticide and fungicide treatment were investigated to reduce mycotoxin contamination of corn (Zea mays L. seeds. Deoxynivalenol and zearalenone contents were reduced in the treated seeds, but aflatoxin, ochratoxin A, fumonisin, and T-2 toxin were not effective by chemical treatments. The chemical treatment did not affect the growth of saprophyte, but inhibited the pathogenic fungi such as Fusarium verticillioides, F. graminearum and F. equiseti. Myotoxin contents at different harvesting time were compared. As the harvest time was delayed, both levels of deoxynivalenol and zearalenone and frequency of Fusarium spp. increased. However, the major nutrient contents of corn seeds were not affected by harvesting period. These results show that chemical treatments are necessary to reduce the fungal contamination of corn and harvest without delay is important as well.
Sustainability of corn stover harvest strategies in Pennsylvania
Paul R. Adler; Benjamin M. Rau; Gregory W. Roth
2015-01-01
Pennsylvania farmers have a long history of harvesting corn (Zea mays L.) stover after grain harvest for animal bedding and feed or as a component of mushroom compost, or as silage for dairy cattle feed. With the shallow soils and rolling topography, soil erosion and carbon losses have been minimized through extensive use of cover crops, no-till, and...
Insect resistance to transgenic crops expressing one or more genes from Bacillus thuringiensis Berliner (Bt) is a growing concern for farmers, regulatory agencies, the seed industry, and researchers alike. Western corn rootworm (Diabrotica virgifera virgifera LeConte) is a pest of corn (Zea mays L.)...
SILAGE QUALITY OF CORN AND SORGHUM ADDED WITH FORAGE PEANUTS
Directory of Open Access Journals (Sweden)
WALKÍRIA GUIMARÃES CARVALHO
2016-01-01
Full Text Available Corn and sorghum are standard silage crops because of their fermentative characteristics. While corn and sorghum silages have lower crude protein (CP contents than other crops, intercropping with legumes can increase CP content. Furthermore, one way to increase CP content is the addition of legumes to silage. Consequently, the research objective was to evaluate the fermentative and bromatological characteristics of corn (Zea mays and sorghum (Sorghum bicolor silages added with forage peanuts (Arachis pintoi. The experimental design was completely randomized with four replicates. The treatments consisted of corn silage, sorghum silage, forage peanut silage, corn silage with 30% forage peanut, and sorghum silage with 30% forage peanut. The results showed that the corn and sorghum added with peanut helped to improve the silage fermentative and bromatological characteristics, proving to be an efficient technique for silage quality. The forage peanut silage had lower fermentative characteristics than the corn and sorghum silages. However, the forage peanut silage had a greater CP content, which increased the protein contents of the corn and sorghum silages when intercropped with forage peanuts.
Energy issues affecting corn/soybean systems: Challenges for sustainable production
Quantifying energy issues associated with agricultural systems, even for a simple two-crop corn (Zea mays L.) and soybean (Glycine max [L.] Merr.) rotation, is not a simple task. It becomes even more complicated if the goal is to include all aspects of sustainability (i.e., economic, environmental, ...
Within-field Corn Nitrogen Response Related to Aerial Photograph Color
Precision agriculture management of nitrogen (N) using aerial imagery of corn [Zea mays L.] canopy color has been a proposed strategy to understand crop N health and base within-season N fertilizer application rates. The objective of this study was to evaluate at field scale the relationship between...
Improved Canopy Sensor-based Corn Nitrogen Recommendations Using Auxiliary Information
The nitrogen (N) supplying capacity of the soil available to support corn (Zea mays L.) production can be highly variable both among and within fields. Thus, the amount of N fertilizer applied should be site-specific and also climate-sensitive. In recent years, canopy reflectance sensing has been in...
Corn stover for advanced biofuels perspectives of a soil “Lorax”
Crop residues like corn (Zea Mays L) stover are potential feedstock for production of advanced biofuels (e.g., cellulosic ethanol). Utilization of residue like stover for biofuel feedstock may provide economic and greenhouse gas mitigation benefits; however, harvesting these materials must be done i...
Directory of Open Access Journals (Sweden)
Gessí Ceccon
2013-02-01
Full Text Available The feasibility of no-tillage in the Cerrado (Savanna-like vegetation of Brazil depends on the production of sufficient above-ground crop residue, which can be increased by corn-forage intercropping. This study evaluated how above-ground crop residue production and yields of soybean and late-season corn in a soybean-corn rotation were influenced by the following crops in the year before soybean: corn (Zea mays L. intercropped with Brachiaria (Urochloa brizantha cv. Marandu, B. decumbens cv. Basilisk, B. ruziziensis, cv. comum., Panicummaximum cv. Tanzânia, sunn hemp (Crotalaria juncea L., pigeon pea [Cajanus cajan (L. Millsp]; sole corn, forage sorghum [Sorghum bicolor (L. Moench (cv. Santa Elisa], and ruzi grass. In March 2005, corn and forage species were planted in alternate rows spaced 0.90 m apart, and sole forage species were planted in rows spaced 0.45 m apart. In October 2005, the forages were killed with glyphosate and soybean was planted. After the soybean harvest in March 2006, sole late-season corn was planted in the entire experimental area. Corn grain and stover yields were unaffected by intercropping. Above-ground crop residue was greater when corn was intercropped with Tanzania grass (10.7 Mg ha-1, Marandu (10.1 Mg ha-1, and Ruzi Grass (9.8 Mg ha-1 than when corn was not intercropped (4.0 Mg ha-1. The intercropped treatments increased the percentage of soil surface covered with crop residue. Soybean and corn grain yields were higher after sole ruzi grass and intercropped ruzi grass than after other crops. The intercropping corn with Brachiaria spp. and corn with Panicum spp. increases above-ground crop residue production and maintains nutrients in the soil without reducing late-season corn yield and the viability of no-till in the midwestern region of Brazil.
Organic Based Glutinous Corn (Zea maize Supplemented With Seaweeds Emulsion
Directory of Open Access Journals (Sweden)
Jayrome S. Butay
2017-11-01
Full Text Available The study was therefore design to generate scientific information that are vital for organic farming advocates as it uses natural organic farm inputs in the production of corn. It was conducted because of the insurmountable rising cost of inorganic fertilizers perspective the farmers have to look for alternative measures to sustain the profitability of their farming business by evaluating the efficacy of seaweeds emulsion (Carrageenan as nutrient supplement to organic fertilizer on glutinous corn production, a study was conducted at the Cagayan State University – Lal-lo, Cagayan from July 17 to September 25, 2016with the following treatments: T1- Control, T2 – 3 tons Organic Fertilizer, T3 - 1.5 liters Seaweeds Emulsion ha-1 , T4 - 3 liters Seaweeds Emulsion ha-1 , T5 - 4.5 liters Seaweeds Emulsion ha-1 and T6 - 6 liters Seaweeds Emulsion ha-1 arranged in Randomized Complete Block Design with three replications. The treatments have no significant effect on plant height. Application of seaweed emulsion affected the grain development as manifested by longer and heavier corn ear. Higher rates (3-6 li ha-1 proved to more efficient as indicated by the bigger ear, highest yield and ROI of 909.62 percent. The study revealed that 3 tons Organic Fertilizer with liters of seaweed emulsion improved glutinous corn production. Further study is recommended to validate the result and come up with a more reliable conclusion.
Nonomuraea zeae sp. nov., isolated from the rhizosphere of corn (Zea mays L.).
Shen, Yue; Jia, Feiyu; Liu, Chongxi; Li, Jiansong; Guo, Siyu; Zhou, Shuyu; Wang, Xiangjing; Xiang, Wensheng
2016-06-01
A novel actinobacterium, designated strain NEAU-ND5T, was isolated from the rhizosphere of corn (Zea mays L.) collected in Heilongjiang Province, north-east China, and characterized using a polyphasic approach. 16S rRNA gene sequence analysis showed that strain NEAU-ND5T was a member of the genus Nonomuraea, with highest sequence similarities to Nonomuraea jabiensis A4036T (98.29 %), Nonomuraea rosea GW12687T (98.25 %), Nonomuraea candida HMC10T (98.22 %), Nonomuraea rhizophila YIM 67092T (98.04 %) and Nonomuraea kuesteri NRRL B-24325T (98.04 %). Similarities to other type strains of the genus Nonomuraea were lower than 98 %. Morphological and chemotaxonomic properties of strain NEAU-ND5T were also consistent with the description of the genus Nonomuraea. The cell wall contained meso-diaminopimelic acid and the whole-cell sugars were glucose, ribose and madurose. The phospholipid profile consisted of diphosphatidylglycerol, phosphatidylmonomethylethanolamine, phosphatidylethanolamine, hydroxy-phosphatidylmonomethylethanolamine, hydroxy-phosphatidylethanolamine, phosphatidylinositol and phosphatidylinositol mannoside. The major menaquinones were MK-9(H4), MK-9(H2) and MK-9(H0). The predominant cellular fatty acids were iso-C16:0 and 10-methyl C17:0. A combination of DNA-DNA hybridization results and some phenotypic characteristics demonstrated that strain NEAU-ND5T was clearly distinguished from its closely related Nonomuraea species. Consequently, it is concluded that strain NEAU-ND5T represents a novel species of the genus Nonomuraea, for which the name Nonomuraea zeae sp. nov. is proposed. The type strain is NEAU-ND5T (=CGMCC 4.7280T=DSM 100528T).
Uptake of Zn/sup + +/ and aflatoxin from perlite and liquid culture by Zea mays seedlings
Energy Technology Data Exchange (ETDEWEB)
Llewellyn, G C; Reynolds, J D; Hurst, L [Virginia Commonwealth Univ., Richmond (USA). Dept. of Biology; Vance, R A; Dashek, W V [West Virginia Univ., Morgantown (USA). Dept. of Biology
1982-01-01
The present paper reports our attempts to determine whether in inclusion of 0.0014 mM Zn/sup + +/ within a hydroponic culture medium affects the ability of 12-day-old Zea mays, cv. 'SS-522' to take-up (/sup 3/H)-aflatoxin B/sub 1/. Data from the corollary experiment., i.e., whether inclusion of aflatoxin affects the ability of Zea mays, cvs. 'Truckers White', 'X-Sweet' and 'Merit' to take-up /sup 65/ZnCl/sub 2/ are presented also. This report is a preliminary to one regarding an in-progress analysis of whether pollutant levels of Zn/sup + +/ affect aflatoxin uptake and distribution. In the absence of irrigating seedlings, which were grown in Perlite containing /sup 65/ZnCl/sub 2/, with a solution containing mixed aflatoxins, the stem contained the greatest amount of label with root plus seed the next highest and the leaf the least for each of the cvs. In contrast, when the seedlings were irrigated with a solution containing mixed aflatoxins, the root plus seed contained either an amount nearly identical to (cv. 'Truckers White') or in excess of that within the stem (cvs. 'X-Sweet' and 'Merit'). Calculation of the percentages of aflatoxin-induced diminutions in leaf, stem and root label suggested that the aflatoxins interfered with the translocation of /sup 65/ZnCl/sub 2/ from the root to the stem and leaf, at least for cvs 'X-Sweet' and 'Merit'.
Tillage and Water Deficit Stress Effects on Corn (Zea mays, L.) Root Distribution
One goal of soil management is to provide optimum conditions for root growth. Corn root distributions were measured in 2004 from a crop rotation – tillage experiment that was started in 2000. Corn was grown either following corn or following sunflower with either no till or deep chisel tillage. Wate...
International Nuclear Information System (INIS)
Yullita SL Andini; Hendrawati; Tri Retno Diah Larasati; Nana Mulyana
2015-01-01
Soil contamination by lead (Pb) and cadmium (Cd) is one form of environmental pollution that is harmful to living organisms. One way to resolve this problem by using phyto remediation with rice straw fermented by Trichoderma viride that given exposure 250 gray doses of gamma radiation. The purpose of this study was to look at the effect of Trichoderma viride fermented hay to improve the ability of Pb and Cd accumulation in the root zone of plants sweet corn (Zea Mays). There are three stages in the research process, namely the stages of SSF (Solid State Fermentation), incorporation, and Land farming. The fermentation process is done during the 16-day trial. Furthermore, the results of the SSF (Solid State Fermentation) mixed in soil that has been contaminated with heavy metals showed that administration of straw result SSF real impact on the value of pH, water content of the four treated samples. Results incorporation process and then applied with a crop of sweet corn (Zea Mays). Accumulation of heavy metals in sweet corn plant, analyzed by AAS analysis instrumentation. The measurement results show that the accumulation of Pb in the roots of plants in the sample K amounted to 33.66 mg/Kg, A sample of 26.80 mg/Kg, the sample B of 51.47 mg/kg, and sample C of 55.70 mg/Kg. While the metals Cd uptake in the roots of corn plants in the sample K showed Cd uptake of 269.65 mg/Kg, the sample A of 445.70 mg/Kg, the sample B of 337.17 mg/Kg and sample C of 336.72 mg/Kg. The phyto remediation process takes place based on the fito-stabilization principle. (author)
Compositional variability of nutrients and phytochemicals in corn after processing.
Prasanthi, P S; Naveena, N; Vishnuvardhana Rao, M; Bhaskarachary, K
2017-04-01
The result of various process strategies on the nutrient and phytochemical composition of corn samples were studied. Fresh and cooked baby corn, sweet corn, dent corn and industrially processed and cooked popcorn, corn grits, corn flour and corn flakes were analysed for the determination of proximate, minerals, xanthophylls and phenolic acids content. This study revealed that the proximate composition of popcorn is high compared to the other corn products analyzed while the mineral composition of these maize products showed higher concentration of magnesium, phosphorus, potassium and low concentration of calcium, manganese, zinc, iron, copper, and sodium. Popcorn was high in iron, zinc, copper, manganese, sodium, magnesium and phosphorus. The xanthophylls lutein and zeaxanthin were predominant in the dent corn and the total polyphenolic content was highest in dent corn while the phenolic acids distribution was variable in different corn products. This study showed preparation and processing brought significant reduction of xanthophylls and polyphenols.
Corn yield and economic return with nitrogen applied through drip tubing
A two year project was established to determine corn (Zea mays, L) yield response to subsurface (SSDI) and surface (SDI) drip irrigation systems at various nitrogen fertilizer rates. Nitrogen was applied through the drip system at two nitrogen levels in three split applications. Supplemental dry N ...
Directory of Open Access Journals (Sweden)
Eduardo Fontes Araújo
2001-07-01
Full Text Available Este trabalho teve como objetivo determinar as curvas de dessorção das sementes de milho-doce (Zea mays L., cultivares Superdoce e Doce Cristal, e ajustar diferentes modelos matemáticos aos dados obtidos. As sementes das duas cultivares foram submetidas à dessorção em diversos níveis de temperatura (30, 40, 50 e 60°C, combinados com diferentes umidades relativas do ar (30, 40, 50 e 60%, até atingirem a umidade de equilíbrio. Os seguintes modelos matemáticos foram ajustados por análise de regressão: Henderson-Thompson, Chung-Pfost, Copace, Sigma-Copace, Sabbah e Smith. As sementes das duas cultivares apresentaram umidades de equilíbrio higroscópico semelhantes. Os valores da variância explicada e do desvio-padrão, bem como a distribuição dos resíduos, das duas cultivares, indicam que as equações de Chung-Pfost, Sabbah e Smith foram as que melhor se ajustaram aos dados experimentais, com pequena superioridade da primeira.This work had the goal to determine the desorption curves of seeds of sweet corn cultivars Superdoce and Doce Cristal, and to adjust mathematical models to obtained data. Corn seeds were submitted to desorption under different temperature conditions (30, 40, 50 and 60°C, associated with different relative humidity (30, 40, 50 and 60% until reaching the equilibrium humidity. The following models of regression analysis were adjusted to the experimental data: Henderson-Thompson, Chung-Pfost, Copace, Sigma-Copace, Sabbah and Smith. Seeds of both cultivars showed similar hygroscopic equilibrium. For both cultivars, the equations of Chung-Pfost, Sabbah and Smith, showed the best adjustments to the experimental data, with slight superiority of the first one.
Dielectric properties of Zea mays kernels - studies for microwave power processing applications
Energy Technology Data Exchange (ETDEWEB)
Surducan, Emanoil; Neamtu, Camelia; Surducan, Vasile, E-mail: emanoil.surducan@itim-cj.r [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania)
2009-08-01
Microwaves absorption in biological samples can be predicted by their specific dielectrical properties. In this paper, the dielectric properties ({epsilon}' and {epsilon}'') of corn (Zea mays) kernels in the 500 MHz - 20 GHz frequencies range are presented. A short analysis of the microwaves absorption process is also presented, in correlation with the specific thermal properties of the samples, measured by simultaneous TGA-DSC method.
Directory of Open Access Journals (Sweden)
Oscar Moreno-Loaiza
2010-12-01
Full Text Available Objetivo. Evaluar la respuesta vasodilatadora e inhibidora de la vasoconstricción del extracto hidroalcohólico de Zea mays L. (maíz morado y determinar si esta respuesta es mediada por óxido nítrico (NO. Materiales y métodos. Se obtuvo un extracto de las corontas de maíz morado maceradas durante ocho días en etanol al 70%, y posterior concentración del producto. Se trabajó con anillos aórticos de rata en cámara de órganos aislados, bañada con solución Krebs-Hensleit (K-H y se registró la actividad vasomotora con un transductor de tensión isométrica. Se produjo una contracción basal con KCl 120 mM sobre la cual determinó el efecto vasodilatador de tres dosis del extracto: 0,1; 0,5 y 1,0 mg/mL. Se utilizó L-NG-Nitroarginina metil ester (L-NAME para comprobar que la vasodilatación depende de la óxido nítrico sinteasa (NOs. Luego se comparó la inhibición de la contracción vascular tras la incubación durante 30 minutos, con extracto de maíz morado y captopril 10-5 M. Resultados. Se observó una reducción de la contracción máxima (100% a 85,25 ± 2,60%, 77,76 ± 3,23% y 73,3 ± 4,87%, para las dosis de 0,1; 0,5 y 1,0 mg/mL, respectivamente. La vasodilatación fue inhibida por la incubación previa con L-NAME. El extracto de maíz morado no inhibió la contracción vascular, a diferencia del captopril (reducción a 75,27 ± 8,61%. Conclusión. El extracto hidroalcohólico de Zea mays L produce vasodilatación dependiente de la síntesis de NO.Objective: To evaluate the vasodilator response of the hydroalcoholic extract of Zea mays L. (Andean purple corn and to determine if this response is mediated by nitric oxide (NO. Material and methods: We obtained an extract by maceration for eight days of Andean purple corn cobs in 70% ethanol and subsequent concentration of the product. Thoracic aortic rings were evaluated in an isolated organ chamber, bathed with Krebs-Hensleit solution (KH, and vasomotor activity was recorded
Micromonospora zeae sp. nov., a novel endophytic actinomycete isolated from corn root (Zea mays L.).
Shen, Yue; Zhang, Yuejing; Liu, Chongxi; Wang, Xiangjing; Zhao, Junwei; Jia, Feiyu; Yang, Lingyu; Yang, Deguang; Xiang, Wensheng
2014-11-01
A novel actinomycete, designated strain NEAU-gq9(T), was isolated from corn root (Zea mays L.) and characterized using a polyphasic approach. The organism was found to have morphological and chemotaxonomic characteristics typical of the genus Micromonospora. On the basis of 16S rRNA gene sequence similarity studies, strain NEAU-gq9(T) was most closely related to Micromonospora zamorensis CR38(T) (99.3%), Micromonospora jinlongensis NEAU-GRX11(T) (99.2%), Micromonospora saelicesensis Lupac 09(T) (99.2%), Micromonospora chokoriensis 2-19(6)(T) (98.9%), Micromonospora coxensis 2-30-b(28)(T) (98.6%) and Micromonospora lupini Lupac 14N(T) (98.5%). Phylogenetic analysis based on the 16S rRNA gene and gyrB gene demonstrated that strain NEAU-gq9(T) is a member of the genus Micromonospora and supported the closest phylogenetic relationship to M. zamorensis CR38(T), M. jinlongensis NEAU-GRX11(T), M. saelicesensis Lupac 09(T), M. chokoriensis 2-19(6)(T) and M. lupini Lupac 14N(T). A combination of DNA-DNA hybridization, morphological and physiological characteristics indicated that the novel strain could be readily distinguished from the closest phylogenetic relatives. Therefore, it is proposed that strain NEAU-gq9(T) represents a novel species of the genus Micromonospora, for which the name Micromonospora zeae sp. nov. is proposed. The type strain is NEAU-gq9(T) (=CGMCC 4.7092(T)=DSM 45882(T)).
Li, Junli; Hu, Jing; Ma, Chuanxin; Wang, Yunqiang; Wu, Chan; Huang, Jin; Xing, Baoshan
2016-09-01
Iron oxide nanoparticles (γ-Fe2O3 NPs) have emerged as an innovative and promising method of iron application in agricultural systems. However, the possible toxicity of γ-Fe2O3 NPs and its uptake and translocation require further study prior to large-scale field application. In this study, we investigated uptake and distribution of γ-Fe2O3 NPs in corn (Zea mays L.) and its impacts on seed germination, antioxidant enzyme activity, malondialdehyde (MDA) content, and chlorophyll content were determined. 20 mg/L of γ-Fe2O3 NPs significantly promoted root elongation by 11.5%, and increased germination index and vigor index by 27.2% and 39.6%, respectively. However, 50 and 100 mg/L γ-Fe2O3 NPs remarkably decreased root length by 13.5% and 12.5%, respectively. Additionally, evidence for γ-Fe2O3 NPs induced oxidative stress was exclusively found in the root. Exposures of different concentrations of NPs induced notably high levels of MDA in corn roots, and the MDA levels of corn roots treated by γ-Fe2O3 NPs (20-100 mg/L) were 5-7-fold higher than that observed in the control plants. Meanwhile, the chlorophyll contents were decreased by 11.6%, 39.9% and 19.6%, respectively, upon NPs treatment relative to the control group. Images from fluorescence and transmission electron microscopy (TEM) indicated that γ-Fe2O3 NPs could enter plant roots and migrate apoplastically from the epidermis to the endodermis and accumulate the vacuole. Furthermore, we found that NPs mostly existed around the epidermis of root and no translocation of NPs from roots to shoots was observed. Our results will be highly meaningful on understanding the fate and physiological effects of γ-Fe2O3 NPs in plants. Copyright © 2016 Elsevier Ltd. All rights reserved.
Penyakit Layu Bakteri Stewart pada Jagung di Bali
Directory of Open Access Journals (Sweden)
I Gede Rai Maya Temaja
2018-01-01
Full Text Available Stewart’s wilt is a serious disease of sweet corn (Zea mays. The typical symptoms of the disease are pale-green to yellow linear streaks parallel to the veins. The symptoms were observed on sweet corn in Denpasar, Tabanan, Gianyar, and Karangasem areas during a survey in 2015. Pathogen detection based on a polymerase chain reaction was carried out using total DNA obtained from symptomatic leaf samples and the pairs of primers, CPSL1/CPSR2c. The expected sized (~1100 bp amplicon was detected in samples from Denpasar. Sequence analysis confirmed that Stewart’s wilt disease symptoms are caused by Pantoea stewartii subsp. stewartii. Nucleotide sequence and phylogenetic analysis showed that P. stewartii subsp. stewartii from Bali has high homology (98.97-99.08 % and placed in the same clade with isolates from Canada, USA and Japan. This is the first report of P. stewarti subsp. stewartii on corn in Bali.
Effects of residues from municipal solid waste landfill on corn yield and heavy metal content
International Nuclear Information System (INIS)
Prabpai, S.; Charerntanyarak, L.; Siri, B.; Moore, M.R.; Noller, Barry N.
2009-01-01
The effects of residues from municipal solid waste landfill, Khon Kaen Municipality, Thailand, on corn (Zea mays L.) yield and heavy metal content were studied. Field experiments with randomized complete block design with five treatments (0, 20, 40, 60 and 80% v/v of residues and soil) and four replications were carried out. Corn yield and heavy metal contents in corn grain were analyzed. Corn yield increased by 50, 72, 85 and 71% at 20, 40, 60 and 80% treatments as compared to the control, respectively. All heavy metals content, except cadmium, nickel and zinc, in corn grain were not significantly different from the control. Arsenic, cadmium and zinc in corn grain were strongly positively correlated with concentrations in soil. The heavy metal content in corn grain was within regulated limits for human consumption.
Evapotranspiration of a corn crop (Zea mays, L.)
International Nuclear Information System (INIS)
Calcache, M.; Engel, G.
1984-01-01
The real and potential evapotranspiration of corn crop is calculated in a field experiment. The potential evapotranspiration (PET) is estimated using the Penman Method with a Type 'A' evaporation tank. The real evapotranspiration (RET) is measured using the Mass Balance Method based on periodic calculations of the volumetric moisture of the soil using a neutron probe and the matrix potential using tensiometers. (M.A.C.) [pt
2010-04-01
... sweet corn packed with a suitable liquid packing medium which may include water and the creamy component... as specified in paragraph (a)(2) of this section. (ii) The words “vacuum pack” or “vacuum packed... found, less the weight of the sieve, as the drained weight. Dry and weigh the empty container and...
Is Corn Stover Harvest Predictable Using Farm Operation, Technology, and Management Variables?
Crop residue management, provision of animal feed or bedding, and increased income potential are some reasons for harvesting corn (Zea mays L.) stover. Reasons for not doing so are that crop residue is essential for restoring soil organic matter, protecting against wind and water erosion, and cyclin...
Directory of Open Access Journals (Sweden)
Luiz Fernando Ganassali Oliveira Júnior
2009-09-01
Full Text Available Durante a germinação e o desenvolvimento pós-germinativo de milho, o fluxo metabólico é intenso, ocorrendo síntese e degradação de açúcares (glicose, frutose e sacarose e hidrólise de amido, além da redução da concentração do ácido abscísico (ABA. Acredita-se que altas concentrações de glicose exógena, promovam acúmulo de ABA, proporcionando atraso na germinação e desenvolvimento de plântulas. Concentrações menores, por outro lado, podem ocasionar estímulo na germinação e desenvolvimento. Neste trabalho, foi observado que a glicose (800 µM estimulou a germinação e o desenvolvimento inicial de genótipo de milho comum e retardou, severa ou brandamente, genótipos de milho doce (su1, provavelmente devido às diferentes concentrações endógenas de glicose de cada genótipo. Foi visto, também, que a concentração de 1,2 ηM de insulina foi capaz de estimular o maior desenvolvimento de genótipos de milho comum (UENF 506-8 e doce H43IN e nula para o genótipo doce HDC. Quando adicionada insulina e glicose ao meio, foi obtido efeito aditivo para o desenvolvimento. Esses resultados sugerem que a insulina e glicose apresentam forte influência na germinação e no desenvolvimento de sementes de milho.During germination and development of corn seeds the metabolic flow is intense, the synthesis and degradation of sugars (glucose, fructose and sucrose and hydrolysis of starch, besides to the decrease in abscisic acid (ABA concentration are some of the major events. High concentrations of exogenous glucose are believed to promote accumulation of ABA, causing delay in the germination and development of seedlings, while lower concentrations stimulated the germination and development. In our studies it was verified that 800 µM glucose stimulated the germination and initial development of the common corn genotype and delayed severely or softly for sweet corn (su1 genotypes, probably due to different glucose endogenous
The Agricultural Policy Environmental Extender (APEX) model is used to simulate the effects of vegetative filter strips on runoff and pollutant loadings from agricultural watersheds. A long-term paired watershed study under corn (Zea mays L-soybean [Glycine max (L.) Merr.] rotation with agroforestr...
Relationships between soil-based management zones and canopy sensing for corn nitrogen management
Integrating soil-based management zones (MZ) with crop-based active canopy sensors to direct spatially variable nitrogen (N) applications has been proposed for improving N fertilizer management of corn (Zea mays L.). Analyses are needed to evaluate relationships between canopy sensing and soil-based...
Maryati, Yati; Susilowati, Agustine; Melanie, Hakiki; Lotulung, Puspa D.
2017-11-01
Corn hydrolyzate (Zea mays L) as a functional food fortificant derived from natural folic acid has been evaluated through a hydrolysis process using protease enzyme Rhizopus oligosporus strain C1. Enzymatic hydrolysis was carried out on two types of corn; yellow and white pearl variety corn, at concentration of protease enzyme (rough) 0.025; 0.125; and 0.225% (v/w of soluble nixtamal corn protein) with a hydrolysis time of 24 h at 30 °C, and pH 5.0. The results showed that the concentration of protease enzymes can increase the folic acid to the optimum condition, from the beginning to the end of the process time. Folic acid optimization of hydrolysis results in each corn was at the concentration of protease enzyme 0.225% (v/w of soluble nixtamal corn protein) in white corn and yellow corn at 24 hours hydrolysis, with folic acid composition, 283.56 µg/mL and 412.52 µg/mL, 1.07 and 1.04 mg/mL of soluble proteins, proteolytic activity 2.09 and 2.06 U/mL, total solids of 21.74 and 17.85%, total sugars of 0.56 and 2.22 mg/mL, and reducing sugar 91.72 and 48.47 mg/mL. In this condition, the increase of optimum folic acid for white corn was 33.57% and for yellow corn was 71.60% after hydrolysis.
Corn nitrogen management influences nitrous oxide emissions in drained and undrained soils
Tile-drainage and nitrogen (N) fertilization are important for corn (Zea mays L.) production. To date, no studies have evaluated nitrous oxide (N2O) emissions of single vs. split-N fertilizer application under different soil drainage conditions. The objective of this study was to quantify season-lon...
Directory of Open Access Journals (Sweden)
Francisco Ferraz de Toledo
1999-01-01
Full Text Available Foi desenvolvido trabalho baseado na determinação da precocidade da emissão da raiz primária de sementes de milho, em dez lotes de um mesmo cultivar. Este processo constou da distribuição de 200 sementes de cada lote sobre folhas de papel umedecido e, também, rolos de papel, que permaneceram em germinador a 25 °C; de 12 em 12 horas, aquelas que apresentaram emissão da raiz primária foram removidas, contadas e anotadas. Para estabelecer comparação entre os métodos e os lotes, paralelamente, as sementes eram avaliadas através da determinação do grau de umidade, dos testes de germinação e de vigor (primeira contagem, teste de frio com solo e emergência de plântulas em campo. Concluiu-se que há possibilidade de se utilizar o teste de emissão da raiz primária, em rolos de papel, para a avaliação do vigor de sementes de milho.The objectives of this study were to evaluate the variability of the emission of seed radicle of corn (Zea mays L. and to establish indexes of primary root emission to test the vigor of commercial seed lots. Samples of corn seeds not treated with fungicides, were taken from ten lots of the same cultivar. Two hundred seeds from each lot were distributed on wetted paper towels and also within paper rolles at 25 °C. Each 12 hours, seeds with primary root emission were counted and removed. Indexes of primary root emission were calculated and compared to conventional laboratory tests (first count; accelerated aging; cold test and field emergence. It was concluded that the primary root emission test, in rolled paper towels can be of great value for evaluating the vigor of corn seeds.
Rule, D.M.; Nolting, S.P.; Prasfika, P.L.; Storer, N.P.; Hopkins, B.W.; Scherder, E.J.A.; Siebert, M.W.; Hendrix, W.H.
2014-01-01
Commercial field corn (Zea mays L.) hybrids transformed to express some or all of the lepidopteran insect-resistant traits present in SmartStax corn hybrids were evaluated for insecticidal efficacy against a wide range of lepidopteran corn pests common to the northern United States, during 2008 to
Directory of Open Access Journals (Sweden)
Alexandra Mara Goulart Nunes Mamede
2009-02-01
Full Text Available Objetivou-se, neste trabalho, avaliar o efeito de três temperaturas (5ºC, 8ºC e 11ºC, na qualidade de híbridos de milho verde (Zea maiz L. com endosperma normal, minimamente processado, durante oito dias de armazenamento, com avaliações a cada dois dias. Foram utilizadas espigas de dois híbridos, sendo um comercial da Sementes Agroceres (Ag 1051 e outro do programa de melhoramento da Embrapa Milho e Sorgo (Embrapa HT1. A temperatura de 5ºC foi a que melhor preservou a qualidade das espigas dos híbridos de milho verde estudados, por proporcionar perda de massa reduzida e manutenção dos teores de sólidos solúveis, frutose e glicose. O híbrido Ag 1051 apresentou menor perda de massa, maiores valores de umidade e maior teor de frutose. O Embrapa HT1 apresentou maiores valores iniciais e finais para os teores de sólidos solúveis e maior valor para a coloração b*. O valor L*, que indica quãoclaro e escuro é produto, também diminuiu ao longo do armazenamento, indicando escurecimento das espigas ao longo do armazenamento.This work had the aim of evaluating the effect of three temperatures (5ºC, 8ºC and 11ºC on the quality of fresh-cut corn on the cob (Zea maiz L. with normal endosperm, for 8 days, with analyses taken every two days. Corn on the cob of two hybrids was used, a commercial common type from Sementes Agroceres (Ag 1051 and the other from the breeding program Embrapa Milho e Sorgo (Embrapa HT1. The temperature of 5ºC was more efficient to preserve the quality of normal corn by promoting reduced mass loss and higher contents of soluble solids, fructose and glucose. The hybrid Ag 1051 presented lower mass loss, higher contents of moisture and higher content of fructose. The hybrid Embrapa HT1 presented higher initial and final values for soluble solids and higher b* value. The L* value also decreased along storage, indicating browning of the corns along the storage.
Drury, Suzanne M; Reynolds, Tracey L; Ridley, William P; Bogdanova, Natalia; Riordan, Susan; Nemeth, Margaret A; Sorbet, Roy; Trujillo, William A; Breeze, Matthew L
2008-06-25
Insect-protected corn hybrids containing Cry insecticidal proteins derived from Bacillus thuringiensis have protection from target pests and provide effective management of insect resistance. MON 89034 hybrids have been developed that produce both the Cry1A.105 and Cry2Ab2 proteins, which provide two independent modes of insecticidal action against the European corn borer ( Ostrinia nubilalis ) and other lepidopteran insect pests of corn. The composition of MON 89034 corn was compared to conventional corn by measuring proximates, fiber, and minerals in forage and by measuring proximates, fiber, amino acids, fatty acids, vitamins, minerals, antinutrients, and secondary metabolites in grain collected from 10 replicated field sites across the United States and Argentina during the 2004-2005 growing seasons. Analyses established that the forage and grain from MON 89034 are compositionally comparable to the control corn hybrid and conventional corn reference hybrids. These findings support the conclusion that MON 89034 is compositionally equivalent to conventional corn hybrids.
Overview of a public-industry partnership for enhancing corn nitrogen research and datasets
Due to economic and environmental consequences of nitrogen (N) lost from fertilizer applications in corn (Zea mays L.), considerable public and industry attention has been devoted to development of N decision tools. Now a wide variety of tools are available to farmers for managing N inputs. However,...
Is a Nitrogen-rich Reference Needed for Canopy Sensor-based Corn Nitrogen Applications?
The nitrogen (N) supplying capacity of the soil available to support corn (Zea mays L.) production can be highly variable both among and within fields. In recent years, canopy reflectance sensing has been investigated for in-season assessment of crop N health and fertilization. Typically, the proced...
Elevated carbon dioxide reduces emission of herbivore-induced volatiles in Zea mays.
Block, Anna; Vaughan, Martha M; Christensen, Shawn A; Alborn, Hans T; Tumlinson, James H
2017-09-01
Terpene volatiles produced by sweet corn (Zea mays) upon infestation with pests such as beet armyworm (Spodoptera exigua) function as part of an indirect defence mechanism by attracting parasitoid wasps; yet little is known about the impact of climate change on this form of plant defence. To investigate how a central component of climate change affects indirect defence, we measured herbivore-induced volatile emissions in plants grown under elevated carbon dioxide (CO 2 ). We found that S. exigua infested or elicitor-treated Z. mays grown at elevated CO 2 had decreased emission of its major sesquiterpene, (E)-β-caryophyllene and two homoterpenes, (3E)-4,8-dimethyl-1,3,7-nonatriene and (3E,7E)-4,8,12-trimethyl-1,3,7,11-tridecatetraene. In contrast, inside the leaves, elicitor-induced (E)-β-caryophyllene hyper-accumulated at elevated CO 2 , while levels of homoterpenes were unaffected. Furthermore, gene expression analysis revealed that the induction of terpene synthase genes following treatment was lower in plants grown at elevated CO 2 . Our data indicate that elevated CO 2 leads both to a repression of volatile synthesis at the transcriptional level and to limitation of volatile release through effects of CO 2 on stomatal conductance. These findings suggest that elevated CO 2 may alter the ability of Z. mays to utilize volatile terpenes to mediate indirect defenses. © 2017 John Wiley & Sons Ltd.
Evaluation of the soil health nutrient tool for corn nitrogen recommendations across the Midwest
Use and development of soil biological tests for estimating soil N availability and subsequently corn (Zea mays L.) fertilizer N recommendations is garnering considerable interest. The objective of this research was to evaluate relationships between the Soil Health Nutrient Tool (SHNT), also known a...
Drought genetics have varying influence on corn water stress under differing water availability
Irrigated corn (Zea mays L.) in the Great Plains will be increasingly grown under limited irrigation management and greater water stress. Hybrids with drought genetics may decrease the impacts of water stress on yield. The objective of this experiment was to evaluate the effect of drought genetics o...
Prohexadione-calcium rate and timing effects on alfalfa interseeded into silage corn
Prohexadione-Ca (PHD) can enhance establishment of alfalfa (Medicago sativa, L.) interseeded into silage corn (Zea mays, L.), but optimal application rates and timing for this growth regulator are unknown. Two experiments examined how single or split applications of 0.25 to 1.0 kg a.i. ha-1 of PHD o...
Prasad, Rishi; Hochmuth, George J
2016-01-01
The springs and the Suwannee river of northern Florida in Middle Suwanee River Basin (MSRB) are among several examples in this planet that have shown a temporal trend of increasing nitrate concentration primarily due to the impacts of non-point sources such as agriculture. The rate of nitrate increase in the river as documented by Ham and Hatzell (1996) was 0.02 mg N L-1 y-1. Best management practices (BMPs) for nutrients were adopted by the commercial farms in the MSRB region to reduce the amounts of pollutants entering the water bodies, however the effectiveness of BMPs remains a topic of interest and discussion among the researchers, environmental administrators and policy makers about the loads of nitrogen entering into groundwater and river systems. Through this study, an initiative was taken to estimate nitrogen losses into the environment from commercial production systems of row and vegetable crops that had adopted BMPs and were under a presumption of compliance with state water quality standards. Nitrogen mass budget was constructed by quantifying the N sources and sinks for three crops (potato (Solanum tuberosum L.), sweet corn (Zea mays L.) and silage corn (Zea mays L.)) over a four year period (2010-2013) on a large representative commercial farm in northern Florida. Fertilizer N was found to be the primary N input and represented 98.0 ± 1.4, 91.0 ± 13.9, 78.0 ± 17.3% of the total N input for potato, sweet corn, and silage corn, respectively. Average crop N uptake represented 55.5%, 60.5%, and 65.2% of the mean total input N whereas average mineral N left in top 0.3 m soil layer at harvest represented 9.1%, 4.5%, and 2.6% of the mean total input N. Mean environmental N losses represented 35.3%, 34.3%, and 32.7% of the mean total input N for potato, sweet corn, and silage corn, respectively. Nitrogen losses showed a linear trend with increase in N inputs. Although, there is no quick fix for controlling N losses from crop production in MSRB, the
Visual soil structure effects of tillage and corn stover harvest in Iowa, U.S.A.
Excessive harvest of corn (Zea mays L.) stover for ethanol production has raised concerns regarding negative consequences on soil structure and physical quality. Visual soil structure assessment methods have the potential to help address these concerns through simple, straightforward on-farm evaluat...
Uptake, distribution, and velocity of organically complexed plutonium in corn (Zea mays).
Thompson, Shannon W; Molz, Fred J; Fjeld, Robert A; Kaplan, Daniel I
2012-10-01
Lysimeter experiments and associated simulations suggested that Pu moved into and through plants that invaded field lysimeters during an 11-year study at the Savannah River Site. However, probable plant uptake and transport mechanisms were not well defined, so more detailed study is needed. Therefore, experiments were performed to examine movement, distribution, and velocity of soluble, complexed Pu in corn. Corn was grown and exposed to Pu using a "long root" system in which the primary root extended through a soil pot and into a hydroponic container. To maintain solubility, Pu was complexed with the bacterial siderophore DFOB (Desferrioxamine B) or the chelating agent DTPA (diethylenetriaminepentaacetic acid). Corn plants were exposed to nutrient solutions containing Pu for periods of 10 min to 10 d. Analysis of root and shoot tissues permitted concentration measurement and calculation of uptake velocity and Pu retardation in corn. Results showed that depending on exposure time, 98.3-95.9% of Pu entering the plant was retained in the roots external to the xylem, and that 1.7-4.1% of Pu entered the shoots (shoot fraction increased with exposure time). Corn Pu uptake was 2-4 times greater as Pu(DFOB) than as Pu(2)(DTPA)(3). Pu(DFOB) solution entered the root xylem and moved 1.74 m h(-1) or greater upward, which is more than a million times faster than Pu(III/IV) downward movement through soil during the lysimeter study. The Pu(DFOB) xylem retardation factor was estimated to be 3.7-11, allowing for rapid upward Pu transport and potential environmental release. Copyright © 2012 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
N. Khodaeian
2013-06-01
Full Text Available To evaluate the effects of row spacing and plant density on yield and yield components of sweet corn, variety KSC403, an experiment was conducted in Research Farm of Isfahan University of Technology, Isfahan, Iran, in 2007, as randomized complete block design with a split-plot layout and three replications. The main plots were allocated to two row spacing (60 and 75 cm and the sub-plots accommodated four levels of plant density (50000, 70000, 90000 and 110000 plants per ha. There was significant increase in leaf area index, shoot dry weight, 100-grain fresh weight and grain fresh yield, as row width was decreased from 75 to 60 cm but the plant height was decreased. There was no significant effect of row spacing on number of rows per ear, number of grains per row and number of grains per ear. Plant height, leaf area index, shoot dry weight per m2 and number of ears per m2 were increased with an increase in plant density. The number of rows per ear, number of grains per row, number of grains per ear, 100-grain fresh weight and grain fresh yield were significantly higher under plant densities of 90000 and 110000 as compared to 50000 and 70000 plants per ha. There was significant interaction between row spacing and plant density for leaf area index, shoot dry weight, number of grains per ear, 100-grain fresh weight and grain fresh yield. Under all plant densities, the grain fresh yield was higher in 60-cm row width compared to 70-cm row width. However, the difference between these two row spacing was not significant in plant densities of 50000 and 110000 plants per ha. The highest grain fresh yield (33940 kg/ha was achieved under row spacing 60 cm and 70000 plants per ha and the least grain fresh yield (20750 kg/ha was obtained in under 75 cm row width and 110000 plants per ha. Considering the obtained results of this experiment, to have maximum grain fresh yield of sweet corn under Isfahan climate, the row spacing of 60 cm and plant density of
Influence of variety and harvest maturity on phytochemical content in corn silk.
