WorldWideScience

Sample records for sweet basil ocimum

  1. Transfer of Downy Mildew Resistance from Wild Basil (Ocimum americanum) to Sweet Basil (O. basilicum).

    Science.gov (United States)

    Ben-Naim, Yariv; Falach, Lidan; Cohen, Yigal

    2018-01-01

    Sweet basil (Ocimum basilicum) is susceptible to downy mildew caused by the oomycete foliar pathogen Peronospora belbahrii. No resistant varieties of sweet basil are commercially available. Here, we report on the transfer of resistance gene Pb1 from the highly resistant tetraploid wild basil O. americanum var. americanum (PI 500945, 2n = 4x = 48) to the tetraploid susceptible O. basilicum 'Sweet basil' (2n = 4x = 48). F1 progeny plants derived from the interspecific hybridization PI 500945 × Sweet basil were resistant, indicating that the gene controlling resistance (Pb1) is dominant, but sterile due to the genetic distance between the parents. Despite their sterility, F1 plants were pollinated with the susceptible parent and 115 first backcross generation to the susceptible parent (BCs1) embryos were rescued in vitro. The emerging BCs1 plants segregated, upon inoculation, 5:1 resistant/susceptible, suggesting that resistance in F1 was controlled by a pair of dominant genes (Pb1A and Pb1A'). Thirty-one partially fertile BCs1 plants were self-pollinated to obtain BCs1-F2 or were backcrossed to Sweet basil to obtain the second backcross generation to the susceptible parent (BCs2). In total, 1 BCs1-F2 and 22 BCs2 progenies were obtained. The BCs1-F2 progeny segregated 35:1 resistant/susceptible, as expected from a tetraploid parent with two dominant resistant genes. The 22 BCs2 progenies segregated 1:1 resistant/susceptible (for a BCs1 parent that carried one dominant gene for resistance) or 5:1 (for a BCs1 parent that carried two dominant genes for resistance) at a ratio of 4:1. The data suggest that a pair of dominant genes (Pb1A and Pb1A') residing on a two homeologous chromosomes is responsible for resistance of PI 500945 against P. belbahrii.

  2. Effect of methyl jasmonate on secondary metabolites of sweet basil (Ocimum basilicum L.).

    Science.gov (United States)

    Kim, Hyun-Jin; Chen, Feng; Wang, Xi; Rajapakse, Nihal C

    2006-03-22

    The effect of methyl jasmonate (MeJA) in terms of its induction of inherent bioactive chemicals in sweet basil (Ocimum basilicum L.) was evaluated after MeJA was sprayed on healthy basil plants. The total phenolic content of the sweet basil significantly increased after 0.1 and 0.5 mM MeJA treatments compared with the control not subjected to MeJA. Two phenolic compounds, rosmarinic acid (RA) and caffeic acid (CA), were identified as strong antioxidant constituents of the sweet basil. Their amounts also significantly increased after the MeJA treatment. In addition, eugenol and linalool increased 56 and 43%, respectively, by the 0.5 mM MeJA treatment. Due to the accumulation of RA, CA, and eugenol, which possess strong 2,2-diphenyl-1-picrylhydrazyl (DPPH*) free radical scavenging activities, the antioxidant activity of the sweet basil extract was 2.3-fold greater than that of the control after the 0.5 mM MeJA treatment. In the DPPH* assay, the EC50 values of RA, CA, and eugenol were determined as 23, 46, and 59 microM, respectively, which indicated they were 6-, 3-, and 2.4-fold more efficient than BHT (140 microM). Besides, an unidentified HPLC peak in the methanolic extract of the sweet basil was 4.3-fold higher than that of the control after the 0.5 mM MeJA treatment.

  3. Biodiesel production by lipase-catalyzed transesterification of Ocimum basilicum L. (sweet basil) seed oil

    International Nuclear Information System (INIS)

    Amini, Zeynab; Ong, Hwai Chyuan; Harrison, Mark D.; Kusumo, Fitranto; Mazaheri, Hoora; Ilham, Zul

    2017-01-01

    Highlights: • Need for alternative energy has led to explore new feedstock. • Ocimum basilicum seeds oil was used as biodiesel feedstock. • Biodiesel was produced via lipase-catalyzed transesterification by Novozym. • Artificial neural network with genetic algorithm modelling was employed. - Abstract: The increasing global demand for fuel, limited fossil fuel resources, and increasing concern about the upturn in gaseous CO_2 emissions are the key drivers of research and development into sources of renewable liquid transport fuels, such as biodiesel. In the present work, we demonstrate biodiesel production from Ocimum basilicum (sweet basil) seed oil by lipase-catalyzed transesterification. Sweet basil seeds contain 22% oil on a dry weight basis. Artificial neural network with genetic algorithm modelling was used to optimize reaction. Temperature, catalyst concentration, time, and methanol to oil molar ratio were the input factors in the optimization study, while fatty acid methyl ester (FAME) yield was the key model output. FAME composition was determined by gas chromatography mass spectrometry. The optimized transesterification process resulted in a 94.58% FAME yield after reaction at 47 °C for 68 h in the presence of 6% w/w catalyst and a methanol to oil ratio of 10:1. The viscosity, density, calorific value, pour point, and cloud point of the biodiesel derived from sweet basil seed oil conformed to the EN 14214 and ASTM D6751 standard specifications. The antioxidant stability of the biodiesel did not meet these specifications but could be improved via the addition of antioxidant.