Sarepoua, Eakrin; Tangwongchai, Ratchada; Suriharn, Bhalang; Lertrat, Kamol
2015-02-15
Corn silk has been used as a traditional herb in Asia. The objective of this study was to evaluate variability in phytochemicals in corn varieties at three maturity stages of corn silk. Ten vegetable corn varieties were evaluated in a completely randomized design with three replications. Data were recorded for total phenolic (TPC), total flavonoids (TFC), total anthocyanin (TAC) and antioxidant activity (AA) by DPPH free-radical-scavenging assays. Differences among corn varieties were observed for all parameters at all maturity stages, and the interactions between maturity stage and corn variety were significant. TPC and TAC were highest at the milky stage, whereas TFC and AA were highest at the silking stage. TPC, TFC and AA were highest in super sweet corn and white corn at the silking stage. PWC5 variety of purple waxy corn at the milky stage had the highest values for all parameters, and it is useful for further development of functional food products. Copyright © 2014 Elsevier Ltd. All rights reserved.
Impaired phloem loading in zmsweet13a,b,c sucrose transporter triple knock-out mutants in Zea mays.
Bezrutczyk, Margaret; Hartwig, Thomas; Horschman, Marc; Char, Si Nian; Yang, Jinliang; Yang, Bing; Frommer, Wolf B; Sosso, Davide
2018-04-01
Crop yield depends on efficient allocation of sucrose from leaves to seeds. In Arabidopsis, phloem loading is mediated by a combination of SWEET sucrose effluxers and subsequent uptake by SUT1/SUC2 sucrose/H + symporters. ZmSUT1 is essential for carbon allocation in maize, but the relative contribution to apoplasmic phloem loading and retrieval of sucrose leaking from the translocation path is not known. Here we analysed the contribution of SWEETs to phloem loading in maize. We identified three leaf-expressed SWEET sucrose transporters as key components of apoplasmic phloem loading in Zea mays L. ZmSWEET13 paralogues (a, b, c) are among the most highly expressed genes in the leaf vasculature. Genome-edited triple knock-out mutants were severely stunted. Photosynthesis of mutants was impaired and leaves accumulated high levels of soluble sugars and starch. RNA-seq revealed profound transcriptional deregulation of genes associated with photosynthesis and carbohydrate metabolism. Genome-wide association study (GWAS) analyses may indicate that variability in ZmSWEET13s correlates with agronomical traits, especifically flowering time and leaf angle. This work provides support for cooperation of three ZmSWEET13s with ZmSUT1 in phloem loading in Z. mays. © 2018 The Authors. New Phytologist © 2018 New Phytologist Trust.
Effect of Winter Cover Crops on Soil Nitrogen Availability, Corn Yield, and Nitrate Leaching
Kuo, S.; Huang, B.; Bembenek, R.
2001-01-01
Biculture of nonlegumes and legumes could serve as cover crops for increasing main crop yield, while reducing NO3 leaching. This study, conducted from 1994 to 1999, determined the effect of monocultured cereal rye (Secale cereale L.), annual ryegrass (Lolium multiflorum), and hairy vetch (Vicia villosa), and bicultured rye/vetch and ryegrass/vetch on N availability in soil, corn (Zea mays L.) yield, and NO3-N leaching in a silt loam soil. The field had been in corn and cover crop rotation sin...
Directory of Open Access Journals (Sweden)
Marcos Tulio García González
2015-02-01
Full Text Available This research was done in Fomento municipality, Sancti Spíritus, in Cuba, from 2011 through 2013 in two ecosystems and in two sowing times (rainy and dry seasons. The objectives were to describe the life cycle of Peregrinus maidis (Ashmead and the damage caused to corn (Zea mays L., to identify the main pest bio-regulators naturally occurring in two agro-ecosystems, and to determine the predator-prey relationship. The experiment was arranged in a randomized block design. The data were collected through observation at weekly intervals. In order to estimate the number of pest insects and bio-regulators occurring on the plants, 25 plants per parcel were selected for a total of 100 plants per treatment (maize/squash, maize/beans, maize/ Sesame, maize/sunflower, and maize monoculture. Once the research was accomplished, it was concluded that P maidis had been present since the first week, and reached its population peak in week six. The lower indexes of affectation occurred in the pre-mountain agro-ecosystems, and with more frequency in the maize/sesame and maize/squash polyculture, which depended on the time of the year and the season. Fifteen species of P. maidis control insects of were identified, and Scymnus sp was found in all treatments. The life cycle of P maidis averaged 5.4 days more in the dry season than in rain season. The predator-prey relationship showed relatively superior indexes in the polyculture systems than in monocrops systems.
Directory of Open Access Journals (Sweden)
Linus Gog
2014-09-01
Full Text Available The polyphagous feeding habits of the corn earworm, Helicoverpa zea (Boddie, underscore its status as a major agricultural pest with a wide geographic distribution and host plant repertoire. To study the transcriptomic response to toxins in diet, we conducted a microarray analysis of H. zea caterpillars feeding on artificial diet, diet laced with nicotine and Nicotiana tabacum (L. plants. We supplemented our analysis with growth and aversion bioassays. The transcriptome reflects an abundant expression of proteases, chitin, cytochrome P450 and immune-related genes, many of which are shared between the two experimental treatments. However, the tobacco treatment tended to elicit stronger transcriptional responses than nicotine-laced diet. The salivary factor glucose oxidase, known to suppress nicotine induction in the plant, was upregulated by H. zea in response to tobacco but not to nicotine-laced diet. Reduced caterpillar growth rates accompanied the broad regulation of genes associated with growth, such as juvenile hormone epoxide hydrolase. The differential expression of chemosensory proteins, such as odorant binding-protein-2 precursor, as well as the neurotransmitter nicotinic-acetylcholine-receptor subunit 9, highlights candidate genes regulating aversive behavior towards nicotine. We suggest that an observed coincidental rise in cannibalistic behavior and regulation of proteases and protease inhibitors in H. zea larvae signify a compensatory response to induced plant defenses.
Directory of Open Access Journals (Sweden)
aziz karmollachaab
2017-10-01
Filter Cake, due to high salinity and salt accumulation in the root zone, causes secondary oxidative stress and increases damage to cell membranes and reduces the economic benefit. In order to investigate the effect of Filter Cake levels application on some morpho-physiological characteristics and ear yield of sweet corn (Zea mays var saccharata under late drought stress condition, an experiment was conducted in Ramin Agriculture and Natural Resources University, Khuzestan, at 2012. The experiment was arranged in split-plots design in RCBD (Randomized Complete Block Design with three replications. Treatments of experiment were drought stress (irrigation after 25, 50 and 75% depletion of available water content in main plots and filter cake (0, 10, 20 and 30 ton.ha-1 arranged in sub-plots. Results showed that the effect of drought stress significant on more traits and led to decrease of plant height, leaf area index (LAI, membrane stability index(MSI, leaf osmotic potential, soluble protein contents, ear and biological yield while effect of drought stress on shoot sodium concentration was not significant. The intensive drought stress led to decrease 21.7 and 27.3% ear and biological yield compared to control respectively. Application of filter cake on non-stress led to increase height of plant and ear and biological yield. But high levels of filter cake in intensive stress led to increase salinity and damage to cell membranes and reduce LAI and MSI and thus reduce economic performance. It also the amount of 30 ton.ha-1 of filter cake in intensive stress condition has been decrease ear and biological yield 18.7 and 23.3% compared to non-filter cake application respectively.
DEVELOPMENT OF ACID-SOIL TOLERANT CORN (Zea mays L. WITH HIGH-QUALITY PROTEIN
Directory of Open Access Journals (Sweden)
E.S. Halimi
2011-06-01
Full Text Available Corn is an important food crop in Indonesia. Plant expansion has been hampered by soil-acidity problem and the protein content of many corn varieties was low. This research initiates development of soil-acid-tolerant corn with high-quality-protein content. Research was done on 12 factorial treatments and 3 replications as blocks in RCBD. The first factor was corn populations: Toray-1(G1, Toray-2(G2, GS-5(G3 and GS-10(G4. The second factor was fertilizations: P1(69 kg N+36 kg P2O5+15 kg K2O per ha; P2(115 kg N+54 kg P2O5+30 kg K2O per ha; and P3(161 kg N+72 kg P2O5+45 kg K2O per ha. The observed variables consisted of several agronomic traits, including the protein content. Results indicated that the corn populations, in general, showed good agronomic traits. The differences were mostly between populations, not between fertilizations, and no interaction was observed. The yield potential ranged from 4.25 to 6.47 ton dry seeds per ha. The protein content of seed resulted from cross ranged from 9.84% to 11.30%, as compared to the parents of 9.11% and 12.62%. This research concludes that genetic factors play an important role as confirmed by heritability estimate (h2=0.75.
An Active Sensor Algorithm for Corn Nitrogen Recommendations Based on a Chlorophyll Meter Algorithm
In previous work we found active canopy sensor reflectance assessments of corn (Zea mays L.) N status acquired at two growth stages (V11 and V15) have the greatest potential for directing in-season N applications, but emphasized an algorithm was needed to translate sensor readings into appropriate N...
Comparison of corn and switchgrass on marginal soils for bioenergy
Energy Technology Data Exchange (ETDEWEB)
Varvel, G.E.; Vogel, K.P.; Mitchell, R.B. [USDA-ARS, 344 Keim Hall, University of Nebraska-Lincoln, P.O. Box 830937, Lincoln, NE 68583-0937 (United States); Follett, R.F. [USDA-ARS, Room S-100, 2150 Centre Avenue Building D, Ft. Collins, CO 80526-8119 (United States); Kimble, J.M. [USDA-NRCS, National Soil Survey Center, 100 Centennial Mall North, Lincoln, NE 68508-3866 (United States)
2008-01-15
Crop residues such as corn (Zea mays L.) stover are viewed as an abundant and inexpensive source of biomass that can be removed from fields to produce bioenergy. Assumptions include that with minimum or no-tillage farming methods, there will be no deleterious production or environmental effects. A long-term field study was established in eastern Nebraska, USA, to compare the switchgrass managed as a biomass energy crop versus no-till corn on a non-irrigated site, marginal for row-crop production, in the western Corn Belt. Our objective in this paper is to report on corn stover removal effects on corn grain yields and potential ethanol production in both cropping systems. Corn, under no-till management, and switchgrass were grown at three N fertilizer levels. In the first 5 years (2001-2005), removal of half the available stover significantly reduced corn yields. During that same time period, the potential ethanol yield for switchgrass was equal to or greater than the potential total ethanol yield of corn grain and harvested stover fertilized at the same optimum N rate. The effect of crop residue removal on crop productivity needs to be investigated in other agro-ecosystems and the potential use of dedicated perennial biomass energy crops should remain a viable renewable energy option on non-irrigated marginal croplands. (author)
Use and development of soil biological tests for estimating soil N availability and subsequently corn (Zea mays L.) fertilizer N recommendations is garnering considerable interest. The objective of this research was to evaluate relationships between the Soil Health Nutrient Tool (SHNT), also known a...
Dominque, Brunson; Gichuhi, Peter N.; Rangari, Vijay; Bovell-Benjamin, Adelia C.
2013-01-01
Currently, corn is used to produce more than 85% of the world's high fructose syrup (HFS). There is a search for alternative HFS substrates because of increased food demand and shrinking economies, especially in the developing world. The sweet potato is a feasible, alternative raw material. This study isomerized a high glucose sweet potato starch syrup (SPSS) and determined its sugar profile, mineral content, and rheological and thermal properties. Rheological and thermal properties were meas...
Comparisons of Herbicide Treated and Cultivated Herbicide-Resistant Corn
H. Arnold Bruns; Hamed K. Abbas
2010-01-01
Four glyphosate resistant corn (Zea mays L.) hybrids, a glufosinate-ammonium resistant hybrid, and a conventional atrazine resistant hybrid gown at Stoneville, MS in 2005, 2006, and 2007 with furrow irrigation were treated with their respective herbicides and their growth, yield, and mycotoxin incidence were compared with untreated cultivated plots. Leaf area index (LAI) and dry matter accumulation (DMA) were collected on a weekly basis beginning at growth stage V3 and terminating at anthesi...
Angzzas Sari Mohd Kassim; Halizah Awang; Ashuvila Mohd Aripin
2013-01-01
Malaysia is a country that is a rich source of agricultural waste material. Three different crops were studied here, including pineapple (Ananas comosus) leaf, corn (Zea mays) stalk, and Napier grass (Pennisetum purpureum). These crops are characterized as agricultural waste materials in Malaysia and have a high potential to be used as alternative fibers for the paper making industry. The objective of this work was to analyze the chemical composition of pineapple leaf, corn stalk, and Napier ...
Calles-Torrez, Veronica; Knodel, Janet J; Boetel, Mark A; Doetkott, Curt D; Podliska, Kellie K; Ransom, Joel K; Beauzay, Patrick; French, B Wade; Fuller, Billy W
2018-02-09
Northern, Diabrotica barberi Smith & Lawrence (Coleoptera: Chrysomelidae), and western, Diabrotica virgifera virgifera LeConte (Coleoptera: Chrysomelidae), corn rootworms are economic pests of corn, Zea mays L. in North America. We measured the impacts of corn hybrids incorporated with Cry3Bb1, Cry34/35Ab1, and pyramided (Cry3Bb1 + Cry34/35Ab1) Bacillus thuringiensis Berliner (Bt) proteins, tefluthrin soil insecticide, and clothianidin insecticidal seed treatment on beetle emergence, larval feeding injury, and corn yield at five locations from 2013 to 2015 in eastern North Dakota. In most cases, emergence was significantly lower in Bt-protected corn than in non-Bt corn hybrids. Exceptions included Wyndmere, ND (2013), where D. barberi emergence from Cry34/35Ab1 plots was not different from that in the non-Bt hybrid, and Arthur, ND (2013), where D. v. virgifera emergence from Cry3Bb1 plots did not differ from that in the non-Bt hybrid. Bt hybrids generally produced increased grain yield compared with non-Bt corn where rootworm densities were high, and larval root-feeding injury was consistently lower in Bt-protected plots than in non-Bt corn. The lowest overall feeding injury and emergence levels occurred in plots planted with the Cry3Bb1 + Cry34/35Ab1 hybrid. Time to 50% cumulative emergence of both species was 5-7 d later in Bt-protected than in non-Bt hybrids. Tefluthrin and clothianidin were mostly inconsequential in relation to beetle emergence and larval root injury. Our findings could suggest that some North Dakota populations could be in early stages of increased tolerance to some Bt toxins; however, Bt corn hybrids currently provide effective protection against rootworm injury in eastern North Dakota. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Due to economic and environmental consequences of nitrogen (N) lost from fertilizer applications in corn (Zea mays L.), considerable public and industry attention has been devoted to development of N decision tools. Now a wide variety of tools are available to farmers for managing N inputs. However,...
Energy analysis of ethanol production from sweet sorghum
Energy Technology Data Exchange (ETDEWEB)
Worley, J.W. (Georgia Univ., Athens, GA (United States). Dept. of Agricultural Engineering); Vaughan, D.H.; Cundiff, J.S. (Virginia Polytechnic Inst. and State Univ., Blacksburg, VA (United States). Dept. of Agricultural Engineering)
1992-01-01
The Piedmont System is a collection of equipment for efficiently removing the juice from sweet sorghum stalks for the production of ethanol. The concept is to separate the whole stalks into pith and rind-leaf fractions, pass only the pith fraction through a screw press, and thus achieve an improvement in juice-expression efficiency and press capacity. An energy analysis was done for two options of this proposed harvesting/processing system: (Option 1) The juice is evaporated to syrup and used throughout the year to produce ethanol, and the by-products are used as cattle feed. (Option 2) The juice is fermented as it is harvested, and the by-products (along with other cellulosic materials) are used as feedstock for the remainder of the year. Energy ratios (energy output/energy input) of 0.9, 1.1 and 0.8 were found for sweet sorghum Option 1, sweet sorghum Option 2, and corn, respectively, as feedstocks for ethanol. If only liquid fuels are considered, the ratios are increased to 3.5, 7.9 and 4.5. (author).
Bioethanol production from dried sweet sorghum stalk
Energy Technology Data Exchange (ETDEWEB)
Almodares, A.; Etemadifar, Z.; Ghoreishi, F.; Yosefi, F. [Biology Dept. Univ. of Isfahan, Isfahan (Iran, Islamic Republic of)], e-mail: aalmodares@yahoo.com
2012-11-01
Bioethanol as a renewable transportation fuel has a great potential for energy and clean environment. Among crops sweet sorghum is one of the best feedstock for ethanol production under hot and dry climatic conditions. Because it has higher tolerance to salt and drought comparing to sugarcane and corn that are currently used for bio-fuel production in the world. Generally mills are used to extract the juice from sweet sorghum stalks. Three roller mills extract around nearly 50 percent of the juice and more mills is needed to extract higher percentage of the juice. More over under cold weather the stalks become dry and juice is not extracted from the stalk, therefore reduce harvesting period. In this study stalks were harvested, leaves were stripped from the stalks and the stalks were chopped to nearly 4 mm length and sun dried. The dry stalks were grounded to 60 mesh powder by a mill. Fermentation medium consists of 15-35% (w/w) sweet sorghum powder, micronutrients and active yeast inoculum from 0.5-1% (w/w) by submerge fermentation method. The fermentation time and temperature were 48-72 hours and 30 deg, respectively. The results showed the highest amount of ethanol (14.5 % w/w sorghum) was produced with 10% sweet sorghum powder and 1% of yeast inoculum, three day fermentation at 30 deg.
Hubungan antara Zea mays L., Ostrinia furnacalis (Lep.:Pyralidae dan Beauveria bassiana Vuill.
Directory of Open Access Journals (Sweden)
Itji Diana Daud
2017-02-01
Full Text Available Connection between Zea mays L., Ostrinia furnacalis (Lep.:Pyralidae and Beauveria bassiana Vuill. The entomopatogen fungus, Beauveria bassiana (Balsamo, is obtained in the tissue of corn plant through submersion of seed in cinidia 1010/ml. Tissue observation showed that hifa B. bassiana appears when the plant attain the age of three weeks and when it reaches six weeks B bassiana appears in all sample plants. Hifa obtained in parenchyma tissue passively without causing illness the mother plant. The appearance of B. bassiana is remained until the 12th weeks of plant. Bio test of plan which contain the endofit of B. bassiana showed the percentage of tested insect mortality is 64%. The observation showed that the corn plant can still produce the toxin of beauverisin.
Nitrogen (N) needs to support corn (Zea mays L.) production can be highly variable within fields. Canopy reflectance sensing for assessing crop N health has been implemented on many farmers’ fields to side-dress or top-dress variable-rate N application, but at times farmers report the performance of...
Luzardo-Ocampo, I; Campos-Vega, R; Gaytán-Martínez, M; Preciado-Ortiz, R; Mendoza, S; Loarca-Piña, G
2017-10-01
Corn (Zea mays L.) and common beans (Phaseolus vulgaris L.) are alternative suitable ingredients for snacks, because of their content of bioactive compounds such as phenolic compounds (PC) and oligosaccharides (OS). However, there is no information about the transformation of these compounds associated with food matrix during gastrointestinal digestion. Therefore, the objective of this work was to simulate the whole digestion process (mouth to colon) to estimate bioaccessibility and small intestine permeability of free PC and OS, and the antioxidant capacity of free PC. Digested nixtamalized corn-cooked common bean chips exhibited significant different quantities of free PC and OS, and higher antioxidant activity compared to methanolic extract. The free PC showed high values of apparent permeability coefficients (0.023-0.729×10 -3 ), related with their absorption in the small intestine. Both free PC and OS were retained in the non-digestible fraction of chips (10.24-64.4%) and were able to reach the colon. Our results suggest the digestion potential to increase chip bioactive compounds and antioxidant activity. Additional studies are required to evaluate their in vivo effects. Copyright © 2017. Published by Elsevier Ltd.
Evolution of Corn Transpiration and Leaf Water Potential During Sprinkler Irrigation
Martínez-Cob, Antonio; Fernández-Navajas, Julián; Durán, Víctor; Cavero Campo, José
2009-01-01
Corn (Zea mays L.) transpiration during daytime solid-set sprinkler irrigation was analyzed on two neighbouring subplots to determine the effect of the transpiration reduction on water application efficiency. During each irrigation event, one subplot was irrigated (moist treatment) while the other was not (dry treatment). Transpiration rates were determined at each subplot by the heat balance method (Dynamax Flow4 System) before, during and after the irrigations. During irri...
Beckford, R. C.; Bartlett, J. R.
2015-01-01
The amount of corn available for animal and poultry feed has been unpredictable in recent years due to the increased use of corn for ethanol production. As a consequence, there has been an increase in the price of feed, chicken, and chicken products. Researchers are exploring alternative feed sources to substitute for corn in poultry ration. This study evaluated the performance and carcass quality of broilers fed diets containing sweet potato root meal (SPRM). After a complete nutrient analys...
Since soil types within and between corn (Zea mays L.) fields can be highly variable, the amount of nitrogen (N) provided by those different soil types to support production can also be highly variable. Ideally, the amount of N fertilizer added during a given growing season should be both climate-se...
Microwave heat treatment of dent corn (Zea mays var. indentata sturt ...
African Journals Online (AJOL)
2012-02-07
Feb 7, 2012 ... This study is on the determination of drying kinetics of corn and selecting proper model in ... energy and high thermal conductivity to the inner sides of ... The size of the oven is 300 x 460 x 280 mm and its rotating glass.
Využití kukuřice seté (Zea mays L.) pro energetické účely
RATAJ, David
2011-01-01
This bachelor thesis deals with the types of energy use of flint corn (Zea mays). It compares the suitability of hybrid maize lines. The thesis is to summarize and compare the literature data on other types of energy crops and compares them suitable for cultivation for energy recovery on the basis of some production capacity and energy parameters (dry matter yield, energy recovery, combustion heat and humidity).
Aldose Reductase Inhibitory Activity of Compounds from Zea mays L.
Kim, Tae Hyeon; Kim, Jin Kyu; Kang, Young-Hee; Lee, Jae-Yong; Kang, Il Jun; Lim, Soon Sung
2013-01-01
Aldose reductase (AR) inhibitors have a considerable therapeutic potential against diabetes complications and do not increase the risk of hypoglycemia. Through bioassay-guided fractionation of an EtOH extract of the kernel from purple corn (Zea mays L.), 7 nonanthocyanin phenolic compounds (compound 1–7) and 5 anthocyanins (compound 8–12) were isolated. These compounds were investigated by rat lens aldose reductase (RLAR) inhibitory assays. Kinetic analyses of recombinant human aldose reductase (rhAR) were performed, and intracellular galactitol levels were measured. Hirsutrin, one of 12 isolated compounds, showed the most potent RLAR inhibitory activity (IC50, 4.78 μM). In the kinetic analyses using Lineweaver-Burk plots of 1/velocity and 1/substrate concentration, hirsutrin showed competitive inhibition against rhAR. Furthermore, hirsutrin inhibited galactitol formation in rat lens and erythrocytes sample incubated with a high concentration of galactose; this finding indicates that hirsutrin may effectively prevent osmotic stress in hyperglycemia. Therefore, hirsutrin derived from Zea mays L. may be a potential therapeutic agent against diabetes complications. PMID:23586057
Hormetic effect(s) of tetracyclines as environmental contaminant on Zea mays
International Nuclear Information System (INIS)
Migliore, Luciana; Godeas, Feliciana; De Filippis, Stefania Paola; Mantovi, Paolo; Barchi, Davide; Testa, Cecilia; Rubattu, Nicolino; Brambilla, Gianfranco
2010-01-01
Animal wastes from intensive pig farming as fertilizers may expose crops to antimicrobials. Zea mays cultivations were carried out on a virgin field, subjected to dressing with pig slurries contaminated at 15 mg L -1 of Oxy- and 5 mg L -1 of Chlor-tetracycline, and at 8 mg L -1 of Oxy and 3 mg L -1 of Chlor, respectively. Pot cultivation was performed outdoor (Oxy in the range 62.5-1000 ng g -1 dry soil) and plants harvested after 45 days. Tetracyclines analyses on soils and on field plants (roots, stalks, and leaves) did not determine the appreciable presence of tetracyclines. Residues were found in the 45-day pot corn only, in the range of 1-50 ng g -1 for Oxy in roots, accounting for a 5% carry-over rate, on average. Although no detectable residues in plants from on land cultivations, both experimental batches showed the same biphasic growth form corresponding to a dose/response hormetic curve. - Oxytetracycline in soils elicits a hormetic response in Zea mays plants.
Hormetic effect(s) of tetracyclines as environmental contaminant on Zea mays
Energy Technology Data Exchange (ETDEWEB)
Migliore, Luciana; Godeas, Feliciana [Dipartimento di Biologia, Universita Tor Vergata, Rome (Italy); De Filippis, Stefania Paola [Istituto Superiore di Sanita, Toxicological Chemistry Unit, Rome (Italy); Mantovi, Paolo [Centro Ricerche Produzioni Animali, Reggio Emilia (Italy); Barchi, Davide [Assessorato all' Agricoltura, Regione Emilia-Romagna, Bologna (Italy); Testa, Cecilia; Rubattu, Nicolino [Istituto Zooprofilattico Sperimentale della Sardegna, Sassari (Italy); Brambilla, Gianfranco [Istituto Superiore di Sanita, Toxicological Chemistry Unit, Rome (Italy)
2010-01-15
Animal wastes from intensive pig farming as fertilizers may expose crops to antimicrobials. Zea mays cultivations were carried out on a virgin field, subjected to dressing with pig slurries contaminated at 15 mg L{sup -1} of Oxy- and 5 mg L{sup -1} of Chlor-tetracycline, and at 8 mg L{sup -1} of Oxy and 3 mg L{sup -1} of Chlor, respectively. Pot cultivation was performed outdoor (Oxy in the range 62.5-1000 ng g{sup -1} dry soil) and plants harvested after 45 days. Tetracyclines analyses on soils and on field plants (roots, stalks, and leaves) did not determine the appreciable presence of tetracyclines. Residues were found in the 45-day pot corn only, in the range of 1-50 ng g{sup -1} for Oxy in roots, accounting for a 5% carry-over rate, on average. Although no detectable residues in plants from on land cultivations, both experimental batches showed the same biphasic growth form corresponding to a dose/response hormetic curve. - Oxytetracycline in soils elicits a hormetic response in Zea mays plants.
Genetic Markers for Western Corn Rootworm Resistance to Bt Toxin
Flagel, Lex E.; Swarup, Shilpa; Chen, Mao; Bauer, Christopher; Wanjugi, Humphrey; Carroll, Matthew; Hill, Patrick; Tuscan, Meghan; Bansal, Raman; Flannagan, Ronald; Clark, Thomas L.; Michel, Andrew P.; Head, Graham P.; Goldman, Barry S.
2015-01-01
Western corn rootworm (WCR) is a major maize (Zea mays L.) pest leading to annual economic losses of more than 1 billion dollars in the United States. Transgenic maize expressing insecticidal toxins derived from the bacterium Bacillus thuringiensis (Bt) are widely used for the management of WCR. However, cultivation of Bt-expressing maize places intense selection pressure on pest populations to evolve resistance. Instances of resistance to Bt toxins have been reported in WCR. Developing genet...
International Nuclear Information System (INIS)
Fresquez, P.R.; Mullen, M.A.; Naranjo, L. Jr.; Armstrong, D.R.
1997-05-01
Pinto beans, sweet corn, and zucchini squash (Cucurbita pepo var. black beauty) were grown in a randomized complete-block field/pot experiment at a site that contained the highest observed levels of surface gross gamma radioactivity within Los Alamos Canyon (LAC) at Los Alamos National Laboratory. Soils as well as washed edible and nonedible crop tissues were analyzed for various radionuclides and heavy metals . Most radionuclides, with the exception of 3 H and tot U, in soil from LAC were detected in significantly higher concentrations (p -1 . This dose was below the International Commission on Radiological Protection permissible dose limit (PDL) of 100 mrem y -1 from all pathways; however, the addition of other internal and external exposure route factors may increase the overall dose over the PDL. Also, the risk of an excess cancer fatality, based on 74 mrem y -1 , was 3.7 x 10 -5 (37 in a million), which is above the Environmental Protection Agency's (acceptable) guideline of one in a million. 31 refs., 15 tabs
Improved methods of predicting grain yield response to fertilizer N for first-year corn (Zea mays L.) following alfalfa (Medicago sativa L.) on fine-textured soils are needed. Data from 21 site-years in the North Central Region were used to (i) determine how Illinois soil nitrogen test (ISNT) and pr...
Directory of Open Access Journals (Sweden)
M. Nasrolah alhossini,
2014-02-01
Full Text Available To investigate the effects of different levels of seed priming on germination indices and nutrient absorption at early growth stages of sweet corn (Golden Kernel Hybrid a factorial experiment based on completely randomized design was conducted with three replications in 2011. The experiment consists of 6 levels of primings (seeds without priming, priming with tap water, priming with distilled water, priming with sodium chloride, potassium chloride, and hydrous calcium chloride and five levels of salinity (zero, 4, 8, 12 and 16 ds/m sodium chloride. The characteristics studied were germination percentage, germination rate, root and shoot length, fresh weight and dry weight of seedling, root to shoot ratio and determination of sodium, chloride, calcium, and potassium concentration in different parts of seedlings (stems, roots and seed. The results indicated that increasing salinity stress levels decreased all parameters measured. Priming seeds with hydrated calcium chloride responded to significantly to salinity stress better than other treatments. Results also showed that increasing concentration of sodium chloride salt, increased absorption rate of sodium but concentration of calcium and potassium were reduced. Because application of hydrous calcium chloride stimulates cell in using calcium under salinity conditions it leads to improved seedling growth parameters. To achieve a more accurate results slicing interaction effect of seed priming×salinity levels was performed. Hydrous calcium chloride treatments improved all traits under study except sodium and potassium concentration. This represents a better performance of seeds germination under salinity stress when seeds primed with hydrous calcium chloride.
Giordano, Debora; Beta, Trust; Gagliardi, Federica; Blandino, Massimo
2018-05-02
Among the agronomic practices carried out in corn cultivation, the early sowing time is increasingly used by farmers of temperate regions to improve yield and reduce mycotoxin contamination of corn grains. The present study determined the influence of sowing time on the phytochemical content of grains of 10 colored genotypes of corn. There was a significant improvement of both grain yield (+26%), thousand kernel weight (+3%), and test weight (+2%) in plots sown early. The early sowing also significantly influenced the chemical composition of corn grains, with an increase in the concentration of cell-wall-bound phenolic acids (+5%) and β-cryptoxanthin (+23%) and a decrease in the concentration of lutein (-18%) and total anthocyanins (-21%). Environmental conditions that occurred during grain development significantly influenced the phytochemical content of corn grain, and early spring sowing could impart advantages in terms of both productivity and content of some antioxidants of whole-meal corn flour.
Effect of Organic Amendments and Chemical Fertilization in Production of Corn (Zea Mays L.
Directory of Open Access Journals (Sweden)
Fabio Emilio Forero Ulloa
2014-11-01
Full Text Available Corn is grown in 135 countries, and because of its uses and nutritional benefits is the world's most important cereal. In Colombia it is grown in various agro-ecological conditions of production. The bagasse is an organic residue resulting from the grinding of sugar cane (Saccharum officinarum L., used for the production of jaggery (solid resulting of boiling and evaporation of the juice from sugar cane, which can be used as an amendment and is a soil conditioner, as a rich source of phosphorus, calcium and nitrogen. The aim of the research was to evaluate the effect of bagasse against the application of other organic sources and chemical fertilization in maize, variety ICA-V-305. For this, a completely random statistical design with four treatments and absolute control was established. Results were subjected to analysis of variance and Tukey comparison test. Applying Bagasse + Abimgra® produced the greatest number of ears of corn, while the use of only bagasse, presented the second best results in terms of number of grains / ear and weight of 100 grains of corn, therefore bagasse becomes , through time, an important option as organic amendment, which would favor the production of corn, and an option as organic fertilizer.
International Nuclear Information System (INIS)
Martinez y Huaman, C.A.; Cerri, C.C.
1984-01-01
The relationship between photosynthesis and distribution of 14 C-photosinthate as affected by water stress was evaluated. Corn (Zea mays L.) during the grain filling period and bean (Phaseolus vulgaris L.) during flowering, representing a C-4 and a C-3 photosynthetic type, respectively, were studied. (M.A.C.) [pt
Evaluating of Physiological Indices of Weed Species at Different Density on Corn (Zea mays L. Growth
Directory of Open Access Journals (Sweden)
Gh Mahmodi
2014-07-01
Full Text Available Crop density is one of the usage tools in sustainable agriculture to carry out integrated weed management. Weed species response varied according to diversity and density of species in agricultural ecosystems. This study was conducted in research field of Ferdowsi University of Mashhad, Iran. Four levels of corn densities (5, 6, 7 and 9 plant m-2 and four levels of species diversity were used including complete control, broad leaved control (corn and narrow leaves, grass control (corn and broad leaves and without control (corn, broadleaves and grass weeds by weeding. All species sampling were done at five stages from 42 days after planting up to the end of growth period. Crop growth rate, total dry matter of weed (TDMw and total dry matter of corn (TDMc were measured. Results showed that TDMc was minimum at 9 and 5 plant m-2 in the early growth period, while it was highest at 9 plant m-2 by the end of the growth period. Also, TDMc increased with increasing density in the weed free control, but (TDMc decreased about 46% in compare with complete control. The same trends were observed for CGR. It was found that broad leaves weeds were more effective than narrow leaves (causing 60 and 34% lower CGR reduction, respectively on corn growth.
Blended Refuge and Insect Resistance Management for Insecticidal Corn
Crespo, Andre L B; Pan, Zaiqi; Crain, Philip R; Thompson, Stephen D; Pilcher, Clinton D; Sethi, Amit
2018-01-01
Abstract In this review, we evaluate the intentional mixing or blending of insecticidal seed with refuge seed for managing resistance by insects to insecticidal corn (Zea mays). We first describe the pest biology and farming practices that will contribute to weighing trade-offs between using block refuges and blended refuges. Case studies are presented to demonstrate how the trade-offs will differ in different systems. We compare biological aspects of several abstract models to guide the reader through the history of modeling, which has played a key role in the promotion or denigration of blending in various scientific debates about insect resistance management for insecticidal crops. We conclude that the use of blended refuge should be considered on a case-by-case basis after evaluation of insect biology, environment, and farmer behavior. For Diabrotica virgifera virgifera, Ostrinia nubilalis, and Helicoverpa zea in the United States, blended refuge provides similar, if not longer, delays in the evolution of resistance compared to separate block refuges. PMID:29220481
McCann, Melinda C; Trujillo, William A; Riordan, Susan G; Sorbet, Roy; Bogdanova, Natalia N; Sidhu, Ravinder S
2007-05-16
The next generation of biotechnology-derived products with the combined benefit of herbicide tolerance and insect protection (MON 88017) was developed to withstand feeding damage caused by the coleopteran pest corn rootworm and over-the-top applications of glyphosate, the active ingredient in Roundup herbicides. As a part of a larger safety and characterization assessment, MON 88017 was grown under field conditions at geographically diverse locations within the United States and Argentina during the 2002 and 2003-2004 field seasons, respectively, along with a near-isogenic control and other conventional corn hybrids for compositional assessment. Field trials were conducted using a randomized complete block design with three replication blocks at each site. Corn forage samples were harvested at the late dough/early dent stage, ground, and analyzed for the concentration of proximate constituents, fibers, and minerals. Samples of mature grain were harvested, ground, and analyzed for the concentration of proximate constituents, fiber, minerals, amino acids, fatty acids, vitamins, antinutrients, and secondary metabolites. The results showed that the forage and grain from MON 88017 are compositionally equivalent to forage and grain from control and conventional corn hybrids.
Vertical Distribution of Structural Components in Corn Stover
Directory of Open Access Journals (Sweden)
Jane M. F. Johnson
2014-11-01
Full Text Available In the United States, corn (Zea mays L. stover has been targeted for second generation fuel production and other bio-products. Our objective was to characterize sugar and structural composition as a function of vertical distribution of corn stover (leaves and stalk that was sampled at physiological maturity and about three weeks later from multiple USA locations. A small subset of samples was assessed for thermochemical composition. Concentrations of lignin, glucan, and xylan were about 10% greater at grain harvest than at physiological maturity, but harvestable biomass was about 25% less due to stalk breakage. Gross heating density above the ear averaged 16.3 ± 0.40 MJ kg−1, but with an alkalinity measure of 0.83 g MJ−1, slagging is likely to occur during gasification. Assuming a stover harvest height of 10 cm, the estimated ethanol yield would be >2500 L ha−1, but it would be only 1000 L ha−1 if stover harvest was restricted to the material from above the primary ear. Vertical composition of corn stover is relatively uniform; thus, decision on cutting height may be driven by agronomic, economic and environmental considerations.
Vertical distribution of structural components in corn stover
Energy Technology Data Exchange (ETDEWEB)
Jane M. F. Johnson; Douglas L. Karlen; Garold L. Gresham; Keri B. Cantrell; David W. Archer; Brian J. Wienhold; Gary E. Varvel; David A. Laird; John Baker; Tyson E. Ochsner; Jeff M. Novak; Ardell D. Halvorson; Francisco Arriaga; David T. Lightle; Amber Hoover; Rachel Emerson; Nancy W. Barbour
2014-11-01
In the United States, corn (Zea mays L.) stover has been targeted for second generation fuel production and other bio-products. Our objective was to characterize sugar and structural composition as a function of vertical distribution of corn stover (leaves and stalk) that was sampled at physiological maturity and about three weeks later from multiple USA locations. A small subset of samples was assessed for thermochemical composition. Concentrations of lignin, glucan, and xylan were about 10% greater at grain harvest than at physiological maturity, but harvestable biomass was about 25% less due to stalk breakage. Gross heating density above the ear averaged 16.3 ± 0.40 MJ kg?¹, but with an alkalinity measure of 0.83 g MJ?¹, slagging is likely to occur during gasification. Assuming a stover harvest height of 10 cm, the estimated ethanol yield would be >2500 L ha?¹, but it would be only 1000 L ha?¹ if stover harvest was restricted to the material from above the primary ear. Vertical composition of corn stover is relatively uniform; thus, decision on cutting height may be driven by agronomic, economic and environmental considerations.
Effects of Vermi compost and Compost tea Application on the Growth criteria of Corn (Zea mays
Directory of Open Access Journals (Sweden)
R Afsharmanesh
2016-07-01
Full Text Available Introduction Maize (Zea mays is a cereal crop that is grown widely throughout the world in a range of agroecological environments. .Its value as a cost-effective ruminant feed is one of the main reasons that farmers grow it. However, lack of nutrients such as N and P, are the principal obstacles - to crop production under low input agricultural systems leading to dependency on chemical fertilizers. Long-term use of chemical fertilizers destroy soil physicochemical properties and it reduced permeability which restricts root growth, nutrient uptake and plant production. Therefore, the use of organic fertilizers can help to enrich the soil root zone As a result growth and yield will improve. Materials and Methods In order to study the effects of different levels of vermicompost and foliar application of tea compost on growth characteristics of the hybrid maize genotype 713, a greenhouse experiment was conducted as a factorial experiment in randomized complete block design with three replications at the Vali-e-Asr University of Rafsanjan, during 2013. Treatments were included vermicompost (0, 5%, 10%, 15%, 20%, 25% and 30% pot weight and tea composts (foliar application, non-foliar application. Measured traits were included root dry weight, root volume, leaf dry weight, stem dry weight, macro nutrient concentration (N and P and micro nutrient concentration (Zn, Mn, Fe and Cu. All the data were subjected to the statistical analysis (two-way ANOVA using SAS software (SAS 9.1.3. Differences between the treatments were performed by Duncan’s multiple range test (DMRT at 1% confidence interval. Results and Discussion Results indicated that leaf and stem dry weight affected by the application of vermicompost and tea compost. However, the interaction effects had no significant effects on the leaf and stem dry weight. Application of tea compost increased 20% and 50% leaf dry weight and stem dry weight of corn compared to non- foliar application
Evaluation of multi-species weed competition and weeds population dynamic in corn Zea mays L. field
Directory of Open Access Journals (Sweden)
S Mijani
2016-05-01
Full Text Available In order to examine the multi-species weed competition in corn field an experiment as an interval mapping was carried out at the Agricultural Research field of Ferdowsi University of Mashhad during growing season 2009-2010. At 3-4 leafy stages of corn, 20 non-destructive quadrates determine and the density of weeds was counted separately. At the same time, 20 destructive quadrates determine and in addition of counting number of plants, leaf area index and dry weight of each species were recorded separately. By using data from previous section, hyperbolic functions were fitted. In these functions number of species serve as the independent variable, weight or leaf area was considered as the dependent variable. With the help of these functions and leaf dry weight of each species was determined for non-destructive quadrates at this stage. Relative leaf area at early season as independent variables and natural logarithm of individual plant weight at later season as dependent variable in a multiple linear regression was fitted to obtain the interspecies competition coefficients. Based on ln of weight of single plant equation the weed interference effects on the corn yield can be divided into two groups: inhibition (negative sign and stimulation (positive sign. Among all weeds, night shade (Solanum nigrum L., redroot pigweed (Amaranthus retroflexus L. and lambsquarter (Chenopodium album L. had positive effects on corn yield, respectively. In fact, these weeds had competition and negative impacts on other weeds and reduced their competition power with corn and caused facilitation role on corn yield. At the end of growing season of corn, population of lambsquarter and Common purslane (Portulaca oleracea L. decreased while population of barnyard grass(Echinochloa crus-galli L., redroot pigweed and night shade increased.
QTL analysis of kernel soluble sugar content in supersweet corn | Qi ...
African Journals Online (AJOL)
sweet corn population consisting of 208 F2 individuals from the cross Ji557 (sh2) × Ji165 (sh2). Density of the linkage groups varied from 2.2 cM to 65.3 cM, with an average of 13.0 2 cM between two adjacent markers. The map covered 1470.9 cM ...