  4. Organic versus conventional fertilization effects on sweet basil (Ocimum basilicum L.) growth in a greenhouse system

    Science.gov (United States)

    Ocimum basilicum L. (sweet basil) is an essential oil producing crop used in culinary and fragrance applications. The objective of this controlled environment study was to evaluate the effects of organic and conventional fertilization, (applied at two nitrogen rates, 150 and 250 kg N/ha), on plant g...

  5. Resistance Against Basil Downy Mildew in Ocimum Species.

    Science.gov (United States)

    Ben-Naim, Yariv; Falach, Lidan; Cohen, Yigal

    2015-06-01

    Downy mildew, caused by the oomycete Peronospora belbahrii, is a devastating disease of sweet basil. In this study, 113 accessions of Ocimum species (83 Plant Introduction entries and 30 commercial entries) were tested for resistance against downy mildew at the seedling stage in growth chambers, and during three seasons, in the field. Most entries belonging to O. basilicum were highly susceptible whereas most entries belonging to O. americanum, O. kilimanadascharicum, O. gratissimum, O. campechianum, or O. tenuiflorum were highly resistant at both the seedling stage and the field. Twenty-seven highly resistant individual plants were each crossed with the susceptible sweet basil 'Peri', and the F1 progeny plants were examined for disease resistance. The F1 plants of two crosses were highly resistant, F1 plants of 24 crosses were moderately resistant, and F1 plants of one cross were susceptible, suggesting full, partial, or no dominance of the resistance gene(s), respectively. These data confirm the feasibility of producing downy mildew-resistant cultivars of sweet basil by crossing with wild Ocimum species.

  6. Utilization of heavy metal-rich tannery sludge for sweet basil (Ocimum basilicum L.) cultivation.

    Science.gov (United States)

    Chand, Sukhmal; Singh, Shweta; Singh, Vinay Kumar; Patra, D D

    2015-05-01

    Unlike food crops, essential oil-bearing crops in which the oil is extracted through hydro-distillation can be a suitable crop to be grown in heavy metal-polluted soils as the oil does not carry any heavy metal. In a field experiment conducted at CIMAP, Lucknow, India during 2011 and 2012, influence of six doses of tannery sludge viz 0, 10, 20, 30, 40, and 50 t ha(-1) were tested, taking sweet basil (Ocimum basilicum) as the test crop. Maximum herb yield was obtained with the application of sludge at 20 t ha(-1). While in root, accumulation of Cd and Pb increased significantly up to 20 t ha(-1), Cr accumulation increased with increasing the dose of tannery sludge reaching maximum at 50 t ha(-1). Essential oil yield of basil (Ocimum basilicum) was significantly affected due to sludge application. Quality of essential oil, in term of chemical constituents, however, was marginally influenced due to tannery sludge application.

  7. First report of tomato chlorotic spot virus in sweet basil (Ocimum basilicum) and purslane (Portulaca oleracea) in Florida

    Science.gov (United States)

    Tomato chlorotic spot virus (TCSV) has been recently detected in tomato, pepper, hoya and vinca in Florida. Observations of additional crops in 2016 and 2017 revealed TCSV-like symptoms. Testing of these symptomatic plants identified three new hosts of TCSV in Florida: sweet basil (Ocimum basilicu...

  8. Herb yield and chemical composition of basil ( Ocimum basilicum L ...

    African Journals Online (AJOL)

    Background: Ocimum basilicum L., commonly known as sweet basil, is an important aromatic plant cultivated in many parts of the world for its essential oil. Basil does not show natural distribution in Turkey but they are cultivated as medicinal, seasoning or oil plants especially in the western and southern Anatolia.

  9. Evaluation of replacement intercropping of soybean (Glycine max L. with sweet basil (Ocimum basilicum L. and borage (Borago officinalis L. under weed infestation

    Directory of Open Access Journals (Sweden)

    M. Bagheri Shirvan

    2016-05-01

    Full Text Available In order to evaluate intercropping of soybean (Glycine max L. cv. JK with sweet basil (Ocimum basilicum L. and borage (Borago officinalis L. with weed interference, an experiment was performed in randomized complete block design with 12 treatments and three replications at a field located 10 km of Shirvan during year of 2011. The treatments were included 75% soybean: 25%sweet basil, 50%soybean: 50% sweet basil, 25% soybean: 75% sweet basil, 75% soybean: 25% borage, 50% soybean: 50% borage and 25% soybean: 75% borage under weed infestation, in addition sole cropping of plants under weed control and weed interference. Intercropped plants had more success in reduction of weed density and biomass compared to monoculture. Soybean50: sweet basil50, reduced the weed density by 47.95% and 52.9%, and reduced the weed biomass by 68.91% and 61.87% more than sweet basil and soybean pure stand, respectively. Investigation of dry matter accumulation showed that increasing of plant proportion in intercropping caused increasing of plant dry matter. The height of soybean and borage was increased in intercropping and weed interference, while the highest height of sweet basil was observed in monoculture at second harvest. Biological and economical yield of soybean in intercropping with sweet basil was higher than intercropping with borage. The highest harvest index was related to 50:50 soybean: sweet basil ratio. In this ratio, the harvest index increased 4.9% compared to soybean monoculture. Yield of sweet basil and borage decreased with increasing of soybean rows in intercropping. Based on area-time equivalent ratio, soybean 75% with sweet basil and borage 25% (based on borage seed yield had 3% and 4% advantage compared to monoculture.

  10. Photoprotection by foliar anthocyanins mitigates effects of boron toxicity in sweet basil (Ocimum basilicum).

    Science.gov (United States)

    Landi, Marco; Guidi, Lucia; Pardossi, Alberto; Tattini, Massimiliano; Gould, Kevin S

    2014-11-01

    Boron (B) toxicity is an important agricultural problem in arid environments. Excess edaphic B compromises photosynthetic efficiency, limits growth and reduces crop yield. However, some purple-leafed cultivars of sweet basil (Ocimum basilicum) exhibit greater tolerance to high B concentrations than do green-leafed cultivars. We hypothesised that foliar anthocyanins protect basil leaf mesophyll from photo-oxidative stress when chloroplast function is compromised by B toxicity. Purple-leafed 'Red Rubin' and green-leafed 'Tigullio' cultivars, grown with high or negligible edaphic B, were given a photoinhibitory light treatment. Possible effects of photoabatement by anthocyanins were simulated by superimposing a purple polycarbonate filter on the green leaves. An ameliorative effect of light filtering on photosynthetic quantum yield and on photo-oxidative load was observed in B-stressed plants. In addition, when green protoplasts from both cultivars were treated with B and illuminated through a screen of anthocyanic protoplasts or a polycarbonate film which approximated cyanidin-3-O-glucoside optical properties, the degree of photoinhibition, hydrogen peroxide production, and malondialdehyde content were reduced. The data provide evidence that anthocyanins exert a photoprotective role in purple-leafed basil mesophyll cells, thereby contributing to improved tolerance to high B concentrations.

  11. Biosynthesis of estragole and methyl-eugenol in sweet basil (Ocimum basilicum L). Developmental and chemotypic association of allylphenol O-methyltransferase activities.

    Science.gov (United States)

    Lewinsohn, E; Ziv-Raz, I; Dudai, N; Tadmor, Y; Lastochkin, E; Larkov, O; Chaimovitsh, D; Ravid, U; Putievsky, E; Pichersky, E; Shoham, Y

    2000-12-07

    Sweet basil (Ocimum basilicum L., Lamiaceae) is a common herb, used for culinary and medicinal purposes. The essential oils of different sweet basil chemotypes contain various proportions of the allyl phenol derivatives estragole (methyl chavicol), eugenol, and methyl eugenol, as well as the monoterpene alcohol linalool. To monitor the developmental regulation of estragole biosynthesis in sweet basil, an enzymatic assay for S-adenosyl-L-methionine (SAM):chavicol O-methyltransferase activity was developed. Young leaves display high levels of chavicol O-methyltransferase activity, but the activity was negligible in older leaves, indicating that the O-methylation of chavicol primarily occurs early during leaf development. The O-methyltransferase activities detected in different sweet basil genotypes differed in their substrate specificities towards the methyl acceptor substrate. In the high-estragole-containing chemotype R3, the O-methyltransferase activity was highly specific for chavicol, while eugenol was virtually not O-methylated. In contrast, chemotype 147/97, that contains equal levels of estragole and methyl eugenol, displayed O-methyltransferase activities that accepted both chavicol and eugenol as substrates, generating estragole and methyl eugenol, respectively. Chemotype SW that contains high levels of eugenol, but lacks both estragole and methyl eugenol, had apparently no allylphenol dependent O-methyltransferase activities. These results indicate the presence of at least two types of allylphenol-specific O-methyltransferase activities in sweet basil chemotypes, one highly specific for chavicol; and a different one that can accept eugenol as a substrate. The relative availability and substrate specificities of these O-methyltransferase activities biochemically rationalizes the variation in the composition of the essential oils of these chemotypes.

  12. Basil (Ocimum basilicum L.) oils

    Science.gov (United States)

    Basil (Ocimum basilicum) is one of the most popular and healthy culinary herbs in the world. Essential oil derived from basil (basil oil) through steam distillation has traditionally been used for a wide range of applications such as cooking spices, aromatherapy, perfumery, medicinal treatments, pes...

  13. Effect of Salt Stress and Irrigation Water on Growth and Development of Sweet Basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Caliskan Omer

    2017-11-01

    Full Text Available This study was conducted to assess the influence of different salinity and irrigation water treatments on the growth and development of sweet basil (Ocimum basilicum L.. Five salinity levels (0.4, 1.00, 2.50, 4.00 and 8.00 dSm-1 and three different irrigation water regimes (80, 100, 120% of full irrigation were applied in a factorial design with three replications. Dry root weight, aerial part dry weight and aerial part/root ratio were determined and evaluated as experimental parameters at the end of growing period. Results revealed significant decreases in yields with increasing salinity levels. However, basil managed to survive high salt stress. With increasing salinity levels, decreases in growth were higher in roots than in leaves. Changes in the amount of irrigation water also significantly affected the evaluated parameters.

  14. Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet ...

    African Journals Online (AJOL)

    We evaluated the effects of aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) on sodium arsenite-induced hepatotoxicity in Wistar rats. We observed that treatment of the animals with the extracts before or just after sodium arsenite administration significantly (p < 0.05) reduced mean liver and serum ...

  15. Light Quality Dependent Changes in Morphology, Antioxidant Capacity, and Volatile Production in Sweet Basil (Ocimum basilicum).