Wang, Pei; Lu, Yanli; Zheng, Mingmin; Rong, Tingzhao; Tang, Qilin
2011-01-01
Genetic relationship of a newly discovered teosinte from Nicaragua, Zea nicaraguensis with waterlogging tolerance, was determined based on randomly amplified polymorphic DNA (RAPD) markers and the internal transcribed spacer (ITS) sequences of nuclear ribosomal DNA using 14 accessions from Zea species. RAPD analysis showed that a total of 5,303 fragments were produced by 136 random decamer primers, of which 84.86% bands were polymorphic. RAPD-based UPGMA analysis demonstrated that the genus Zea can be divided into section Luxuriantes including Zea diploperennis, Zea luxurians, Zea perennis and Zea nicaraguensis, and section Zea including Zea mays ssp. mexicana, Zea mays ssp. parviglumis, Zea mays ssp. huehuetenangensis and Zea mays ssp. mays. ITS sequence analysis showed the lengths of the entire ITS region of the 14 taxa in Zea varied from 597 to 605 bp. The average GC content was 67.8%. In addition to the insertion/deletions, 78 variable sites were recorded in the total ITS region with 47 in ITS1, 5 in 5.8S, and 26 in ITS2. Sequences of these taxa were analyzed with neighbor-joining (NJ) and maximum parsimony (MP) methods to construct the phylogenetic trees, selecting Tripsacum dactyloides L. as the outgroup. The phylogenetic relationships of Zea species inferred from the ITS sequences are highly concordant with the RAPD evidence that resolved two major subgenus clades. Both RAPD and ITS sequence analyses indicate that Zea nicaraguensis is more closely related to Zea luxurians than the other teosintes and cultivated maize, which should be regarded as a section Luxuriantes species. PMID:21525982
We report results of the last two years of a 7-year (2008-2014) field experiment designed to test the null hypothesis that applications of glyphosate on glyphosate resistant corn (Zea mays L.) as a routine weed control practice under both conventional and reduced tillage practices would have no effe...
Purple corn-associated rhizobacteria with potential for plant growth promotion.
Castellano-Hinojosa, A; Pérez-Tapia, V; Bedmar, E J; Santillana, N
2018-05-01
Purple corn (Zea mays var. purple amylaceum) is a native variety of the Peruvian Andes, cultivated at 3000 m since the pre-Inca times without N fertilization. We aimed to isolate and identify native plant growth-promoting rhizobacteria (PGPR) for future microbial-based inoculants. Eighteen strains were isolated from the rhizosphere of purple corn plants grown without N fertilization in Ayacucho (Peru). The 16S rRNA gene clustered the 18 strains into nine groups that contained species of Bacillus, Stenotrophomonas, Achromobacter, Paenibacillus, Pseudomonas and Lysinibacillus. A representative strain from each group was selected and assayed for N 2 fixation, phosphate solubilization, indole acetic and siderophore production, 1-aminocyclopropane-1-carboxylic acid deaminase activity and biocontrol abilities. Inoculation of purple corn plants with single and combined strains selected after a principal component analysis caused significant increases in root and shoot dry weight, total C and N contents of the plants. PGPRs can support growth and crop production of purple corn in the Peruvian Andes and constitute the base for microbial-based inoculants. This study enlarges our knowledge on plant-microbial interactions in high altitude mountains and provides new applications for PGPR inoculation in purple amylaceum corn, which is part of the staple diet for the native Quechua communities. © 2018 The Society for Applied Microbiology.
Quantitative analysis of allantoin in Iranian corn silk
Directory of Open Access Journals (Sweden)
E. Khanpour*
2017-11-01
Full Text Available Background and objectives: Zea mays is cultivated in different parts of Iran and corn silk is used in traditional medicine. Allantoin is one of the major compounds in corn silk. The purpose of this research was the quantitatve analysis of allantoin in corn silks belonging to several regions of Iran. Methods: The samples of corn silk were prepared from three provinces of Iran (Kermanshah, Fars and Razavi Khorasan. The dried plant materials were infused in boiling distilled water with a temperature of 90-95 °C on magnetic stirrer for 30 min. The levels of allantoin in aqueous extracts were determined by HPLC. Quantification was achieved using an C18 column (250×4.6 mm, 5 µm under isocratic conditions and phosphate buffer solution (pH 3.0 as the mobile phase at a flow rate of 0.5 mL/min. Column effluent was monitored at 210 nm. The calibration curve of allantoin standard was plotted with concentrations from 6.25 to 100 µg/mL. Results: The calibration curve of standard was linear over the concentration range used (R2=0.9999. The results showed that the amount of allantoin in samples was between 205 and 374 mg/100g of dry plant material. The corn silk samples of Razavi Khorasan and Fars provinces showed the lowest and highest amount of allantoin, respectively. Conclusion: The levels of allantoin obtained in this study were higher than the values reported in other studies; therefore, the researchers of this project are investigating the wound healing effect of corn silk.
Irrigation management for corn (Zea mays L.) production on the typical low water holding capacity soil of the southeastern USA needs to be improved to increase irrigation efficiency and reduce losses of nitrate from fields. A three-year (2012-2014) field study was conducted to compare the effects of...
Paula-Moraes, S V; Hunt, T E; Wright, R J; Hein, G L; Blankenship, E E
2012-12-01
Western bean cutworm, Striacosta albicosta (Smith), has undergone a recent eastward expansion from the western U.S. Corn Belt to Pennsylvania and parts of Canada. Little is known about its ecology and behavior, particularly during the early instars, on corn (Zea mays L.). There is a narrow treatment window for larvae, and early detection of the pest in the field is essential. An understanding of western bean cutworm larval feeding and early-instar dispersal is essential to understand larval survival and establishment in corn. Studies were conducted in 2009 through 2011 in Nebraska to determine the feeding and dispersal of early-instar western bean cutworm on corn. The treatment design was a factorial with three corn stages (pretassel, tassel, and posttassel) and five corn plant zones (tassel, above ear, primary ear, secondary ear, and below ear) in a randomized complete block design. The effects of different corn tissues on larval survival and development were investigated in laboratory studies in a randomized complete block design during 2009 and 2011. Treatments were different corn tissues (leaf alone, leaf with developing tassel, pollen, pollen plus silk, and silk alone). Results demonstrated that neonate larvae move to the upper part of the plant, independent of corn stage. Larval growth was optimal when fed on tassel tissue. Overall results indicated a selective benefit for movement of the early instar to upper part of the plant.
Directory of Open Access Journals (Sweden)
Jane M. F. Johnson
2013-02-01
Full Text Available Corn (Zea mays L. stover is a potential bioenergy feedstock, but little is known about the impacts of reducing stover return on yield and soil quality in the Northern US Corn Belt. Our study objectives were to measure the impact of three stover return rates (Full (~7.8 Mg ha−1 yr−1, Moderate (~3.8 Mg ha−1 yr−1 or Low (~1.5 Mg ha yr−1 Return on corn and soybean (Glycine max. L [Merr.] yields and on soil dynamic properties on a chisel-tilled (Chisel field, and well- (NT1995 or newly- (NT2005 established no-till managed fields. Stover return rate did not affect corn and soybean yields except under NT1995 where Low Return (2.88 Mg ha−1 reduced yields compared with Full and Moderate Return (3.13 Mg ha−1. In NT1995 at 0–5 cm depth, particulate organic matter in Full Return and Moderate Return (14.3 g kg−1 exceeded Low Return (11.3 g kg−1. In NT2005, acid phosphatase activity was reduced about 20% in Low Return compared to Full Return. Also the Low Return had an increase in erodible-sized dry aggregates at the soil surface compared to Full Return. Three or fewer cycles of stover treatments revealed little evidence for short-term impacts on crop yield, but detected subtle soil changes that indicate repeated harvests may have negative consequences if stover removed.
Luterotti, S.; Bicanic, D.D.; Kijak, K.; Grbesa, D.; Martinez, E.; Spruijt, R.B.
2011-01-01
This study describes the application of the laser photoacoustic spectroscopy (PAS) for quantification of total carotenoids (TC) in corn flours and sweetpotato flours. Overall, thirty-three different corn flours and nine sweetpotato flours were investigated. All PAS measurements were performed at
Comparisons of Herbicide Treated and Cultivated Herbicide-Resistant Corn
Directory of Open Access Journals (Sweden)
H. Arnold Bruns
2010-01-01
Full Text Available Four glyphosate resistant corn (Zea mays L. hybrids, a glufosinate-ammonium resistant hybrid, and a conventional atrazine resistant hybrid gown at Stoneville, MS in 2005, 2006, and 2007 with furrow irrigation were treated with their respective herbicides and their growth, yield, and mycotoxin incidence were compared with untreated cultivated plots. Leaf area index (LAI and dry matter accumulation (DMA were collected on a weekly basis beginning at growth stage V3 and terminating at anthesis. Crop growth rates (CRGs and relative growth rates (RGRs were calculated. Plots were later harvested, yield and yield component data collected, and kernel samples analyzed for aflatoxin and fumonisin. Leaf area index, DMA, CRG, and RGR were not different among the herbicide treated plots and from those that were cultivated. Curves for LAI and DMA were similar to those previously reported. Aflatoxin and fumonisin were relatively low in all plots. Herbicide application or the lack thereof had no negative impact on the incidence of kernel contamination by these two mycotoxins. Herbicides, especially glyphosate on resistant hybrids, have no negative effects on corn yields or kernel quality in corn produced in a humid subtropical environment.
Water Table Management Reduces Tile Nitrate Loss in Continuous Corn and in a Soybean-Corn Rotation
Directory of Open Access Journals (Sweden)
Craig F. Drury
2001-01-01
Full Text Available Water table management systems can be designed to alleviate soil water excesses and deficits, as well as reduce nitrate leaching losses in tile discharge. With this in mind, a standard tile drainage (DR system was compared over 8 years (1991 to 1999 to a controlled tile drainage/subirrigation (CDS system on a low-slope (0.05 to 0.1% Brookston clay loam soil (Typic Argiaquoll in southwestern Ontario, Canada. In the CDS system, tile discharge was controlled to prevent excessive drainage, and water was pumped back up the tile lines (subirrigation to replenish the crop root zone during water deficit periods. In the first phase of the study (1991 to 1994, continuous corn (Zea mays, L. was grown with annual nitrogen (N fertilizer inputs as per local soil test recommendations. In the second phase (1995 to 1999, a soybean (Glycine max L., Merr.-corn rotation was used with N fertilizer added only during the two corn years. In Phase 1 when continuous corn was grown, CDS reduced total tile discharge by 26% and total nitrate loss in tile discharge by 55%, compared to DR. In addition, the 4-year flow weighted mean (FWM nitrate concentration in tile discharge exceeded the Canadian drinking water guideline (10 mg N l–1 under DR (11.4 mg N l–1, but not under CDS (7.0 mg N l–1. In Phase 2 during the soybean-corn rotation, CDS reduced total tile discharge by 38% and total nitrate loss in tile discharge by 66%, relative to DR. The 4-year FWM nitrate concentration during Phase 2 in tile discharge was below the drinking water guideline for both DR (7.3 mg N l–1 and CDS (4.0 mg N l–1. During both phases of the experiment, the CDS treatment caused only minor increases in nitrate loss in surface runoff relative to DR. Hence CDS decreased FWM nitrate concentrations, total drainage water loss, and total nitrate loss in tile discharge relative to DR. In addition, soybean-corn rotation reduced FWM nitrate concentrations and total nitrate loss in tile discharge
Fresh market sweet corn produced in Florida is threatened by larval damage by Euxesta stigmatias Loew, E. eluta Loew, and Chaetopsis massyla Walker (Diptera: Ulidiidae) that renders ears unmarketable. No standard lure exists for monitoring these pests. Oviposition and attraction bioassays were desig...
Dorhout, David L; Rice, Marlin E
2010-02-01
The effect of genetically modified corn (event MON810, YieldGard Corn Borer) expressing the Bacillus thuringiensis sp. kurstaki (Berliner) (Bt) endotoxin, Cry1Ab, on the survival of western bean cutworm, Striacosta albicosta (Smith), larvae was examined during intraguild competition studies with either European corn borer, Ostrinia nubilalis (Hübner), or corn earworm, Helicoverpa zea (Boddie), larvae. Competition scenarios were constructed by using either a laboratory or field competition arena containing one of five different diets and one of 13 different larval size-by-species scenarios. The survival of western bean cutworms competing with corn earworms in the laboratory arenas on either a meridic diet or isoline corn silk diet was significantly lower (P corn earworm on a Cry1Ab-MON810 corn silk diet was significant higher (P corn borers generally did not alter the outcomes observed in the western bean cutworm and corn earworm only two-way competitions. These data suggest that Cry1Ab-MON810 corn may confer a competitive advantage to western bean cutworm larvae during intraguild competition, particularly from corn earworms, and that western bean cutworms become equal competitors only when they are of equal or larger size and the diet is Cry1Ab-MON810 corn.
Patil, N N; Waghmode, M S; Gaikwad, P S; Gajbhiye, M H; Gunjal, A B; Nawani, N N; Kapadnis, B P
2014-11-01
The study was undertaken with the aim of exploring novel and beneficial agro activities of rare actinomycetes like Microbispora sp. V2. The antagonistic activity of Microbispora sp. V2 was evaluated as a biocontrol agents against Sclerotium rolfsii, a soil-borne fungal plant pathogen. The methodology performed for evaluation of biocontrol agent was in vitro evaluation assay which comprised of three tests viz., cellophane overlay technique, seed germination test and Thiram (fungicide) tolerance of Microbispora sp. V2. The isolate was found to inhibit the fungal pathogen Sclerotium rolfsii to 91.43% in cellophane assay. In seed germination assay, Microbispora sp. V2 treated seeds resulted in 25.75% increased germination efficiency, as compared to seeds infected by Sclerotium rolfsii. The isolate Microbispora sp. V2 could tolerate 1000 microg mL(-1) of Thiram (fungicide). The in vitro assay studies proved that Microbispora sp. V2 can be used as antifungal antagonist and thus posses' great potential as biocontrol agent against southern blight caused by Sclerotium rolfsii in Zea mays L (Baby corn) which causes large economical losses.
Sytykiewicz, Hubert
2014-01-01
The aim of this study was to compare the expression patterns of superoxide dismutase genes (sod2, sod3.4, sod9 and sodB) in seedling leaves of the Zea mays L. Tasty Sweet (susceptible) and Ambrozja (relatively resistant) cultivars infested with one of two hemipteran species, namely monophagous Sitobion avenae F. (grain aphid) or oligophagous Rhopalosiphum padi L. (bird cherry-oat aphid). Secondarily, aphid-elicited alternations in the antioxidative capacity towards DPPH (1,1-diphenyl-2-picrylhydrazyl) radical in insect-stressed plants were evaluated. Comprehensive comparison of expression profiles of the four sod genes showed that both insect species evoked significant upregulation of three genes sod2, sod3.4 and sod9). However, aphid infestation affected non-significant fluctuations in expression of sodB gene in seedlings of both maize genotypes. The highest levels of transcript accumulation occurred at 8 h (sod2 and sod3.4) or 24 h (sod9) post-infestation, and aphid-induced changes in the expression of sod genes were more dramatic in the Ambrozja cultivar than in the Tasty Sweet variety. Furthermore, bird cherry-oat aphid colonization had a more substantial impact on levels of DPPH radical scavenging activity in infested host seedlings than grain aphid colonization. Additionally, Ambrozja plants infested by either hemipteran species showed markedly lower antioxidative capacity compared with attacked Tasty Sweet plants.
Sytykiewicz, Hubert
2014-01-01
The aim of this study was to compare the expression patterns of superoxide dismutase genes (sod2, sod3.4, sod9 and sodB) in seedling leaves of the Zea mays L. Tasty Sweet (susceptible) and Ambrozja (relatively resistant) cultivars infested with one of two hemipteran species, namely monophagous Sitobion avenae F. (grain aphid) or oligophagous Rhopalosiphum padi L. (bird cherry-oat aphid). Secondarily, aphid-elicited alternations in the antioxidative capacity towards DPPH (1,1-diphenyl-2-picrylhydrazyl) radical in insect-stressed plants were evaluated. Comprehensive comparison of expression profiles of the four sod genes showed that both insect species evoked significant upregulation of three genes sod2, sod3.4 and sod9). However, aphid infestation affected non-significant fluctuations in expression of sodB gene in seedlings of both maize genotypes. The highest levels of transcript accumulation occurred at 8 h (sod2 and sod3.4) or 24 h (sod9) post-infestation, and aphid-induced changes in the expression of sod genes were more dramatic in the Ambrozja cultivar than in the Tasty Sweet variety. Furthermore, bird cherry-oat aphid colonization had a more substantial impact on levels of DPPH radical scavenging activity in infested host seedlings than grain aphid colonization. Additionally, Ambrozja plants infested by either hemipteran species showed markedly lower antioxidative capacity compared with attacked Tasty Sweet plants. PMID:24722734
George, Gladys O; Idu, Faustina K
2015-03-01
Hypotensive properties have been attributed to the stigma/style of Zea mays L (corn silk). Although the effect of corn silk extract on blood pressure has been documented in animal studies, we are not aware of any study on its effect on human blood pressure and intraocular pressure. A randomised study was carried out on the effect of water only, masked doses of corn silk aqueous extract (60, 130, 192.5 and 260 mg/kg body weight) on intraocular pressure and blood pressure of 20 systemic and 20 non-systemic hypertensive subjects. Intraocular pressure and blood pressure were measured at baseline and every hour for eight hours after administering water or a masked dose of corn silk aqueous extract. Each dose was administered at two-week intervals to each subject in the two study groups. The results showed that the last three doses of corn silk aqueous extract gave a statistically significant reduction (p Corn silk aqueous extract has a lowering effect on intraocular pressure in systemic and non-systemic hypertensive subjects. This may have resulted from the fall in blood pressure that is due to potassium-induced natriuresis and diuresis caused by the high potassium content in the high doses of the corn silk extract. © 2015 The Authors. Clinical and Experimental Optometry © 2015 Optometry Australia.
Nitrogen replacement value of alfalfa to corn and wheat under irrigated Mediterranean conditions
Ballesta, A.; Lloveras, J.
2010-01-01
In crop rotations that include alfalfa (Medicago sativa L.), agronomic and environmental concerns mean that it is important to determine the N fertilizer contribution of this legume for subsequent crops in order to help to increase the sustainability of cropping systems. To determine the N fertilizer replacement value (FRV) of a 2-yr alfalfa crop on subsequent crops of corn (Zea mays L.) followed by wheat (Triticum aestivum L.) under irrigated Mediterranean conditions, two 4-yr rotations (alf...
Infection of corn ears by Fusarium spp. induces the emission of volatile sesquiterpenes.
Becker, Eva-Maria; Herrfurth, Cornelia; Irmisch, Sandra; Köllner, Tobias G; Feussner, Ivo; Karlovsky, Petr; Splivallo, Richard
2014-06-04
Infection of corn (Zea mays L.) ears with fungal pathogens of the Fusarium genus might result in yield losses and in the accumulation of mycotoxins. The aim of this study was to investigate whether volatile profiles could be used to identify Fusarium-infected corn ears. The volatiles released by corn ears infected by Fusarium graminearum, Fusarium verticillioides, and Fusarium subglutinans were studied. Volatile emission was recorded at 24 days postinoculation (dpi) and in a time series (from 4 to 24 dpi). Twenty-two volatiles were differentially emitted from Fusarium-infected versus healthy corn ears. These included C6-C8 compounds and sesquiterpenoids. All volatiles indicative of Fusarium infection were detectable as early as 4-8 dpi and continued to be produced to the final sampling time (early milk maturity stage). The induced emission of β-macrocarpene and β-bisabolene correlated with an increased transcript accumulation of corn terpene synthase 6/11 (tps6/11). Additionally, the modification of volatile profiles after Fusarium infection was accompanied by the induction of plant defense compounds such as zealexins and oxylipins. Together, these results reveal a broad metabolic response of the plant to pathogen attack. Volatile biomarkers of Fusarium infection are promising indicators for the early detection of fungal infection before disease symptoms become visible.
Directory of Open Access Journals (Sweden)
Geraldo Pereira Pereira Junior
2013-06-01
Full Text Available O objetivo deste estudo foi avaliar o desempenho produtivo de juvenis de tambaqui (Colossoma macropomum, alimentados com níveis crescentes de farinha de crueira de mandioca, Manihot esculenta (0%, 20%, 40%, 60%, 80%, 100%, como substituto do milho (Zea mays. Os peixes (peso médio inicial de 6,6 ± 0,1 g foram distribuídos aleatoriamente em 24 grupos (20 peixes/grupo e alimentados com as dietas experimentais em quatro repetições para avaliação da performance de crescimento, eficiência alimentar, composição corporal e os custos de produção. As performances de crescimento não foram afetados pelos tratamentos. O teor de lipídio no músculo foi diferentemente significativo em peixes alimentados com 40% e 100% em relação aos outros tratamentos. O custo de produção de milho diminuiu linearmente com a substituição. O valor da dieta diminuiu de R $ 1,43 kg-1 a R $ 1,21 kg-1 e o peixe de R $ 1,54 kg-1 a R $ 1,30 peixe kg-1. Concluiu-se que o milho pode ser totalmente substituído por farinha de crueira de mandioca na dieta de juvenil de tambaqui, sem prejudicar o seu desempenho.The main objective of this study was to evaluate the productive performance of young tambaqui (Colossoma macropum, fed with increasing levels of cassava flour, Manihot esculenta (0%, 20%, 40%, 60%, 80%, 100%, as corn (Zea mays replacement. Fish (initial body weight 6.6 ± 0.1 g were randomly distributed in 24 groups (20 fish/group with four replications. They were fed with the experimental diets for evaluation of growth performances, feed utilization, body composition and production costs. Growth performances were not affected by the dietary treatments. Lipid content in muscle were significant different in fish fed 40% and 100% substitution when compared to the other treatments. The production cost decreased linearly with corn substitution. Diet decreased from R$ 1.43 kg-1 to R$ 1.21 kg-1 and fish production cost from R$ 1.54 kg-1 to R$ 1.30 kg-1 fish. It was
Field evidence for the exposure of ground beetles to Cry1Ab from transgenic corn.
Zwahlen, Claudia; Andow, David A
2005-01-01
Non-target organisms associated with the soil might be adversely affected by exposure to the CrylAb protein from Bacillus thuringiensis (Bt) in transgenic corn (Zea mays L.). To check for such exposure, we used ELISA to test for Cry1Ab in ground beetles collected live from fields with Bt corn residues and Bt corn (Bt/Bt), Bt corn residues and non-Bt crops (Bt/non-Bt), or non-Bt corn residues and non-Bt crops (non-Bt/non-Bt). In fields with Bt corn residues (Bt/Bt and Bt/non-Bt), Cry1Ab was present in all seven species of ground beetles examined (Agonum placidum, Bembidion rupicola, Clivina impressefrons, Cyclotrachelus iowensis, Harpalus pensylvanicus, Poecilus chalcites, and Poecilus lucublandus). For the two most abundant species, P. chalcites and P. lucublandus, the proportion of beetles with Cry1Ab was significantly higher in Bt/Bt fields (0.50-1.0) and Bt/non-Bt fields (0.41-0.50) than in non-Bt/non-Bt fields (0.0). This is the first field evidence that some ground beetle species are exposed to Cry1Ab. The implications of exposure on the performance of these non-target organisms are unclear.
Organics and mineral fertilizers and biological control on the incidence of stalk rot and corn yield
Directory of Open Access Journals (Sweden)
Elena Blume
2014-06-01
Full Text Available The expansion of area under maize (Zea mays L. and the use of no tillage have favored the incidence of stalk rot on this crop. The study aimed to evaluate the organic fertilizers and the treatment of corn seeds with Trichoderma spp. on the production of dry matter (DM of shoot, incidence of stalk rot and corn yield. The experiment consisted in a factorial with split-plot in strips, on the randomized block design with four replicates, and the fertilization treatments (pig slurry; swine deep bedding; cattle slurry; mineral fertilizer; control treatment were applied to the plots and the seeds treatment (with and without Trichoderma spp. in the subplots. At the flowering stage, three corn plants per subplot were collected for the assessment of DM production. At physiological maturity stage, the incidence of stalk rot was assessed, and the ears of corn harvested for productivity assessment. The organic and mineral fertilizers increased the production of DM and productivity of corn. Trichoderma spp. increased the production of DM of corn, but had no reflection on productivity. The incidence of stalk rot in corn was higher in treatments with organic and mineral fertilization. Organic fertilizers increase dry matter production of shoot and corn yield, and Trichoderma spp. provides an increase in dry matter production of shoot.
Prediction of County-Level Corn Yields Using an Energy-Crop Growth Index.
Andresen, Jeffrey A.; Dale, Robert F.; Fletcher, Jerald J.; Preckel, Paul V.
1989-01-01
Weather conditions significantly affect corn yields. while weather remains as the major uncontrolled variable in crop production, an understanding of the influence of weather on yields can aid in early and accurate assessment of the impact of weather and climate on crop yields and allow for timely agricultural extension advisories to help reduce farm management costs and improve marketing, decisions. Based on data for four representative countries in Indiana from 1960 to 1984 (excluding 1970 because of the disastrous southern corn leaf blight), a model was developed to estimate corn (Zea mays L.) yields as a function of several composite soil-crop-weather variables and a technology-trend marker, applied nitrogen fertilizer (N). The model was tested by predicting corn yields for 15 other counties. A daily energy-crop growth (ECG) variable in which different weights were used for the three crop-weather variables which make up the daily ECG-solar radiation intercepted by the canopy, a temperature function, and the ratio of actual to potential evapotranspiration-performed better than when the ECG components were weighted equally. The summation of the weighted daily ECG over a relatively short period (36 days spanning silk) was found to provide the best index for predicting county average corn yield. Numerical estimation results indicate that the ratio of actual to potential evapotranspiration (ET/PET) is much more important than the other two ECG factors in estimating county average corn yield in Indiana.
Reyes, Andres; Messina, Carlos D; Hammer, Graeme L; Liu, Lu; van Oosterom, Erik; Lafitte, Renee; Cooper, Mark
2015-12-01
Breeders have successfully improved maize (Zea mays L.) grain yield for the conditions of the US corn-belt over the past 80 years, with the past 50 years utilizing single-cross hybrids. Long-term improvement for grain yield under water-limited conditions has also been reported. Grain yield under water-limited conditions depends on water use, water use efficiency, and harvest index. It has been hypothesized that long-term genetic gain for yield could be due, in part, to increased water capture from the soil. This hypothesis was tested using a set of elite single-cross hybrids that were released by DuPont Pioneer between 1963 and 2009. Eighteen hybrids were grown in the field during 2010 and 2011 growing seasons at Woodland, CA, USA. Crops grew predominantly on stored soil water and drought stress increased as the season progressed. Soil water content was measured to 300cm depth throughout the growing season. Significant water extraction occurred to a depth of 240-300cm and seasonal water use was calculated from the change in soil water over this rooting zone. Grain yield increased significantly with year of commercialization, but no such trend was observed for total water extraction. Therefore, the measured genetic gain for yield for the period represented by this set of hybrids must be related to either increased efficiency of water use or increased carbon partitioning to the grain, rather than increased soil water uptake. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Rapid changes in protein phosphorylation associated with gravity perception in corn roots
International Nuclear Information System (INIS)
McFadden, J.J.; Poovaiah, B.W.
1987-01-01
A previous paper from this laboratory showed calcium- and calmodulin-dependent in vivo protein phosphorylation in corn root tips. The authors show that rapid changes in calcium-dependent protein phosphorylation are involved in light-dependent graviperception in corn root tips. Corn seedlings (Zea mays L, cv Merit) were grown in the dark for 3 d, then apical root segments were harvested in dim green light to measure in vivo protein phosphorylation. Segments were incubated with 0.5 mCi 32 P for 1 h, then immediately frozen in liquid N 2 or first treated with either 7 min light, or 7 min light plus 1 mM EGTA and 10 μM A23187. Labeled proteins were separated by 2D gel electrophoresis and detected by autoradiography. Light caused rapid and specific promotion of phosphorylation of 5 polypeptides. The increases in protein phosphorylation were reversed by treating with EGTA and A23187. The authors postulate that these changes in protein phosphorylation are an essential part of the light-dependent gravity response in Merit roots
Leaf transpiration efficiency of sweet corn varieties from three eras of breeding
When measured under midday field conditions, modern varieties of corn often have sub-stomatal concentrations of carbon dioxide in excess of those required to saturate photosynthesis. This results in lower leaf transpiration efficiency, the ratio of photosynthesis to transpiration, than potentially ...
Optical Reflectance and Fluorescence for Detecting Nitrogen Needs in Zea mays L.
McMurtrey, J. E.; Middleton, E. M.; Corp. L. A.; Campbell, P. K. Entcheva; Butcher, L. M.; Daughtry, C. S. T.
2003-01-01
Nitrogen (N) status in field grown corn (Zea mays L.) was assessed using spectral techniques. Passive reflectance remote sensing and, both passive and active fluorescence sensing methods were investigated. Reflectance and fluorescence methods are reported to detect changes in the primary plant pigments (chlorophylls a and b; carotenoids) in higher plant species. As a general rule, foliar chlorophyll a (Chl a) and chlorophyll b (Chl b) usually exist in approx.3:l ratio. In plants under stress, Chl b content is affected before Chl a reductions occur. For reflectance, a version of the chlorophyll absorption in reflectance index (CARI) method was tested with narrow bands from the Airborne Imaging Spectroradiometer for Applications (ASIA). CARI minimizes the effects of soil background on the signal from green canopies. A modified CARI (MCARI) was used to track total Chl a levels in the red dip of the spectrum from the corn canopy. A second MCARI was used to track the auxiliary plant pigments (Chl b and the carotenoids) in the yellow/orange/red edge part of the reflectance spectrum. The difference between these two MCARI indices detected variations in N levels across the field plot canopies using ASIA data. At the leaf level, ratios of fluorescence emissions in the blue, green, red and far-red wavelengths sensed responses that were associated with the plant pigments, and were indicative of energy transfer in the photosynthetic process. N stressed corn stands could be distinguish from those with optimally applied N with fluorescence emission spectra obtained from individual corn leaves. Both reflectance and fluorescence methods are sensitive in detecting corn N needs and may be especially powerful in monitoring crop conditions if both types of information can be combined.
Daniel F. de Carvalho; Eliete N. Eduardo; Wilk S. de Almeida; Lucas A. F. Santos; Teodorico Alves Sobrinho
2015-01-01
ABSTRACTThis study evaluated soil and water losses, soil water infiltration and infiltration rate models in soil tillage systems and corn (Zea mays, L.) development stages under simulated rainfall. The treatments were: cultivation along contour lines, cultivation down the slope and exposed soil. Soil losses and infiltration in each treatment were quantified for rains applied using a portable simulator, at 0, 30, 60 and 75 days after planting. Infiltration rates were estimated using the models...
Pine (Pinus spp.) bedding has been shown to lower the concentration of odorous volatile organic compounds (VOCs) and pathogenic bacteria compared with corn (Zea mays L.) stover bedding, but availability and cost limit the use of pine bedding in cattle confinement facilities. The objectives of this s...
The effect of nitrogen rate on transgenic corn Cry3Bb1 protein expression.
Marquardt, Paul T; Krupke, Christian H; Camberato, James J; Johnson, William G
2014-05-01
Combining herbicide-resistant and Bacillus thuringiensis (Bt) traits in corn (Zea mays L.) hybrids may affect insect resistance management owing to volunteer corn. Some Bt toxins may be expressed at lower levels by nitrogen-deficient corn roots. Corn plants with sublethal levels of Bt expression could accelerate the evolution of Bt resistance in target insects. The present objective was to quantify the concentration of Bt (Cry3Bb1) in corn root tissue with varying tissue nitrogen concentrations. Expression of Cry3Bb1 toxin in root tissue was highly variable, but there were no differences in the overall concentration of Cry3Bb1 expressed between roots taken from Cry3Bb1-positive volunteer and hybrid corn plants. The nitrogen rate did affect Cry3Bb1 expression in the greenhouse, less nitrogen resulted in decreased Cry3Bb1 expression, yet this result was not documented in the field. A positive linear relationship of plant nitrogen status on Cry3Bb1 toxin expression was documented. Also, high variability in Cry3Bb1 expression is potentially problematic from an insect resistance management perspective. This variability could create a mosaic of toxin doses in the field, which does not fit into the high-dose refuge strategy and could alter predictions about the speed of evolution of resistance to Cry3Bb1 in western corn rootworm Diabrotica virgifera virgifera LeConte. © 2013 Society of Chemical Industry.
Assessment of plant biomass and nitrogen nutrition with plant height in early-to mid-season corn.
Yin, Xinhua; Hayes, Robert M; McClure, M Angela; Savoy, Hubert J
2012-10-01
The physiological basis for using non-destructive high-resolution measurements of plant height through plant height sensing to guide variable-rate nitrogen (N) applications on corn (Zea mays L.) during early (six-leaf growth stage, V6) to mid (V12) season is largely unknown. This study was conducted to assess the relationships of plant biomass and leaf N with plant height in early- to mid-season corn under six different N rate treatments. Corn plant biomass was significantly and positively related to plant height under an exponential model when both were measured at V6. This relationship explained 62-78% of the variations in corn biomass production. Leaf N concentration was, in general, significantly and positively related to plant height when both were measured at V6, V8, V10 and V12. This relationship became stronger as the growing season progressed from V6 to V12. The relationship of leaf N with plant height in early- to mid-season corn was affected by initial soil N fertility and abnormal weather conditions. The relationship of leaf N concentration with plant height may provide a physiological basis for using plant height sensing to guide variable-rate N applications on corn. Copyright © 2012 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Márcio Viera
2011-06-01
Full Text Available This study aimed at quantifying the production and distribution of aboveground biomass from the plants in monospecific and mixed stands of eucalyptus (hybrid E. urophylla x E. grandis and black wattle (Acacia mearnsii and, of corn (Zea mays in agrosilvicultural systems. The biomass evaluation (leaf, branch, bark and wood from the forest species at 6 and 18 months of age were performed at the treatments: 100E (100% of eucalyptus + corn; - 100A (100% of black wattle + corn; - 50E:50A (50% of eucalyptus + 50% of black wattle + corn. The corn biomass evaluation (stem, leaves, straw, cob and grains was performed at treatments 100E; 100A; 50E:50A; 75E:25A (75% of eucalyptus + 25% of black wattle + corn; and - 25E:75A (25% of eucalyptus + 75% of black wattle + corn. The biomass production from eucalyptus and from the black wattle, in both monospecific and mixed planting, did not differ in any of the assessed ages but, when evaluated by plants compartments, it was verified an interspecific competitive interaction from the eucalyptus on the black wattle, reducing the formation of crown biomass. The total production of corn biomass in agrosilvicutural systems with eucalyptus and with black wattle in monospecific or mixed plantings did not differ in the studied treatments.
Planting pattern and weed control method influence on yield production of corn (Zea mays L.)
Purba, E.; Nasution, D. P.
2018-02-01
Field experiment was carried out to evaluate the influence of planting patterns and weed control methods on the growth and yield of corn. The effect of the planting pattern and weed control method was studied in a split plot design. The main plots were that of planting pattern single row (25cm x 60cm), double row (25cm x 25cm x 60cm) and triangle row ( 25cm x 25cm x 25cm). Subplot was that of weed control method consisted five methods namely weed free throughout the growing season, hand weeding, sprayed with glyphosate, sprayed with paraquat, and no weeding.. Result showed that both planting pattern and weed control method did not affect the growth of corn. However, planting pattern and weed control method significantly affected yield production. Yield resulted from double row and triangle planting pattern was 14% and 41% higher, consecutively, than that of single row pattern. The triangle planting pattern combined with any weed control method produced the highest yield production of corn.
Nitrogen deficiency detection using reflected shortwave radiation from irrigated corn canopies
International Nuclear Information System (INIS)
Blackmer, T.M.; Schepers, J.S.; Varvel, G.E.; Walter-Shea, E.A.
1996-01-01
Techniques that measure the N status of corn (Zea mays L.) can aid in management decisions that have economic and environmental implications. This study was conducted to identify reflected electromagnetic wavelengths most sensitive to detecting N deficiencies in a corn canopy with the possibility for use as a management tool. Reflected shortwave radiation was measured from an irrigated corn N response trial with four hybrids and five N rates at 0, 40, 80, 120, and 160 kg N ha -1 in 1992 and 0, 50, 100, 150, and 200 kg N ha -1 in 1993. A portable spectroradiometer was used to measure reflected radiation (400-1100 nm in 1992, 350-1050 nm in 1993) from corn canopies at approximately the R5 growth stage. Regression analyses revealed that reflected radiation near 550 and 710 nm was superior to reflected radiation near 450 or 650 nm for detecting N deficiencies. The ratio of light reflectance between 550 and 600 nm to light reflectance between 800 and 900 nm also provided sensitive detection of N stress. In 1993, an inexpensive photometric cell, which has peak sensitivity to light centered at 550 nm, was also used to measure reflected radiation from a corn canopy. Photometric cell readings correlated with relative grain yield (P < 0.001, r 2 = 0.74), but more research will be required to develop procedures to account for varying daylight conditions. These results provide information needed for the development of variable-rate fertilizer N application technology. (author)
Is Sweet Taste Perception Associated with Sweet Food Liking and Intake?
Jayasinghe, Shakeela N; Kruger, Rozanne; Walsh, Daniel C I; Cao, Guojiao; Rivers, Stacey; Richter, Marilize; Breier, Bernhard H
2017-07-14
A range of psychophysical taste measurements are used to characterize an individual's sweet taste perception and to assess links between taste perception and dietary intake. The aims of this study were to investigate the relationship between four different psychophysical measurements of sweet taste perception, and to explore which measures of sweet taste perception relate to sweet food intake. Forty-four women aged 20-40 years were recruited for the study. Four measures of sweet taste perception (detection and recognition thresholds, and sweet taste intensity and hedonic liking of suprathreshold concentrations) were assessed using glucose as the tastant. Dietary measurements included a four-day weighed food record, a sweet food-food frequency questionnaire and a sweet beverage liking questionnaire. Glucose detection and recognition thresholds showed no correlation with suprathreshold taste measurements or any dietary intake measurement. Importantly, sweet taste intensity correlated negatively with total energy and carbohydrate (starch, total sugar, fructose, glucose) intakes, frequency of sweet food intake and sweet beverage liking. Furthermore, sweet hedonic liking correlated positively with total energy and carbohydrate (total sugar, fructose, glucose) intakes. The present study shows a clear link between sweet taste intensity and hedonic liking with sweet food liking, and total energy, carbohydrate and sugar intake.
The contribution of genetic selection of corn to quantity and quality of stover is still poor-known. The aim of the study was to evaluate production, C and N in fractions of corn stover in response to the cultivar development. Two field experiments were conducted in the city of Rolândia (Paraná - Br...
Directory of Open Access Journals (Sweden)
Hamed K. Abbas
2012-01-01
Full Text Available The effect of corn-soybean rotation on mycotoxin contamination in corn (Zea mays L. and soybean (Glycine max L. Merrill. grains has not been fully evaluated. Therefore, this research investigated the effect of corn-soybean rotation on aflatoxin and fumonisin contamination in respective grains. The results showed that aflatoxin levels in soybean averaged 2.3, <0.5, 0.6, and 6.8 ng/g in 2005, 2006, 2007, and 2008, while corn aflatoxin levels were 16.7, 37.1, 2.4, and 54.8 ng/g, respectively. Aspergillus flavus colonization was significantly greater (P≤0.05 in corn (log 1.9, 2.9, and 4.0 cfu/g compared to soybean (<1.3, 2.6, and 2.7 cfu/g in 2005, 2007, and 2008, respectively. Aflatoxigenic A. flavus isolates were more frequent in corn than in soybean in all four years. Higher fumonisin levels were found in corn (0.2 to 3.6 μg/g than in soybean (<0.2 μg/g. Rotating soybean with corn reduces the potential for aflatoxin contamination in corn by reducing A. flavus propagules in soil and grain and reducing aflatoxigenic A. flavus colonization. These results demonstrated that soybean grain is less susceptible to aflatoxin contamination compared to corn due to a lower level of colonization by A. flavus with a greater occurrence of non-aflatoxigenic isolates.
Directory of Open Access Journals (Sweden)
Aracelle Assunção
2008-11-01
Full Text Available
This study was developed to evaluate the agronomic performance and physiological quality of seeds of six commercial sweet corn simple hybrids, fifteen double hybrids obtained from crossings among the simple hybrids, taken two by two, and one control. The field phase was conducted in Goiânia (16°35'S, 49°21'W and 730 m of altitude, in a clay Oxisol. It was used a randomized complete design, with four replications. The yield, percentage of standard ears without straw, percentage of industrial yield, total soluble solids content, measured chlorophyll content, and total sugars content were determined. The germination tests cold without soil (modified, accelerated aging, and tetrazolium were carried out for physiological quality seed evaluation. From the physiological tests, the percentage values and emission indexes of primary root were calculated. The results showed genetic potential among the genotypes tested for agronomic characters and seed quality. Thus, the use of those genotypes in plant breeding programs could happen through the composite obtention of inbred lines, mainly for the characters productivity of ears with straw, industrial yield, chlorophyll content, and modified cold test.
KEY-WORDS: Zea mays; total sugar; vigor; chlorophyll.
Este estudo buscou avaliar o desempenho agronômico e a qualidade fisiológica de sementes de seis híbridos simples comerciais de milho doce, quinze híbridos duplos obtidos dos cruzamentos entre os híbridos simples, tomados dois a dois, e uma testemunha. A fase de campo foi conduzida em Goiânia (16°35'S, 49º21'W e altitude m
Carbon dynamics in corn-soybean sequences as estimated from natural carbon-13 abundance
International Nuclear Information System (INIS)
Huggins, D.R.; Clapp, C.E.; Allmaras, R.R.; Lamb, J.A.; Layese, M.F.