    Science.gov (United States)

    Carvalho, Sofia D; Schwieterman, Michael L; Abrahan, Carolina E; Colquhoun, Thomas A; Folta, Kevin M

    2016-01-01

    Narrow-bandwidth light treatments may be used to manipulate plant growth, development and metabolism. In this report LED-based light treatments were used to affect yield and metabolic content of sweet basil (Ocimum basilicum L. cv "Ceasar") grown in controlled environments. This culinary herb produces an aroma highly appreciated by consumers, primarily composed of terpenes/terpenoids, phenylpropanoids, and fatty-acid- derived volatile molecules. Basil plants were grown under narrow-bandwidth light conditions, and leaf area, height, mass, antioxidant capacity and volatile emissions were measured at various time points. The results indicate reproducible significant differences in specific volatiles, and in biochemical classes of volatiles, compared to greenhouse grown plants. For example, basil plants grown under blue/red/yellow or blue/red/green wavelengths emit higher levels of a subset of monoterpenoid volatiles, while a blue/red/far-red treatment leads to higher levels of most sesquiterpenoid volatile molecules. Specific light treatments increase volatile content, mass, and antioxidant capacity. The results show that narrow-bandwidth illumination can induce discrete suites of volatile classes that affect sensory quality in commercial herbs, and may be a useful tool in improving commercial production.

  16. α-Linalool - a marker compound of forged/synthetic sweet basil (Ocimum basilicum L.) essential oils.

    Science.gov (United States)

    Radulović, Niko S; Blagojević, Polina D; Miltojević, Ana B

    2013-10-01

    Ocimum basilicum L. (sweet basil) is known to occur as several chemotypes or cultivars that differ in their essential oil composition. The surprising discovery of 3,7-dimethylocta-1,7-dien-3-ol, the rare α isomer of the well-known monoterpene alcohol β-linalool (3,7-dimethylocta-1,6-dien-3-ol), in samples of Serbian basil oil provoked an investigation of the origin of α-linalool in these samples. Three scenarios were considered, namely (a) the existence of a new natural chemotype, (b) an artefactual formation during the isolation procedure and (c) the case of a synthetic/forged oil. Noteworthy amounts (15.1-16.9%) of pure α-linalool were isolated from a commercial sample of basil oil, and detailed spectral analyses (MS, IR, (1) H and (13) C NMR) unequivocally confirmed its identity. The analysis by GC and GC/MS of an additional 20 samples of different O. basilicum oils commercially available on the Serbian market or isolated from plant material cultivated in Serbia resulted in the identification of 149 compounds. The obtained compositional data were compared using multivariate statistical analysis to reveal the possible existence of a new basil chemotype. The results of the chemical and statistical analyses give more pro arguments for the synthetic/forged oil hypothesis and suggest that α-linalool could be used as a marker compound of such O. basilicum oils. © 2013 Society of Chemical Industry.

  17. Essential oil composition of sweet basil (Ocimum basilicum L.) in symbiotic relationship with Piriformospora indica and paclobutrazol application under salt stress.

    Science.gov (United States)

    Keramati, Sara; Pirdashti, Hemmatollah; Babaeizad, Valliollah; Dehestani, Ali

    2016-12-01

    Essential oil content and oil composition of paclobutrazol treated sweet basil (Ocimum basilicum L.) plant inoculated with Piriformospora indica under salt stress were investigated by GC-MS. The results show a slight increase in essential oil content when basil plants subjected to moderate salinity stress (3 dS m -1 of NaCl). It decreased signifiicantly with increasing salinity level to 9 dS m -1 . The findings revealed that leaf area, above ground and leaf dry weights, essential oil content and yield were significantly affected by P. indica inoculation, however paclobutrazol application significantly influenced essential oil yield but not content. Fungal symbiosis as well as paclobutrazol application ameliorated the negative effects of salinity on dry matter and essential oil yield. The main constituents found in the volatile oil of O. basilicum in control treatment were Geranial (26.03%), Neral (24.88%) and Estragole (24.78%). The compounds concentrations showed some differences in P. indica and paclobutrazol treatments. The results demonstrate that micorrhiza-like fungi concomitantly increase essential oil production and biomass in sweet basil, a medicinal herb rich in commercially valuable essential oils.

  18. The Effect of Static Magnetic Forces on Water Contents and Photosynthetic Pigments in Sweet Basil Ocimum basilicum L. (Lamiaceae)

    Energy Technology Data Exchange (ETDEWEB)

    Taia, Wafaa K; Kotbi, Abeer M [Alexandria Univ., Faculty of Science, Botany Dept., Alexandria (Egypt); AlZahrani, Hassan S [Faculty of Science, King AbdulAziz Univ., Biology Dept., Jeddah (Saudi Arabia)

    2007-07-01

    Three different magnetic regimes; aerial, surface and buried; each with three different forces, have been used to investigate their effects on the water contents and photosynthetic pigments of sweet basil plants (Ocimum basilicum L.). Two groups of sweet basil seeds, Ocimum basilicum L. have been cultivated, one under normal conditions and the second has been subdivided into three portion (aerial, surface and buried) to examine the effect of different magnetic forces coming from the three directions on the resulted plants. At all directions of magnets, water contents have been significantly affected by the magnetic forces. Chlorophyll A and carotene contents have been affected, as well, according to the three magnetic forces coming from soil surface regime only. Chlorophyll B did not significantly affected by differences magnetic forces in the three regimes, but it is affected by magnetism wherever its direction or force. But all the photosynthetic pigments contents (Chlorophyll A, B and Carotenes) decreased significantly than the control in the three magnetic regimes., but without any effect according to differences in the magnetic force in the aerial and burried regimes of magnetism. It was concluded that magnetism affects both water absorption and retention , the most influenced regime was the aerial magnets followed by the surface and buried ones. This result can be interpreted by the ionization of water which makes water ions respond to magnetic forces. Photosynthetic pigments have been decreased significantly by the exposure to magnetic fields, irrespective to its direction or force and this may be due to the effect of magnetic fields on the reduction in plastids inside the cells. (author)

  19. The Effect of Static Magnetic Forces on Water Contents and Photosynthetic Pigments in Sweet Basil Ocimum basilicum L. (Lamiaceae)

    International Nuclear Information System (INIS)

    Taia, Wafaa K; Kotbi, Abeer M; AlZahrani, Hassan S

    2007-01-01

    Three different magnetic regimes; aerial, surface and buried; each with three different forces, have been used to investigate their effects on the water contents and photosynthetic pigments of sweet basil plants (Ocimum basilicum L.). Two groups of sweet basil seeds, Ocimum basilicum L. have been cultivated, one under normal conditions and the second has been subdivided into three portion (aerial, surface and buried) to examine the effect of different magnetic forces coming from the three directions on the resulted plants. At all directions of magnets, water contents have been significantly affected by the magnetic forces. Chlorophyll A and carotene contents have been affected, as well, according to the three magnetic forces coming from soil surface regime only. Chlorophyll B did not significantly affected by differences magnetic forces in the three regimes, but it is affected by magnetism wherever its direction or force. But all the photosynthetic pigments contents (Chlorophyll A, B and Carotenes) decreased significantly than the control in the three magnetic regimes., but without any effect according to differences in the magnetic force in the aerial and burried regimes of magnetism. It was concluded that magnetism affects both water absorption and retention , the most influenced regime was the aerial magnets followed by the surface and buried ones. This result can be interpreted by the ionization of water which makes water ions respond to magnetic forces. Photosynthetic pigments have been decreased significantly by the exposure to magnetic fields, irrespective to its direction or force and this may be due to the effect of magnetic fields on the reduction in plastids inside the cells. (author)

  20. Comparing the Effects of Benzyladenine and meta-Topolin on Sweet Basil (Ocimum basilicum Micropropagation

    Directory of Open Access Journals (Sweden)

    Szidónia KŐSZEGHI

    2014-12-01

    Full Text Available Micropropagation of aromatic plants reveals an effective way of obtaining high volume, virus-free plant material of uniform quality. The application of meta-Topolin (mT (N6-(2-hydroxybenzyl adenine-9-riboside and aromatic cytokinin as Benzyladenine (BAP in the micro propagation of sweet basil (Ocimum basilicum L. was tested for the first time and plant growth parameters assessed to determine the optimum level of these cytokinins. Additionally, the rate of root-growth inhibition due to these two cytokinins was also assessed. Our results show that 1 mg/l (4.43 mM BAP and 0.5 mg/l (2.07 mMmT produced the most favourable effects on new shoot developments. Meta-Topolin was shown to increase the quality of the plants and in comparison with BAP fewer distortions were observed. No significant differences in root-growth inhibition between the mT and BAP were detected.  

  1. Basil (Ocimum basilicum L. essential oil and extracts obtained by supercritical fluid extraction

    Directory of Open Access Journals (Sweden)

    Zeković Zoran P.

    2015-01-01

    Full Text Available The extracts obtained from sweet basil (Ocimum basilicum L. by hydrodistillation and supercritical fluid extraction (SFE were qualitative and quantitative analyzed by GC-MS and GC-FID. Essential oil (EO content of basil sample, determined by an official method, was 0.565% (V/w. The yields of basil obtained by SFE were from 0.719 to 1.483% (w/w, depending on the supercritical fluid (carbon dioxide density (from 0.378 to 0.929 g mL-1. The dominant compounds detected in all investigated samples (EO obtained by hydrodistillation and different SFE extracts were: linalool, as the major compound of basil EO (content from 10.14 to 49.79%, w/w, eugenol (from 3.74 to 9.78% and ä-cardinene (from 3.94 to 8.07%. The quantitative results of GC-MS from peak areas and by GC-FID using external standard method involving main standards, were compared and discussed. [Projekat Ministarstva nauke Republike Srbije, br. TR 31013

  2. Characterization of organic and conventional sweet basil leaves using chromatographic and flow-injection mass spectrometric (FIMS) fingerprints combined with principal component analysis

    Science.gov (United States)

    Lu, Yingjian; Gao, Boyan; Chen, Pei; Charles, Denys; Yu, Liangli (Lucy)

    2014-01-01

    Sweet basil, Ocimum basilicum., is one of the most important and wildly used spices and has been shown to have antioxidant, antibacterial, and anti-diarrheal activities. In this study, high performance liquid chromatographic (HPLC) and flow-injection mass spectrometric (FIMS) fingerprinting techniques were used to differentiate organic and conventional sweet basil leaf samples. Principal component analysis (PCA) of the fingerprints indicated that both HPLC and FIMS fingerprints could effectively detect the chemical differences in the organic and conventional sweet basil leaf samples. This study suggested that the organic basil sample contained greater concentrations of almost all the major compounds than its conventional counterpart on a per same botanical weight basis. The FIMS method was able to rapidly differentiate the organic and conventional sweet basil leaf samples (1 min analysis time), whereas the HPLC fingerprints provided more information about the chemical composition of the basil samples with a longer analytical time. PMID:24518341

  3. Improvement in Flavonoids and Phenolic Acids Production and Pharmaceutical Quality of Sweet Basil (Ocimum basilicum L.) by Ultraviolet-B Irradiation.