1998-01-01
Carbon flow in terrestrial ecosystems regulates partitioning between soil organic C (SOC) and atmospheric CO2. Our objectives were to assess SOC dynamics using natural 13C abundance in corn (Zea mays L., a C4 species)-soybean [Glycine max (L.) Merr., a C3 species] sequences. Fifteen treatments of continuous corn, continuous soybean, various sequences of corn and soybean, and fallow were initiated in 1981 at Lamberton, MN, on a Webster clay loam (fine-loamy, mixed, mesic Typic Haplaquoll). In 1991, soil and aboveground shoot samples from all treatments were analyzed for total organic C and delta 13C. Carbon inputs, delta 13C, and SOC were integrated into a two-pool model to evaluate C dynamics of corn and soybean. Total SOC was similar across all treatments after 10 yr; however, differences in soil delta 13C occurred between continuous corn (delta 13C = -17.2 per thous and) and continuous soybean (delta 13C = -18.2 per thousand). Modeled C dynamics showed SOC decay rates of 0.011 yr-1 for C4-derived C and 0.007 yr-1 for C3-derived C, and humification rates of 0.16 yr-1 for corn and 0.11 yr-1 for soybean. Decay and humification rates were slightly lower than those found in other Corn Belt studies. Levels of SOC were predicted to decline an additional 7 to 18% with current C inputs from either corn or soybean, respectively. Annual C additions required for SOC maintenance averaged 5.6 Mg C ha-1, 1.4 to 2.1 times greater than previously reported estimates. Controlled variation in natural 13C abundance in corn-soybean rotations during a 10-yr period adequately traced C dynamics
Directory of Open Access Journals (Sweden)
Chantarudee Atip
2012-04-01
Full Text Available Abstract Background Bee pollen is composed of floral pollen mixed with nectar and bee secretion that is collected by foraging honey (Apis sp. and stingless bees. It is rich in nutrients, such as sugars, proteins, lipids, vitamins and flavonoids, and has been ascribed antiproliferative, anti-allergenic, anti-angiogenic and free radical scavenging activities. This research aimed at a preliminary investigation of the chemical constituents and free radical scavenging activity in A. mellifera bee pollen. Methods Bee pollen was directly collected from A. mellifera colonies in Nan province, Thailand, in June, 2010, whilst floral corn (Zea mays L. pollen was collected from the nearby corn fields. The pollen was then sequentially extracted with methanol, dichloromethane (DCM and hexane, and each crude extract was tested for free radical scavenging activity using the DPPH assay, evaluating the percentage scavenging activity and the effective concentration at 50% (EC50. The most active crude fraction from the bee pollen was then further enriched for bioactive components by silica gel 60 quick and adsorption or Sephadex LH-20 size exclusion chromatography. The purity of all fractions in each step was observed by thin layer chromatography and the bioactivity assessed by the DPPH assay. The chemical structures of the most active fractions were analyzed by nuclear magnetic resonance. Results The crude DCM extract of both the bee corn pollen and floral corn pollen provided the highest active free radical scavenging activity of the three solvent extracts, but it was significantly (over 28-fold higher in the bee corn pollen (EC50 = 7.42 ± 0.12 μg/ml, than the floral corn pollen (EC50 = 212 ± 13.6% μg/ml. After fractionation to homogeneity, the phenolic hydroquinone and the flavone 7-O-R-apigenin were found as the minor and major bioactive compounds, respectively. Bee corn pollen contained a reasonably diverse array of nutritional components, including
Production Systems and Potential Development of Corn in West Pasaman Districts
Directory of Open Access Journals (Sweden)
Yulmar Jastra
2015-09-01
Full Text Available Maize (Zea mays L. is the second national food crop after rice and its role is increasing in line increase of population, livestock operations, and development of raw material corn processing industry. This research is a descriptive qualitative and quantitative as well as done in stages, namely: pre -study in order neighbor information gathering and general condition of farmers in the districts of West Pasaman, intensive desk study on the extent of data and the development of hybrid corn and all information obtained from pre -study activities; observation, field survey. This study aims to: identify systems of maize production in West Pasaman, identify potential areas of development and analysis of maize farming, Prepare Corn Development Action Programme in West Pasaman. Age maize farmers in West Pasaman between 40-60 years old, with old school for 9 years and the number of family members of farmers 5. The highest maize production in West Pasaman district occurred in 2009 amounted to 364 287 tonnes with 44 793 ha of harvested area and productivity of 6.99 tonnes/ha, in 2010, a decline in production to 220 761 tonnes with a productivity of 6.3 tons /ha due to a decline in harvested area into 33 757 ha. And in 2011 the production of corn production back to normal by 286 078 tons / year with 44 360 ha of harvested area and productivity of 6.50 tonnes/ha. Potential land that can be used to achieve the 142 850 ha of maize farming dominated peat and mineral soil of each area of 7,550 ha and 16,550 ha. Of corn farming can provide a gain of Rp 8,860,000,-/ha . When the period of 4 months of the corn crop corn farmer income per month is Rp 2.215.000,-
International Nuclear Information System (INIS)
Greenberg, J.M.
1985-01-01
Developing field-grown kernels of corn (Zea mays L. cv. Cornell 175) from the base and apex of the ear were sampled from seven to 70 days after pollination (DAP) an compared with respect to dry weight, ability to take up 14 C-sucrose from solution in vitro, and content of sucrose, glucose, starch, glucose-1-P (G1P), glucose-6-P (G6P), fructose-6-P (F6P), ADP-glucose (ADPG), and UDP-glucose (UDPG). ADPG and UDPG were analyzed by HPLC. All other metabolites were analyzed enzymatically. Simultaneous hand-pollination of all ovaries in an ear did not reduce the difference between apical and basal kernels in dry weight, indicating that the latter fertilization of apical kernels was not responsible for their lesser mature dry weight. Detached kernels took up 14 C-sucrose (0.3-400 mM) and glucose (5-100 mM) at rates linearly proportional to the sugar concentration. Glucose, fructose, and sorbitol did not inhibit uptake of 14 C-sucrose. Uptake was not stimulated by 5 mM CaCl 2 or the addition of buffers (pH 4.5-6.7) to the medium. Sulfhydryl reagents (PCMBS, NEM) and metabolic inhibitors (TNBS, DNP, NaF) did not reduce uptake. These observations suggest that sucrose is taken up by a non-saturable, non-energy-requiring mechanism. Sucrose uptake increased throughout development, especially at the stage when basal kernels began to accumulate more dry weight than apical kernels (10-20 DAP in freely pollinated ears; 25 DAP in synchronously pollinated ears). Hydrolysis of incorporated sucrose increased from 87% at 14 DAP to 99% by 57 DAP
Kullik, Sigrun A; Sears, Mark K; Schaafsma, Arthur W
2011-04-01
Black cutworm, Agrotis ipsilon (Hufnagel) (Lepidoptera: Noctuidae), is an occasional pest of maize (corn), Zea mays L., that may cause severe stand losses and injury to corn seedlings. The efficacy of the neonicotinoid seed treatment clothianidin at two commercially available rates and their interaction with a transgenic corn hybrid (Bt corn), trait expressing the Bacillus thuringiensis variety aizawai insecticidal toxin Cry 1Fa2, against black cutworm larvae was investigated. Clothianidin at a rate of 25 mg kernel(-1) on Bt corn increased larval mortality and reduced larval weight gains additively. In contrast, weights of larvae fed non-Bt corn seedlings treated with clothianidin at a rate of 25 mg kernel(-1) increased significantly, suggesting either compensatory overconsumption, hormesis, or hormoligosis. Both Bt corn alone and clothianidin at a rate of 125 mg kernel(-1) applied to non-Bt corn seedlings caused increased mortality and reduced larval weight gains. In two field trials, plots planted with Bt corn hybrids consistently had the highest plant populations and yields, regardless of whether they were treated with clothianidin at the lower commercial rate of 25 mg kernel(-1) The use of Bt corn alone or in combination with the low rate of clothianidin (25 mg kernel(-1)) seems suitable as a means of suppressing black cutworm in no-tillage cornfields, although rescue treatments may still be necessary under severe infestations. Clothianidin alone at the low rate of 25 mg kernel(-1) is not recommended for black cutworm control until further studies of its effects on larval physiology and field performance have been completed.
Corn yield for silage and grains in different integrated crop-livestock systems
Directory of Open Access Journals (Sweden)
Laíse da Silveira Pontes
Full Text Available Abstract In this study, the objective was to assess the influence of two doses of N (90 and 180 kg N ha-1, added to the winter pastures, two integrated crop-livestock systems (ICLS, with and without trees and five positions between the tree rows, on the corn (Zea mays L. quality and productivity, for silage and grain. Adopting the complete randomized block design, the treatments included three replicates. In 2006, following the 14 x 3 m spacing (currently with 158 trees ha-1 the trees were planted in 6 out of the 12 paddocks. While the corn was implemented during summer of 2013/2014, cattle grazing on the annual pasture was done during the prior winter, in both ICLS. Corn for silage was reaped at the R5 phenological stage, whereas for grains it was done at 176 days post seeding. For silage, the corn plants were grinded and then stocked in the experimental mini PVC silos. The silage varied slightly in quality along the positions between the tree rows. The differences observed between N levels in the dry matter, crude protein (CP and grain productivity are expressions of the residual effects of the winter fertilization. Silage quality was improved by the shade effect which minimized the acid detergent fiber and raised the CP, although it reduced the corn production for silage and grains by 52%. Some feasible techniques to reduce these losses are discussed.
Energy Technology Data Exchange (ETDEWEB)
Xiong, Shaojun [Unit of Biomass Technology and Chemistry, Swedish University of Agricultural Sciences, SE-901 83 Umeaa (Sweden); College of Life Science, Beijing Normal University, Beijing (China); Zhang, Yufen [College of Life Science, Beijing Normal University, Beijing (China); Zhuo, Yue [Biomass Engineering Centre, China Agricultural University, Beijing (China); Lestander, Torbjoern; Geladi, Paul [Unit of Biomass Technology and Chemistry, Swedish University of Agricultural Sciences, SE-901 83 Umeaa (Sweden)
2010-06-15
The geographic variations in corn stover fuel and soil characteristics from 22 sites in the Kerchin region (43.8-45.0 N, 122.7-125.1 E), north-east China, were examined in both 2006 and 2007. The correlations between fuel characteristics and soil parameters were analysed using principal component analysis (PCA) and partial least squares regression (PLS). The main emphasis was on the feasibility of using corn stovers as feedstock in direct combustion for heat and power generation. The examined corn stovers from Kerchin generally have similar characteristics to energy grasses grown in Europe and may be used as biofuels. However, large variations, up to several orders of magnitude, in the fuel characteristics existed among the samples. With PCA, the studied soils showed a clear distinction between soluble and less soluble elements, with a trend for higher insoluble element (such as Si) concentrations in south-western soils and a higher pH in the more northern soils. The component for fuel characteristics showed a distinct trend with latitude that can be explained by the above-mentioned soil component pattern. PLS regression models suggested some important relationships that may be used to predict corn stover fuel characteristics using soil and environment properties; for example, latitude, soil pH and Si are the most important predictors for Ca content in corn stovers, but not for K that is best predicted by soil K. Although limited by numbers of samples and sites, this study indicated that this approach can be used to predict biofuel quality. (author)
Zand, E; Soufizadeh, S; Eskandari, A
2006-01-01
To examine how drought and nitrogen limitation might affect crop competitive ability with C3 or C4 weeds, a two year experiment was conducted at the research field of Plant Pest and Disease Research Institute, Karaj, in 2002 and 2003. Irrigation interval (every 7d and 14d (moderate drought stress)), nitrogen rate (recommended and 1/4 recommended), and crop-weed competition (corn, corn-common lambsquarters (Chenopodium album L.), corn-redroot pigweed (Amaranthus retroflexus L.), and corn-common lambsquarters-redroot pigweed) were studied in a split-factorial design with 4 replications, with irrigation interval as the main plot, and factorial combination of the other two factors as the sub-plot. Grain yield, harvest index (HI), water and nitrogen use efficiencies (WUE and NUE, respectively) were measured at harvest. Drought and nitrogen deficiency reduced corn grain yield and HI (except for corn-redroot pigweed and corn-common lambsquarters treatments under drought stress). Redroot pigweed was found inhibitorier to corn compared to common lambsquarters in all irrigation and nitrogen levels. Corn WUE reduced under drought condition and competition, but drought caused less reduction in corn WUE when it competed with common lambsquarters compared to redroot pigweed. This shows that drought has more negative effect on C3 weeds (probably due to higher reduction in stomatal conductance and increment in photo-respiration under these conditions compared to a C4 plant). The same result was obtained for corn NUE under nitrogen limitation and competition. In other words, nitrogen deficiency had more inhibitory effect on common lambsquarters competitive ability compared with redroot pigweed. Totally, it was concluded that drought stress and nitrogen deficiency, as the two results of climate change, had more negative effect on C3 weeds compared with C4.
Directory of Open Access Journals (Sweden)
A. Öktem
2000-12-01
Full Text Available Southeastern Anatolia region of Turkey has a great agricultural potential. When the Southeastern Anatolia Project (GAP is complete, 1.7 million hectare area will be irrigated. Corn has a great importance due to have high-yield and being a secondary crop at GAP region which has suitable soil and climate conditions for corn production. The main goal of this study was to determine the suitable corn varieties for GAP region. This research was conducted with 14 hybrid dent corn varieties at Agriculture Faculty in Şanlıurfa province during the growth season of 1997-1998. At this study grain yield, tassel flowering date, plant height, ear length, kernel number of ear, grain weight of ear, 1000 seeds weight and grain moisture at harvest were investigated. Variance analysis results showed that there were significant differences (P<0.01 in grain yield and yield characteristics among tested varieties. According to the average of two years, grain yield varied between 8.83 (Alimax and 13.92 (Rx.770 t /ha and grain moisture at harvest varied from 15.81% (Antbey to 25.92% (P.3394. Antbey had the highest tassel flowering date value (62.3 day and the lowest value was obtained from C.6127 (55.5 day genotype. Plant height varied between 190.5 cm (C.6127 and 243.4 cm (Antbey. Ear length ranged from 18.9 cm (Alimax to 21.8 cm (Tambre. Kernel number of ear varied from 439.0 number/ear (Antbey to 670.9 number/ear (P.3279. The highest grain weight of ear value was obtained from Rx.770 genotype (239.5 g and also the lowest value was 162.1 g (Antbey. 1000 seed weight ranged from 328.9 g (P.3279 to 383.0 g (Tambre. All tested varieties gave over 10 t /ha yield except Alimax, Sele and Antbey varieties.
Barone, Roberto; de Biasi, Margherita-Gabriella; Piccialli, Vincenzo; de Napoli, Lorenzo; Oliviero, Giorgia; Borbone, Nicola; Piccialli, Gennaro
2016-10-01
The ability of the water-soluble protein extracts from Zea mais L. cv. PR32-B10 to degrade some representative polycyclic aromatic hydrocarbons (PAHs), has been evaluated. Surface sterilized seeds of corn (Zea mais L. Pioneer cv. PR32-B10) were hydroponically cultivated in a growth chamber under no-stressful conditions. The water-soluble protein extracts isolated from maize tissues showed peroxidase, polyphenol oxidase and catalase activities. Incubation of the extracts with naphthalene, fluorene, phenanthrene and pyrene, led to formation of oxidized and/or degradation products. GC-MS and TLC monitoring of the processes showed that naphthalene, phenanthrene, fluorene and pyrene underwent 100%, 78%, 92% and 65% oxidative degradation, respectively, after 120 min. The chemical structure of the degradation products were determined by (1)H NMR and ESI-MS spectrometry. Copyright © 2016 Elsevier Ltd. All rights reserved.
NUTRIENTS POOL IN CONSORTIA OF Eucalyptus urograndis, Acacia mearnsii AND Zea mays
Directory of Open Access Journals (Sweden)
Márcio Viera
2013-08-01
Full Text Available http://dx.doi.org/10.5902/1980509810543This study aimed to determine the nutrient pool in monospecific and mixed stands of Eucalyptus urograndis and Acacia mearnsii in a consortium with Zea mays.The amount determination of nutrients of forest species was carried out in the treatments: 100E (100% of eucalyptus; 100A (100% of black wattle and 50E:50A (50% of eucalyptus + 50% of black-wattle. On the other hand, for corn, it was carried out in all treatments (100E; 100A, 50E:50A; 75E:25A – 75% of eucalyptus + 25% black-wattle and 25E:75A – 25% of eucalyptus + 75% of black wattle. The delimitation adopted was the one of a randomized block with three replications. The magnitude of the nutrient pool in the agrossilvicultural systems biomass was: N> K > Ca > Mg > P > S, for macronutrients, and Mn > Fe > Zn > B > Cu, for micronutrients. Due to the great export of nutrients through the corn harvest, residues should be kept and it is necessary to make a nutritional reposition, mainly with P, N, K, S and Zn in the following crops, because of the higher amount that are exported with the extraction of the corn tang, which reaches 75.3; 60.6; 59.9; 55.8 e 53.8%, respectively, in relation to the total stocked in the biomass.
Baby corn, green corn, and dry corn yield of corn cultivars
Castro,Renato S; Silva,Paulo Sérgio L; Cardoso,Milton J
2013-01-01
In corn, when the first female inflorescence is removed, the plant often produces new female inflorescences. This allows the first ear to be harvested as baby corn (BC) and the second as green corn (GC) or dry corn (DC), that is, mature corn. The flexibility provided by a variety of harvested products allows the grower to compete with better conditions in the markets. We evaluated BC, GC, and DC yields in corn cultivars AG 1051, AG 2060, and BRS 2020, after the first ear was harvested as BC. ...
Regional pest suppression associated with widespread Bt maize adoption benefits vegetable growers.
Dively, Galen P; Venugopal, P Dilip; Bean, Dick; Whalen, Joanne; Holmstrom, Kristian; Kuhar, Thomas P; Doughty, Hélène B; Patton, Terry; Cissel, William; Hutchison, William D
2018-03-27
Transgenic crops containing the bacterium Bacillus thuringiensis (Bt) genes reduce pests and insecticide usage, promote biocontrol services, and economically benefit growers. Area-wide Bt adoption suppresses pests regionally, with declines expanding beyond the planted Bt crops into other non-Bt crop fields. However, the offsite benefits to growers of other crops from such regional suppression remain uncertain. With data spanning 1976-2016, we demonstrate that vegetable growers benefit via decreased crop damage and insecticide applications in relation to pest suppression in the Mid-Atlantic United States. We provide evidence for the regional suppression of Ostrinia nubilalis (Hübner), European corn borer, and Helicoverpa zea (Boddie), corn earworm, populations in association with widespread Bt maize adoption (1996-2016) and decreased economic levels for injury in vegetable crops [peppers ( Capsicum annuum L.), green beans ( Phaseolus vulgaris L.), and sweet corn ( Zea mays L., convar. saccharata )] compared with the pre-Bt period (1976-1995). Moth populations of both species significantly declined in association with widespread Bt maize (field corn) adoption, even as increased temperatures buffered the population reduction. We show marked decreases in the number of recommended insecticidal applications, insecticides applied, and O. nubilalis damage in vegetable crops in association with widespread Bt maize adoption. These offsite benefits to vegetable growers in the agricultural landscape have not been previously documented, and the positive impacts identified here expand on the reported ecological effects of Bt adoption. Our results also underscore the need to account for offsite economic benefits of pest suppression, in addition to the direct economic benefits of Bt crops.
Sweet sorghum bagasse and corn stover serving as substrates for producing sophorolipids
Energy Technology Data Exchange (ETDEWEB)
Samad, Abdul; Zhang, Ji; Chen, Da; Chen, Xiaowen; Tucker, Melvin; Liang, Yanna
2016-12-28
To make the process of producing sophorolipids by Candida bombicola truly sustainable, we investigated production of these biosurfactants on biomass hydrolysates. This study revealed: (1) yield of sophorolipds on bagasse hydrolysate decreased from 0.56 to 0.54 and to 0.37 g/g carbon source when yellow grease was dosed at 10, 40 and 60 g/L, respectively. In the same order, concentration of sophorolipids was 35.9, 41.9, and 39.3 g/L; (2) under similar conditions, sophorolipid yield was 0.12, 0.05 and 0.04 g/g carbon source when corn stover hydrolysate was mixed with soybean oil at 10, 20 and 40 g/L. Sophorolipid concentration was 11.6, 4.9, and 3.9 g/L for the three oil doses from low to high; and (3) when corn stover hydrolysate and yellow grease served as the substrates for cultivating the yeast in a fermentor, sophorolipid concentration reached 52.1 g/L. Upon further optimization, sophorolipids production from ligocellulose will be indeed sustainable.
Electrical conductivity testing of corn seeds as influenced by temperature and period of storage
Fessel,Simone Aparecida; Vieira,Roberval Daiton; Cruz,Mara Cristina Pessoa da; Paula,Rinaldo Cesar de; Panobianco,Maristela
2006-01-01
The objective of this work was to evaluate the effects of temperature (10, 20, 30, 20/10 and 30/10ºC) and period of storage on electrical conductivity (EC) in four seed lots of corn (Zea mays L.), as well as the mineral composition of the soaking solution. EC test determines indirectly the integrity of seed membrane systems, and is used for the assessment of seed vigor, because this test detects the seed deterioration process since its early phase. The research comprised determinations o...
Directory of Open Access Journals (Sweden)
Muhammet Karasahin
2014-03-01
Full Text Available The yield and quality of corn silage is related to genotype as well as factors such as climate, soil conditions, altitude, planting time, plant density, irrigation, and harvesting time. This study was conducted to determine the effects of different irrigation methods (drip, subsoil drip, and subsoil capillary and different plant densities (102 040, 119 040, and 142 850 plant ha-1 on silage quality parameters of PR 31Y43 hybrid corn (Zea mays L. var. indentata [Sturtev.] L.H. Bailey in 2011 and 2012 under ecological conditions in Eskipazar-Karabuk, Turkey. Plant densities were significantly different on fresh ear ratio and plant crude protein (CP yield in both years under study. The highest fresh ear ratio values were obtained with 102 040 and 119 040 plant ha-1 densities and the highest plant CP yield with 142 850 plant ha-1. While the irrigation method x plant density interactions were significant for silage CP ratio in the first year, they were significant on fresh ear ratio in the second year. The highest fresh ear ratio values were obtained from subsoil capillary x 119 040 plant ha-1 and drip x 119 040 plant ha-1 interactions; the highest plant and silage CP ratio values were obtained from subsoil capillary x 142 850 plant ha-1 and subsoil drip x 102 040 plant ha-1 interactions. As a result of the research, high Flieg scores were obtained from each irrigation method and plant density. When plant CP yield is taken into consideration, the 142 850 plant ha-1 density is more important.
Zhao, Xiulan; Wang, Dingyong
2010-01-01
Mercury (Hg) contents in ten chemical fertilizers were determined, and the effect of calcium superphosphate (CSP) on the uptake and translocation of Hg in corn seedlings was investigated by pot experiments. CSP was applied at the levels of 0, 66.7, and 133.4 mg P2O5/kg to Hg-treated (2 mg/kg) and untreated soils. CSP had the highest Hg content (5.1 mg/kg), followed by the NPK compound fertilizer 15-5-5 (15% N, 5% P2O5, 5% K2O) (1.2 mg/kg), then by nitrogen fertilizers (except for ammonia sulfate) and potassium fertilizers. Application of CSP did not obviously influence the biomass of corn roots, but it significantly increased the biomass of corn shoots in Hg-treated soil. Application of CSP at the levels of 66.7 and 133.4 mg P2O5/kg did not obviously influence the uptake of Hg by corn seedlings on soils without Hg treatment, but it decreased the Hg uptake of corn seedlings significantly on Hg-treated soils. The transfer coefficient of Hg in corn seedlings improved slightly on soils without Hg treatment, but decreased slightly on Hg-treated soils with the application of CSP. These results implied that CSP could ameliorate Hg toxicity to corn seedlings by inhibiting the uptake and the translocation of Hg in plants on Hg-polluted soils.
Jaffe, M. J.; Leopold, A. C.
1984-01-01
In etiolated corn (Zea mays L.) and etiolated pea (Pisum sativum L.) seedlings, a gravitropic stimulation induces the deposition of callose. In the corn coleoptiles this occurs within 5 min of gravity stimulation, and prior to the beginning of curvature. Both gravitropic curvature and callose deposition reach their maxima by 12 h. Within the first 2 h more callose is deposited on the upper (concave) side, but after 2-3 h, this deposition pattern is reversed. An inhibitor of protein glycosylation, 2-deoxy-D-glucose (DDG), inhibits callose production and considerably retards gravitropic bending in both species of plants. Mannose can relieve the inhibition of gravitropic bending by DDG. The pea mutant "Ageotropum", which does not respond to gravity when etiolated, also fails to produce callose in response to a gravitic stimulus. These correlations indicate that callose deposition may be a biochemical component of gravitropism in plant shoots.
Wastewater from monosodium glutamate industry as a low cost fertilizer source for corn (Zea mays L.)
International Nuclear Information System (INIS)
Singh, Satnam; Rekha, P.D.; Arun, A.B.; Huang, Y.-M.; Shen, F.-T.; Young, Chiu-Chung
2011-01-01
Nitrogen rich wastewater from monosodium glutamate industry (MSG) and paper-mill wastewater were used in this study as low cost fertilizers for growing corn, a common fuel crop. Detailed characterization of the wastewaters and toxicity testes were conducted to assure the safety of these wastewaters. In a greenhouse pot experiment, effects of these wastewaters on corn growth and biomass yield along with the soil properties were evaluated. MSG-wastewater was applied at three rates i.e., zero, 5 m 3 ha -1 and 7.5 m 3 ha -1 and paper-mill wastewater was applied at and zero, 3.5 m 3 ha -1 and 5 m 3 ha -1 in a complete randomized blocks design experiment. Significant increase in the corn biomass yield was observed in all the wastewater treatments compared to the Control. Both these wastewaters did not show any adverse effects on plant. N-use efficiency from the MSG-wastewater was comparable to urea-N application. This study emphasizes on sustainable practices for energy crop production by utilizing wastewaters as fertilizer sources. Hence, we report for the first time that the MSG-wastewater can be used for growing corn as a low cost green practice without adverse affects on the soil properties. -- Highlights: → MSG-wastewater acidity neutralization with highly alkaline paper-mill effluent is sustainable practice. → Growing fuel crops using wastewaters comprises multiple benefits on plant, soil, and environment. → Organic rich wastewaters improve SOC. → Co-application of MSG and paper-mill wastewaters stimulates humification.
Fate of tagged nitrogen fertilizer applied to irrigated corn
International Nuclear Information System (INIS)
Olson, R.V.
1980-01-01
A field experiment was conducted for 2 years with ammonium sulfate tagged with 5.93 at. % 15 N to determine the fate of N fertilizer applied to sprinkler-irrigated corn (Zea mays L.). All areas of triplicate, 356-cm square plots were treated with 50 or 150 kg tagged N/ha. N fertilizer used by the crop and that remaining in the top 240 cm of soil were measured. NH 4 + -N and NO 3 - -N in the 0- to 10-cm layers after the second harvest also were determined. Grain yields in 1976 did not differ significantly. In 1977 response to N was significant, but responses to two N rates did not differ significantly
Johnston-Monje, David; Raizada, Manish N
2011-01-01
Endophytes are non-pathogenic microbes living inside plants. We asked whether endophytic species were conserved in the agriculturally important plant genus Zea as it became domesticated from its wild ancestors (teosinte) to modern maize (corn) and moved from Mexico to Canada. Kernels from populations of four different teosintes and 10 different maize varieties were screened for endophytic bacteria by culturing, cloning and DNA fingerprinting using terminal restriction fragment length polymorphism (TRFLP) of 16S rDNA. Principle component analysis of TRFLP data showed that seed endophyte community composition varied in relation to plant host phylogeny. However, there was a core microbiota of endophytes that was conserved in Zea seeds across boundaries of evolution, ethnography and ecology. The majority of seed endophytes in the wild ancestor persist today in domesticated maize, though ancient selection against the hard fruitcase surrounding seeds may have altered the abundance of endophytes. Four TRFLP signals including two predicted to represent Clostridium and Paenibacillus species were conserved across all Zea genotypes, while culturing showed that Enterobacter, Methylobacteria, Pantoea and Pseudomonas species were widespread, with γ-proteobacteria being the prevalent class. Twenty-six different genera were cultured, and these were evaluated for their ability to stimulate plant growth, grow on nitrogen-free media, solubilize phosphate, sequester iron, secrete RNAse, antagonize pathogens, catabolize the precursor of ethylene, produce auxin and acetoin/butanediol. Of these traits, phosphate solubilization and production of acetoin/butanediol were the most commonly observed. An isolate from the giant Mexican landrace Mixteco, with 100% identity to Burkholderia phytofirmans, significantly promoted shoot potato biomass. GFP tagging and maize stem injection confirmed that several seed endophytes could spread systemically through the plant. One seed isolate
Johnston-Monje, David; Raizada, Manish N.
2011-01-01
Endophytes are non-pathogenic microbes living inside plants. We asked whether endophytic species were conserved in the agriculturally important plant genus Zea as it became domesticated from its wild ancestors (teosinte) to modern maize (corn) and moved from Mexico to Canada. Kernels from populations of four different teosintes and 10 different maize varieties were screened for endophytic bacteria by culturing, cloning and DNA fingerprinting using terminal restriction fragment length polymorphism (TRFLP) of 16S rDNA. Principle component analysis of TRFLP data showed that seed endophyte community composition varied in relation to plant host phylogeny. However, there was a core microbiota of endophytes that was conserved in Zea seeds across boundaries of evolution, ethnography and ecology. The majority of seed endophytes in the wild ancestor persist today in domesticated maize, though ancient selection against the hard fruitcase surrounding seeds may have altered the abundance of endophytes. Four TRFLP signals including two predicted to represent Clostridium and Paenibacillus species were conserved across all Zea genotypes, while culturing showed that Enterobacter, Methylobacteria, Pantoea and Pseudomonas species were widespread, with γ-proteobacteria being the prevalent class. Twenty-six different genera were cultured, and these were evaluated for their ability to stimulate plant growth, grow on nitrogen-free media, solubilize phosphate, sequester iron, secrete RNAse, antagonize pathogens, catabolize the precursor of ethylene, produce auxin and acetoin/butanediol. Of these traits, phosphate solubilization and production of acetoin/butanediol were the most commonly observed. An isolate from the giant Mexican landrace Mixteco, with 100% identity to Burkholderia phytofirmans, significantly promoted shoot potato biomass. GFP tagging and maize stem injection confirmed that several seed endophytes could spread systemically through the plant. One seed isolate
Directory of Open Access Journals (Sweden)
David Johnston-Monje
Full Text Available Endophytes are non-pathogenic microbes living inside plants. We asked whether endophytic species were conserved in the agriculturally important plant genus Zea as it became domesticated from its wild ancestors (teosinte to modern maize (corn and moved from Mexico to Canada. Kernels from populations of four different teosintes and 10 different maize varieties were screened for endophytic bacteria by culturing, cloning and DNA fingerprinting using terminal restriction fragment length polymorphism (TRFLP of 16S rDNA. Principle component analysis of TRFLP data showed that seed endophyte community composition varied in relation to plant host phylogeny. However, there was a core microbiota of endophytes that was conserved in Zea seeds across boundaries of evolution, ethnography and ecology. The majority of seed endophytes in the wild ancestor persist today in domesticated maize, though ancient selection against the hard fruitcase surrounding seeds may have altered the abundance of endophytes. Four TRFLP signals including two predicted to represent Clostridium and Paenibacillus species were conserved across all Zea genotypes, while culturing showed that Enterobacter, Methylobacteria, Pantoea and Pseudomonas species were widespread, with γ-proteobacteria being the prevalent class. Twenty-six different genera were cultured, and these were evaluated for their ability to stimulate plant growth, grow on nitrogen-free media, solubilize phosphate, sequester iron, secrete RNAse, antagonize pathogens, catabolize the precursor of ethylene, produce auxin and acetoin/butanediol. Of these traits, phosphate solubilization and production of acetoin/butanediol were the most commonly observed. An isolate from the giant Mexican landrace Mixteco, with 100% identity to Burkholderia phytofirmans, significantly promoted shoot potato biomass. GFP tagging and maize stem injection confirmed that several seed endophytes could spread systemically through the plant. One seed
Transport of indoleacetic acid in intact corn coleoptiles
International Nuclear Information System (INIS)
Parker, K.E.; Briggs, W.R.
1990-01-01
We have characterized the transport of [ 3 H]indoleacetic acid (IAA) in intact corn (Zea mays L.) coleoptiles. We have used a wide range of concentrations of added IAA (28 femtomoles to 100 picomoles taken up over 60 minutes). The shape of the transport curve varies with the concentration of added IAA, although the rate of movement of the observed front of tracer is invariant with concentration. At the lowest concentration of tracer used, the labeled IAA in the transport stream is not detectably metabolized or immobilized, curvature does not develop as a result of tracer application, and normal phototropic and gravitropic responsiveness are not affected. Therefore we believe we are observing the transport of true tracer quantities of labeled auxin at this lowest concentration
A comparison of corn (Zea mays L.) residue and its biochar on soil C and plant growth.
Calderón, Francisco J; Benjamin, Joseph; Vigil, Merle F
2015-01-01
In order to properly determine the value of charring crop residues, the C use efficiency and effects on crop performance of biochar needs to be compared to the un-charred crop residues. In this study we compared the addition of corn stalks to soil, with equivalent additions of charred (300 °C and 500 °C) corn residues. Two experiments were conducted: a long term laboratory mineralization, and a growth chamber trial with proso millet plants. In the laboratory, we measured soil mineral N dynamics, C use efficiency, and soil organic matter (SOM) chemical changes via infrared spectroscopy. The 300 °C biochar decreased plant biomass relative to a nothing added control. The 500°C biochar had little to no effect on plant biomass. With incubation we measured lower soil NO3 content in the corn stalk treatment than in the biochar-amended soils, suggesting that the millet growth reduction in the stalk treatment was mainly driven by N limitation, whereas other factors contributed to the biomass yield reductions in the biochar treatments. Corn stalks had a C sequestration use efficiency of up to 0.26, but charring enhanced C sequestration to values that ranged from 0.64 to 1.0. Infrared spectroscopy of the soils as they mineralized showed that absorbance at 3400, 2925-2850, 1737 cm-1, and 1656 cm-1 decreased during the incubation and can be regarded as labile SOM, corn residue, or biochar bands. Absorbances near 1600, 1500-1420, and 1345 cm-1 represented the more refractory SOM moieties. Our results show that adding crop residue biochar to soil is a sound C sequestration technology compared to letting the crop residues decompose in the field. This is because the resistance to decomposition of the chars after soil amendment offsets any C losses during charring of the crop residues.
Increased Risk of Insect Injury to Corn Following Rye Cover Crop.
Dunbar, Mike W; O'Neal, Matthew E; Gassmann, Aaron J
2016-08-01
Decreased pest pressure is sometimes associated with more diverse agroecosystems, including the addition of a rye cover crop (Secale cereale L.). However, not all pests respond similarly to greater vegetational diversity. Polyphagous pests, such as true armyworm (Mythimna unipuncta Haworth), black cutworm (Agrotis ipsilon Hufnagel), and common stalk borer (Papaipema nebris Guenee), whose host range includes rye have the potential to cause injury to crops following a rye cover crop. The objectives of this study were to compare the abundance of early-season insect pests and injury to corn (Zea mays L.) from fields with and without a rye cover crop on commercial farms. Fields were sampled weekly to quantify adult and larval pests and feeding injury to corn plants from mid-April until corn reached V8 stage, during 2014 and 2015. Measurements within fields were collected along transects that extended perpendicularly from field edges into the interior of cornfields. Adult true armyworm and adult black cutworm were captured around all cornfields, but most lepidopteran larvae captured within cornfields were true armyworm and common stalk borer. Cornfields with a rye cover crop had significantly greater abundance of true armyworm and greater proportion of injured corn. Both true armyworm abundance and feeding injury were significantly greater in the interior of cornfields with rye. Common stalk borer abundance did not differ between cornfields with or without rye cover. Farmers planting corn following a rye cover crop should be aware of the potential for increased presence of true armyworm and for greater injury to corn. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Incorporation of 15N-inorganic nitrogen into free-amino acids in germinating corn
International Nuclear Information System (INIS)
Samukawa, Kisaburo; Yamaguchi, Masuro
1979-01-01
Incorporation of 15 N-labeled compounds, (K 15 NO 3 ) and ( 15 NH 4 ) 2 SO 4 , into free-amino acids was measured in germinating corn. Sterilized seeds of sweet corn (Choko No. 865) were sown on the filter papers soaked in 10 ml of the solution containing one of the labeled compounds (40 ppm N, 99 atom % excess) in petri dishes and germinated at 30 deg C. After 48 hours and 72 hours, 15 N-incorporation was measured in 5 seedlings selected owing to uniform growth. A GC-MS was used for measuring the ratio of 15 N isotopes present in free-amino acids. 15 N incorporation into free-amino acids hardly occurred when corn was germinated in the solution containing K 15 NO 3 , which suggested that endogenous nitrogen was used during the early germination stage of corn when nitrate is present. Incorporation into amino acids was greater when corn was germinated in the medium containing ( 15 NH 4 ) 2 SO 4 , than the case of the solution containing K 15 NO 3 . When corn was germinated in the solution containing ( 15 NH 4 ) 2 SO 4 , assimilation of 15 N into asparagine or aspartic acid was comparatively higher than that into the other amino acids, though the incorporation rate was low. Thus, in intact germinating corn, the hydrolyzed product of protein was utilized for germination with priority, and dependence on exogenous nitrogen was low. (Kaihara, S.)
Lifescience Database Archive (English)
Full Text Available 1JB9 トウモロコシ Corn Zea mays L. Ferredoxin-Nadp Reductase Precursor Zea Mays Molecule:...SLLYDEEFTSYLKQYPDNFRYDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVAERRGESWDQKLAQLKKNKQWHVEVY corn_1JB9.jpg ...
Reyes Campaña, Alex Ramiro
2011-01-01
The corn, (Zea mays) L. is a basic crop in ecuadorian agriculture, which is why the search for environmentally friendly nitrogen fertilization of low cost doesn’t cease to be important. One of these options is the use of bio-fertilizers, for which the nitrogen fixing bacteria Azospirillum sp. can be used. The objective of this work is to isolate and identify Azospirillum sp. stumps, and evaluate its capacity to provide the nitrogen’s needs in the semi-hydroponic crop, , (Zea mays) L. withi...
Mycoflora Of Maize Zea Maize At Different Locations In Hail Area-Saudi Arabia
Directory of Open Access Journals (Sweden)
Elham S. Dawood
2015-06-01
Full Text Available Abstract Zea maize is one of the main cereals produced in Hail area Saudi Arabia. The risk of mycotoxin contamination is related to mycoflora associated with corn kernel. This paper reports on isolation and identification of external and internal mycoflora of maize harvested in Hail area in 2006 2008. A mycological survey was carried out on 200 samples from two agricultural companies . Comparison between frequency and relative density of the prevalent genera and species was carried out. Genus Fusarium was the most prevalent component of the internal seed - borne mycoflora in the two companies Aspergillus spp. was the most prevalent genus as external seed borne mycoflora. The predominant species of the different genera were Fusarium moniliforrme Aspergillus flavus A. niger and Alternaria alternate.
Directory of Open Access Journals (Sweden)
Liovando Marciano da Costa
2007-09-01
Full Text Available
Evoluated agronomic characteristics of corn in six crop sequences (corn-corn, soybean-corn, sunflower-corn, pearl milletcorn, sorghum-corn and pigeon pea-corn under no-tillage for three years, in Rio Verde, Goiás State. Significance was observed by the test F for plant height, 100 grain weight and grain moisture. Pigeon pea, soybean, sunflower and pearl millet, resulted in taller corn plants. No statistical differences were found between crop sequences for corn grain yield and other characteristics.
KEY-WORDS: Crop sequences; corn; agronomic characteristics.
Avaliaram-se características agronômicas na cultura do milho em seis sucessões de culturas (milho-milho, soja-milho,girassol-milho, milheto-milho, sorgo-milho e guandu milho em plantio direto, durante três anos, em Rio Verde, Goiás. Observou-se significância, pelo teste F, para altura de planta, peso de 100 grãos e umidade dos grãos na colheita. Guandu, soja, girassol e milheto proporcionaram maior altura da planta de milho. Não foram observadas diferenças estatísticas entre as sucessões para produtividades de grãos e demais características avaliadas.
PALAVRAS-CHAVE: Sucessão de culturas; milho; características agronômicas.
High-LET particle dosimetry in the ASTP-Biostack III: Zea mays experiment
International Nuclear Information System (INIS)
Peterson, D.D.; Benton, E.V.; Tran, M.; Yang, T.; Freeling, M.; Craise, L.; Tobias, C.A.
1977-01-01
High-LET particle hits in embryos of Zea mays (corn) seeds, flown as part of the ASTP-Biostack III, were determined via plastic nuclear track detectors. Based on etched particle-tracks measurements, 41 embryos were hit in seed layer 1 which contained 80 seeds, and 49 hits occurred in layer 2 which contained 79 seeds. The mean LET value and range of atomic numbers of recorded hits is, respectively, 210 +- 57 keV/μm and 9 approximately less than Z approximately less than 26. Detailed analysis of one particular seed showing marked growth anomalies revealed two hits in the central region of the embryo. These two hits had LET values in the region of 100 to 150 keV/μm, and Z less than approximately 20. (author)
Oxidation of indole-3-acetic acid to oxindole-3-acetic acid by an enzyme preparation from Zea mays
Reinecke, D. M.; Bandurski, R. S.
1988-01-01
Indole-3-acetic acid is oxidized to oxindole-3-acetic acid by Zea mays tissue extracts. Shoot, root, and endosperm tissues have enzyme activities of 1 to 10 picomoles per hour per milligram protein. The enzyme is heat labile, is soluble, and requires oxygen for activity. Cofactors of mixed function oxygenase, peroxidase, and intermolecular dioxygenase are not stimulatory to enzymic activity. A heat-stable, detergent-extractable component from corn enhances enzyme activity 6- to 10-fold. This is the first demonstration of the in vitro enzymic oxidation of indole-3-acetic acid to oxindole-3-acetic acid in higher plants.
Expression of maize prolamins in Escherichia Coli. [Zea mays L
Energy Technology Data Exchange (ETDEWEB)
Wang, Szu-zhen; Esen, Asim
1985-12-02
A cDNA expression library of developing corn (Zea mays L.) endosperm has been constructed using plasmid pUC8 as vector and Escherichia coli strain DH1 as host. The expression library was screened with non-radioactive immunological probes to detect the expression of gamma-zein and alpha-zein. When anti-gamma-zein antibody was used as the probe, 23 colonies gave positive reactions. The lengths of cDNA inserts of the 23 colonies were found to be 250-900 base pairs. When anti-alpha zein antibody was used, however, fewer colonies gave positive reactions. The library was also screened by colony-hybridization with /sup 32/P-labeled DNA probes. Based on immunological and hybridization screening of the library and other evidence, it was conclude that alpha-zein was either toxic to E. coli cells or rapidly degraded whereas gamma-zein and its fragments were readily expressed. 21 references.
Cover cropping to reduce nitrate loss through subsurface drainage in the northern U.S. corn belt.
Strock, J S; Porter, P M; Russelle, M P
2004-01-01
Despite the use of best management practices for nitrogen (N) application rate and timing, significant losses of nitrate nitrogen (NO3(-)-N) in drainage discharge continue to occur from row crop cropping systems. Our objective was to determine whether a autumn-seeded winter rye (Secale cereale L.) cover crop following corn (Zea mays L.) would reduce NO3(-)-N losses through subsurface tile drainage in a corn-soybean [Glycine mar (L.) Merr.] cropping system in the northern Corn Belt (USA) in a moderately well-drained soil. Both phases of the corn-soybean rotation, with and without the winter rye cover crop following corn, were established in 1998 in a Normania clay loam (fine-loamy, mixed, mesic Aquic Haplustoll) soil at Lamberton, MN. Cover cropping did not affect subsequent soybean yield, but reduced drainage discharge, flow-weighted mean nitrate concentration (FWMNC), and NO3(-)-N loss relative to winter fallow, although the magnitude of the effect varied considerably with annual precipitation. Three-year average drainage discharge was lower with a winter rye cover crop than without (p = 0.06). Over three years, subsurface tile-drainage discharge was reduced 11% and NO3(-)-N loss was reduced 13% for a corn-soybean cropping system with a rye cover crop following corn than with no rye cover crop. We estimate that establishment of a winter rye cover crop after corn will be successful in one of four years in southwestern Minnesota. Cover cropping with rye has the potential to be an effective management tool for reducing NO3(-)-N loss from subsurface drainage discharge despite challenges to establishment and spring growth in the north-central USA.
Jayaram, Smitha; Kapoor, Sabeeta; Dharmesh, Shylaja M
2015-06-25
Corn pectic polysaccharide (COPP) inhibited galectin-3 mediated hemagglutination at Minimum Inhibitory Concentration (MIC) of 4.08 μg/mL as opposed to citrus pectin (25 μg/mL), a well known galectin-3 inhibitor and lactose (4.16 μg/mL)--sugar specific to galectin-3. COPP effectively (72%) inhibited invasion and metastasis in experimental animals. In vivo results were substantiated by modulation of cancer specific markers such as galectin-3, which is a key molecule for initiation of metastatic cascade, vascular endothelial growth factor (VEGF) that enhances angiogenesis, matrix metalloproteinases 2 and 9 that are required for invasion, NF-κB, a transcription factor for proliferative potency of tumor cells and a phosphoglucoisomerase (PGI), the activity of which favors cancer cell growth. Structural characterization studies indicate the active component (relatively less acidic, 0.05 M ammonium carbonate, 160 kDa fraction) which showed antimetastatic potency in vitro with MIC of 0.09 μg/mL, and ∼ 45 fold increase in the activity when compared to that of COPP. Gas liquid chromatographic analysis indicated the presence of rhamnose (1%), arabinose (20%), xylose (3%), mannose (4%), galactose (54%) and uronic acid (10%) in different proportions. However, correlative data attributed galectin-3 inhibitory activity to enhanced levels of arabinose and galactose. FTIR, HPLC and NMR spectroscopic analysis further highlights that COPP is an arabinogalactan with methyl/ethyl esters. It is therefore suggested that the blockade of galectin-3 mediated lung metastasis appears to be a result of an inhibition of mixed functions induced during metastasis. The data signifies the importance of dietary carbohydrate as cancer-preventive agent. Although pectin digestibility and absorption are issues of concern, promising in vivo data provides evidence for the cancer preventive property of corn. The present study reveals for the first time a new component of corn, i.e.,--corn pectin
Boyer, Christopher N.; Larson, James A.; Roberts, Roland K.; McClure, Angela T.; Tyler, Donald D.; Zhou, Vivian
2013-01-01
Deterministic and stochastic yield response plateau functions were estimated to determine the expected profit-maximizing nitrogen rates, yields, and net returns for corn grown after corn, cotton, and soybeans. The stochastic response functions were more appropriate than their deterministic counterparts, and the linear response stochastic plateau described the data the best. The profit-maximizing nitrogen rates were similar for corn after corn, cotton, and soybeans, but relative to corn after ...
Directory of Open Access Journals (Sweden)
k Hajmohammadnia Ghalibaf
2011-02-01
Full Text Available Abstract In order to study the effects of four chickpea cultivar (Cicer arietinum L. on vegetative growth of sunflower (Helianthus annus and corn (Zea mays, two separate experiments was conducted at Research Greenhouse of Ferdowsi University of Mashhad in 2005. Experiments were done in a factorial arrangement of treatments with two factors based on completely randomized design with 4 replications. Factors included chickpea cultivars (Karag12-60-31, Filip 84-482, Gam, ILC 482, and no residue control and planting date of corn and sunflowers within root residues of chick pea (seeds planted simultaneously, 2 weeks, and 4 weeks after harvesting of chickpea shoots. Seeds of corn and sunflower were planted within root residues of chickpea. Results showed that root residues of chickpea cultivars influenced height and shoot weight of sunflower significantly. The lowest sunflower height was obtained when they were planted within root residues of Flip and ILC cultivars, which decreased 13.7 and 11.1% relative to control, respectively. Planting date of sunflower within root residues of chick pea cultivars had a significant effect on sunflower leaf area, shoot weight, and its root/shoot ratio. So that, lowest leaf area, shoot weight, and also highest root/shoot ratio was obtained in third planting date. Results showed that lowest plant height, leaf area, root weight, shoot weight, and also highest root/shoot ratio of corn (6 weeks after planting was obtained after planting within chickpea cultivars, Gam and ILC. Also the effect of corn planting date was significant. The lowest root and shoot weight, and root/shoot ratio of corn was obtained in the earliest corn planting date. Therefore, corn plants showed more sensitive than sunflower after planting within chickpea cultivars, and the highest inhibitory effects resulted in the earliest corn planting date. Keywords: Pea cultivars, Integrated management, Crop rotation
Latent nitrate reductase activity is associated with the plasma membrane of corn roots
Ward, M. R.; Grimes, H. D.; Huffaker, R. C.
1989-01-01
Latent nitrate reductase activity (NRA) was detected in corn (Zea mays L., Golden Jubilee) root microsome fractions. Microsome-associated NRA was stimulated up to 20-fold by Triton X-100 (octylphenoxy polyethoxyethanol) whereas soluble NRA was only increased up to 1.2-fold. Microsome-associated NRA represented up to 19% of the total root NRA. Analysis of microsomal fractions by aqueous two-phase partitioning showed that the membrane-associated NRA was localized in the second upper phase (U2). Analysis with marker enzymes indicated that the U2 fraction was plasma membrane (PM). The PM-associated NRA was not removed by washing vesicles with up to 1.0 M NACl but was solubilized from the PM with 0.05% Triton X-100. In contrast, vanadate-sensitive ATPase activity was not solubilized from the PM by treatment with 0.1% Triton X-100. The results show that a protein capable of reducing nitrate is embedded in the hydrophobic region of the PM of corn roots.
Effect of tillage and crop residue management on nematode densities on corn.
McSorley, R; Gallaher, R N
1994-12-01
Effects of winter cover crop management on nematode densities associated with a subsequent corn (Zea mays) crop were examined in five sites in north Florida. Two sites had received winter cover crops of lupine (Lupinus angustifolius), and one site each had rye (Secale cereale), hairy vetch (Vicia villosa), and crimson clover (Trifolium incarnatum). In each site, five different management regimes were compared: 1) conventional tillage after the cover crop was removed for forage; 2) conventional tillage with the cover crop retained as green manure; 3) no-till with the cover crop mowed and used as a mulch; 4) no-till with the cover crop removed as forage; and 5) fallow. Sites were sampled at corn planting and harvest for estimates of initial (Pi) and final (Pf) nematode population densities, respectively. Whether the cover crop was removed as forage or retained as green manure or mulch had no effect (P > 0.10) on population densities of any plant-parasitic nematode before or after corn at any site. Differences between conventional-till and no-till treatments were significant (P cover crop residues had little consistent effect on nematodes, and these practices should be considered based on agronomic benefits rather than for nematode management.
Directory of Open Access Journals (Sweden)
Sri Setyani
2017-03-01
Full Text Available The purpose of this research was to find the best formulation of corn tempe flour and wheat flour to produce chemically, physicochemically and organoleptically acceptable sweet noodle. The formulation consisted of 4 levels ratio of 100% corn tempe flour and wheat flour L1 (10:90, L2 (20:80, L3 (30:70, L4 (40:60 w/w with 6 replications. The experiment was arranged in Complete Randomized Block Design (CRBD. Data were analyzed by using analysis of variance, further were tested by using the Least Significant Difference (LSD test in 5% level of significance. The result showed that the best formula was L3 treatment (30% corn tempe flour and 70% wheat flour. The characteristic of this noodle were 23.31% moisture content, 1.55% ash, 8.50% fat, 9.11% protein, 57,2% carbohydrate, 9.85% cooking loss, and 13.50 %water absorption. The wet noodle score sensory of texture was 2,88 (rather chewy, taste’s and aroma score was 3.05 (typical corn, and the overall of acceptance was 2.93 (like.Keywords: chemical-physicochemical and organoleptic characteristics, corn tempe flour, wet noodle,wheat.
Directory of Open Access Journals (Sweden)
Magda Narváez Castillo
2010-12-01
Full Text Available Se evalúo el efecto de la aplicación de vinaza en las propiedades químicas y la actividad de las fosfatasas ácidas y alcalinas de dos suelos del Valle del Cauca, Colombia (Typic Argiudoll y Fluventic Haplustoll en condiciones controladas. Se establecieron seis tratamientos y cinco repeticiones distribuidos en un diseño completamente al azar, cuatro de ellos buscaban suplir los requerimientos de K+ del cultivo maíz dulce de la siguiente forma: T1, 100% del K+ con vinazas, T2 100% de K+ con KCl, T3 50% de K+ con Vinaza y 50% con KCl, y T4 75% del K+ con vinaza y 25% con KCl, T5 fue el testigo absoluto sin planta y T6 el testigo más planta. Las evaluaciones se realizaron en un periodo de 76 días y las muestras se tomaron entre 0-5 cm de profundidad. El pH, K+, B y relación Ca + Mg/K disminuyeron, muy significativamente (PIt was evaluated the effect of vinasse application on chemical properties and activity of acid and alkaline phosphatases of two soils of Valle del Cauca Colombia (Typic Argiudoll and Fluventic Haplustoll under controlled conditions. Six treatments and five replicates arranged in a completely randomized design were stablished; four of them, sought meet the requirements of K+ crop sweet corn as follows: T1, 100% of K+ with vinasse, T2 100% K+ with KCl T3 50% of K+ with vinasse and 50% KCl, and T4 75% of K+ with vinasse and 25% with KCl, T5 was the absolute control without plant and T6 the witness more plant. The evaluations were conducted over a period of 76 days and samples were taken from 0 - 5 cm deep. The pH, K+, B and Ca + Mg / K decreased significantly (P<0.01, while the contents of K+ and B were increased in both soils The P, Cu, Na and Fe increased differently in each soil. Alkaline phosphatase was significantly higher in the Fluventic Haplustoll and maximum activity occurred at 10 days after sowing (DAS; however, no significant differences between soils with reference to acid phosphatase and increased activity
75 FR 33190 - Trifloxystrobin; Pesticide Tolerances
2010-06-11
..., fat and meat byproduct of cattle, goats, horses, and sheep tolerances to 0.1 ppm. The reasons for... byproducts; corn, field, forage; corn, sweet, forage; corn, sweet, stover; goat, fat; goat, meat; goat, meat..., forage 7.0 * * * * * Corn, sweet, stover 4.0 * * * * * Goat, fat 0.1 Goat, meat 0.1 Goat, meat byproducts...
de Almeida, Rodrigo Estevam Munhoz; Pierozan Junior, Clovis; Lago, Bruno Cocco; Trivelin, Paulo Cesar Ocheuze
2018-01-01
Early fertilizer nitrogen (N) application on cover crops or their residues during the off-season is a practice adopted in Brazil subtropical conditions under no-tillage corn (Zea mays L.) systems. However, the effect of early N application on yield, plant N content, and N recovery efficiency (NRE) for corn is not yet well documented. Five fertilizer N timings in an oat-corn system were evaluated in two studies utilizing an isotopic-labeled N determination, 15N isotope. The N fertilization timings were: (i) oat tillering, (ii) 15 days before corn planting time, over the oat residues, (iii) at corn planting time, (iv) in-season at the three-leaf growth stage (V3), and (v) in-season split application at V3 and six-leaf (V6) growth stages. Based on the statistical analysis, the N fertilization timings were separated into three groups: 1) N-OATS, designated to N applied at oat; 2) N-PLANT, referred to pre-plant and planting N applications; and 3) N-CORN, designated to in-season corn N applications. Corn yield was not affected by the N fertilization timing. However, the N-CORN N fertilization timings enhanced NRE by 17% and 35% and final N recovery system (plant plus soil) by 16% and 24% all relative to N-OATS and N-PLANT groups, respectively. Overall, N-OATS resulted in the largest N derived from fertilizer (NDFF) amount in the deeper soil layer, in overall a delta of 10 kg N ha-1 relative to the rest of the groups. Notwithstanding corn yield was not affected, early N fertilization under subtropical conditions is not a viable option since NRE was diminished and the non-recovery N increased relative to the in-season N applications. PMID:29462178
Maciel de Oliveira, Silas; Almeida, Rodrigo Estevam Munhoz de; Ciampitti, Ignacio A; Pierozan Junior, Clovis; Lago, Bruno Cocco; Trivelin, Paulo Cesar Ocheuze; Favarin, José Laércio
2018-01-01
Early fertilizer nitrogen (N) application on cover crops or their residues during the off-season is a practice adopted in Brazil subtropical conditions under no-tillage corn (Zea mays L.) systems. However, the effect of early N application on yield, plant N content, and N recovery efficiency (NRE) for corn is not yet well documented. Five fertilizer N timings in an oat-corn system were evaluated in two studies utilizing an isotopic-labeled N determination, 15N isotope. The N fertilization timings were: (i) oat tillering, (ii) 15 days before corn planting time, over the oat residues, (iii) at corn planting time, (iv) in-season at the three-leaf growth stage (V3), and (v) in-season split application at V3 and six-leaf (V6) growth stages. Based on the statistical analysis, the N fertilization timings were separated into three groups: 1) N-OATS, designated to N applied at oat; 2) N-PLANT, referred to pre-plant and planting N applications; and 3) N-CORN, designated to in-season corn N applications. Corn yield was not affected by the N fertilization timing. However, the N-CORN N fertilization timings enhanced NRE by 17% and 35% and final N recovery system (plant plus soil) by 16% and 24% all relative to N-OATS and N-PLANT groups, respectively. Overall, N-OATS resulted in the largest N derived from fertilizer (NDFF) amount in the deeper soil layer, in overall a delta of 10 kg N ha-1 relative to the rest of the groups. Notwithstanding corn yield was not affected, early N fertilization under subtropical conditions is not a viable option since NRE was diminished and the non-recovery N increased relative to the in-season N applications.
Varanda, Carla M R; Santos, Susana J; Oliveira, Mônica D M; Clara, Maria Ivone E; Félix, Maria Rosário F
2015-06-01
Field sweet potato plants showing virus-like symptoms, as stunting, leaf distortion, mosaic and chlorosis, were collected in southwest Portugal and tested for the presence of four potyviruses, sweet potato virus C (SPVC), sweet potato virus 2 (SPV2), sweet potato feathery mottle virus (SPFMV), sweet potato virus G (SPVG), and the crinivirus sweet potato chlorotic stunt virus (SPCSV). DsRNA fractions were extracted from symptomatic leaves and used as templates in single and multiplex RT-PCR assays using previously described specific primers for each analyzed virus. The amplified reaction products for SPVC, SPV2 and SPFMV were of expected size, and direct sequencing of PCR products revealed that they correspond to the coat protein gene (CP) and showed 98%, 99% and 99% identity, respectively, to those viruses. Comparison of the CP genomic and amino acid sequences of the Portuguese viral isolates recovered here with those of ten other sequences of isolates obtained in different countries retrieved from the GenBank showed very few differences. The application of the RT-PCR assays revealed for the first time the presence of SPVC and SPFMV in the sweet potato crop in Portugal, the absence of SPVG and SPCSV in tested plants, as well as the occurrence of triple virus infections under field conditions.
7 CFR 319.24 - Notice of quarantine.
2010-01-01
..., that maize or Indian corn (Zea mays L.) and closely related plants are subject to certain injurious... the United States. (d) Seed of Indian corn or maize (Zea mays L.) that is free from the cob and from...
Directory of Open Access Journals (Sweden)
Kelly Ávila
2011-12-01
Full Text Available In the corn belt of Valle de San Juan and in the cotton zone of El Espinal, municipalities in the department of Tolima (Colombia, 10 conventional corn producers, 10 producers of genetically modified corn, five producers of conventional cotton and 15 producers of transgenic cotton were surveyed in the first half of 2009 to contrast the differences in the environmental impact associated with use of insecticides and herbicides, which were evaluated by estimating the environmental index quotient-EIQ. In the case of maize, an EIQ of 42 was found in the conventional type, while transgenic technology had an EIQ of 3.03. In the cultivation of cotton, an EIQ of 263.59 was found for the conventional type while for transgenic technology this value varied between 335.75 (Nuopal BG/RR and 324.79 (DP 455 BG/RR. These data showed a lower environmental impact using GM technology in the cultivation of maize when compared to the conventional counterpart, in connection with the use of insecticides and herbicides, in the context of time, space and genotypic analysis. This effect was not observed in the case of cotton, where environmental impacts were similar
Residual nitrogen-15 recovery by corn as influenced by tillage and fertilization method
International Nuclear Information System (INIS)
Timmons, D.R.; Cruse, R.M.
1991-01-01
Tillage systems that create different surface residue conditions may also affect the recovery of residual fertilizer N during subsequent growing seasons. This study evaluated the recovery of residual labeled N fertilizer in the soil by corn (Zea mays L.) for two tillage systems and two fertilization methods. Five atom % 15 N-enriched 28% urea-ammonium nitrate solution (UAN) at 224 kg N ha -1 was either surface-applied in the fall before any primary tillage or banded (knifed in) just before planting in the spring. Continuous corn was grown with either fall moldboard-plow (MP) or ridge-till (RT) systems. After the initial growing season, the recovery of residual labeled N in the soil by corn was determined for three consecutive growing seasons, and the soil profile was sampled periodically to measure residual 15 N in the organic and inorganic pools. One year after labeled UAN application, from 16 to 27% of the initial 15 N applied was found in the organic N pool and only 1% as inorganic N[NH 4 +(NO 2 +NO 3 )-N]. After four seasons, residual 15 N in the organic N pool ranged from 13 to 24%. Less than 0.5% remained as inorganic N. Regression analyses indicated that about 5 kg 15 N ha -1 year -1 became available for both MP and RT systems with banded N, so the amounts were small. Total residual 15 N recovery by corn grain plus stover for three seasons ranged from 1.7 to 3.5%, and was greatest for spring-banded fertilizer. Because the amounts of residual 15 N utilized were too small to affect corn growth, this N source appears to be negligible when considering corn-N needs
Insecticidal Management and Movement of the Brown Stink Bug, Euschistus servus, in Corn
Reisig, Dominic D.
2011-01-01
In eastern North Carolina, some brown stink bugs, Euschistus servus (Say) (Hemiptera: Pentatomidae) are suspected to pass the F1 generation in wheat (Triticum aestivum L.) (Poales: Poaceae) before moving into corn (Zea mays L.) (Poales: Poaceae). These pests can injure corn ears as they develop. To test their effectiveness as a management tactic, pyrethroids were aerially applied to field corn in two experiments, one with 0.77 ha plots and another with 85 ha plots. Euschistus servus population abundance was monitored over time in both experiments and yield was assessed in the larger of the two experiments. In the smaller experiment, the populations were spatially monitored in a 6.3 ha area of corn adjacent to a recently harvested wheat field (352 sampling points of 6.1 row-meters in all but the first sampling event). Overall E. servus abundance decreased throughout the monitoring period in the sampling area of the smaller experiment, but remained unchanged over time in the large-scale experiment. During all sampling periods in both experiments, abundance was the same between treatments. Yield was unaffected by treatment where it was measured in the larger experiment. In the smaller experiment, E. servus were initially aggregated at the field edge of the corn (two, six and 13 days following the wheat harvest). Sixteen days following the wheat harvest they were randomly distributed in the corn. Although it was not directly measured, stink bugs are suspected to move the cornfield edge as a result of the adjacent wheat harvest. More study of the biology of E. servus is needed, specifically in the area of host preference, phenology and movement to explain these phenomena and to produce better management strategies for these pests. PMID:22950984
Spatial Patterns of Aflatoxin Levels in Relation to Ear-Feeding Insect Damage in Pre-Harvest Corn
Directory of Open Access Journals (Sweden)
Alisa Huffaker
2011-07-01
Full Text Available Key impediments to increased corn yield and quality in the southeastern US coastal plain region are damage by ear-feeding insects and aflatoxin contamination caused by infection of Aspergillus flavus. Key ear-feeding insects are corn earworm, Helicoverpa zea, fall armyworm, Spodoptera frugiperda, maize weevil, Sitophilus zeamais, and brown stink bug, Euschistus servus. In 2006 and 2007, aflatoxin contamination and insect damage were sampled before harvest in three 0.4-hectare corn fields using a grid sampling method. The feeding damage by each of ear/kernel-feeding insects (i.e., corn earworm/fall armyworm damage on the silk/cob, and discoloration of corn kernels by stink bugs, and maize weevil population were assessed at each grid point with five ears. The spatial distribution pattern of aflatoxin contamination was also assessed using the corn samples collected at each sampling point. Aflatoxin level was correlated to the number of maize weevils and stink bug-discolored kernels, but not closely correlated to either husk coverage or corn earworm damage. Contour maps of the maize weevil populations, stink bug-damaged kernels, and aflatoxin levels exhibited an aggregated distribution pattern with a strong edge effect on all three parameters. The separation of silk- and cob-feeding insects from kernel-feeding insects, as well as chewing (i.e., the corn earworm and maize weevil and piercing-sucking insects (i.e., the stink bugs and their damage in relation to aflatoxin accumulation is economically important. Both theoretic and applied ramifications of this study were discussed by proposing a hypothesis on the underlying mechanisms of the aggregated distribution patterns and strong edge effect of insect damage and aflatoxin contamination, and by discussing possible management tactics for aflatoxin reduction by proper management of kernel-feeding insects. Future directions on basic and applied research related to aflatoxin contamination are also
Spatial patterns of aflatoxin levels in relation to ear-feeding insect damage in pre-harvest corn.
Ni, Xinzhi; Wilson, Jeffrey P; Buntin, G David; Guo, Baozhu; Krakowsky, Matthew D; Lee, R Dewey; Cottrell, Ted E; Scully, Brian T; Huffaker, Alisa; Schmelz, Eric A
2011-07-01
Key impediments to increased corn yield and quality in the southeastern US coastal plain region are damage by ear-feeding insects and aflatoxin contamination caused by infection of Aspergillus flavus. Key ear-feeding insects are corn earworm, Helicoverpa zea, fall armyworm, Spodoptera frugiperda, maize weevil, Sitophilus zeamais, and brown stink bug, Euschistus servus. In 2006 and 2007, aflatoxin contamination and insect damage were sampled before harvest in three 0.4-hectare corn fields using a grid sampling method. The feeding damage by each of ear/kernel-feeding insects (i.e., corn earworm/fall armyworm damage on the silk/cob, and discoloration of corn kernels by stink bugs), and maize weevil population were assessed at each grid point with five ears. The spatial distribution pattern of aflatoxin contamination was also assessed using the corn samples collected at each sampling point. Aflatoxin level was correlated to the number of maize weevils and stink bug-discolored kernels, but not closely correlated to either husk coverage or corn earworm damage. Contour maps of the maize weevil populations, stink bug-damaged kernels, and aflatoxin levels exhibited an aggregated distribution pattern with a strong edge effect on all three parameters. The separation of silk- and cob-feeding insects from kernel-feeding insects, as well as chewing (i.e., the corn earworm and maize weevil) and piercing-sucking insects (i.e., the stink bugs) and their damage in relation to aflatoxin accumulation is economically important. Both theoretic and applied ramifications of this study were discussed by proposing a hypothesis on the underlying mechanisms of the aggregated distribution patterns and strong edge effect of insect damage and aflatoxin contamination, and by discussing possible management tactics for aflatoxin reduction by proper management of kernel-feeding insects. Future directions on basic and applied research related to aflatoxin contamination are also discussed.
Spatial Patterns of Aflatoxin Levels in Relation to Ear-Feeding Insect Damage in Pre-Harvest Corn
Ni, Xinzhi; Wilson, Jeffrey P.; Buntin, G. David; Guo, Baozhu; Krakowsky, Matthew D.; Lee, R. Dewey; Cottrell, Ted E.; Scully, Brian T.; Huffaker, Alisa; Schmelz, Eric A.
2011-01-01
Key impediments to increased corn yield and quality in the southeastern US coastal plain region are damage by ear-feeding insects and aflatoxin contamination caused by infection of Aspergillus flavus. Key ear-feeding insects are corn earworm, Helicoverpa zea, fall armyworm, Spodoptera frugiperda, maize weevil, Sitophilus zeamais, and brown stink bug, Euschistus servus. In 2006 and 2007, aflatoxin contamination and insect damage were sampled before harvest in three 0.4-hectare corn fields using a grid sampling method. The feeding damage by each of ear/kernel-feeding insects (i.e., corn earworm/fall armyworm damage on the silk/cob, and discoloration of corn kernels by stink bugs), and maize weevil population were assessed at each grid point with five ears. The spatial distribution pattern of aflatoxin contamination was also assessed using the corn samples collected at each sampling point. Aflatoxin level was correlated to the number of maize weevils and stink bug-discolored kernels, but not closely correlated to either husk coverage or corn earworm damage. Contour maps of the maize weevil populations, stink bug-damaged kernels, and aflatoxin levels exhibited an aggregated distribution pattern with a strong edge effect on all three parameters. The separation of silk- and cob-feeding insects from kernel-feeding insects, as well as chewing (i.e., the corn earworm and maize weevil) and piercing-sucking insects (i.e., the stink bugs) and their damage in relation to aflatoxin accumulation is economically important. Both theoretic and applied ramifications of this study were discussed by proposing a hypothesis on the underlying mechanisms of the aggregated distribution patterns and strong edge effect of insect damage and aflatoxin contamination, and by discussing possible management tactics for aflatoxin reduction by proper management of kernel-feeding insects. Future directions on basic and applied research related to aflatoxin contamination are also discussed. PMID
Directory of Open Access Journals (Sweden)
Rogério de Andrade Coimbra
2009-12-01
Full Text Available Dentro de um programa de controle de qualidade, a avaliação do vigor de sementes é fundamental e necessária para o sucesso da produção. Com o objetivo de avaliar a eficiência de diferentes testes de vigor na avaliação da qualidade fisiológica de sementes de milho-doce na tentativa de diferenciação de lotes quanto ao nível de vigor e previsão de emergência de plântulas em campo e ao potencial de armazenamento, 10 lotes do híbrido DO-04 shrunken-2 (sh-2 foram submetidos a teste de germinação, primeira contagem, precocidade de emissão de raiz primária (32, 48, 56 e 72h, teste de frio, condutividade elétrica (50 sementes 75mL-1 de água; 25°C/4, 6, 8 e 24h, envelhecimento acelerado (42°C em água destilada (100%UR, solução saturada de cloreto de potássio (87%UR e solução saturada de cloreto de sódio (76% UR, avaliando-se quatro períodos de exposição (24, 48, 72 e 96h, teor de água, emergência de plântulas em campo e germinação após armazenamento das sementes (10°C e 40%UR, avaliada quadrimestralmente por 16 meses. A condutividade elétrica (por 6, 8 e 24h foi o único teste eficiente na diferenciação do vigor de lotes de sementes de milho-doce (sh2; no entanto, não apresentou correlação com a emergência de plântulas em campo ou armazenamento.In a program of seed quality assurance, the evaluation of seed vigor is fundamental and necessary to the global production process outcome. The objective of this experiment was to verify the efficiency of different vigor tests for evaluation of sweet corn seeds quality towards lots differentiation and prevision of seedling emergence and storage capacity of those. Ten lots of DO-04 shrunken-2 (sh2 hybrid sweet corn seeds were submitted to the following evaluations: germination, first counting of germination test, earliness of primary root emission (32, 48, 56 and 72 hours, cold test, electrical conductivity test (50 seeds into 75ml of water, at 25°C for 4, 6, 8 and
Windbreak effect on biomass and grain mass accumulation of corn: a modeling approach
International Nuclear Information System (INIS)
Zhang, H.; Brandle, J.R.
1996-01-01
While numerous studies have indicated that field windbreaks both improve crop growing conditions and generally enhance crop growth and yield, especially under less favorable conditions, the relationship between the two is not clearly understood. A simple model is proposed to simulate biomass and grain mass accumulation of corn (Zea mays L,) with a windbreak shelter or without (exposed condition). The model is based on the positive relationship between intercepted solar radiation and biomass accumulation and requires plant population and hourly inputs of solar radiation and air temperature. Using published data, radiation use efficiency (RUE) was related to plant population, and a temperature function was established between the relative corn growth and temperature for pre-silking stages. Biomass and grain mass simulated by the model agreed well with those measured for both sheltered and unsheltered plants from 1990 to 1992. Windbreaks did not significantly increase biomass or grain mass of corn for this study, even though air temperature was greater with than without shelter, probably indicating that the microclimatic changes induced by windbreaks were not physiologically significant for the 3-yr period studied. The model has potential use in future studies to relate windbreak effects to crop yield and to evaluate windbreak designs for maximum benefits
Sharma, Lakesh K; Bu, Honggang; Denton, Anne; Franzen, David W
2015-11-02
Active-optical sensor readings from an N non-limiting area standard established within a farm field are used to predict yield in the standard. Lower yield predictions from sensor readings obtained from other parts of the field outside of the N non-limiting standard area indicate a need for supplemental N. Active-optical sensor algorithms for predicting corn (Zea mays, L.) yield to direct in-season nitrogen (N) fertilization in corn utilize red NDVI (normalized differential vegetative index). Use of red edge NDVI might improve corn yield prediction at later growth stages when corn leaves cover the inter-row space resulting in "saturation" of red NDVI readings. The purpose of this study was to determine whether the use of red edge NDVI in two active-optical sensors (GreenSeeker™ and Holland Scientific Crop Circle™) improved corn yield prediction. Nitrogen rate experiments were established at 15 sites in North Dakota (ND). Sensor readings were conducted at V6 and V12 corn. Red NDVI and red edge NDVI were similar in the relationship of readings with yield at V6. At V12, the red edge NDVI was superior to the red NDVI in most comparisons, indicating that it would be most useful in developing late-season N application algorithms.
Sharma, Lakesh K.; Bu, Honggang; Denton, Anne; Franzen, David W.
2015-01-01
Active-optical sensor readings from an N non-limiting area standard established within a farm field are used to predict yield in the standard. Lower yield predictions from sensor readings obtained from other parts of the field outside of the N non-limiting standard area indicate a need for supplemental N. Active-optical sensor algorithms for predicting corn (Zea mays, L.) yield to direct in-season nitrogen (N) fertilization in corn utilize red NDVI (normalized differential vegetative index). Use of red edge NDVI might improve corn yield prediction at later growth stages when corn leaves cover the inter-row space resulting in “saturation” of red NDVI readings. The purpose of this study was to determine whether the use of red edge NDVI in two active-optical sensors (GreenSeeker™ and Holland Scientific Crop Circle™) improved corn yield prediction. Nitrogen rate experiments were established at 15 sites in North Dakota (ND). Sensor readings were conducted at V6 and V12 corn. Red NDVI and red edge NDVI were similar in the relationship of readings with yield at V6. At V12, the red edge NDVI was superior to the red NDVI in most comparisons, indicating that it would be most useful in developing late-season N application algorithms. PMID:26540057
Directory of Open Access Journals (Sweden)
Mohamed Alburaki
Full Text Available Thirty-two honeybee (Apis mellifera colonies were studied in order to detect and measure potential in vivo effects of neonicotinoid pesticides used in cornfields (Zea mays spp on honeybee health. Honeybee colonies were randomly split on four different agricultural cornfield areas located near Quebec City, Canada. Two locations contained cornfields treated with a seed-coated systemic neonicotinoid insecticide while the two others were organic cornfields used as control treatments. Hives were extensively monitored for their performance and health traits over a period of two years. Honeybee viruses (brood queen cell virus BQCV, deformed wing virus DWV, and Israeli acute paralysis virus IAPV and the brain specific expression of a biomarker of host physiological stress, the Acetylcholinesterase gene AChE, were investigated using RT-qPCR. Liquid chromatography-mass spectrometry (LC-MS was performed to detect pesticide residues in adult bees, honey, pollen, and corn flowers collected from the studied hives in each location. In addition, general hive conditions were assessed by monitoring colony weight and brood development. Neonicotinoids were only identified in corn flowers at low concentrations. However, honeybee colonies located in neonicotinoid treated cornfields expressed significantly higher pathogen infection than those located in untreated cornfields. AChE levels showed elevated levels among honeybees that collected corn pollen from treated fields. Positive correlations were recorded between pathogens and the treated locations. Our data suggests that neonicotinoids indirectly weaken honeybee health by inducing physiological stress and increasing pathogen loads.
International Nuclear Information System (INIS)
Andrade, F.H.; Anderson, I.C.
1986-01-01
Physiological effects of different N forms (NO − 3 , NH + 4 , or a combination of both) on corn (Zea mays L.) root tips and leaves were studied by following 31 P signals with a nuclear magnetic resonance spectrometer. With root tips, both cytoplasmic and vacuolar pH could be measured, whereas with leaves, only vacuolar pH could be determined. The N treatments did not affect the cytoplasmic pH of corn root tips in contrast to proposals of previous workers. Leaf vacuolar pH was higher and root tip vacuolar pH lower with NO − 3 than with NH + 4 . Under anaerobic conditions, cytoplasmic pH was reduced because of lactic acid fermentation. Nitrate, an electron acceptor, delayed the acidification of the cytoplasm compartment because it represents an alternative way to reoxidize NADH. In conclusion, for the conditions of these experiments, the pH of the cytoplasm of corn root tips was not modified by the form of N absorbed; however, the pH of this compartment was affected by the form of N presented during development anaerobiosi. (author)
Iowa History for Young People, 1993
1993-01-01
This theme issue focuses on corn. Iowa is the number one corn producing state in the United States. The featured articles in the issue concern, among other topics, Iowa children who live on farms, facts and statistics about corn, the Mesquakie Indians and corn shelling, corn hybrids, a short story, and the corn palaces of Sioux City. Activities,…
Energy Technology Data Exchange (ETDEWEB)
Garten, C.T. Jr.; Myttenaere, C.; Vandecasteele, C.M.; Kirchmann, R.; Van Bruwaene, R.
1984-01-01
The food chain availability of technetium incorporated into plant tissue, its chemical form in corn leaves, and the potential for gastrointestinal absorption of plant-incorporated technetium was investigated. Technetium-95m was incorporated into corn leaves via root uptake. Chemical fractionation of the /sup 95m/Tc in leaves showed that 60% was extractable with boiling ethanol and weak mineral acids. The remainder was associated with cell walls and was extractable by harsh chemical treatment. Gel permeation chromatography of the cytosol, indicated that 50% of the /sup 95m/Tc co-chromatographed with anionic pertechnetate; however, it was impossible to distinguish if this pure pertechnetate or technetium complexed with organic molecules. Technetium-95m was administered to laboratory rats in a single dose as: (1) intravenous injection of pertechnetate, (2) pertechnetate mixed with standard laboratory food, and (3) a meal containing /sup 95m/Tc biologically incorporated into corn leaves. High concentrations of /sup 95m/Tc were found in the thyroids, hair, kidneys, and liver of rats. Technetium rapidly disappeared from the liver, kidneys, and other tissues, but remained in the thyroids and hair. Urinary excretion of technetium decreased, and fecal excretion increased when technetium was fed to rats as a /sup 95m/Tc incorporated into corn leaves. The percent of the administered dose absorbed into thyroid gland and the kidneys was less when technetium was biologically incorporated into corn leaves than when pertechnetate was mixed with food. Biological incorporation of technetium into plants appears to reduce its potential for food chain transfer by decreasing its availability for gastrointestinal absorption. 5 references, 4 figures, 3 tables.
International Nuclear Information System (INIS)
Garten, C.T. Jr.; Myttenaere, C.; Vandecasteele, C.M.; Kirchmann, R.; Van Bruwaene, R.
1984-01-01
The food chain availability of technetium incorporated into plant tissue, its chemical form in corn leaves, and the potential for gastrointestinal absorption of plant-incorporated technetium was investigated. Technetium-95m was incorporated into corn leaves via root uptake. Chemical fractionation of the /sup 95m/Tc in leaves showed that 60% was extractable with boiling ethanol and weak mineral acids. The remainder was associated with cell walls and was extractable by harsh chemical treatment. Gel permeation chromatography of the cytosol, indicated that 50% of the /sup 95m/Tc co-chromatographed with anionic pertechnetate; however, it was impossible to distinguish if this pure pertechnetate or technetium complexed with organic molecules. Technetium-95m was administered to laboratory rats in a single dose as: (1) intravenous injection of pertechnetate, (2) pertechnetate mixed with standard laboratory food, and (3) a meal containing /sup 95m/Tc biologically incorporated into corn leaves. High concentrations of /sup 95m/Tc were found in the thyroids, hair, kidneys, and liver of rats. Technetium rapidly disappeared from the liver, kidneys, and other tissues, but remained in the thyroids and hair. Urinary excretion of technetium decreased, and fecal excretion increased when technetium was fed to rats as a /sup 95m/Tc incorporated into corn leaves. The percent of the administered dose absorbed into thyroid gland and the kidneys was less when technetium was biologically incorporated into corn leaves than when pertechnetate was mixed with food. Biological incorporation of technetium into plants appears to reduce its potential for food chain transfer by decreasing its availability for gastrointestinal absorption. 5 references, 4 figures, 3 tables
Dominque, Brunson; Gichuhi, Peter N; Rangari, Vijay; Bovell-Benjamin, Adelia C
2013-01-01
Currently, corn is used to produce more than 85% of the world's high fructose syrup (HFS). There is a search for alternative HFS substrates because of increased food demand and shrinking economies, especially in the developing world. The sweet potato is a feasible, alternative raw material. This study isomerized a high glucose sweet potato starch syrup (SPSS) and determined its sugar profile, mineral content, and rheological and thermal properties. Rheological and thermal properties were measured using a rheometer and DSC, respectively. Sweet potato starch was hydrolyzed to syrup with a mean fructose content of 7.6 ± 0.4%. The SPSS had significantly higher (P syrups. During 70 days of storage, the SPSS acted as a non-Newtonian, shear-thinning liquid in which the viscosity decreased as shear stress increased. Water loss temperature of the SPSS continually decreased during storage, while pancake and ginger syrups' peak water loss temperature decreased initially and then increased. Further and more detailed studies should be designed to further enhance the fructose content of the syrup and observe its stability beyond 70 days. The SPSS has the potential to be used in human food systems in space and on Earth.
Directory of Open Access Journals (Sweden)
M. Gholamshahi
2017-01-01
Full Text Available Introduction: Corn is one of the important crops of poaceae family which has important role in supplying food for human societies. Corn is third food crop in world and it has high potential compare to other crops because of its C4 photosynthetic pathway. In addition, corn is a strong and fast growing plant but it is sensitive to competition with weeds. According studies, there are 25 to 30 problematic weeds in corn farms which they include annual and perennial species. Annual weeds life cycle is similar to corn life cycle, there for the most problem of weeds in corn is summer annual weeds. Damage of weeds is different and it depends on weeds density, species composition, time of emergence, crop variety and other factors. While non control of weeds depending on those density and Variety, corn yeild may be decrease of 15 to 90 percent. Weeds which germinate in a short time can compete with crop on light, water and nutrition sources. Most of the weeds show better reaction to fertilizers compare with crops. This subject is due to weeds ability to nutrition absorption and aggregation and their high performances. Most of the weeds species are more responsive than crops to application of nitrogen fertilizer. Furthermore, the growth of most of the weed species increases with increasing nitrogen. Therefore, the increase of nitrogen in farming systems can have impacts on weeds and crops competitiveness. However, weeds compete with crop about using light, nutrient, water and soil space and the result of this competition is yield losses. Moreover, nitrogen is necessary to increase yield and nitrogen fertilizer enhances corn competitiveness, especially early in the season due to the slow growth of the plant and is necessary to achieve optimal performance. Excessive of nitrogen fertilizer during the growing season is benefit for weeds. Therefore, in order to study the effects of nitrogen fertilizer in combination with weeds management on yield and yield
Meyer, J D F; Snook, M E; Houchins, K E; Rector, B G; Widstrom, N W; McMullen, M D
2007-06-01
Maysin is a naturally occurring C-glycosyl flavone found in maize (Zea mays L.) silk tissue that confers resistance to corn earworm (Helicoverpa zea, Boddie). Recently, two new maize populations were derived for high silk maysin. The two populations were named the exotic populations of maize (EPM) and the southern inbreds of maize (SIM). Quantitative trait locus (QTL) analysis was employed to determine which loci were responsible for elevated maysin levels in inbred lines derived from the EPM and SIM populations. The candidate genes consistent with QTL position included the p (pericarp color), c2 (colorless2), whp1 (white pollen1) and in1 (intensifier1) loci. The role of these loci in controlling high maysin levels in silks was tested by expression analysis and use of the loci as genetic markers onto the QTL populations. These studies support p, c2 and whp1, but not in1, as loci controlling maysin. Through this study, we determined that the p locus regulates whp1 transcription and that increased maysin in these inbred lines was primarily due to alleles at both structural and regulatory loci promoting increased flux through the flavone pathway by increasing chalcone synthase activity.
DEFF Research Database (Denmark)
Petersen, Annette; Thorup, Inger
2001-01-01
Experts from the Nordic countries (Denmark, Norway, Sweden, Finland and Iceland) have carried out an evaluation of fumonisins. The working group members concluded that, at that time point, it was not possible to carry out a complete risk assessment. However, it was recommended that the human daily...... intake of fumonisins should be less than 1 mug/kg bw/day. Subsequently, the presence of the Fusarium mycotoxins fumonisin B-1 and B-2 (FB1 and FB2) in corn-based food on the Danish retail market has been determined. A total of 70 samples were analysed and 37% contained FB1 and 21% contained FB2....... No fumonisins were found in sweet corn (canned or frozen), corn-on-the-cob, corn starch or gruel powder for babies. FB1 was found in about half of the corn flakes, corn snack and popcorn (not popped) samples, whereas FB2 was seen to a lesser extent. Both FB1 and FB2 were found in 75% or more of the corn flour...
Czech Academy of Sciences Publication Activity Database
Zhang, Q.; Žďárek, Jan; Nachman, R. J.; Denlinger, D. L.