    Science.gov (United States)

    Ghasemzadeh, Ali; Ashkani, Sadegh; Baghdadi, Ali; Pazoki, Alireza; Jaafar, Hawa Z E; Rahmat, Asmah

    2016-09-09

    Sweet basil (Ocimum basilicum Linnaeus) is aromatic herb that has been utilized in traditional medicine. To improve the phytochemical constituents and pharmaceutical quality of sweet basil leaves, ultraviolet (UV)-B irradiation at different intensities (2.30, 3.60, and 4.80 W/m²) and durations (4, 6, 8, and 10-h) was applied at the post-harvest stage. Total flavonoid content (TFC) and total phenolic content (TPC) were measured using spectrophotometric method, and individual flavonoids and phenolic acids were identified using ultra-high performance liquid chromatography. As a key enzyme for the metabolism of flavonoids, chalcone synthase (CHS) activity, was measured using a CHS assay. Antioxidant activity and antiproliferative activity of extracts against a breast cancer cell line (MCF-7) were evaluated using 1,1-diphenyl-2-picrylhydrazyl (DPPH) assays and MTT (3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide) assays, respectively. UV-B irradiation at an intensity of 3.60 W/m² increased TFC approximately 0.85-fold and also increased quercetin (0.41-fold), catechin (0.85-fold), kaempferol (0.65-fold) rutin (0.68-fold) and luteolin (1.00-fold) content. The highest TPC and individual phenolic acid (gallic acid, cinnamic acid and ferulic acid) was observed in the 3.60 W/m² of UV-B treatment. Cinnamic acid and luteolin were not detected in the control plants, production being induced by UV-B irradiation. Production of these secondary metabolites was also significantly influenced by the duration of UV-B irradiation. Irradiation for 8-h led to higher TFC, TPC and individual flavonoids and phenolic acids than for the other durations (4, 8, and 10-h) except for cinnamic acid, which was detected at higher concentration when irradiated for 6-h. Irradiation for 10-h significantly decreased the secondary metabolite production in sweet basil leaves. CHS activity was induced by UV-B irradiation and highest activity was observed at 3.60 W/m² of UV-B irradiation. UV

  4. Improvement in Flavonoids and Phenolic Acids Production and Pharmaceutical Quality of Sweet Basil (Ocimum basilicum L. by Ultraviolet-B Irradiation

    Directory of Open Access Journals (Sweden)

    Ali Ghasemzadeh

    2016-09-01

    Full Text Available Sweet basil (Ocimum basilicum Linnaeus is aromatic herb that has been utilized in traditional medicine. To improve the phytochemical constituents and pharmaceutical quality of sweet basil leaves, ultraviolet (UV-B irradiation at different intensities (2.30, 3.60, and 4.80 W/m2 and durations (4, 6, 8, and 10-h was applied at the post-harvest stage. Total flavonoid content (TFC and total phenolic content (TPC were measured using spectrophotometric method, and individual flavonoids and phenolic acids were identified using ultra-high performance liquid chromatography. As a key enzyme for the metabolism of flavonoids, chalcone synthase (CHS activity, was measured using a CHS assay. Antioxidant activity and antiproliferative activity of extracts against a breast cancer cell line (MCF-7 were evaluated using 1,1-diphenyl-2-picrylhydrazyl (DPPH assays and MTT (3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide assays, respectively. UV-B irradiation at an intensity of 3.60 W/m2 increased TFC approximately 0.85-fold and also increased quercetin (0.41-fold, catechin (0.85-fold, kaempferol (0.65-fold rutin (0.68-fold and luteolin (1.00-fold content. The highest TPC and individual phenolic acid (gallic acid, cinnamic acid and ferulic acid was observed in the 3.60 W/m2 of UV-B treatment. Cinnamic acid and luteolin were not detected in the control plants, production being induced by UV-B irradiation. Production of these secondary metabolites was also significantly influenced by the duration of UV-B irradiation. Irradiation for 8-h led to higher TFC, TPC and individual flavonoids and phenolic acids than for the other durations (4, 8, and 10-h except for cinnamic acid, which was detected at higher concentration when irradiated for 6-h. Irradiation for 10-h significantly decreased the secondary metabolite production in sweet basil leaves. CHS activity was induced by UV-B irradiation and highest activity was observed at 3.60 W/m2 of UV-B irradiation. UV

  5. Characterization of Peronospora belbahrii on basil under light and scanning electron microscopy

    Science.gov (United States)

    Basil (Ocimum spp.) downy mildew caused by Peronsoora belbahrii is a major yield-limiting disease of sweet basil (O. basilicum) production worldwide. In this study, sweet basil was grown in a soilless potting mix in plant growth chambers and inoculated with sporangia of P. belbahrii harvested from p...