2008-01-01
Roč. 29, č. 2 (2008), s. 196-205 ISSN 0196-9781 Institutional research plan: CEZ:AV0Z40550506 Keywords : diapause hormone * neuropeptide analogs * diapause termination * pupariation * Helicoverpa zea Subject RIV: CC - Organic Chemistry Impact factor: 2.565, year: 2008
Directory of Open Access Journals (Sweden)
Sri Setyani
2012-12-01
Full Text Available Sweet corn-mung bean milk can be used to helping increasing the nutrition status of the society . This research was aimed to find the formulation of sweet corn and mung bean that produce sweet corn-mung bean milk with the best physical, chemical and sensory characteristics and is accepted by consument. The experiment was arranged in a completely block randomized design (CBRD withy one factor and three replications. The treatments were five formulations of sweet corn and mung bean , they were 3:1 (F1, 2:1 (F2, 1:1 (F3, 1:2 (F4, and 1:3 (F5 (w/w. The data were analysed using analysis of variance, and then continued with 1 % and 5 % Least Significant Different Test. The determinination of the water addition that produced mung bean-sweet corn milk that is compliance with the total solid in SNI (11.5 % was done in the preliminary research. The preliminary research result showed that mung bean sweet corn milk has total solid of 15-19% for all of formulations, while the best favorable milk was milk with the formulation: water that is at 1:10. The result of the main research showed that the stabilityobjectively, protein content, and organoleptic characteristic were not significanly different among sweet corn and mung bean formulations, but the stability visually, the viscosity, soluble total solid and fat content were significanltly different among sweet corn and mung bean formulation. According to the SNI (soluble total solid, protein and fat contents are the formulation that have met the soy milk quality standard, but the best formulation was found in F2, with the protein content of 3,183% , fat content of 3,667%, and the most favourable formulation was F2 formulation with 1, 893 score. The result of amino acid analysis on the best mung bean-sweet corn milk showed that five types of essential amino acid (threonine, valine, isoleucine, leucine and lysine have not met the amino acid standard yet by FAO (1973. In conclusion, the combination of
Directory of Open Access Journals (Sweden)
Gessí Ceccon
2013-02-01
Full Text Available The feasibility of no-tillage in the Cerrado (Savanna-like vegetation of Brazil depends on the production of sufficient above-ground crop residue, which can be increased by corn-forage intercropping. This study evaluated how above-ground crop residue production and yields of soybean and late-season corn in a soybean-corn rotation were influenced by the following crops in the year before soybean: corn (Zea mays L. intercropped with Brachiaria (Urochloa brizantha cv. Marandu, B. decumbens cv. Basilisk, B. ruziziensis, cv. comum., Panicummaximum cv. Tanzânia, sunn hemp (Crotalaria juncea L., pigeon pea [Cajanus cajan (L. Millsp]; sole corn, forage sorghum [Sorghum bicolor (L. Moench (cv. Santa Elisa], and ruzi grass. In March 2005, corn and forage species were planted in alternate rows spaced 0.90 m apart, and sole forage species were planted in rows spaced 0.45 m apart. In October 2005, the forages were killed with glyphosate and soybean was planted. After the soybean harvest in March 2006, sole late-season corn was planted in the entire experimental area. Corn grain and stover yields were unaffected by intercropping. Above-ground crop residue was greater when corn was intercropped with Tanzania grass (10.7 Mg ha-1, Marandu (10.1 Mg ha-1, and Ruzi Grass (9.8 Mg ha-1 than when corn was not intercropped (4.0 Mg ha-1. The intercropped treatments increased the percentage of soil surface covered with crop residue. Soybean and corn grain yields were higher after sole ruzi grass and intercropped ruzi grass than after other crops. The intercropping corn with Brachiaria spp. and corn with Panicum spp. increases above-ground crop residue production and maintains nutrients in the soil without reducing late-season corn yield and the viability of no-till in the midwestern region of Brazil.A viabilidade do plantio direto no Cerrado brasileiro depende da produção adequada de palha das culturas, que pode ser aumentada pela consorciação de milho (Zea mays L
Sweet eating: a definition and the development of the Dutch Sweet Eating Questionnaire.
van den Heuvel, Margot; Hörchner, Rogier; Wijtsma, Anneke; Bourhim, Noufissa; Willemsen, Dascha; Mathus-Vliegen, Elisabeth M H
2011-06-01
Previous studies have suggested that patients who are defined as so-called sweet eaters have more difficulties to lose weight and to maintain weight loss after both conservative treatment and restrictive bariatric surgery, such as gastric banding. There is, however, no agreement on the definition of sweet eating. Also, a questionnaire to measure sweet eating is not available. Therefore, the aim of our study was to agree on a definition of sweet eating and to construct a valid and reliable questionnaire that might be of help to assess the influence of sweet eating on weight loss after bariatric surgery. A Delphi Study design was chosen to define sweet eating. Based on the Delphi rounds, a questionnaire with self-reported sweets intake was constructed and validated. Nine experts with different scientific backgrounds participated in the Delphi Study which consisted of four rounds. They finally agreed on the definition that sweet eating can be defined as an eating behavior in which at least 50% of daily consumed carbohydrates consist of simple carbohydrates and which can be triggered by emotional factors (i.e., stress). They did not include the intake of artificial sweeteners in the definition. The Dutch Sweet Eating Questionnaire built on the four Delphi rounds was tested in 138 female patients and appeared to be both valid and reliable. A shortcoming of this study is that the results may not be applicable to males and to non-Western populations. The definition and the questionnaire may be useful in future research regarding sweet eating and bariatric surgery outcomes in morbidly obese patients.
Modeling Long Term Corn Yield Response to Nitrogen Rate and Crop Rotation
Directory of Open Access Journals (Sweden)
Laila Alejandra Puntel
2016-11-01
Full Text Available Improved prediction of optimal N fertilizer rates for corn (Zea mays L. can reduce N losses and increase profits. We tested the ability of the Agricultural Production Systems sIMulator (APSIM to simulate corn and soybean (Glycine max L. yields, the economic optimum N rate (EONR using a 16-year field-experiment dataset from central Iowa, USA that included two crop sequences (continuous corn and soybean-corn and five N fertilizer rates (0, 67, 134, 201, and 268 kg N ha-1 applied to corn. Our objectives were to: a quantify model prediction accuracy before and after calibration, and report calibration steps; b compare crop model-based techniques in estimating optimal N rate for corn; and c utilize the calibrated model to explain factors causing year to year variability in yield and optimal N. Results indicated that the model simultaneously simulated well long-term crop yields response to N (relative root mean square error, RRMSE of 19.6% before and 12.3% after calibration, which provided strong evidence that important soil and crop processes were accounted for in the model. The prediction of EONR was more complex and had greater uncertainty than the prediction of crop yield (RRMSE of 44.5% before and 36.6% after calibration. For long-term site mean EONR predictions, both calibrated and uncalibrated versions can be used as the 16-yr mean differences in EONR’s were within the historical N rate error range (40 to 50 kg N ha-1. However, for accurate year-by-year simulation of EONR the calibrated version should be used. Model analysis revealed that higher EONR values in years with above normal spring precipitation were caused by an exponential increase in N loss (denitrification and leaching with precipitation. We concluded that long term experimental data were valuable in testing and refining APSIM predictions. The model can be used as a tool to assist N management guidelines in the US Midwest and we identified five avenues on how the model can add
Modeling Long-Term Corn Yield Response to Nitrogen Rate and Crop Rotation.
Puntel, Laila A; Sawyer, John E; Barker, Daniel W; Dietzel, Ranae; Poffenbarger, Hanna; Castellano, Michael J; Moore, Kenneth J; Thorburn, Peter; Archontoulis, Sotirios V
2016-01-01
Improved prediction of optimal N fertilizer rates for corn ( Zea mays L. ) can reduce N losses and increase profits. We tested the ability of the Agricultural Production Systems sIMulator (APSIM) to simulate corn and soybean ( Glycine max L. ) yields, the economic optimum N rate (EONR) using a 16-year field-experiment dataset from central Iowa, USA that included two crop sequences (continuous corn and soybean-corn) and five N fertilizer rates (0, 67, 134, 201, and 268 kg N ha -1 ) applied to corn. Our objectives were to: (a) quantify model prediction accuracy before and after calibration, and report calibration steps; (b) compare crop model-based techniques in estimating optimal N rate for corn; and (c) utilize the calibrated model to explain factors causing year to year variability in yield and optimal N. Results indicated that the model simulated well long-term crop yields response to N (relative root mean square error, RRMSE of 19.6% before and 12.3% after calibration), which provided strong evidence that important soil and crop processes were accounted for in the model. The prediction of EONR was more complex and had greater uncertainty than the prediction of crop yield (RRMSE of 44.5% before and 36.6% after calibration). For long-term site mean EONR predictions, both calibrated and uncalibrated versions can be used as the 16-year mean differences in EONR's were within the historical N rate error range (40-50 kg N ha -1 ). However, for accurate year-by-year simulation of EONR the calibrated version should be used. Model analysis revealed that higher EONR values in years with above normal spring precipitation were caused by an exponential increase in N loss (denitrification and leaching) with precipitation. We concluded that long-term experimental data were valuable in testing and refining APSIM predictions. The model can be used as a tool to assist N management guidelines in the US Midwest and we identified five avenues on how the model can add value toward
Energy Technology Data Exchange (ETDEWEB)
Gibbons, W.R.; Westby, C.A.
1989-01-01
In an attempt to reduce the costs associated with fuel ethanol production from grain, sweet sorghum juice was used as a partial or complete replacement for tap-water in mash preparation and fermentation. This juice, which was an unutilized by-product of sweet sorghum silage preservation by the Ag-Bag method, contained 6.5-7.6% (wt/wt) reducing sugar and produced up to 3.51% (v/v) ethanol beers after fermentation. Varying amounts of this juice were mixed with water and corn or wheat, either before or after liquefaction (front-end or back-end loading, respectively). When over 60% juice replacement was used in front-end loading trials, salt buildup, due to required pH adjustments during cooking, inhibited yeast metabolism and thereby reduced yields. This inhibition was not observed during back-end loading trials since acid and base usage during cooking were reduced. (author).
Lundry, Denise R; Burns, J Austin; Nemeth, Margaret A; Riordan, Susan G
2013-02-27
Monsanto Company and Dow AgroSciences LLC have developed the combined-trait corn product MON 89034 × TC1507 × MON 88017 × DAS-59122-7 (SmartStax, a registered trademark of Monsanto Technology LLC). The combination of four biotechnology-derived events into a single corn product (stacking) through conventional breeding provides broad protection against lepidopteran and corn rootworm insect pests as well as tolerance to the glyphosate and glufosinate-ammonium herbicide families. The purpose of the work described here was to assess whether the nutrient, antinutrient, and secondary metabolite levels in grain and forage tissues of the combined-trait product are comparable to those in conventional corn. Compositional analyses were conducted on grain and forage from SmartStax, a near-isogenic conventional corn hybrid (XE6001), and 14 conventional reference hybrids, grown at multiple locations across the United States. No statistically significant differences between SmartStax and conventional corn were observed for the 8 components analyzed in forage and for 46 of the 52 components analyzed in grain. The six significant differences observed in grain components (p corn, as previously demonstrated for the single-event products.
Directory of Open Access Journals (Sweden)
Marleni Limonu1
2008-12-01
Full Text Available The objective of this research was to study the effects of pre-gelatinization and freezing processes on physico-chemical characteristics of young corn kernel instant. The results showed that pre-gelatinization and slow freezing processes significantly affected bulk density, rehidration capacity, hardness and cooking time of young corn kernel instant. The study of water sorption isothermic showed that the product had a sigmoid curve. Based on this curve, shelf life of the product had been calculated. The YCKI waxy, YCKI Flint, and YCKI Sweet products packed in alufo had shelf life of 7.2, 12.1 and 13.8 months respectively.
Sytykiewicz, Hubert; Chrzanowski, Grzegorz; Czerniewicz, Paweł; Sprawka, Iwona; Łukasik, Iwona; Goławska, Sylwia; Sempruch, Cezary
2014-01-01
The purpose of this report was to evaluate the expression patterns of selected glutathione transferase genes (gst1, gst18, gst23 and gst24) in the tissues of two maize (Zea mays L.) varieties (relatively resistant Ambrozja and susceptible Tasty Sweet) that were colonized with oligophagous bird cherry-oat aphid (Rhopalosiphum padi L.) or monophagous grain aphid (Sitobion avenae L.). Simultaneously, insect-triggered generation of superoxide anion radicals (O2•-) in infested Z. mays plants was monitored. Quantified parameters were measured at 1, 2, 4, 8, 24, 48 and 72 h post-initial aphid infestation (hpi) in relation to the non-infested control seedlings. Significant increases in gst transcript amounts were recorded in aphid-stressed plants in comparison to the control seedlings. Maximal enhancement in the expression of the gst genes in aphid-attacked maize plants was found at 8 hpi (gst23) or 24 hpi (gst1, gst18 and gst24) compared to the control. Investigated Z. mays cultivars formed excessive superoxide anion radicals in response to insect treatments, and the highest overproduction of O2•- was noted 4 or 8 h after infestation, depending on the aphid treatment and maize genotype. Importantly, the Ambrozja variety could be characterized as having more profound increments in the levels of gst transcript abundance and O2•- generation in comparison with the Tasty Sweet genotype.
Leung, Shuk-kwan S.; Lo, Jane-Jane
2010-01-01
This article features Sweet play math, a "math by the month" activity that involves decorating and making sugar cubes. Teachers may want to substitute straws, paper squares, alphabet blocks, or such commercially made manipulatives as Unifix[R] cubes for the real sweets. Given no allergy concerns, teachers and students alike would enjoy some sweet…
Shirley, Britt M.; Wooldridge, Barbara Ross; Camp, Kerri M.
2012-01-01
Jen Harrington is the owner and pastry chef of Sweet Conclusion, a bakery in Tampa, Florida. Most of Harrington's business comes from baking wedding cakes, but she has been attempting to attract customers to her retail bakery, where she sells cupcakes, pies, ice cream, and coffee. Nearly four years she opened Sweet Conclusion, the retail part of…
Directory of Open Access Journals (Sweden)
Brunson Dominque
2013-01-01
Full Text Available Currently, corn is used to produce more than 85% of the world’s high fructose syrup (HFS. There is a search for alternative HFS substrates because of increased food demand and shrinking economies, especially in the developing world. The sweet potato is a feasible, alternative raw material. This study isomerized a high glucose sweet potato starch syrup (SPSS and determined its sugar profile, mineral content, and rheological and thermal properties. Rheological and thermal properties were measured using a rheometer and DSC, respectively. Sweet potato starch was hydrolyzed to syrup with a mean fructose content of 7.6±0.4%. The SPSS had significantly higher (P<0.05 mineral content when compared to commercial ginger and pancake syrups. During 70 days of storage, the SPSS acted as a non-Newtonian, shear-thinning liquid in which the viscosity decreased as shear stress increased. Water loss temperature of the SPSS continually decreased during storage, while pancake and ginger syrups’ peak water loss temperature decreased initially and then increased. Further and more detailed studies should be designed to further enhance the fructose content of the syrup and observe its stability beyond 70 days. The SPSS has the potential to be used in human food systems in space and on Earth.
A Study on the Effects of Pulp and Paper Industry Sludge on Sweet Corn Crops Grown in Containers
Directory of Open Access Journals (Sweden)
Daniela Krasteva – Malinova
2014-06-01
Full Text Available Sludge which are produced from waste-water treatment facilities represent a serious environmental problem in terms of their storage. However, they also represent an organic reserve, biomass rich in macro and micronutrients for soils. Thus, sludge could be used to recover the balance of organic matter in soils. We aimed in the present study to determine the influence of sludge produced from a pulp factory on the development of mays (Zea mays in laboratory conditions.
Kaya, Yusuf; Aksakal, Ozkan; Sunar, Serap; Erturk, Filiz Aygun; Bozari, Sedat; Agar, Guleray; Erez, Mehmet Emre; Battal, Peyami
2015-03-01
Laboratory experiments were performed to determine phytotoxic potentials of white top (Lepidium draba) methanol extracts (root, stem and leaf) on germination and early growth of corn (Zea mays) and redroot pigweed (Amaranthus retroflexus). Furthermore, the effects of different methanol extracts of L. draba on the phytohormone (indole-3-acetic acid (IAA), gibberellic acid (GA), abscisic acid (ABA) and zeatin) levels of corn and redroot pigweed were investigated. It was observed that all concentrations of methanol extracts of root, stem and leaf of L. draba inhibited germination, radicle and plumule elongation when compared with the respective controls. Besides this, the degree of inhibition was increased in concert with increasing concentrations of extracts used. On the other hand, phytohormone levels changed with the application of different extract concentrations. Comparing with the control, the GA levels significantly decreased while the ABA levels increased in all the application groups. Zeatin and IAA levels showed changes depending upon the applied extracts and concentrations. © The Author(s) 2012.
Johnson, Eric T; Berhow, Mark A; Dowd, Patrick F
2007-04-18
Hi II maize (Zea mays) plants were engineered to express maize p1 cDNA, a Myb transcription factor, controlled by a putative silk specific promoter, for secondary metabolite production and corn earworm resistance. Transgene expression did not enhance silk color, but about half of the transformed plant silks displayed browning when cut, which indicated the presence of p1-produced secondary metabolites. Levels of maysin, a secondary metabolite with insect toxicity, were highest in newly emerged browning silks. The insect resistance of transgenic silks was also highest at emergence, regardless of maysin levels, which suggests that other unidentified p1-induced molecules likely contributed to larval mortality. Mean survivor weights of corn earworm larvae fed mature browning transgenic silks were significantly lower than weights of those fed mature nonbrowning transgenic silks. Some transgenic pericarps browned with drying and contained similar molecules found in pericarps expressing a dominant p1 allele, suggesting that the promoter may not be silk-specific.
Ren, Li-Li; Hardy, Giles; Liu, Zhu-Dong; Wei, Wei; Dai, Hua-Guo
2013-06-01
Many studies have reported the effect of nitrogen (N) fertilization on plant constitutive defense responses; however, little is known about their effects on plant induced defense patterns and its consequence for insect herbivores. In our experiments, the effects of N availability on growth, nutritional quality (N content, protein/carbohydrate [P:C] ratio, modified gross energy [MGE]), and constitutive phenolics of corn, Zea mays L. were quantified. Moreover, the indirect effects of N fertilization on the beet armyworm, Spodoptera exigua Hübner through larval performance and feeding preference were examined. N fertilization increased plant growth, and depressed defense traits by increasing N content and the P:C ratio, as well as decreasing the constitutive concentration of phenolics. Subsequently, beet armyworm showed higher performance and preferentially fed on high-N corn because of its low defense traits. After beet armyworm feeding, high-N corn significantly deterred larval feeding, and had negative effects on the performance of beet armyworm through decreasing P:C ratio and increasing induced phenolics. On the contrary, there were no significant changes in P:C ratio and phenolics in low-N corn after feeding damage. Larval performance and preference were also not affected by induced compounds in low-N corn, which suggested that the expression of induced defense was dependent on N availability. The result indicates that N availability can exert a variety of bottom-up effect on plant defense patterns to influence insect population dynamics, and thereby may represent a source of variation in plant-insect interactions.
Beckford, R C; Bartlett, J R
2015-06-01
The amount of corn available for animal and poultry feed has been unpredictable in recent years due to the increased use of corn for ethanol production. As a consequence, there has been an increase in the price of feed, chicken, and chicken products. Researchers are exploring alternative feed sources to substitute for corn in poultry ration. This study evaluated the performance and carcass quality of broilers fed diets containing sweet potato root meal (SPRM). After a complete nutrient analysis of the SPRM, diets were formulated where 0, 10, 20, and 30% of corn was substituted with SPRM. The study utilized 360 1-d-old Cornish X Rock male broiler chickens randomly assigned to one of 4 treatments; 0%, 10%, 20%, and 30% SPRM. Body weights and feed intake (FI) were monitored weekly for 7 wk. Birds were slaughtered on d 50 and FI, BW gain, ADG, ADFI, abdominal fat, dressing percentage, and organ weights measured. White (breast) and dark (leg and thigh) meat were evaluated for nutrient content (protein, moisture, fat, and ash). Results showed birds fed 20% SPRM had lower (Pdressing percentage among treatments. Abdominal fat was highest (PPoultry Science Association.
The Potential Research of Catch Crop in Decrease Soil Nitrate Under Greenhouse Vegetable Production
Directory of Open Access Journals (Sweden)
YIN Xing
2015-06-01
Full Text Available In order to clarify the impact of catch crops on greenhouse vegetable soil nitrate, explore the mechanism of barrier and controll soil nitrogen leaching losses in greenhouse, and provide a theoretical basis for control nitrogen leaching and prevention of groundwater pollution, this study selected the traditional greenhouse vegetable rotation system in North China plain as research subjects, using field situ remediation technologies on deep-root planting catch crops in the vegetable fallow period by sweet corn, Achyranthes bidentata and white Chrysanthemum. The results showed that: nitrogen content and nitrogen uptake of sweet corn and sweet corn with Achyranthes bidentata intercropping were the highest, respectively 20.11 t·hm-2, 19.62 t·hm-2 and 240.34 kg·hm-2, 287.56 kg·hm-2, significantly higher than white Chrysanthemum. The density of root length and root dry weight decreased with soil depth in the profiles, root length density was demonstrated in order as: intercropping sweet corn> sweet corn> white Chrysanthemum> intercropping Achyranthes bidentata blume. The reduction of NO3--N of sweet corn reached 907.87 kg·hm-2 in soil profile 0~200 cm, significantly higher than sweet corn and hyssop intercropping and white Chrysanthemums. In the interim period of vegetable crop rotation, planting catch crops could effectively reduce nitrate accumulation in the soil, control the soil profile nitrate leaching down.
Directory of Open Access Journals (Sweden)
Wagner dos Reis
2013-03-01
Full Text Available The objective of this work was to evaluate the effect of processing two corn hybrids conserved, dry and humid grains, the dry matter (DM and crude protein (CP degradability in situ. The particle size was determined and difference was verified in MGD (Medium Geometric Diameter of processed ingredients. Three sheep were used with rumen canulated, in a completely randomized design, using a factorial outline 2 x 2 x 3, being two corn hybrid, two conservation methods and three processing forms (whole, coarsely and finely ground, with five times of incubation (3, 6, 12, 24 and 48 hours. The fraction A in SDC (silage of dent corn of DM was superior to GDC (grain of dent corn in all of the particles size. The ensiling process increased the DM solubility, reducing the fraction B in comparison to dry grain. The values regarding the fractions DP and DE the 5% per hour of the protein, were larger for SDC and GDC, it presents a decreasing when the incubation time advances. The fermentation rate was superior for SDC and GDC. The ensiling process has positive effect in the decreasing of DM and CP in comparison to GDC.
Giordano, Debora; Beta, Trust; Vanara, Francesca; Blandino, Massimo
2018-05-02
In this study, the influence of nitrogen (N) fertilization (170 versus 300 kg of N/ha) on the content of bioactive compounds of whole-meal flour of 10 different colored corn genotypes was investigated. Considerable differences in antioxidant capacity and phytochemical concentrations were observed among genotypes. Higher N fertilization rates significantly ( p < 0.05) increased the content of both total cell-wall-bound phenolics and xanthophylls (lutein and zeaxanthin). Nevertheless, the main phenolic acids (ferulic, p-coumaric, and sinapic acids) as well as the antioxidant capacity and content of β-cryptoxanthin, β-carotene, and total anthocyanins did not show significant differences as far as the N fertilization rate is concerned. For corn cultivation, the application of high N fertilization rates, generally carried out to obtain higher grain yields, could positively influence the content of some bioactives particularly in years characterized by high rainfall levels responsible for N leaching from the soil.
Zea mays L. extracts modify glomerular function and potassium urinary excretion in conscious rats.
Velazquez, D V O; Xavier, H S; Batista, J E M; de Castro-Chaves, C
2005-05-01
Diuretic and uricosuric properties have traditionally been attributed to corn silk, stigma/style of Zea mays L. Although the diuretic effect was confirmed, studies of the plant's effects on renal function or solute excretion were lacking. Thus, we studied the effects of corn silk aqueous extract on the urinary excretion of water, Na+, K+, and uric acid. Glomerular and proximal tubular function and Na+ tubular handling were also studied. Conscious, unrestrained adult male rats were housed in individual metabolic cages (IMC) with continuous urine collection for 5 and 3 h, following two protocols. The effects of 25, 50, 200, 350, and 500 mg/kg body wt. corn silk extract on urine volume plus Na+ and K+ excretions were studied in water-loaded conscious rats (2.5 ml/100 g body wt.) in the IMC for 5 h (Protocol 1). Kaliuresis was observed with doses of 350 (100.42 +/- 22.32-120.28 +/- 19.70 microEq/5 h/100 g body wt.; n = 13) and 500 mg/kg body wt. (94.97+/- 29.30-134.32 +/- 39.98 microEq/5h/100 g body wt.; n = 12; pcorn silk extract on urine volume, Na+, K+ and uric acid excretions, and glomerular and proximal tubular function, were measured respectively by creatinine (Cler) and Li+ (ClLi) clearances and Na+ tubular handling, in water-loaded rats (5 ml/100 g body wt.) in the IMC for 3 h (Protocol 2). Clcr (294.6 +/- 73.2, n = 12, to 241.7 +/- 48.0 microl/ min/100 g body wt.; n = 13; pcorn silk aqueous extract is diuretic at a dose of 500 mg/kg body wt. and kaliuretic at doses of 350 and 500 mg/kg body wt. In water-loaded conscious rats (5.0 ml/100 g body wt.), corn silk aqueous extract is kaliuretic at a dose of 500 mg/kg body wt., but glomerular filtration and filtered load decrease without affecting proximal tubular function, Na+, or uric acid excretion.
Directory of Open Access Journals (Sweden)
Issa Piri
2017-12-01
Full Text Available Introduction Intercropping is a multiple cropping agricultural practice involves growing two or more crops in close proximity. Intercropping of compatible plants also encourages biodiversity, by providing a habitat for a variety of insects and soil organisms that would not be present in a monocrop environment. This in turn can help limit outbreaks of crop pests by increasing predator biodiversity. Additionally, reducing the homogeneity of crops increases the barriers against biological dispersal of pests through the crops. Cereal–legume intercropping plays an important role in subsistence food production in developing countries, especially in the situations of limited resources. Nitrogen fixing legumes can be included to a greater extent in arable cropping systems via intercrops. Legumes contribute to maintaining the soil fertility via nitrogen fixation, which is increased in intercrops due to the more competitive character of the cereal for soil inorganic N. Ariel et al., (2013 showed that,Legume-Cereal Intercropping of corn and soybean may be advantageous compared to monocultures. Corn and soybean intercropping produce high yields of green matter and seed concentrates especially when the corn-soybean ratio is 1:2. Due to the importance of cereal–legume intercropping in the sustainability of agricultural systems, the objective of this study was to determine the effects of cereal-legume intercropping on the total biomass and grain yield and to find the best pattern of additive and replacement intercropping systems in Iranshahr Region. Material and Methods In order to study the agronomical and ecological parameters of additive and replacement intercropping systems of corn and soybean, a field experiment was conducted in 2012-13 in the south of Iranshahr city on a randomized complete block design with three replications. Treatments consisted of 8 different intercropping ratios: corn monoculture (C100S0 and soybean monoculture (C0S100 as sole
Sytykiewicz, Hubert
2016-02-23
Reduced forms of ascorbate (AsA) and glutathione (GSH) are among the most important non-enzymatic foliar antioxidants in maize (Zea mays L.). The survey was aimed to evaluate impact of bird cherry-oat aphid (Rhopalosiphum padi L.) or grain aphid (Sitobion avenae F.) herbivory on expression of genes related to ascorbate-glutathione (AsA-GSH) cycle in seedlings of six maize varieties (Ambrozja, Nana, Tasty Sweet, Touran, Waza, Złota Karłowa), differing in resistance to the cereal aphids. Relative expression of sixteen maize genes encoding isoenzymes of ascorbate peroxidase (APX1, APX2, APX3, APX4, APX5, APX6, APX7), monodehydroascorbate reductase (MDHAR1, MDHAR2, MDHAR3, MDHAR4), dehydroascorbate reductase (DHAR1, DHAR2, DHAR3) and glutathione reductase (GR1, GR2) was quantified. Furthermore, effect of hemipterans' attack on activity of APX, MDHAR, DHAR and GR enzymes, and the content of reduced and oxidized ascorbate and glutathione in maize plants were assessed. Seedling leaves of more resistant Z. mays varieties responded higher elevations in abundance of target transcripts. In addition, earlier and stronger aphid-triggered changes in activity of APX, MDHAR, DHAR and GR enzymes, and greater modulations in amount of the analyzed antioxidative metabolites were detected in foliar tissues of highly resistant Ambrozja genotype in relation to susceptible Tasty Sweet plants.
Böttger, Rita; Schaller, Jörg; Lintow, Sven; Gert Dudel, E
2015-03-01
The increasing cultivation of genetically modified corn plants (Zea mays) during the last decades is suggested as a potential risk to the environment. One of these genetically modified variety expressed the insecticidal Cry1Ab protein originating from Bacillus thuringiensis (Bt), resulting in resistance against Ostrinia nubilalis, the European corn borer. Transgenic litter material is extensively studied regarding the decomposition in soils. However, only a few field studies analyzed the fate of the Cry1Ab protein and the impact of green and senescent leaf litter from corn on the decomposition rate and related ecosystem functions in aquatic environments. Consequently, a microbial litter decomposition experiment was conducted under controlled semi-natural conditions in batch culture using two maize varieties: one variety with Cry1Ab and another one with the appertaining Iso-line as control treatment. The results showed no significant differences between the treatment with Cry1Ab and the Iso-line regarding loss of total mass in dry weight of 43% for Iso-line and 45% for Bt-corn litter, lignin content increased to 137.5% (Iso-line) and 115.7% (Bt-corn), and phenol loss decreased by 53.6% (Iso-line), 62.2% (Bt-corn) during three weeks of the experiment. At the end of the experiment Cry1Ab protein was still detected with 6% of the initial concentration. A slightly but significant lower cellulose content was found for the Cry1Ab treatment compared to the Iso-line litter at the end of the experiment. The significant higher total protein (25%) and nitrogen (25%) content in Bt corn, most likely due to the additionally expression of the transgenic protein, may increase the microbial cellulose degradation and decrease microbial lignin degradation. In conclusion a relevant year by year input of protein and therefore nitrogen rich Bt corn litter into aquatic environments may affect the balanced nutrient turnover in aquatic ecosystems. Copyright © 2014 Elsevier Inc. All rights
Wheelock, M J; Rey, K P; O'Neal, M E
2016-10-01
Although corn (Zea mays L.) and soybeans (Glycine max L.) do not require pollination, they offer floral resources used by insect pollinators. We asked if a similar community of insect pollinators visits these crops in central Iowa, a landscape dominated by corn and soybean production. We used modified pan traps (i.e., bee bowls) in both corn and soybean fields during anthesis and used nonmetric multidimensional scaling (NMS) to compare the communities found in the two crops. Summed across both crops, 6,704 individual insects were captured representing at least 60 species, morphospecies, or higher-level taxa. Thirty-four species were collected in both crops, 19 collected only in corn and seven were collected only in soybean. The most abundant taxa were Lasioglossum [Dialictus] spp., Agapostemon virescens Cresson, Melissodes bimaculata (Lepeletier), and Toxomerus marginatus (Say), which accounted for 65% of the insect pollinators collected from both crops. Although social bees (Apis mellifera L. and Bombus spp.) were found in both crops, they accounted for only 0.5% of all insects captured. The NMS analysis revealed a shared community of pollinators composed of mostly solitary, ground nesting bees. Many of these species have been found in other crop fields throughout North America. Although corn and soybean are grown in landscapes that are often highly disturbed, these data suggest that a community of pollinators can persist within them. We suggest approaches to conserving this community based on partnering with activities that aim to lessen the environmental impact of annual crop production. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Corn stover harvest increases herbicide movement to subsurface drains: RZWQM simulations
Shipitalo, Martin J.; Malone, Robert W.; Ma, Liwang; Nolan, Bernard T.; Kanwar, Rameshwar S.; Shaner, Dale L.; Pederson, Carl H.
2016-01-01
BACKGROUND Crop residue removal for bioenergy production can alter soil hydrologic properties and the movement of agrochemicals to subsurface drains. The Root Zone Water Quality Model (RZWQM), previously calibrated using measured flow and atrazine concentrations in drainage from a 0.4 ha chisel-tilled plot, was used to investigate effects of 50 and 100% corn (Zea mays L.) stover harvest and the accompanying reductions in soil crust hydraulic conductivity and total macroporosity on transport of atrazine, metolachlor, and metolachlor oxanilic acid (OXA). RESULTS The model accurately simulated field-measured metolachlor transport in drainage. A 3-yr simulation indicated that 50% residue removal decreased subsurface drainage by 31% and increased atrazine and metolachlor transport in drainage 4 to 5-fold when surface crust conductivity and macroporosity were reduced by 25%. Based on its measured sorption coefficient, ~ 2-fold reductions in OXA losses were simulated with residue removal. CONCLUSION RZWQM indicated that if corn stover harvest reduces crust conductivity and soil macroporosity, losses of atrazine and metolachlor in subsurface drainage will increase due to reduced sorption related to more water moving through fewer macropores. Losses of the metolachlor degradation product OXA will decrease due to the more rapid movement of the parent compound into the soil.
Uronide Deposition Rates in the Primary Root of Zea mays1
Silk, Wendy Kuhn; Walker, Robert C.; Labavitch, John
1984-01-01
The spatial distribution of the rate of deposition of uronic acids in the elongation zone of Zea mays L. Crow WF9 × Mo 17 was determined using the continuity equation with experimentally determined values for uronide density and growth velocity. In spatial terms, the uronide deposition rate has a maximum of 0.4 micrograms per millimeter per hour at s = 3.5 mm (i.e., at the location 3.5 mm from the root tip) and decreases to 0.1 mg mm−1 h−1 by s = 10 mm. In terms of a material tissue element, a tissue segment located initially from s = 2.0 to s = 2.1 mm has 0.14 μg of uronic acids and increases in both length and uronic acid content until it is 0.9 mm long and has 0.7 μg of uronide when its center is at s = 10 mm. Simulations of radioactive labeling experiments show that 15 min is the appropriate time scale for pulse determinations of deposition rate profiles in a rapidly growing corn root. PMID:16663488
Genetics of sweet taste preferences†
Bachmanov, Alexander A; Bosak, Natalia P; Floriano, Wely B; Inoue, Masashi; Li, Xia; Lin, Cailu; Murovets, Vladimir O; Reed, Danielle R; Zolotarev, Vasily A; Beauchamp, Gary K
2011-01-01
Sweet taste is a powerful factor influencing food acceptance. There is considerable variation in sweet taste perception and preferences within and among species. Although learning and homeostatic mechanisms contribute to this variation in sweet taste, much of it is genetically determined. Recent studies have shown that variation in the T1R genes contributes to within- and between-species differences in sweet taste. In addition, our ongoing studies using the mouse model demonstrate that a sign...
Use of natural enemies and biorational pest control of corne
Directory of Open Access Journals (Sweden)
Cipriano García Gutiérrez
2012-09-01
Full Text Available A general analysis of the potential use of natural enemies and biorational insecticides for control of main pests of corn in thestate of Sinaloa is presented. A discuss on their composition, dosage, toxicity and type of effect on beneficial organisms(natural enemies and pollinators is too included. The work revealed that is possible implement the use of these natural enemies and products for the control of neonate larvae of Spodoptera frugiperda fall armyworm (J. E Smith with Nomuraea rileyi (Farlow (Samson; against thrips Frankliniella occidentalis (Pergande using the nematodes Steinernema riobravis (Cabanillas and Poinar, S. feltiae (Filipjev and Heterorhabditis bacteriophora (Poinar at doses of 10,000 IJ (4x10 ~ IJ/m; against the corn silk fly Euxesta stigmatias (Loew encouraging the natural parasitism of Spalangia sp., while for the cutworm Agrotis ipsilon (Hufnagel can be with spinosad (soluble concentrate at doses of 0.123 kg a. i, and to the corn earwormHelicoverpa zea (Boddie using the analog of methoxyfenozide molting hormone (24% at 144 mg of a. i/L. The biorational control agents that not affect significantly to the natural enemies were the nucleopoliedrosis virus SfMNPV and SeMNPV; N. rileyi and Isaria fumosorosea (Wize; Bacillus thuringiensis (Berlinier; the azadirachtin (neem and parasitoids. In the case of products of chemical synthesis: Spinosad, oxymatrine and bifenthrin showed high rates of mortality in the control of corn pests, so these are considered as of high and moderate risk to Aphis mellifera (L. bees, the methoxyfenozide presented relatively low toxicity to natural enemies. In general, biorational products have repellent effect on larvae and adults of these insects, inhibit feeding and induce molting, also causing deformities and impede the development and growth, too interfere with sexual intercourse and copulate, reducing the oviposition, as well as cause sterility of adults, so these may also constitute a risk to
Paula-Moraes, S; Hunt, T E; Wright, R J; Hein, G L; Blankenship, E E
2013-06-01
Western bean cutworm, Striacosta albicosta (Smith) (Lepidoptera: Noctuidae), is a native pest of dry beans (Phaseolus vulgaris L.) and corn (Zea mays L.). Historically, the western bean cutworm was distributed in the western United States, but since 1999 eastward expansion has been observed. In corn, economic impact is caused by larval ear feeding. Information on western bean cutworm biology, ecology, and economic impact is relatively limited, and the development of economic injury levels (EILs) and economic thresholds (ETs) is required for more effective management. Studies during 2008-2011, across three ecoregions of Nebraska, sought to characterize western bean cutworm survival and development of EILs and ETs. Calculations of EILs and ETs incorporated the dynamics of corn price, management cost, and pest survival. The results from the current study demonstrated low larval survival of this species (1.51-12.82%). The mean yield loss from one western bean cutworm larva per plant was 945.52 kg/ha (15.08 bu/acre), based on 74,100 plants per ha. Economic thresholds are expressed as a percentage of plants with at least one egg mass. This study is the first study that explicitly incorporates variable management costs and crop values into western bean cutworm EIL calculations, and larval survival into ET calculations.
Corn rootworm area-wide management across the United States
International Nuclear Information System (INIS)
Chandler, Laurence D.; Coppedge, James R.; Richard Edwards, C.; Tollefson, Jon J.; Wilde, Gerald E.
2000-01-01
The western corn rootworm, Diabrotica virgifera virgifera LeConte, northern corn rootworm, D. barberi Smith and Lawrence, and Mexican corn rootworm, D. virgifera zeae Krysan and Smith are among the most economically and environmentally important pests of United States maize (Zea mays L.) production systems (Metcalf 1986). Annually, 8 to 10 million hectares of maize are treated with soil applied insecticides to protect the crop from larval feeding damage. Crop rotation, however, is also widely used to minimise the need for soil insecticide applications. Insecticides for adult rootworm management are also frequently used. Numerous problems are currently associated with corn rootworm management approaches. Soil insecticides are normally used to protect maize roots from larval feeding damage. However, they are ineffective in controlling the management of corn rootworm populations (Gray et al. 1992, Sutter et al. 1991). It is not uncommon for large numbers of rootworms to develop within treated fields. Thus, when maize is grown in the same field year after year (continuous cropping), soil insecticide applications must be used to protect the plant. These applications are generally made without knowledge (prophylactic) of the rootworm population levels within the field due to the difficulty of sampling for immature life stages. Western corn rootworm resistance to chlorinated hydrocarbon insecticides has been extensively documented (Ball and Weekman 1962). Recently, two distinct populations of western corn rootworms in Nebraska were found to be resistant to carbaryl and methyl parathion which are commonly used for adult control (Meinke et al. 1998). Although the occurrence of resistance has not spread outside of these areas, the potential for increased tolerance of western corn rootworm populations to carbamate and organophosphate insecticides across the region does exist. In response to many of the management problems discussed above, scientists with the USDA Agricultural
International Nuclear Information System (INIS)
Milhomme, H.; Bastide, J.
1990-01-01
Growth of Zea mays L. cv Potro roots was inhibited by the herbicide metsulfuron methyl (MSM) at the lowest concentration tested: 5 nanomoles per liter. Pretreatment of corn seeds with commercial 1,8-naphthalic anhydride (NA) at 1% (w/w) partially reversed MSM-induced root growth inhibition. MSM at a concentration of 52 nanomoles per liter was taken up rapidly by roots and accumulated in the corn tissue to concentrations three times those in the external medium; the safener NA increased MSM uptake up to 48 hours. The protective effect of NA was related to the ability of the safener to increase the metabolism of MSM; ten-fold increases in the metabolic rates of MSM were observed in NA-pretreated corn seedlings grown for 48 hours on 52 nanomolar [ 14 C]MSM solution. DNA synthesis determined by measurement of [ 3 H]thymidine incorporation into DNA was inhibited by root MSM applications; after a 6-hour application period, 13 nanomolar MSM solution reduced DNA synthesis by 64%, and the same reduction was also observed with NA-treated seedlings. Pretreatment of corn seeds with safener NA did not increase the acetolactate synthase activity in the roots and did not change, up to 13 micromoles per liter, the in vitro sensitivity of roots to MSM
International Nuclear Information System (INIS)
Ibrikci, H.; Ulger, A.C.; Buyuk, G.; Korkmaz, K.; Ryan, J.; Karnez, E.; Cakir, B.; Konuskan, O.
2012-01-01
Efficient nitrogen (N) fertilizer management in crop production is based on supplying adequate amounts of the nutrient for optimum economic yield, while minimizing losses to the environment. Exploiting genotypic differences in N use is an additional consideration in achieving nutrient-use efficiency. Thus, in order to identify N-efficient corn genotypes, we established N-response field trials at 2 locations (University Research Farm, and Cutaem) for 2 years (1999, 2000) in the Cukurova region of Turkey. Ten corn genotypes, commonly grown in the region, were fertilized with N at application rates of 160, 240, 320 and 400kg N ha/sup -1/. The optimum N fertilizer rate was probably in the 160-240 kg N ha/sup -1/ rate based on response data. There were no significant or consistent differences between genotypes and N application for grain yield and N uptake. The average agronomic efficiency ranged between 20 to 65% across the genotypes and decreased with increasing N application rates. The pattern was similar for other efficiency indices with decreases with applied N, but little or no genotype differences. It is apparent that the genotypes used were bred for N as well as yield. There was little evidence of differences between genotypes or their response to N. Thus, while genotypic selection of corn can be one of the suitable potential N management practices in the Mediterranean region where genetic diversity exists, it is not appropriate considering genotypes are homogenous with respect to N use. (author)
Directory of Open Access Journals (Sweden)
N. Najafi
2016-01-01
Full Text Available Soil compaction is one of the most important limiting factor for normal crop growth, because it reduces absorption by the plant. Application of organic fertilizers in agricultural soils can reduce the detrimental effects of soil compaction on plant growth and also supply some nutrients to plant. Thus, a factorial experiment was carried out in a randomized complete block design with three replications and 14 treatments to evaluate the effects of organic fertilizers in mitigating soil compaction. The first factor in this study was the source and amount of organic fertilizer at seven levels (control, farmyard manure, sewage sludge compost and municipal solid waste compost and each of organic fertilizers at two levels of 15 and 30 g/kg of soil. The second factor was soil compaction at two levels (bulk density of 1.2 and 1.7 g/cm3. To perform this experiment, 10 kg of dry soil was poured into special PVC pots and then seeds of single cross 704 corn were planted. At the end of the growth period, the corn shoot was harvested and concentrations of phosphorus (P, potassium (K, sodium (Na, iron (Fe, zinc (Zn, manganese (Mn, cadmium (Cd and lead (Pb were determined by dry ashing method. The results showed that concentrations of Cd and Pb in the shoot, related to the different treatments, were negligible. Concentrations of P, K, Fe, Mn and Zn in the corn shoot were increased significantly by application of farmyard manure, sewage sludge compost and municipal solid waste compost at both levels of soil compaction. However, Na concentration of shoot did not change significantly. Soil compaction significantly reduced P, Fe, Mn and Zn concentrations of corn shoot, but it affected concentrations of Na and K significantly. Application of organic fertilizers and increasing their levels reduced the negative effects of soil compaction on nutrients uptake by corn plant. This study showed that to improve forage corn nutrition, application of 15 or 30 g of farmyard
Sytykiewicz, Hubert; Chrzanowski, Grzegorz; Czerniewicz, Paweł; Sprawka, Iwona; Łukasik, Iwona; Goławska, Sylwia; Sempruch, Cezary
2014-01-01
The purpose of this report was to evaluate the expression patterns of selected glutathione transferase genes (gst1, gst18, gst23 and gst24) in the tissues of two maize (Zea mays L.) varieties (relatively resistant Ambrozja and susceptible Tasty Sweet) that were colonized with oligophagous bird cherry-oat aphid (Rhopalosiphum padi L.) or monophagous grain aphid (Sitobion avenae L.). Simultaneously, insect-triggered generation of superoxide anion radicals (O2 •−) in infested Z. mays plants was monitored. Quantified parameters were measured at 1, 2, 4, 8, 24, 48 and 72 h post-initial aphid infestation (hpi) in relation to the non-infested control seedlings. Significant increases in gst transcript amounts were recorded in aphid-stressed plants in comparison to the control seedlings. Maximal enhancement in the expression of the gst genes in aphid-attacked maize plants was found at 8 hpi (gst23) or 24 hpi (gst1, gst18 and gst24) compared to the control. Investigated Z. mays cultivars formed excessive superoxide anion radicals in response to insect treatments, and the highest overproduction of O2 •− was noted 4 or 8 h after infestation, depending on the aphid treatment and maize genotype. Importantly, the Ambrozja variety could be characterized as having more profound increments in the levels of gst transcript abundance and O2 •− generation in comparison with the Tasty Sweet genotype. PMID:25365518
Directory of Open Access Journals (Sweden)
Azizollaah Zargaraan
2016-10-01
Full Text Available High fructose corn syrup (HFCS is commonly found in soft drinks and juice beverages, as well as in many pre-packaged foods such as breakfast cereals, baked goods and dairy desserts. Historically, sucrose (table sugar was primarily added to processed foods and beverages as the sweetening agent. In recent years, the use of HFCS has significantly increased in popularity due to its sweetness, ability to enhance flavor and shelf life, and its low cost. HFCF made by enzymatic isomerization of glucose to fructose was introduced as HFCS-42 (42% fructose and HFCS-55 (55% fructose and opened a new frontier for the sweetener and soft drink industries. Using a glucose isomerase, the starch in corn can be efficiently converted into glucose and then to various amounts of fructose. Hydrolysis of sucrose produces a 50:50 molar mixture of fructose and glucose. The primary difference is that these monosaccharides exist free in solution in HFCS, but in sucrose bonded together. The disaccharide sucrose is easily cleaved in the small intestine, so free fructose and glucose are absorbed from both sucrose and HFCS. The advantage to food manufacturers is that the free monosaccharide in HFCS provides better flavor enhancement, stability, freshness, texture, color, pourability, and consistency in foods in comparison to sucrose. The development of these inexpensive, sweet corn-based syrups made it profitable to replace sucrose (sugar and simple sugars with HFCS in our diet. In the present study, the replacement of sucrose with HFCS and its effect on the functionality and organoleptic properties of different food products were reviewed.
Pérez, Isela Carballo; Mu, Tai-Hua; Zhang, Miao; Ji, Lei-Lei
2017-12-01
The effect of heat treatment at 90, 100, 110 and 120 ℃ for 20 min to sweet potato flour on dough properties and characteristics of sweet potato-wheat bread was investigated. The lightness (L*) and a* of sweet potato flour samples after heat treatment were increased, while the b* were decreased significantly, as well as the particle size, volume and area mean diameter ( p sweet potato flour was observed, where the number of irregular granules increased as the temperature increased from 90 to 120 ℃. Compared with sweet potato flour samples without heat treatment and with heat treatment at 90, 100 and 120 ℃, the gelatinization temperature and enthalpy change of sweet potato flour at 110 ℃ were the lowest, which were 77.94 ℃ and 3.67 J/g, respectively ( p sweet potato flour increased significantly from 1199 ml without heat treatment to 1214 ml at 90 ℃ ( p sweet potato-wheat bread with sweet potato flour after heat treatment increased significantly, which was the largest at 90 ℃ (2.53 cm 3 /g) ( p sweet potato flour could be potentially used in wheat bread production.
Simanjuntak, Desi
2017-01-01
This study was to know the effect of eggshell flour and manure in increasing soil pH, P- availability and Ca of inceptisol with P-absorption and Ca-absorption of corn (Zea mays L.). The research had been conducted from march to september 2015 at screen hoise faculty of agriculture,USU. The experimental design used was Randomized Block Design with 2 factors and 2 replications. The first factor was dosage of manure 0, 18,75, 37,5 and 56,25g /5 Kg soil and the second factor was dosage of chic...
Mayhew, Emily; Schmidt, Shelly; Lee, Soo-Yeun
2016-07-01
In a novel approach to formulation, the flash descriptive profiling technique Napping-Ultra Flash Profile (Napping-UFP) was used to characterize a wide range of commercial caramel corn products. The objectives were to identify product categories, develop model systems based on product categories, and correlate analytical parameters with sensory terms generated through the Napping-UFP exercise. In one 2 h session, 12 panelists participated in 4 Napping-UFP exercises, describing and grouping, on a 43×56 cm paper sheet, 12 commercial caramel corn samples by degree of similarity, globally and in terms of aroma-by-mouth, texture, and taste. The coordinates of each sample's placement on the paper sheet and descriptive terms generated by the panelists were used to conduct Multiple Factor Analysis (MFA) and hierarchical clustering of the samples. Strong trends in the clustering of samples across the 4 Napping-UFP exercises resulted in the determination of 3 overarching types of commercial caramel corn: "small-scale dark" (typified by burnt, rich caramel corn), "large-scale light" (typified by light and buttery caramel corn), and "large-scale dark" (typified by sweet and molasses-like caramel corn). Representative samples that best exemplified the properties of each category were used as guides in the formulation of 3 model systems that represent the spread of commercial caramel corn products. Analytical testing of the commercial products, including aw measurement, moisture content determination, and thermal characterization via differential scanning calorimetry, were conducted and results related to sensory descriptors using Spearman's correlation. © 2016 Institute of Food Technologists®
Wagner dos Reis; Ciniro Costa; Paulo Roberto de Lima Meirelles; Marina Gabriela Berchiol da Silva; Marco Aurélio Factori; Janaína Conte Hadlich; Kátia de Oliveira; Erikelly Aline Ribeiro de Santana; Cristiano Magalhães Pariz; Josineudson Augusto II de Vasconcelos Silva
2013-01-01
The objective of this work was to evaluate the effect of processing two corn hybrids conserved, dry and humid grains, the dry matter (DM) and crude protein (CP) degradability in situ. The particle size was determined and difference was verified in MGD (Medium Geometric Diameter) of processed ingredients. Three sheep were used with rumen canulated, in a completely randomized design, using a factorial outline 2 x 2 x 3, being two corn hybrid, two conservation methods and three processing forms ...
Drug versus sweet reward: greater attraction to and preference for sweet versus drug cues.
Madsen, Heather B; Ahmed, Serge H
2015-05-01
Despite the unique ability of addictive drugs to directly activate brain reward circuits, recent evidence suggests that drugs induce reinforcing and incentive effects that are comparable to, or even lower than some nondrug rewards. In particular, when rats have a choice between pressing a lever associated with intravenous cocaine or heroin delivery and another lever associated with sweet water delivery, most respond on the latter. This outcome suggests that sweet water is more reinforcing and attractive than either drug. However, this outcome may also be due to the differential ability of sweet versus drug levers to elicit Pavlovian feeding-like conditioned responses that can cause involuntary lever pressing, such as pawing and biting the lever. To test this hypothesis, rats first underwent Pavlovian conditioning to associate one lever with sweet water (0.2% saccharin) and a different lever with intravenous cocaine (0.25 mg) or heroin (0.01 mg). Choice between these two levers was then assessed under two operant choice procedures: one that permitted the expression of Pavlovian-conditioned lever press responses during choice, the other not. During conditioning, Pavlovian-conditioned lever press responses were considerably higher on the sweet lever than on either drug lever, and slightly greater on the heroin lever than on the cocaine lever. Importantly, though these differences in Pavlovian-conditioned behavior predicted subsequent preference for sweet water during choice, they were not required for its expression. Overall, this study confirms that rats prefer the sweet lever because sweet water is more reinforcing and attractive than cocaine or heroin. © 2014 Society for the Study of Addiction.
Inhibition of white light of 86Rb+ absorption in the root apex of corn
International Nuclear Information System (INIS)
McKendree, W.L.; Smith, R.C.
1990-01-01
Measurements of cell lengths made at 0.5 millimeter intervals in median longitudinal sections of the primary roots of corn (Zea mays) were used to construct a growth curve. The region 1.5 to 4.0 millimeters from the apex contained the largest number of elongating cells. Absorption of 86 Rb + was measured using intact, dark-grown corn seedlings. Following uptake and exchange, the terminal 8.0 millimeters of each root was cut into four 2.0 millimeter segments. Maximum 86 Rb + uptake occurred in the region from 0.0 to 4.0 millimeter from the root tip. Washing the intact primary root in fresh 2.0 millimolar CaSO 4 for 2 hours prior to uptake augmented the rate of 86 Rb + uptake in all regions. Illumination with white light during washing caused a reduction of 86 Rb + uptake as compared with controls washing in darkness, and the region of greatest light response was the region of elongation. Removal of the coleoptile prior to washing did not prevent the light inhibition of subsequent 86 Rb + uptake. Removal of the root cap prior to washing in light partially reversed the light-induced inhibition of the washing response
Assessment of the nutritional values of genetically modified wheat, corn, and tomato crops.
Venneria, Eugenia; Fanasca, Simone; Monastra, Giovanni; Finotti, Enrico; Ambra, Roberto; Azzini, Elena; Durazzo, Alessandra; Foddai, Maria Stella; Maiani, Giuseppe
2008-10-08
The genetic modification in fruit and vegetables could lead to changes in metabolic pathways and, therefore, to the variation of the molecular pattern, with particular attention to antioxidant compounds not well-described in the literature. The aim of the present study was to compare the quality composition of transgenic wheat ( Triticum durum L.), corn ( Zea mays L.), and tomato ( Lycopersicum esculentum Mill.) to the nontransgenic control with a similar genetic background. In the first experiment, Ofanto wheat cultivar containing the tobacco rab1 gene and nontransgenic Ofanto were used. The second experiment compared two transgenic lines of corn containing Bacillus thuringiensis "Cry toxin" gene (PR33P67 and Pegaso Bt) to their nontransgenic forms. The third experiment was conducted on transgenic tomato ( Lycopersicum esculentum Mill.) containing the Agrobacterium rhizogenes rolD gene and its nontransgenic control (cv. Tondino). Conventional and genetically modified crops were compared in terms of fatty acids content, unsaponifiable fraction of antioxidants, total phenols, polyphenols, carotenoids, vitamin C, total antioxidant activity, and mineral composition. No significant differences were observed for qualitative traits analyzed in wheat and corn samples. In tomato samples, the total antioxidant activity (TAA), measured by FRAP assay, and the naringenin content showed a lower value in genetically modified organism (GMO) samples (0.35 mmol of Fe (2+) 100 g (-1) and 2.82 mg 100 g (-1), respectively), in comparison to its nontransgenic control (0.41 mmol of Fe (2+) 100 g (-1) and 4.17 mg 100 g (-1), respectively). On the basis of the principle of substantial equivalence, as articulated by the World Health Organization, the Organization for Economic Cooperation and Development, and the United Nations Food and Agriculture Organization, these data support the conclusion that GM events are nutritionally similar to conventional varieties of wheat, corn, and tomato on
Lu, Ping; Lin, Yin-Hua; Yang, Zhong-Qi; Xu, Yan-Peng; Tan, Fei; Jia, Xu-Dong; Wang, Miao; Xu, De-Rong; Wang, Xi-Zhuo
2015-01-01
This study investigated the influence of corn straw application on soil microbial communities and the relationship between such communities and soil properties in black soil. The crop used in this study was maize (Zea mays L.). The five treatments consisted of applying a gradient (50, 100, 150, and 200%) of shattered corn straw residue to the soil. Soil samples were taken from May through September during the 2012 maize growing season. The microbial community structure was determined using phospholipid fatty acid (PLFA) analysis. Our results revealed that the application of corn straw influenced the soil properties and increased the soil organic carbon and total nitrogen. Applying corn straw to fields also influenced the variation in soil microbial biomass and community composition, which is consistent with the variations found in soil total nitrogen (TN) and soil respiration (SR). However, the soil carbon-to-nitrogen ratio had no effect on soil microbial communities. The abundance of PLFAs, TN, and SR was higher in C1.5 than those in other treatments, suggesting that the soil properties and soil microbial community composition were affected positively by the application of corn straw to black soil. A Principal Component Analysis indicated that soil microbial communities were different in the straw decomposition processes. Moreover, the soil microbial communities from C1.5 were significantly different from those of CK (p soil and significant variations in the ratio of monounsaturated-to-branched fatty acids with different straw treatments that correlated with SR (p soil properties and soil microbial communities and that these properties affect these communities. The individual PLFA signatures were sensitive indicators that reflected the changes in the soil environment condition. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
The U2U Corn Growing Degree Day tool: Tracking corn growth across the US Corn Belt
Directory of Open Access Journals (Sweden)
James R. Angel
2017-01-01
Full Text Available The Corn Growing Degree Day (Corn GDD tool is a web-based product that can provide decision support on a variety of issues throughout the entire growing season by integrating current conditions, historical climate data, and projections of Corn GDD through the end of the growing season based on both National Weather Service computer model forecasts and climatology. The Corn GDD tool can help agricultural producers make a variety of important decisions before and during the growing season. This support can include: assessing the risk of early and late frosts and freezes that can cause crop damage; comparing corn hybrid maturity requirements and Corn GDD projections to select seed varieties and plan activities such as spraying; guiding marketing decisions based on historical and projected Corn GDDs when considering forward crop pricing (i.e., futures market. The Corn GDD tool provides decision support for corn producers in the central U.S. corn-producing states. Survey results, web statistics, and user feedback indicate that this tool is being actively used by decision makers.
Calcium-regulated in vivo protein phosphorylation in Zea mays L. root tips
Raghothama, K. G.; Reddy, A. S.; Friedmann, M.; Poovaiah, B. W.
1987-01-01
Calcium dependent protein phosphorylation was studied in corn (Zea mays L.) root tips. Prior to in vivo protein phosphorylation experiments, the effect of calcium, ethyleneglycol-bis-(beta-aminoethyl ether)-N-N' -tetraacetic acid (EGTA) and calcium ionophore (A-23187) on phosphorus uptake was studied. Calcium increased phosphorus uptake, whereas EGTA and A-23187 decreased it. Consequently, phosphorus concentration in the media was adjusted so as to attain similar uptake in different treatments. Phosphoproteins were analyzed by two-dimensional gel electrophoresis. Distinct changes in phosphorylation were observed following altered calcium levels. Calcium depletion in root tips with EGTA and A-23187 decreased protein phosphorylation. However, replenishment of calcium following EGTA and ionophore pretreatment enhanced phosphorylation of proteins. Preloading of the root tips with 32P in the presence of EGTA and A-23187 followed by a ten minute calcium treatment, resulted in increased phosphorylation indicating the involvement of calcium, calcium and calmodulin-dependent kinases. Calmodulin antagonist W-7 was effective in inhibiting calcium-promoted phosphorylation. These studies suggest a physiological role for calcium-dependent phosphorylation in calcium-mediated processes in plants.
African Journals Online (AJOL)
Markus
near Jos, during the 2007 and 2008 planting seasons, to study the productivity of seven (7) hybrid varieties of maize. (Zea maysL.), namely SUWAN-1-Y, 'Kenya Kitali', ACR-9776-2, TZMSR-W, DMESR-Y, ACROSS-98 and TZPBSR-W. The experiments were laid out in a randomized complete block design (RCBD) with three ...
Directory of Open Access Journals (Sweden)
Lúcia Maria Zeoula
2003-06-01
Full Text Available O objetivo do presente estudo foi avaliar cinco híbridos de milho (Zea mays L. Pioneer: superprecoce P32R21, os precoces P30R07, P3041 e P30F33 e o semiprecoce P30F80, quanto à composição química, em diferentes estádios de maturação. O delineamento utilizado foi de blocos ao acaso, com cinco tratamentos e quatro repetições. A colheita das amostras dos híbridos de milho foi adotada estimando-se os cinco estádios de maturação da planta: 30, 34, 38, 42 e 46% de matéria seca (MS. Para cada estádio de maturação, procedeu-se à separação de colmo + bainha, lâmina foliar e do grão para posteriores analises químicas. Da fração grão, foram determinados os teores de nitrogênio total e de amido, nos cinco estádios de maturação. Nas frações de lâmina foliar e colmo + bainha, foram determinados os teores de fibra em detergente ácido (FDA, fibra em detergente neutro (FDN, lignina, nitrogênio insolúvel em detergente ácido (NIDA e nitrogênio total. Para os parâmetros avaliados observou-se diferença entre os híbridos de milho e efeito de dias pós-plantio. Com o avanço do estádio de maturação, observou-se que houve ligeira redução nos teores de proteína bruta (PB e os teores de amido praticamente não variaram no grão. Para a fração lâmina foliar, verificou-se que, com o aumento nos teores de matéria seca da planta, houve queda nos teores de PB e NIDA, ao contrário da fração colmo + bainha, cujos teores aumentaram. Os teores de FDN, FDA e lignina na lâmina foliar aumentaram, porém esses nutrientes na fração colmo + bainha dos híbridos de milho, praticamente, não variaram com o avanço do estádio de maturação.The objective of this study was evaluate, of the chemical composition of five corn (Zea mays L. hybrids Pioneer: P32R21, P30R07, P3041, P30F33 and P30F80, at different maturity stages. The treatments were used in plots of 7 x 8 m in a randomized block design, with four replicates. The samples
Manuwoto, S; Scriber, J M
1985-11-01
The effects of differential leaf water, leaf nitrogen and cyclic hydroxamate (DIMBOA) concentrations in corn seedlings were analyzed for a polyphagous insect, the southern armyworm (Spodoptera eridania Cram.). Six different combinations of nutrients and allelochemicals [DIMBOA = 2,4-dihydroxy-7-methoxy(2H)-benzoxazin-3(4H)-one] were generated using two corn genotypes (WF9 and CI3IA) and three fertility regimes (complete nutrient, Fe-deficient, and N-deficient solutions) in the University Biotron. Poorest larval growth was observed in the low-nitrogen treatments (1.2% and 1.7% leaf N) and was the result of both low consumption rates and high metabolic costs (low efficiency of conversion of digested food, ECD). Fastest growth rates were observed forthe larvae fed leaves from the high-nitrogen treatments (4.6% and 4.4% leaf N). It is noteworthy that these treatments also contained the highest concentration of cyclic hydroxamates, which are generally believed to be the primary defensive chemicals mediating resistance against the European corn borer,Ostrinia nubilalis (Hubner). If these hydroxamates do have any deleterious or costly effects (perhaps accounting for a large portion of metabolic expenditures), the high digestibility of the leaf tissue and the increased consumption rates more than compensate, resulting in rapid growth (growth rate = consumption rate × approximate digestibility × efficiency of conversion of the digested food). These studies illustrate that variation in key nutrients and allelochemicals within a single plant species (Zea mays L.) may have significantly different effects upon various potential leaf-chewing caterpillars, such as these armyworms versus corn borers (which cannot handle the cyclic hydroxamates, even if provided with young nutritious leaf tissues).
Higashi, C H V; Brewbaker, J L; Bressan, A
2013-08-01
Crops that are resistant to pests and pathogens are cost-effective for the management of pests and diseases. A corn (Zea mays L.) breeding program conducted in Hawaii has identified a source of heritable resistance to maize mosaic virus (MMV) (Rhabdoviridae: Nucleorhabdovirus). This resistance is controlled by the gene Mv, which has been shown to have a codominant action. To date, no studies have examined whether the resistance associated with this gene affects only MMV or whether it also affects the insect vector, the corn planthopper Peregrinus maidis (Ashmead) (Hemiptera: Delphacidae). Here, we examined the life history of the corn planthopper and its ability to transmit MMV on near isogenic lines that were homozygous dominant (Mv/Mv), homozygous recessive (mv/mv), or heterozygous (Mv/mv) for the gene. A field trial was also conducted to study the colonization of the corn plants with different genotypes by the planthopper. Although field observations revealed slightly lower densities ofplanthoppers on corn with the genotype Mv/Mv than on the inbreds with the genotype mv/mv and their hybrids with the genotype Mv/mv, laboratory assays showed no effects of the gene on planthopper development, longevity, or fecundity. In the field, the corn lines Mv/Mv had a lower incidence of MMV-infected plants. However, in the greenhouse, the transmission of MMV to corn seedlings did not differ across the near isogenic lines, although the corn lines Mv/Mv showed a delayed onset of symptoms compared with the corn lines mv/mv and Mv/mv. The acquisition of MMV by corn planthoppers on the corn genotypes Mv/Mv and Mv/mv averaged 0.2, whereas the acquisition on the corn genotypes mv/mv averaged > 0.3. Our results show that the Mv gene does not influence the fitness of the planthopper vector, suggesting that it may confer resistance by other means, possibly by limiting virus replication or movement within the host plant.
Gilligan, Todd M; Tembrock, Luke R; Farris, Roxanne E; Barr, Norman B; van der Straten, Marja J; van de Vossenberg, Bart T L H; Metz-Verschure, Eveline
2015-01-01
The Old World bollworm, Helicoverpa armigera (Hübner), and the corn earworm, H. zea (Boddie), are two of the most important agricultural pests in the world. Diagnosing these two species is difficult-adults can only be separated with a complex dissection, and larvae cannot be identified to species using morphology, necessitating the use of geographic origin for identification in most instances. With the discovery of H. armigera in the New World, identification of immature Helicoverpa based on origin is no longer possible because H. zea also occurs in all of the geographic regions where H. armigera has been discovered. DNA barcoding and restriction fragment length polymorphism (RFLP) analyses have been reported in publications to distinguish these species, but these methods both require post-PCR processing (i.e., DNA sequencing or restriction digestion) to complete. We report the first real-time PCR assay to distinguish these pests based on two hydrolysis probes that bind to a segment of the internal transcribed spacer region 2 (ITS2) amplified using a single primer pair. One probe targets H. armigera, the second probe targets H. zea, and a third probe that targets a conserved segment of 18S rDNA is used as a control of DNA quality. The assay can be completed in 50 minutes when using isolated DNA and is successfully tested on larvae intercepted at ports of entry and adults captured during domestic surveys. We demonstrate that the assay can be run in triplex with no negative effects on sensitivity, can be run using alternative real-time PCR reagents and instruments, and does not cross react with other New World Heliothinae.
Directory of Open Access Journals (Sweden)
Todd M Gilligan
Full Text Available The Old World bollworm, Helicoverpa armigera (Hübner, and the corn earworm, H. zea (Boddie, are two of the most important agricultural pests in the world. Diagnosing these two species is difficult-adults can only be separated with a complex dissection, and larvae cannot be identified to species using morphology, necessitating the use of geographic origin for identification in most instances. With the discovery of H. armigera in the New World, identification of immature Helicoverpa based on origin is no longer possible because H. zea also occurs in all of the geographic regions where H. armigera has been discovered. DNA barcoding and restriction fragment length polymorphism (RFLP analyses have been reported in publications to distinguish these species, but these methods both require post-PCR processing (i.e., DNA sequencing or restriction digestion to complete. We report the first real-time PCR assay to distinguish these pests based on two hydrolysis probes that bind to a segment of the internal transcribed spacer region 2 (ITS2 amplified using a single primer pair. One probe targets H. armigera, the second probe targets H. zea, and a third probe that targets a conserved segment of 18S rDNA is used as a control of DNA quality. The assay can be completed in 50 minutes when using isolated DNA and is successfully tested on larvae intercepted at ports of entry and adults captured during domestic surveys. We demonstrate that the assay can be run in triplex with no negative effects on sensitivity, can be run using alternative real-time PCR reagents and instruments, and does not cross react with other New World Heliothinae.
Banerjee, Priyanka; Preissner, Robert
2018-04-01
Taste of a chemical compounds present in food stimulates us to take in nutrients and avoid poisons. However, the perception of taste greatly depends on the genetic as well as evolutionary perspectives. The aim of this work was the development and validation of a machine learning model based on molecular fingerprints to discriminate between sweet and bitter taste of molecules. BitterSweetForest is the first open access model based on KNIME workflow that provides platform for prediction of bitter and sweet taste of chemical compounds using molecular fingerprints and Random Forest based classifier. The constructed model yielded an accuracy of 95% and an AUC of 0.98 in cross-validation. In independent test set, BitterSweetForest achieved an accuracy of 96 % and an AUC of 0.98 for bitter and sweet taste prediction. The constructed model was further applied to predict the bitter and sweet taste of natural compounds, approved drugs as well as on an acute toxicity compound data set. BitterSweetForest suggests 70% of the natural product space, as bitter and 10 % of the natural product space as sweet with confidence score of 0.60 and above. 77 % of the approved drug set was predicted as bitter and 2% as sweet with a confidence scores of 0.75 and above. Similarly, 75% of the total compounds from acute oral toxicity class were predicted only as bitter with a minimum confidence score of 0.75, revealing toxic compounds are mostly bitter. Furthermore, we applied a Bayesian based feature analysis method to discriminate the most occurring chemical features between sweet and bitter compounds from the feature space of a circular fingerprint.
Bohn, Martin O; Marroquin, Juan J; Flint-Garcia, Sherry; Dashiell, Kenton; Willmot, David B; Hibbard, Bruce E
2018-02-09
Over the last 70 yr, more than 12,000 maize accessions have been screened for their level of resistance to western corn rootworm, Diabrotica virgifera virgifera (LeConte; Coleoptera: Chrysomelidae), larval feeding. Less than 1% of this germplasm was selected for initiating recurrent selection or other breeding programs. Selected genotypes were mostly characterized by large root systems and superior root regrowth after root damage caused by western corn rootworm larvae. However, no hybrids claiming native (i.e., host plant) resistance to western corn rootworm larval feeding are currently commercially available. We investigated the genetic basis of western corn rootworm resistance in maize materials with improved levels of resistance using linkage disequilibrium mapping approaches. Two populations of topcrossed doubled haploid maize lines (DHLs) derived from crosses between resistant and susceptible maize lines were evaluated for their level of resistance in three to four different environments. For each DHL topcross an average root damage score was estimated and used for quantitative trait loci (QTL) analysis. We found genomic regions contributing to western corn rootworm resistance on all maize chromosomes, except for chromosome 4. Models fitting all QTL simultaneously explained about 30 to 50% of the genotypic variance for root damage scores in both mapping populations. Our findings confirm the complex genetic structure of host plant resistance against western corn rootworm larval feeding in maize. Interestingly, three of these QTL regions also carry genes involved in ascorbate biosynthesis, a key compound we hypothesize is involved in the expression of western corn rootworm resistance. © The Author(s) 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Wang, Zhichao; Dunn, Jennifer B; Han, Jeongwoo; Wang, Michael Q
2015-01-01
Corn oil recovery and conversion to biodiesel has been widely adopted at corn ethanol plants recently. The US EPA has projected 2.6 billion liters of biodiesel will be produced from corn oil in 2022. Corn oil biodiesel may qualify for federal renewable identification number (RIN) credits under the Renewable Fuel Standard, as well as for low greenhouse gas (GHG) emission intensity credits under California's Low Carbon Fuel Standard. Because multiple products [ethanol, biodiesel, and distiller's grain with solubles (DGS)] are produced from one feedstock (corn), however, a careful co-product treatment approach is required to accurately estimate GHG intensities of both ethanol and corn oil biodiesel and to avoid double counting of benefits associated with corn oil biodiesel production. This study develops four co-product treatment methods: (1) displacement, (2) marginal, (3) hybrid allocation, and (4) process-level energy allocation. Life-cycle GHG emissions for corn oil biodiesel were more sensitive to the choice of co-product allocation method because significantly less corn oil biodiesel is produced than corn ethanol at a dry mill. Corn ethanol life-cycle GHG emissions with the displacement, marginal, and hybrid allocation approaches are similar (61, 62, and 59 g CO2e/MJ, respectively). Although corn ethanol and DGS share upstream farming and conversion burdens in both the hybrid and process-level energy allocation methods, DGS bears a higher burden in the latter because it has lower energy content per selling price as compared to corn ethanol. As a result, with the process-level allocation approach, ethanol's life-cycle GHG emissions are lower at 46 g CO2e/MJ. Corn oil biodiesel life-cycle GHG emissions from the marginal, hybrid allocation, and process-level energy allocation methods were 14, 59, and 45 g CO2e/MJ, respectively. Sensitivity analyses were conducted to investigate the influence corn oil yield, soy biodiesel, and defatted DGS displacement credits
Studi Awal Desain Pabrik Bioetanol dari Corn stover
Directory of Open Access Journals (Sweden)
Gumelar Ahmad Muhlis
2015-12-01
Full Text Available Jagung (Zea mays merupakan tanaman pangan yang penting di Indonesia. Pada tahun 2006, luas panen jagung adalah 3,5 juta hektar dengan produksi rata-rata 3,47ton/ha, produksi jagung secara nasional 11,7 juta ton. Limbah batang dan daun jagung kering adalah 3,46 ton/ha sehingga limbah pertanian yang dihasilkan sekitar 12.1juta ton. Potensi energi limbah pada komoditas jagung sangat besar dan diharapkan akan terus meningkat sejalan dengan program pemerintah dalam meningkatkan produksi jagung secara nasional yaitu program pengembangan peternakan secara terintegrasi (Crop Livestock System/CLS. Oleh karena itu, optimasi pemanfaatan limbah jagung sangat diperlukan untuk mendapatkan keuntungan yang optimal sehingga dalam studi ini diputuskan pemanfaatan sebanyak 50% limbah pertanian jagung yang ada di Kab. Tuban untuk selanjutnya diproses menjadi Bioetanol 95%. Ketersediaan bahan baku, letak strategis, transportasi yang mudah terletak di jalur pantura dan langsung terhubung dengan pelabuhan, serta potensi tenaga kerja yang cukup menjanjikan menjadikan alasan dalam pemilihan Kawasan Industri Kec. Jenu Kab. Tuban sebagai lokasi pabrik. Proses pembuatan bioetanol dari corn stover dengan proses fermentasi dibagi menjadi 4 tahap yaitu: penyimpanan dan penanganan bahan baku, hidrolisis, fermentasi, dan pemurnian. Desain konseptual yang disajikan mengacu pada Technical Report Pilot Plan National Renewable Energy Laboratory tahun 2011. Pabrik Bioetanol direncanakan dapat mengolah 484.625 ton corn stover kering/hari pada yield etanol (303 L/dry ton dengan kapasitas produksi etanol 95% sebanyak 44.226 kL/tahun, harga jual adalah Rp13.500,00/L. Masa konstruksi pabrik yang didirikan 2 tahun dengan pembiayaan berupa modal tetap (FCI Rp. 515.854.121.170; modal kerja (WCI Rp. 91.033.080.207; investasi total (TCI Rp. 606.887.201.377 ; total production cost (TPC Rp. 345.715.009.709. Sehingga didapatkan IRR 23,37 % pertahun ;pay out time (POT 6,98 tahun dengan project
Directory of Open Access Journals (Sweden)
Daniel F. de Carvalho
2015-11-01
Full Text Available ABSTRACTThis study evaluated soil and water losses, soil water infiltration and infiltration rate models in soil tillage systems and corn (Zea mays, L. development stages under simulated rainfall. The treatments were: cultivation along contour lines, cultivation down the slope and exposed soil. Soil losses and infiltration in each treatment were quantified for rains applied using a portable simulator, at 0, 30, 60 and 75 days after planting. Infiltration rates were estimated using the models of Kostiakov-Lewis, Horton and Philip. Based on the obtained results, the combination of effects between soil tillage system and corn development stages reduces soil and water losses. The contour tillage system promoted improvements in soil physical properties, favoring the reduction of erosion in 59.7% (water loss and 86.6% (soil loss at 75 days after planting, and the increase in the stable infiltration rate in 223.3%, compared with the exposed soil. Associated to soil cover, contour cultivation reduces soil and water losses, and the former is more influenced by management. Horton model is the most adequate to represent soil water infiltration rate under the evaluated conditions.
Directory of Open Access Journals (Sweden)
Yang Yang
2015-10-01
Full Text Available Biochar, a green way to deal with burning and burying biomass, has attracted more attention in recent years. To fill the gap of the effects of different biochar on crop yield in Northern China, the first field experiment was conducted in farmland located in Hebei Province. Biochars derived from two kinds of feedstocks (rice straw and corn stalk were added into an Inceptisols area with different dosages (1 ton/ha, 2 ton/ha or 4 ton/ha in April 2014. The crop yields were collected for corn, peanut, and sweet potato during one crop season from spring to autumn 2014, and the wheat from winter 2014 to summer 2015, respectively. The results showed biochar amendment could enhance yields, and biochar from rice straw showed a more positive effect on the yield of corn, peanut, and winter wheat than corn stalk biochar. The dosage of biochar of 2 ton/ha or 1 ton/ha could enhance the yield by 5%–15% and biochar of 4 ton/ha could increase the yield by about 20%. The properties of N/P/K, CEC, and pH of soils amended with biochar were not changed, while biochar effects could be related to improvement of soil water content.
Directory of Open Access Journals (Sweden)
Johanna Aristizábal Galvis
2013-01-01
Full Text Available Promoting food security in Latin-America and the Caribbean is directly related to agricultural products. The region faces a food crisis which has reduced large population groups’ access to food. This work contributes to the study of obtaining precooked composite flour made from biofortified crops using protein, vitamin A and/or minerals. This study evaluated the effect of precooked flour’s composition and precooking on its solubility in water, water absorption capacity, consistency and viscosity; such flour was obtained by extrusion and drying on rollers. The composite flours were obtained from cassava roots, sweet potato tubers, corn, rice and bean grains and cassava leaves. Four composite flours were formulated taking four- to six-year-old children’s daily nutrient requirements (protein, iron, zinc and beta-carotenes as a basis. The extruder was operated at 90ºC, 300 rpm screw rotation speed, 17.64 g/min feed flow, with 30% moisture mixture. The dryer rollers were operated at 4 rpm roller rotation speed, 90ºC surface temperature and 1 mm separation between rollers. It was determined that flour dried on rollers led to more complete cooking and modified starch granule structure than precooking by extrusion, thereby producing flour having greater solubility in water, less water absorption, higher consistency and smaller viscosity, comparable to that of pattern flour.
Reddy, M. Kavya; Kuna, Aparna; Devi, N. Lakshmi; Krishnaiah, N.; Kaur, Charanjit; Nagamalleswari, Y.
2014-01-01
Extruded RTE snacks were prepared from flour blends made with corn flour, Bengal gram flour, roots and tuber flours in a proportion of 60–80: 20: 20 respectively and moisture was adjusted to 17–20 %. The roots and tubers flours were developed from potato (Solanum tuberosum), yam (Dioscorea spp.), sweet potato (Ipomoea batatas L.), taro (Colocassia esculenta) and beet root (Beta vulgaris). Different formulations were extruded at 80 ± 5 °C (heater I) and 95–105 °C (heater II) temperature, 300–3...
Nogueira, Amanda C; Sehn, Georgia A R; Rebellato, Ana Paula; Coutinho, Janclei P; Godoy, Helena T; Chang, Yoon K; Steel, Caroline J; Clerici, Maria Teresa P S
2018-01-01
Yellow sweet potato is mostly produced by small farmers, and may be a source of energy and carotenoids in the human diet, but it is a highly perishable crop. To increase its industrial application, yellow sweet potato flour has been produced for use in bakery products. This study aimed to evaluate the technological quality and the carotenoids content in sweet breads produced with the replacement of wheat flour by 0, 3, 6, and 9% yellow sweet potato flour. Breads were characterized by technological parameters and β-carotene levels during nine days of storage. Tukey's test (p<0.05) was used for comparison between means. The increase in yellow sweet potato flour concentrations in bread led to a decrease of specific volume and firmness, and an increase in water activity, moisture, orange coloring, and carotenoids. During storage, the most significant changes were observed after the fifth day, with a decrease in intensity of the orange color. The β-carotene content was 0.1656 to 0.4715 µg/g in breads with yellow sweet potato flour. This work showed a novel use of yellow sweet potato in breads, which brings benefits to consumers' health and for the agricultural business.
Nitrous oxide emissions in cover crop-based corn production systems
Davis, Brian Wesley
Nitrous oxide (N2O) is a potent greenhouse gas; the majority of N2O emissions are the result of agricultural management, particularly the application of N fertilizers to soils. The relationship of N2O emissions to varying sources of N (manures, mineral fertilizers, and cover crops) has not been well-evaluated. Here we discussed a novel methodology for estimating precipitation-induced pulses of N2O using flux measurements; results indicated that short-term intensive time-series sampling methods can adequately describe the magnitude of these pulses. We also evaluated the annual N2O emissions from corn-cover crop (Zea mays; cereal rye [Secale cereale], hairy vetch [Vicia villosa ], or biculture) production systems when fertilized with multiple rates of subsurface banded poultry litter, as compared with tillage incorporation or mineral fertilizer. N2O emissions increased exponentially with total N rate; tillage decreased emissions following cover crops with legume components, while the effect of mineral fertilizer was mixed across cover crops.
Sabiu, S; O'Neill, F H; Ashafa, A O T
2016-05-13
Corn silk (Zea mays L., Stigma maydis) is an important herb used traditionally in many parts of the world to treat array of diseases including diabetes mellitus. Inhibitors of α-amylase and α-glucosidase offer an effective strategy to modulate levels of post prandial hyperglycaemia via control of starch metabolism. This study evaluated α-amylase and α-glucosidase inhibitory potentials of corn silk aqueous extract. Active principles and antioxidant attributes of the extract were also analysed. The α-amylase inhibitory potential of the extract was investigated by reacting its different concentrations with α-amylase and starch solution, while α-glucosidase inhibition was determined by pre-incubating α-glucosidase with different concentrations of the extract followed by addition of p-nitrophenylglucopyranoside. The mode(s) of inhibition of the enzymes were determined using Lineweaver-Burke plot. In vitro analysis of the extract showed that it exhibited potent and moderate inhibitory potential against α-amylase and α-glucosidase, respectively. The inhibition was concentration-dependent with respective half-maximal inhibitory concentration (IC50) values of 5.89 and 0.93mg/mL. Phytochemical analyses revealed the presence of alkaloids, flavonoids, phenols, saponins, tannins and phytosterols as probable inhibitory constituents. Furthermore, the extract remarkably scavenges reactive oxygen species like DPPH and nitric oxide radicals, elicited good reducing power and a significant metal chelating attributes. Overall, the non-competitive and uncompetitive mechanism of action of corn silk extract is due to its inhibitory effects on α-amylase and α-glucosidase, respectively. Consequently, this will reduce the rate of starch hydrolysis, enhance palliated glucose levels, and thus, lending credence to hypoglycaemic candidature of corn silk. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
alireza barkhi
2009-06-01
Full Text Available An experiment was conducted in 2002-2003 using split-split plot arrangement based on Rondomised Compelete Block Design with three replications at Feiz Abad Agricultural Research Station of Qazvin, in order to study of planting patterns and corn densitis effect in competition with redroot pigweed. Main plots inclouded two planting pattern of corn (P1: single row and P2: double row, sub plots inclouded two corn densities (D1:7 and D2:10 plant/m2 and sub sub plots inclouded 4 weed densities (C1:0, C2:2, C3:6, C4:12 plant/m2. Sampling conducted in 2-weekly intervals and growth indices evaluated. Results indicated that with increasing of weed density CGR, TDW, LAI, number of seeds in row, grain and ear yield decreased but plant height increased. Also LAI, CGR, TDW, number of weed seed and seed,s weight of weed increased. By increasing in corn density LAI, CGR, TDW, ear and grain yield increased, but length and diameter of ear and number of seeds in row decreased. Also LAI and CGR of weed increased, but TDW was decreased. In double row planting pattern just CGR, LAI, TDW of corn were higher significantly than single row planting pattern. But single row planting of weed caused higher LAI, NAR, RGR, CGR and TDW of weed in comparison with double row planting pattern. In 2-way interaction, double row planting pattern and zero densities and 2 weeds/m2 had highest grain yield respectively. There were no significant differences for 3-way interactions but double row planting pattern 10 plant density of corn/m2 zero weed/ m2 had highest grain yield.
Matthews, Bethany A; Launis, Karen L; Bauman, Patricia A; Juba, Nicole C
2017-09-27
MZHG0JG corn will offer growers the flexibility to alternate between herbicides with two different modes of action in their weed-management programs, helping to mitigate and manage the evolution of herbicide resistance in weed populations. The proteins conferring herbicide tolerence in MZHG0JG corn, double-mutated 5-enol pyruvylshikimate-3-phosphate synthase protein (mEPSPS) and phosphinothricin acetyltransferase (PAT), as well as the MZHG0JG corn event, have been assessed by regulatory authorities globally and have been determined to be safe for humans, animals, and the environment. In addition to the safety data available for these proteins, further studies were conducted on MZHG0JG corn to assess levels of mEPSPS as compared to previously registered genetically modified (GM) corn. The results support the conclusion of no impact on toxicological safety or nutritional composition.
Directory of Open Access Journals (Sweden)
Ángel León
2016-11-01
Effect of irrigation variant in the corn production (Zea mays L. at Río Verde commune, Santa Elena, Ecuador. The test was conducted at the Production and Practice Center Río Verde, owned by the Santa Elena Peninsula State University, located in Río Verde commune, Santa Elena canton, the research aimed to evaluate the effect of irrigation variations into agronomic performance of corn under different irrigation sheets using as measuring tool evaporation A class Pan. The treatments were five doses of irrigation 60, 70, 80, 90 and 100% of evapotranspiration, treatments were placed in a complete randomized design of blocks with four replications, the averages compared with the Tukey test (p> 0.05. The regression analysis fits a quadratic equation and the coefficient of determination R2 0,91 which shows the high degree of dependence of results based on irrigation variants. The highest production was obtained by the treatment with 90% with 12,18 t.ha-1.
Control of sweet potato virus diseases.