  6. Quality of four basil types after storage at 3 to 10 C

    Science.gov (United States)

    Sweet basil (Ocimum basilicum) has global culinary use as a fresh herb. Basil can also be dried and extracted for its essential oils and grows extremely well in the warm climate of Oklahoma. Several cultivars of sweet basil are known to be chill sensitive when stored below 7 C. In this study, fou...

  7. Comparing the Effects of Benzyladenine and meta-Topolin on Sweet Basil (Ocimum basilicum Micropropagation

    Directory of Open Access Journals (Sweden)

    Szidónia KŐSZEGHI

    2014-12-01

    Full Text Available Micropropagation of aromatic plants reveals an effective way of obtaining high volume, virus-free plant material of uniform quality. The application of meta-Topolin (mT (N6-(2-hydroxybenzyl adenine-9-riboside and aromatic cytokinin as Benzyladenine (BAP in the micro propagation of sweet basil (Ocimum basilicum L. was tested for the first time and plant growth parameters assessed to determine the optimum level of these cytokinins. Additionally, the rate of root-growth inhibition due to these two cytokinins was also assessed. Our results show that 1 mg/l (4.43 mM BAP and 0.5 mg/l (2.07 mMmT produced the most favourable effects on new shoot developments. Meta-Topolin was shown to increase the quality of the plants and in comparison with BAP fewer distortions were observed. No significant differences in root-growth inhibition between the mT and BAP were detected.

  8. Seed Germination and Early Growth Responses of Hyssop, Sweet Basil and Oregano to Temperature Levels

    Directory of Open Access Journals (Sweden)

    Sajad MIJANI

    2013-12-01

    Full Text Available The objectives of this survey were to determine the effect of temperature on germination and seedling growth of Hyssop (Hyssopus officinalis L., Sweet basil (Ocimum basilicum L. and Oregano (Origanum vulgare L. (Lamiaceae family as well as comparing species regarding germination behavior and growth characteristics. Seeds were germinated on a temperature-gradient bar varying between 5 and 40 °C (with 5 °C intervals. Results indicated that the highest germination percentage of hyssop (92-98%, sweet basil (86-90% and oregano (74-77% occurred at 20-30 °C, 25-30 °C and 20-30 °C, respectively; therefore, moderate and warm temperatures are proper for germination of all species. In all species the maximum germination rate obtained at 30 °C. Among all species, Day 10 % of Sweet basil Germination had the lowest value, which indicates faster germination. The cardinal temperatures (base, optimum and ceiling or maximum were estimated by the segmented model. Base temperature (Tb was calculated for hyssop, sweet basil and oregano as 3.42, 5.70 and 5.46 °C, respectively. Optimal temperature (To calculated for all species was approximately 30°C, So warmer temperatures are much more proper for them. The species showed different maximum temperatures (Tm from 42.91 (Oregano to 48.05 °C (Hyssop. In Hyssop and Sweet basil optimum growth of seedlings were observed at 30°C while Oregano reached its best growth at 25°C. The difference between maximum and minimum temperatures of germination knowing as temperature range (TR index could show adaptation capability to broad sites for planting and domestication. Regarding this index Hyssop stood in the first place.

  9. Effect of drip irrigation on yield, evapotranspiration and water use efficiency of sweet basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Pejić Borivoj

    2017-01-01

    Full Text Available The experiments showing the effect of drip irrigation on yield, evapotranspiration and water productivity of sweet basil (Ocimum basilicum L. were conducted at the experimental field of the Alternative Crops Department, Institute of Field and Vegetable Crops, Novi Sad. Irrigation was scheduled on the basis of the water balance method. Daily evapotranspiration (ETd was computed from the reference evapotranspiration (ETo and crop coefficient (kc in May, June, July and August of 0.5, 0.6, 1.1 and 1.0, respectively. ETo was calculated using Hargreaves equation. The irrigation depth was restricted to the soil depth of 0.3 m. In other words, irrigation started when readily available water in the soil layer of 0.3 m was completely depleted by plants. The irrigation rate was 30 mm (30 l m-2 while the amount of water added by irrigation during the season was 140 mm. Basil sensitivity to water stress was determined using a yield response factor (Ky. According to the results, the yield of fresh herb of basil under irrigation (32.015 t ha-1 was higher by 9% compared to non-irrigated, control variant (29.364 t ha-1. Worthy of note, basil essential oil yield was significantly affected by irrigation (35.329/28.766 kg ha-1. The content of essential oil was significantly higher in irrigated (6.45 g kg-1 than in non-irrigated variant (5.33 g kg-1 in the first harvest, while no significant difference between irrigated and non-irrigated variants was obtained in the second harvest (6.83 and 6.62 g kg-1 , respectively. Water used on evapotranspiration in irrigation conditions (ETm was 431 mm and 270 mm in non-irrigated, control variant (ETa. The values of irrigation water use efficiency (Iwue and evapotranspiration water use efficiency (ETwue were 1.89 kg m-3 and 1.65 kg m-3 respectively. Ky value (0.22 exhibits all essential characteristics of climate conditions of 2016 rainy year. These preliminary results could be used as a good platform for basil growers in the

  10. Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) protect against sodium arsenite-induced hepatotoxicity in Wistar rats.