Loebenstein, Gad
2015-01-01
Sweet potato (Ipomoea batatas) is ranked seventh in global food crop production and is the third most important root crop after potato and cassava. Sweet potatoes are vegetative propagated from vines, root slips (sprouts), or tubers. Therefore, virus diseases can be a major constrain, reducing yields markedly, often more than 50%. The main viruses worldwide are Sweet potato feathery mottle virus (SPFMV) and Sweet potato chlorotic stunt virus (SPCSV). Effects on yields by SPFMV or SPCSV alone are minor, or but in complex infection by the two or other viruses yield losses of 50%. The orthodox way of controlling viruses in vegetative propagated crops is by supplying the growers with virus-tested planting material. High-yielding plants are tested for freedom of viruses by PCR, serology, and grafting to sweet potato virus indicator plants. After this, meristem tips are taken from those plants that reacted negative. The meristems were grown into plants which were kept under insect-proof conditions and away from other sweet potato material for distribution to farmers after another cycle of reproduction. © 2015 Elsevier Inc. All rights reserved.
Stevenson, Douglass E; Michels, Gerald J; Bible, John B; Jackman, John A; Harris, Marvin K
2008-10-01
Field observations at three locations in the Texas High Plains were used to develop and validate a degree-day phenology model to predict the onset and proportional emergence of adult Diabrotica virgifera virgifera LeConte (Coleoptera: Chrysomelidae) adults. Climatic data from the Texas High Plains Potential Evapotranspiration network were used with records of cumulative proportional adult emergence to determine the functional lower developmental temperature, optimum starting date, and the sum of degree-days for phenological events from onset to 99% adult emergence. The model base temperature, 10 degrees C (50 degrees F), corresponds closely to known physiological lower limits for development. The model uses a modified Gompertz equation, y = 96.5 x exp (-(exp(6.0 - 0.00404 x (x - 4.0), where x is cumulative heat (degree-days), to predict y, cumulative proportional emergence expressed as a percentage. The model starts degree-day accumulation on the date of corn, Zea mays L., emergence, and predictions correspond closely to corn phenological stages from tasseling to black layer development. Validation shows the model predicts cumulative proportional adult emergence within a satisfactory interval of 4.5 d. The model is flexible enough to accommodate early planting, late emergence, and the effects of drought and heat stress. The model provides corn producers ample lead time to anticipate and implement adult control practices.
Directory of Open Access Journals (Sweden)
Antônio Pasqualetto
2007-09-01
Full Text Available
Objetivou-se avaliar a ocorrência de espécies daninhas na cultura do milho após diversas culturas de safrinha, no sistema plantio direto. As culturas de safrinha foram milho, soja, milheto, girassol, sorgo, aveia e guandu. As plantas daninhas foram avaliadas aos 30 dias após a semeadura, por meio de amostragens ao acaso na parcela, utilizando um quadro de 0,45 m2 (1,5 m x 0,3 m, colocado perpendicularmente às linhas de semeadura e recolhendo-se todo o material verde de plantas daninhas existentes na amostra, classificando-o por espécie vegetal, agrupando as principais monocotiledôneas, principais dicotiledôneas e outras plantas daninhas. Os resultados demonstraram maior ocorrência das espécies Digitaria horizontalis e Commelina benghalensis na cultura do milho, independentemente da sucessão estabelecida. C. benghalensis predominou na sucessão milho-milho, e D. horizontalis na sucessão soja-milho. A menor infestação de plantas daninhas foi observada na área em que a cultura do girassol antecede a cultura do milho. Utilizando-se o milheto como cultura de safrinha, há maior ocorrência de espécies dicotiledôneas na cultura do milho, especialmente a Euphorbia heterophylla.
PALAVRAS-CHAVE: Sucessões de culturas; milho; plantas daninhas.
It was observed to evaluate the occurrence of the weeds, after 3 years of cultivation with successions of double cropping cultures with the culture of the corn. The double cropping cultures were: corn, soybean, pearl millet, sunflower, sorghum, oat and pigeon pea. The weeds were appraised to the 30 days after the sowing, by means of sampling to the maybe in the portion, using a icture of 0.45 m2 (1.5 m x 0.3 m, placed in a perpendicular way to the plantation lines
Directory of Open Access Journals (Sweden)
AMANDA C. NOGUEIRA
2018-02-01
Full Text Available ABSTRACT Yellow sweet potato is mostly produced by small farmers, and may be a source of energy and carotenoids in the human diet, but it is a highly perishable crop. To increase its industrial application, yellow sweet potato flour has been produced for use in bakery products. This study aimed to evaluate the technological quality and the carotenoids content in sweet breads produced with the replacement of wheat flour by 0, 3, 6, and 9% yellow sweet potato flour. Breads were characterized by technological parameters and β-carotene levels during nine days of storage. Tukey’s test (p<0.05 was used for comparison between means. The increase in yellow sweet potato flour concentrations in bread led to a decrease of specific volume and firmness, and an increase in water activity, moisture, orange coloring, and carotenoids. During storage, the most significant changes were observed after the fifth day, with a decrease in intensity of the orange color. The β-carotene content was 0.1656 to 0.4715 µg/g in breads with yellow sweet potato flour. This work showed a novel use of yellow sweet potato in breads, which brings benefits to consumers’ health and for the agricultural business.
Corn stover harvest strategy effects on grain yield and soil quality indicators
International Nuclear Information System (INIS)
Douglas, K.; Stuart, B.; Adam, W.
2013-01-01
Developing strategies to collect and use cellulo sic biomass for bio energy production is important because those materials are not used as human food sources. This study compared corn (Zea mays L.) stover harvest strategies on a 50 ha Clarion- Nicol let-Webster soil Association site near Emmetsburg, Iowa, USA. Surface soil samples (0 to 15 cm) were analyzed after each harvest to monitor soil organic carbon (Soc), ph, phosphorus (P) and potassium (K) changes. Grain yields in 2008, before the stover harvest treatments were imposed, averaged 11.4 Mg ha-1. In 2009, 2010, and 2011 grain yields averaged 10.1, 9.7, and 9.5 Mg ha-1, respectively. Although grain yields after stover harvest strategies imposed were lower than in 2008, there were no significant differences among the treatments. Four-year average stover collection rates ranged 1.0 to 5.2 Mg ha-1 which was 12 to 60% of the above-ground biomass. Soc showed a slight decrease during the study, but the change was not related to any specific stover harvest treatment. Instead, we attribute the Soc decline to the tillage intensity and lower than expected crop yields. Overall, these results are consistent with other Midwestern USA studies that indicate corn stover should not be harvested if average grain yields are less than 11 Mg ha-1
Bitra, Venkata S P; Womac, Alvin R; Igathinathane, C; Miu, Petre I; Yang, Yuechuan T; Smith, David R; Chevanan, Nehru; Sokhansanj, Shahab
2009-12-01
Lengthy straw/stalk of biomass may not be directly fed into grinders such as hammer mills and disc refiners. Hence, biomass needs to be preprocessed using coarse grinders like a knife mill to allow for efficient feeding in refiner mills without bridging and choking. Size reduction mechanical energy was directly measured for switchgrass (Panicum virgatum L.), wheat straw (Triticum aestivum L.), and corn stover (Zea mays L.) in an instrumented knife mill. Direct power inputs were determined for different knife mill screen openings from 12.7 to 50.8 mm, rotor speeds between 250 and 500 rpm, and mass feed rates from 1 to 11 kg/min. Overall accuracy of power measurement was calculated to be +/-0.003 kW. Total specific energy (kWh/Mg) was defined as size reduction energy to operate mill with biomass. Effective specific energy was defined as the energy that can be assumed to reach the biomass. The difference is parasitic or no-load energy of mill. Total specific energy for switchgrass, wheat straw, and corn stover chopping increased with knife mill speed, whereas, effective specific energy decreased marginally for switchgrass and increased for wheat straw and corn stover. Total and effective specific energy decreased with an increase in screen size for all the crops studied. Total specific energy decreased with increase in mass feed rate, but effective specific energy increased for switchgrass and wheat straw, and decreased for corn stover at increased feed rate. For knife mill screen size of 25.4 mm and optimum speed of 250 rpm, optimum feed rates were 7.6, 5.8, and 4.5 kg/min for switchgrass, wheat straw, and corn stover, respectively, and the corresponding total specific energies were 7.57, 10.53, and 8.87 kWh/Mg and effective specific energies were 1.27, 1.50, and 0.24 kWh/Mg for switchgrass, wheat straw, and corn stover, respectively. Energy utilization ratios were calculated as 16.8%, 14.3%, and 2.8% for switchgrass, wheat straw, and corn stover, respectively. These
Storage performance of Taiwanese sweet potato cultivars.
Huang, Che-Lun; Liao, Wayne C; Chan, Chin-Feng; Lai, Yung-Chang
2014-12-01
Three sweet potato cultivars (TNG57, TNG66, and TNG73), provided by the Taiwanese Agricultural Research Institute (TARI), were stored at either 15 °C or under ambient conditions (23.8 ~ 28.4 °C and 77.1 ~ 81.0 % of relative humidity). Sweet potato roots were randomly chosen from each replicate and evaluated for measurement of weight loss, sugar content analysis, and sprouting after 0, 14, 24, 48, 56, 70, 84, and 98 days of storage. Fresh sweet potato roots were baked at 200 °C for 60 min then samples were taken for sugar analysis. After 14 days of ambient condition storage, the sprouting percentages for TNG57, TNG66, and TNG73 were 100, 85, and 95 % respectively. When sweet potatoes were stored at 15 °C, the weight loss became less and no sweet potato root sprouted after 14 days of storage. Because manufacturers can store sweet potatoes at 15 °C for almost 2 month without other treatments, the supply capacity shortage in July and September can be reduced. The total sugar content slowly increased along with increasing the storage time. After baking, the total sugar content of sweet potatoes significantly increased due to the formation of maltose. Maltose became the major sugar of baked sweet potatoes. Raw sweet potatoes stored at 15 °C had higher total sugar contents after baking than those stored under ambient conditions. Raw sweet potatoes were recommended to be stored at 15 °C before baking.
Bina, Fatemeh; Rahimi, Roja
2016-01-01
Origanum majorana L. commonly known as sweet marjoram has been used for variety of diseases in traditional and folklore medicines, including gastrointestinal, ocular, nasopharyngeal, respiratory, cardiac, rheumatologic, and neurological disorders. Essential oil containing monoterpene hydrocarbons and oxygenated monoterpenes as well as phenolic compounds are chemical constituents isolated and detected in O majorana. Wide range of pharmacological activities including antioxidant, hepatoprotective, cardioprotective, anti-platelet, gastroprotective, antibacterial and antifungal, antiprotozoal, antiatherosclerosis, anti-inflammatory, antimetastatic, antitumor, antiulcer, and anticholinesterase inhibitory activities have been reported from this plant in modern medicine. This article summarizes comprehensive information concerning traditional uses, phytochemistry, and pharmacological activities of sweet marjoram. PMID:27231340
Directory of Open Access Journals (Sweden)
Suswi Nalis
2015-09-01
Full Text Available Stewart’s Wilt is an important bacterial disease of sweet corn caused by Pantoea stewartii subsp. stewartii (synonim Erwinia stewartii. This bacteria is a seed transmitted pathogen therefore seed treatment is one method to control stewart’s wilt. The aim of this research was to study the effectiveness of dry heat, bactericide treatment, and their combinations to eliminate P. stewartii subsp. stewartii infection on sweet corn seed without damaging seed quality. The research was conducted in 3 experiments. Experiment I was conducted to determine the treatment window of dry heat and bactericide treatment. The treatment was carried out on sweet corn seed using the P. stewartii subsp. stewartii in vitro. Experiment II was conducted to study dry heat and bactericide treatment on sweet corn seed infested by P. stewartii subsp. stewartii. Experiment III was conducted to study combination of dry heat and bactericide treatment on sweet corn seed infested by P. stewartii subsp. stewartii. The results showed that dry heat treatment at 50 °C for 24 hours was able to eliminate pathogen populations in vitro but was unable to eliminate the 128 pathogen on infected seed (in vivo. Germination tests indicated that seed treatments with dry heat up to 55 °C did not decrease the germination level. The use of bactericide treatment in 100 ppm could reduce the population of bacteria on sweet corn seeds. Bactericide concentration of 150 and 200 ppm could decrease the population of bacteria on sweet corn seeds, however it could cause phytotoxic effect. The combination of bactericide (100 ppm, w/v with dry heat treatment (55 °C for 24 hours was able to eliminate bacteria on infected seed with seed germination above 85%.
El-Ghorab, Ahmed; El-Massry, Khaled F; Shibamoto, Takayuki
2007-10-31
A total of 36 compounds, which comprised 99.4% of the extract, were identified by gas chromatography and mass spectrometry (GC-MS) in the volatile dichloromethane extract obtained from Egyptian corn silk. The main constituents of the volatile extract were cis-alpha-terpineol (24.22%), 6,11-oxidoacor-4-ene (18.06%), citronellol (16.18%), trans-pinocamphone (5.86%), eugenol (4.37%), neo-iso-3-thujanol (2.59%), and cis-sabinene hydrate (2.28%). Dried Egyptian corn silk was also directly extracted with petroleum ether, ethanol, and water. All extracts from solvent extraction and the volatile extract described above exhibited clear antioxidant activities at levels of 50-400 microg/mL in the 2,2-diphenyl-1-picrylhydrazyl (DPPH)/linoleic acid assay. The ethanol extract inhibited DPPH activity by 84% at a level of 400 microg/mL. All samples tested via the beta-carotene bleaching assay also exhibited satisfactory antioxidant activity with clear dose responses. This study indicates that corn silk could be used to produce novel natural antioxidants as well as a flavoring agent in various food products.
Alcoholic fermentation of stored sweet potatoes
Energy Technology Data Exchange (ETDEWEB)
Yutaka, Y; One, H
1958-01-01
Sweet potatoes were ground and stored in a ground hold. The stored sweet potatoes gave about 90% fermentation efficiency by the koji process. A lower fermentation efficiency by the amylo process was improved by adding 20 to 30 mg/100 ml of organic N. Inorganic N has no effect in improving the fermentation efficiency of the stored sweet potatoes by the amylo process.
Directory of Open Access Journals (Sweden)
A. S. O. D. Lima
2015-12-01
Full Text Available Atualmente os produtos orgânicos vêm roubando a cena dos produtos tradicionais, por serem saudáveis, livres de agrotóxicos e por gerarem menor impacto no meio ambiente. O minimilho (Zea mays, L. também conhecido como “babycorn”, uma espiga imatura ainda não fertilizada (espiguetas, é uma hortaliça, produto considerado fino que vem ganhando importância no mercado de conservas no Brasil. Esta pesquisa se propôs avaliar a qualidade de minimilho orgânico in natura de diferentes variedades e determinar a composição centesimal e nutricional.Utilizou-se como metodologias analíticas as determinações de rendimento, peso médio, diâmetro e comprimento das espiguetas, além de pH, sólidos solúveis, acidez titulável, umidade, cinzas, lipídeos, proteínas, carboidratos e valor energético total. Com os resultados obtidos concluiu-se que as variedades que apresentaram maior rendimento foram Pipoca (48,75%, Eldorado (42,06%e Branco (40,50%, sendo mais recomendadas para o beneficiamento e que o minimilho se trata de um produto de baixo valor calórico, podendo ser indicado em dietas hipocalóricas.Physical analysis, and nutritional composition centesimal babycorn (Zea mays, L. organic variety of differentAbstract: Currently organic products come stealing the show from traditional products to be healthy, free of pesticides and generate less impact on the environment. The lithe corn (Zea mays L. also known as " babycorn " an immature ear is not fertilized (spikelets, is a vegetable , thin product concerned that has gained importance in the market preserved in Brazil. This research aims to evaluate the quality of organic fresh baby corn in different varieties and determine the composition and nutritional. Used as analytical methodologies determinations yield , average weight , diameter and length of the spikelets , and pH , soluble solids , titratable acidity, moisture, ash , lipids , proteins , carbohydrates and total energetic
Barros, Kenia Kelly; do Nascimento, Clístenes Williams Araújo; Florencio, Lourdinha
2012-01-01
Treated wastewater has great potential for agricultural use due to its concentrations of nutrients and organic matter, which are capable of improving soil characteristics. Additionally, effluents can induce suppression of plant diseases caused by soil pathogens. This study evaluates the effect of irrigation with effluent in a UASB reactor on maize (Zea mays L.) development and on suppression of the diseases caused by nematodes of the genus Meloidogyne. Twelve lysimeters of 1 m(3) each were arranged in a completely randomized design, with four treatments and three replicates. The following treatments were used: T1 (W+I), irrigation with water and infestation with nematodes; T2 (W+I+NPK), irrigation with water, infestation with nematodes and fertilization with nitrogen (N), phosphorus (P) and potassium (K); T3 (E+I), irrigation with effluent and infestation with nematodes; and T4 (E+I+P), irrigation with effluent, infestation with nematodes and fertilization with phosphorus. The plants irrigated with the effluent plus the phosphorus fertilizer had better growth and productivity and were more resistant to the disease symptoms caused by the nematodes. The suppression levels may have been due to the higher levels of Zn and NO(3)(-) found in the leaf tissue of the plants irrigated with the effluent and phosphorus fertilizer.
Gupta, Ankita; Sankararamakrishnan, Ramasubbu
2018-04-14
SWEET (Sweet Will Eventually be Exported Transporter) proteins have been recently discovered and form one of the three major families of sugar transporters. Homologs of SWEET are found in both prokaryotes and eukaryotes. Bacterial SWEET homologs have three transmembrane segments forming a triple-helical bundle (THB) and the functional form is dimers. Eukaryotic SWEETs have seven transmembrane helical segments forming two THBs with a linker helix. Members of SWEET homologs have been shown to be involved in several important physiological processes in plants. However, not much is known regarding the biological significance of SWEET homologs in prokaryotes and in mammals. We have collected more than 2000 SWEET homologs from both prokaryotes and eukaryotes. For each homolog, we have modeled three different conformational states representing outward open, inward open and occluded states. We have provided details regarding substrate-interacting residues and residues forming the selectivity filter for each SWEET homolog. Several search and analysis options are available. The users can generate a phylogenetic tree and structure-based sequence alignment for selected set of sequences. With no metazoan SWEETs functionally characterized, the features observed in the selectivity filter residues can be used to predict the potential substrates that are likely to be transported across the metazoan SWEETs. We believe that this database will help the researchers to design mutational experiments and simulation studies that will aid to advance our understanding of the physiological role of SWEET homologs. This database is freely available to the scientific community at http://bioinfo.iitk.ac.in/bioinfo/dbSWEET/Home. Copyright © 2018. Published by Elsevier Ltd.
Energy Technology Data Exchange (ETDEWEB)
Wang, Zhichao [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division; Dunn, Jennifer B. [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division; Wang, Michael Q. [Argonne National Lab. (ANL), Argonne, IL (United States). Energy Systems Division
2014-09-01
Corn ethanol, a first-generation biofuel, is the predominant biofuel in the United States. In 2013, the total U.S. ethanol fuel production was 13.3 billion gallons, over 95% of which was produced from corn (RFA, 2014). The 2013 total renewable fuel mandate was 16.6 billion gallons according to the Energy Independence and Security Act (EISA) (U.S. Congress, 2007). Furthermore, until 2020, corn ethanol will make up a large portion of the renewable fuel volume mandated by Renewable Fuels Standard (RFS2). For the GREET1_2014 release, the corn ethanol pathway was subject to updates reflecting changes in corn agriculture and at corn ethanol plants. In the latter case, we especially focused on the incorporation of corn oil as a corn ethanol plant co-product. Section 2 covers these updates. In addition, GREET now includes options to integrate corn grain and corn stover ethanol production on the field and at the biorefinery. These changes are the focus of Section 3.
Sherwood, Brianne; Hawks, Amanda
2011-01-01
We have so much corn right now it's coming out of our ears (great pun, right?). And it's SO incredibly cheap! This is probably because the US produces 42% of the world's corn! Most of it is used for animal feed, but other uses include exporting to other countries, human food, seed, and industrial uses such as ethanol production. Because there is so much corn available here in the U.S. You can find it in a lot more foods than you think. It's in peanut butter, snack foods, soft drinks, multivit...
A new mutant gene su-1 in corn obtained by irradiation with low doses of gamma rays
International Nuclear Information System (INIS)
Diaconu, P.
1993-01-01
This paper provides a description of a sugar corn mutant obtained by irradiation of wetted kernels of Romanesc de Studina variety with low doses of gamma rays (300 R). This mutant influences the structure of the endosperm similarly to the su-1 genes developed spontaneously which resulted in the corn variety Zea mays saccharata thousands of years ago. Although the mutant is a multiple allele of the su-1 locus in chromosome IV it differs widely from the spontaneous mutant. The length of the ears is much reduced, varying between 4 and 6 cm, with numbers of kernels per ear varying between 45 and 72. Attempts to improve the cob size and the number of kernels by breeding and propagation in an insulated area led to no result. Crossing the mutants with the sugar hybrid Delicious resulted in sugar type progeny which confirms the common position of the mutant gene induced by irradiation and the spontaneous su-1 gene. The progenies of sugar mutant x Delicious are 38-43 % lower in cob vigor and 36-46% lower in kernel number. (author). 2 figs, 2 tab., 16 refs
Directory of Open Access Journals (Sweden)
Angzzas Sari Mohd Kassim
2013-12-01
Full Text Available Malaysia is a country that is a rich source of agricultural waste material. Three different crops were studied here, including pineapple (Ananas comosus leaf, corn (Zea mays stalk, and Napier grass (Pennisetum purpureum. These crops are characterized as agricultural waste materials in Malaysia and have a high potential to be used as alternative fibers for the paper making industry. The objective of this work was to analyze the chemical composition of pineapple leaf, corn stalk, and Napier grass and to investigate the fiber morphology of these crops. The chemical components analyzed include the following: cellulose (Kurshner-Hoffner method, holocellulose (chlorination method, hemicellulose (chlorination method, ash content (TAPPI method T211-om-93, lignin content (TAPPI method T222-om-98, and soluble sodium hydroxide (TAPPI method T203-om-98. All handsheets morphologies were observed using scanning electron microscopy (SEM. Results indicated each crop has the potential for use as a fiber in paper making. SEM images indicated a condensed composition of the fiber structure. The observed chemical composition and morphology of these three crops indicate their suitability for use as fiber sources for the paper industry.
The effects of ultraviolet radiation on the growth and gross morphology of Zea mays, Linn. seedlings
Energy Technology Data Exchange (ETDEWEB)
Martin, Ann Kristine Joy T.; Mendiola, Carlo Paulo T
2000-03-01
The study was conducted with a descriptive experimental design in order to determine the effects of broad spectrum ultraviolet radiation on growth factors, seedling height, root length, chlorophyll content, organic weights, and percentage survival, as well as gross morphological factors, leaf, stem, and root appearance, of native sweet corn seedlings. The study was limited to the seedling stage of the plant and observations were taken after 20 days of treatment. The results gathered show that there was a visible manifestation of the detrimental effects of UV on the irradiated seedlings. There were observed decreases in the growth parameters while the gross morphological parameters exhibited signs of wilting and stress. It was therefore concluded that based on the observed results, UV had a detrimental effect on the studied growth and gross morphological parameters. (Author)
Bitter and sweet tasting molecules: It's complicated.
Di Pizio, Antonella; Ben Shoshan-Galeczki, Yaron; Hayes, John E; Niv, Masha Y
2018-04-19
"Bitter" and "sweet" are frequently framed in opposition, both functionally and metaphorically, in regard to affective responses, emotion, and nutrition. This oppositional relationship is complicated by the fact that some molecules are simultaneously bitter and sweet. In some cases, a small chemical modification, or a chirality switch, flips the taste from sweet to bitter. Molecules humans describe as bitter are recognized by a 25-member subfamily of class A G-protein coupled receptors (GPCRs) known as TAS2Rs. Molecules humans describe as sweet are recognized by a TAS1R2/TAS1R3 heterodimer of class C GPCRs. Here we characterize the chemical space of bitter and sweet molecules: the majority of bitter compounds show higher hydrophobicity compared to sweet compounds, while sweet molecules have a wider range of sizes. Importantly, recent evidence indicates that TAS1Rs and TAS2Rs are not limited to the oral cavity; moreover, some bitterants are pharmacologically promiscuous, with the hERG potassium channel, cytochrome P450 enzymes, and carbonic anhydrases as common off-targets. Further focus on polypharmacology may unravel new physiological roles for tastant molecules. Copyright © 2018 Elsevier B.V. All rights reserved.
Advances in Fluorescence Sensing Systems for the Remote Assessment of Nitrogen Supply in Field Corn
Corp, L. A.; Chappelle, E. W.; McMurtrey, J. E.; Daughtry, C. S. T.; Kim, M. S.
2000-01-01
The studies described herein were conducted to better define changes in fluorescence properties of leaves from field grown corn (Zea mays L.) as they relate to varying levels of nitrogen (N) fertilization. This research was directed toward: 1) providing a remote non-destructive sensing technique to aid in the determination of optimal rates of N fertilization in corn crops and, 2) defining parameters for further development of fluorescence instrumentation to be operated remotely at field canopy levels. Fluorescence imaging bands centered in the blue (450 nm), green (525 nm), red (680 nm), and far-red (740 nm) and ratios of these bands were compared with the following plant parameters: rates of photosynthesis, N:C ratio, pigment concentrations, and grain yields. Both the fluorescence and physiological measures exhibited similar curvilinear responses to N fertilization level while significant linear correlations were obtained among fluorescence bands and band ratios to certain physiological measures of plant productivity. The red / blue, red / green, far-red / blue, far-red /green fluorescence ratios are well suited for remote observation and provided high correlations to grain yield, LAI, N:C, and chlorophyll contents. The results from this investigation indicate that fluorescence technology could aid in the determination of N fertilization requirements for corn. This discussion will also address design concepts and preliminary field trials of a mobile field-based Laser Induced Fluorescence Imaging System (LIFIS) capable of simultaneously acquiring images of four fluorescence emission bands from areas of plant canopies equaling 1 sq m and greater without interference of ambient solar radiation.
Induced cytomictic diversity in maize (Zea mays L.) inbred.
Rai, Prashant Kumar; Kumar, Girjesh; Tripathi, Avinash
2010-01-01
Mutation breeding has been used for improving oligogenic and polygenic characters, disease resistance and quantitative characters including yielding ability. The cytological stability of maize inbred lines is an important consideration in view of their extensive use in genetics and plant breeding research. Investigation in Zea mays L. confirms that the migration of chromosomes is a real event that cannot be misunderstood as an artifact produced by fixation or mechanical injuries. During present investigation, we found that out of six inbred lines of Zea mays L. viz. CM-135, CM-136, CM-137, CM-138, CM-142 and CM-213 at various treatment doses of gamma irradiations viz. 200, 400 and 600 Gy, some of the plants of inbred line CM- 138 at 200 Gy dose displayed characteristic cytoplasmic connections during all the stages of meiosis. Four plants from this treatment set were found to be engaged in a rare phenomenon reported as "Cytomixis". It elucidates that in inbred of Zea mays L., induced cytomixis through gamma rays treatment may be considered to be a possible source of production of aneuploid and polyploid gametes. This phenomenon may have several applications in Zea mays L. improvement in the sense of diversity and ever yield potential.
László, Márton, ,, Dr.
2010-05-01
been identified as hazardous (H) waste (W) sites (S)(HWS) because of the presence of elevated concentrations of these elements. They will remain a threat to the environment until they are removed or immobilized. We can test and improve these situation by using different plant species, as corn (Zea mays L.) x macro nutrients as phosphorous experimental methods. Maize has a very great biomass (B) production (P) potential (P)(BPP) and important role in soil fertility by the design of plant rotation to field plant production, the animal foraging as a fodder-crop with a high carbohydrate (70%) and protein (10%) content (70%) and via pytoremediation possibilities. Cd is considered to be a nonessential element for maize, it is effectively absorbed by both the root and leaf system. By these ways a great proportion of the cadmium is to be accumulated in root tissues, even when Cd enters the plant via foliar system from the polluted air and precipitation. The most chief geobiochemical property of cadmium ions is their strong affinity for sulfhydryl groups of several compounds (OSHA 1992; Richardson 1992; RAIS 1991; Sittig 1991; TAP 1999; WA 1996; WHO 1992, 2001). Furthermore Cd shows an affinity for other side chains of protein and for phosphate groups too. The Cd content of maize is of the highest concern as a Cd reservoir and as the patway of cadmium to soil-plant-animal-man chain (FOOD CHAIN). Thus, tolerance and adaptation of corn to higher Cd levels, although important from the environmental poin of view, create a helth risc. Material and Method The phosphorus (P2O5) mineral fertilization and cadmium loading effects were studied in a long-term field experiment set up at Experimental Station of the Research Institute for Soil Science and Agricultural Chemistry of the Hungarian Academy of Sciences on a calcareous chernozem soil at Nagyhörcsök in 1977. The soil had the following agrogeochemical characteristics: pH (KCl) 7.3, humus 3.0%, ammonlactate (AL) soluble-P2O5 60
Ali, M Liakat; Taylor, Jeff H; Jie, Liu; Sun, Genlou; William, Manilal; Kasha, Ken J; Reid, Lana M; Pauls, K Peter
2005-06-01
Gibberella ear rot, caused by the fungus Fusarium graminearum Schwabe, is a serious disease of corn (Zea mays) grown in northern climates. Infected corn is lower yielding and contains toxins that are dangerous to livestock and humans. Resistance to ear rot in corn is quantitative, specific to the mode of fungal entry (silk channels or kernel wounds), and highly influenced by the environment. Evaluations of ear rot resistance are complex and subjective; and they need to be repeated over several years. All of these factors have hampered attempts to develop F. graminearum resistant corn varieties. The aim of this study was to identify molecular markers linked to the genes for resistance to Gibberella ear rot. A recombinant inbred (RI) population, produced from a cross between a Gibberella ear rot resistant line (CO387) and a susceptible line (CG62), was field-inoculated and scored for Gibberella ear rot symptoms in the F4, F6, and F7 generations. The distributions of disease scores were continuous, indicating that resistance is probably conditioned by multiple loci. A molecular linkage map, based on segregation in the F5 RI population, contained 162 markers distributed over 10 linkage groups and had a total length of 2237 cM with an average distance between markers of 13.8 cM. Composite interval mapping identified 11 quantitative trait loci (QTLs) for Gibberella ear rot resistance following silk inoculation and 18 QTLs following kernel inoculation in 4 environments that accounted for 6.7%-35% of the total phenotypic variation. Only 2 QTLs (on linkage group 7) were detected in more than 1 test for silk resistance, and only 1 QTL (on linkage group 5) was detected in more than 1 test for kernel resistance, confirming the strong influence of the environment on these traits. The majority of the favorable alleles were derived from the resistant parent (CO387). The germplasm and markers for QTLs with significant phenotypic effects may be useful for marker-assisted selection
Directory of Open Access Journals (Sweden)
E. Izadi Darbandi
2016-06-01
Full Text Available Introduction: In the whole agro ecosystems, weeds had existence as unwanted plant that control of them is necessary. The competition between weeds and corn for moisture, light, nutrients during the growth season is induced reducing the quality and quantity of corn yield. Although the corn is high and powerful crop but is sensitive to competition with the weed and reduction of yield has been reported over 30%. Since the weeds are adapted to conditions, they are successful to completion and reducing the yield. So weed management is important in corn production. Chemical control has not been the unique and best way to manage the weeds and it reduce the sustainability of agro ecosystems. Although developing the herbicides, reduce the pressures caused by the weeds, but by developing rapidly the weed resistance to herbicides and increasing the environmental concerns and its high cost, today need to new, more immune and sustainable techniques for weed management. The main approach for sustainable weed management in an integrated weed management program is increasing crop competitiveness with weeds to reduce herbicide use. In this regard, the planting date, crop rotation, planting density, intercropping, planting pattern, fertilizer type, rate and application method are some of the most crop management strategies. Among the nutrients necessary for plants, nitrogen is the most nutrient in plant competition. Therefore, its application management plays a key role in reducing weed interference with crops and reduced herbicide use. Foramsulfuron herbicide from ALS inhibitors is a post-emergence sulfonylurea herbicide for the control of grasses and certain broadleaf weeds in maize. Unfortunately, these herbicides are also notorious for their ability to select resistant weed populations. Now, there are more weed species that are resistant to ALS-inhibiting herbicides than to any other herbicide group. In several cropping systems, ALS-inhibiting herbicides were
Tayyem, Reema F; Bawadi, Hiba A; Shehadah, Ihab; Bani-Hani, Kamal E; Takruri, Hamed; Al-Jaberi, Tareq; Heath, Dennis D
2018-01-27
Background: The effects of consuming fast foods, sweets and beverages on the development of colorectal cancer (CRC) are unclear. The aim of this case-control study was to assess possible associations between the consumption of different fast foods, sweets and beverages and CRC risk in a Jordanian population. Methods: Two hundred and twenty diagnosed CRC cases and 281 controls were enrolled. Diet history was obtained using a validated quantitative questionnaire. Results: Consumption of some types of fast food, and particularly falafel, was associated with an increased risk of developing CRC. Elevated risk was found for potato and corn chips with an AOR of 4.36 (95%CI: 1.24-15.28) for daily consumption and 3.33 (95%CI: 1.00-11.11) for ≥5 servings/week. Consuming 1-2 or >5 servings per week of fried potatoes or 2-3 servings per week of chicken in sandwiches also increased the risk while exposure to fresh tomato juice and hot pepper sauce on a monthly basis appeared to exert a protective effect. Conclusions: Consumption of fried fast food items was significantly linked with an increased risk of developing CRC in Jordan. Creative Commons Attribution License
Bilalis, Dimitrios J; Katsenios, Nikolaos; Efthimiadou, Aspasia; Karkanis, Anestis
2012-12-01
Pre-sowing treatment of pulsed electromagnetic fields was used in corn seeds, in both indoor and outdoor conditions, in order to investigate the effect on plant growth and yield. The results of this research showed that pulsed electromagnetic fields can enhance plant characteristics, both under controlled environmental conditions and uncontrolled field conditions. The two varieties responded differently in the duration of magnetic field. Seeds were treated for 0, 15, 30, and 45 min with pulsed electromagnetic field (MF-0, MF-15, MF-30, and MF-45). Common corn variety performed better results in MF-30 treatment, while sweet corn variety performed better in MF-45 treatment. Magnetic field improved germination percentage, vigor, chlorophyll content, leaf area, plant fresh and dry weight, and finally yields. In the very interesting measurement of yield, seeds that have been exposed to magnetic field for 30 and 45 min have been found to perform the best results with no statistical differences among them. Another interesting finding was in root dry weight measurements, where magnetic field has a negative impact in MF-30 treatment in both hybrids, however without affecting other measurements. Enhancements on plant characteristics with economic impact on producer's income could be the future of a modern, organic, and sustainable agriculture.
PREDICTING THE EMERGENCE OF CORN ROOTWORM (Diabrotica virgifera virgifera LeConte IN ESTERN SLAVONIA
Directory of Open Access Journals (Sweden)
Dražen Đoić
2009-12-01
Full Text Available Corn (Zea mays L. is one of the most important field crops in Croatia, country as well as in the world. It is subjected to many pests, among which is corn rootworm. Corn rootworms (Diabrotica virgifera virgifera LeConte are economically significant pests of corn, especially at successive growing of corn or single culture growing. In our corn fields, corn rootworm was a pest since its first appearance in 1995, and more significant damages were detected in 2002. The monitoring of the corn rootworm population enables the development of more efficient models for predicting adult corn rootworm emergence and the control of these pests. The objective of this thesis is to determine the influence of row spacing to corn rootworm population, larval root damages and grain yield. Then, to develop models to predict adult corn rootworm emergence in Eastern Slavonia, based on accumulated degree-days for air temperature, and to determine optimum time for monitoring and for possible control of adult cron rootworms based on ovarian development of the gravid females. The researches were conducted in 2004 and in 2005 in Gunja and Soljani, with two sowing models, row spacing of 50 cm and 70 cm. Hybrid corn OSSK 552 was sown in four repetitions at both sites. Cages and pheromone traps were placed in order to estimate the first day of corn rootworm emergence (the biofix and to monitor the total population number. Predicting of the adult corn rootworm emergence was based on degree–days for air temperature from the biofix. In mid–July, evaluation of the larval damage was made according to the scale from 0–3. Ovarian development was determined by dissection of the gravid females, whereas the complete female gravidity and optimum time for scouting were determined based on degree–days accumulated from the biofix. The larval population was not significantly increased at the reduced row spacing. The number of the larvae per a plant was 24% higher on the average at 50
Directory of Open Access Journals (Sweden)
Rodino A.P.
1999-01-01
Full Text Available Common bean (Phaseolus vulgaris L. is widely intercropped with maize (Zea mays L. in the North of Spain. Breeding beans for multiple cropping systems is important for the development of a productive and sustainable agriculture, and is mainly oriented to minimize intercrop competition and to stabilize complementarity with maize. Most agricultural research on intercropping to date has focused on the agronomic and overall yield effects of the different species, but characters related with socio-economic and food quality aspects are also important. The effect of intercropping beans with maize on food seed quality traits was studied for thirty-five bush bean varieties under different environments in Galicia (Northwestern Spain. Parameters determining Asturian (Northern Spain white bean commercial and culinary quality have also been evaluated in fifteen accessions. There are significant differences between varieties in the selected cropping systems (sole crop, intercrop with field maize and intercrop with sweet maize for dry and soaked seed weight, coat proportion, crude protein, crude fat and moisture. Different white bean accessions have been chosen according to their culinary quality. Under these environmental conditions it appears that intercropping systems with sweet maize give higher returns than sole cropping system. It is also suggested that the culinary and nutritional quality potential of some white bean accessions could be the base material in a breeding programme the objectives of which are to develop varieties giving seeds with high food quality.
[Effect of extrusion on protein and starch bioavailability in corn and lima bean flour blends].
Pérez-Navarrete, Cecilia; Betancur-Ancona, David; Casotto, Meris; Carmona, Andrés; Tovar, Juscelino
2007-09-01
Extrusion is used to produce crunchy expanded foods, such as snacks. The nutritional impact of this process has not been studied sufficiently. In this study, in vitro and in vivo protein and starch bioavailability was evaluated in both raw and extruded corn (Zea mays)(C) and lima bean (Phaseolus lunatus)(B) flour blends, prepared in 75C/25B and 50C/ 50B (p/p) proportions. These were processed with a Brabender extruder at 160 degrees C, 100 rpm and 15.5% moisture content. Proximate composition showed that in the extruded products protein and ash contents increased whereas the fat level decreased. In vitro protein digestibility was higher in the extrudates (82%) than in the raw flours (77%). Potentially available starch and resistant starch contents decreased with extrusion. The in vitro assays indicated that extrusion improved protein and starch availability in the studied blends. In vivo bioavailability was evaluated using the rice weevil (Sithophilus oryzae) as a biological model. The most descriptive biomarkers of the changes suggested by the in vivo tests were body protein content (increased by extrusion) and intestinal a-amylase activity (decreased by processing). Overall, results suggest that extrusion notably increases the nutritional quality of corn and lima bean flour blends.
Directory of Open Access Journals (Sweden)
L. M. Santos
2003-11-01
Full Text Available Spodoptera frugiperda, the fall armyworm, is a very significant polyphagous pest due to the damages it causes, and control difficulties. Lack of information about its impact on sweet corn motivated a comparison of its biology, with respect to the larval and pupal stages, among the genotypes ELISA, BR 400 (sweet corns, and BR PAMPA (field corn. In laboratory conditions (25 ± 1ºC; 70 ± 10% RH; photophase 12 hours, 35 caterpillars were individualized and fed daily with 3.14 cm² sections of corn leaves from the referred-to genotypes, cultivated in plots in the experimental area of the Departament of Fitossanidade, UFRGS, Porto Alegre, RS from October to November 2000. The caterpillars were weighed daily; after each molt, the cephalic capsules were collected and measured (in width, to establish growth rate; pupae were weighed and sexed when 24 hours old. The duration of the larval instars, the pupal sex ratio, and the mortality of larvae and pupae were evaluated. In the first three instars there were no differences registered in capsule width. In the fourth and fifth instars, capsules of caterpillars kept in BR 400 were smaller. The weight of caterpillars and pupae, instar duration and sex ratio did not differ among the genotypes. Pupal phase duration was less in females kept in BR 400. Mortality was greater in the larval phase in ELISA and in the pupal phase in BR PAMPA.Spodoptera frugiperda, a lagarta-do-cartucho-do-milho, é uma praga polífaga de grande importância agrícola pelos danos e dificuldade de controle. A ausência de informações sobre seu impacto em milho doce motivou a comparação de sua biologia, no que tange as fases larval e pupal, entre os genótipos de milho ELISA, BR 400 (milhos doces e BR PAMPA (milho comum. Em condições de laboratório (25 ± 1ºC; 70 ± 10% UR; fotofase 12 horas, 35 lagartas foram individualizadas e alimentadas, diariamente, com seções de folhas de 3,14 cm² dos referidos genótipos, provenientes
Directory of Open Access Journals (Sweden)
Wagiman Wagiman
2012-05-01
Full Text Available The purpose of this research was to obtain a fermentation substrate with a high content of cellulose and hemicellulose, as well as to decrease the cellulose cystalinity. Dried corn stover was crushed to pass 40 mesh, added by Ca(OH and water, then heated at a certain time. The experimental design was prepared using a four-factor central composite design (CCD. The results of the chemical pretreatment were treated using hydrothermolysis methods for enhancing the lignin removal and decreasing cellulose crystalinity. The suitable process condition for chemical pretreatment was achieved at the loading of 0.075 g Ca(OH /g corn stover and 6.25 ml water/g corn stover, temperature 74.6 OC at 2 hours. After hydrothermolysis, cellulose and hemicellulose were dissolved at the percentages of 52.40 % and 31.84 % respectively, while the fraction of solid substrate had a composition of cellulose of 42.68 % and hemicellulosa of 34.68 %. The crystalinity of cellulose from the leaves, cobs, and cornhusk decreased significantly. The SEM results indicated that the surface of cell wall of corn stover had been perforated by these pretreatment processes. These pores might increase the enzymatic hydrolysis of the lignocellulosic corn stover. ABSTRAK Tujuan penelitian adalah mendapatkan substrat fermentasi dengan kandungan selulosa dan hemiselulosa tinggi serta menurunkan kristalinitas komponen selulosa. Limbah tanaman jagung yang sudah kering dihancurkan hingga lolos 40 mesh, ditambah Ca(OH dan air, kemudian dipanaskan pada suhu dan waktu tertentu. Rancangan percobaan disusun dengan menggunakan central composite design (CCD dengan empat faktor. Hasil terbaik tahap ini diberi perlakuan hidrotermolisis untuk meningkatkan penyisihan komponen lignin dan menurunkan kristalinitas selulosa. Hasil pene litian menunjukkan bahwa kondisi proses terbaik adalah penambahan 0,075 g Ca(OH /g biomas dan 6,25 ml air/g biomas, suhu pemanasan 74,6 OC dengan waktu 2 jam