    Science.gov (United States)

    Gbadegesin, M A; Odunola, O A

    2010-11-25

    We evaluated the effects of aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) on sodium arsenite-induced hepatotoxicity in Wistar rats. We observed that treatment of the animals with the extracts before or just after sodium arsenite administration significantly (p < 0.05) reduced mean liver and serum γ-Glutamyl transferase (γGT), and serum alkaline phosphatase (ALP) activities when compared with the group administered the toxin alone. In addition, treatments of the animals with aqueous or ethanolic extract of O. basilicum before the administration of sodium arsenite resulted in the attenuation of the sodium arsenite-induced aspartate and alanine aminotransferase activities: ALT (from 282.6% to 167.7% and 157.8%), AST (from 325.1% to 173.5% and 164.2%) for the group administered sodium arsenite alone, the aqueous extracts plus sodium arsenite, and ethanolic extracts plus sodium arsenite respectively, expressed as percentage of the negative control. These findings support the presence of hepatoprotective activity in the O.basilicum extracts.

  11. Effects of nitrogen fertilization on the phenolic composition and antioxidant properties of basil (Ocimum basilicum L.).

    Science.gov (United States)

    Nguyen, Phuong M; Niemeyer, Emily D

    2008-09-24

    Many herbs and spices have been shown to contain high levels of polyphenolic compounds with potent antioxidant properties. In the present study, we explore how nutrient availability, specifically nitrogen fertilization, affects the production of polyphenolic compounds in three cultivars (Dark Opal, Genovese, and Sweet Thai) of the culinary herb, basil ( Ocimum basilicum L.). Nitrogen fertilization was found to have a significant effect on total phenolic levels in Dark Opal ( p basil with statistically higher phenolic contents observed when nutrient availability was limited at the lowest (0.1 mM) applied nitrogen treatment. Similarly, basil treated at the lowest nitrogen fertilization level generally contained significantly higher rosmarinic ( p = 0.001) and caffeic ( p = 0.001) acid concentrations than basil treated at other nitrogen levels. Nitrogen fertilization also affected antioxidant activity ( p = 0.002) with basil treated at the highest applied nitrogen level, 5.0 mM, exhibiting lower antioxidant activity than all other nitrogen treatments. The anthocyanin content of Dark Opal basil was not affected by applied nitrogen level, but anthocyanin concentrations were significantly impacted by growing season ( p = 0.001). Basil cultivar was also determined to have a statistically significant effect on total phenolic levels, rosmarinic and caffeic acid concentrations, and antioxidant activities.

  12. Yield and oil composition of 38 basil (Ocimum basilicum L.) accessions grown in Mississippi.

    Science.gov (United States)

    Zheljazkov, Valtcho D; Callahan, Amber; Cantrell, Charles L

    2008-01-09

    A field experiment was conducted to assess yield, oil content, and composition of 38 genotypes of sweet basil ( Ocimum basilicum L.). Overall, biomass yields were high and comparable to those reported in the literature. However, basil genotypes differed significantly with respect to oil content and composition. Oil content of the tested accessions varied from 0.07% to 1.92% in dry herbage. On the basis of the oil composition, basil accessions were divided into seven groups: (1) high-linalool chemotype [19-73% (-)-linalool], (2) linalool-eugenol chemotype [six chemotypes with 28-66% (-)-linalool and 5-29% eugenol], (3) methyl chavicol chemotype [six accessions with 20-72% methyl chavicol and no (-)-linalool], (4) methyl chavicol-linalool chemotype [six accessions with 8-29% methyl chavicol and 8-53% (-)-linalool], (5) methyl eugenol-linalool chemotype [two accessions with 37% and 91% methyl eugenol and 60% and 15% (-)-linalool], (6) methyl cinnamate-linalool chemotype [one accession with 9.7% methyl cinnamate and 31% (-)-linalool], and (7) bergamotene chemotype [one accession with bergamotene as major constituent, 5% eucalyptol, and basil could be a viable essential oil crop in Mississippi. The availability of various chemotypes offers the opportunity for production of basil to meet the market requirements of specific basil oils or individual compounds such as (-)-linalool, eugenol, methyl chavicol, methyl cinnamate, or methyl eugenol.

  13. Diversity in chemical composition and yield of essential oil from two Iranian landraces of sweet basil

    Directory of Open Access Journals (Sweden)

    Ghasemi Pirbalouti Abdollah

    2014-01-01

    Full Text Available Ocimum basilicum L. belongs to the family Lamiaceae is an herb that is extensively cultivated in some countries. Areal parts, especially leaves of sweet basil are widely used to enhance the flavour of foods such as salads, pasta, tomato products, vegetables, pizza, meat, soups, marine foods, confectioneries and other products. Essential oil yield and chemical components of two Iranian landraces of sweet basil including “Purple” and “Green” grown south-central of Iran (Isfahan province were investigated. The hydro-distillated oils were analyzed by GC-MS. The oil yields were obtained from the aerial of Purple with 0.56 ml/100 g dry matter and the aerial of Green with 0.48 ml/100 g dry matter. Results indicated significant differences (p < 0.01 among the aerial for the main constituents in the essential oil from two Iranian landraces of sweet basil. The major constituents of the essential oil from the aerial of Purple landrace were methyl chavicol or estragol (63.32% and linalool (7.96%. The main compositions of the essential oil from the aerial of Green landrace were methyl chavicol (31.82%, geranial (24.60% and neral (22.65%. Genarlly, a comparison of our results with the previous reports suggests differences in the essential oil compositions and oil yield of the plant material could be attributed to genetic diversity in two Iranian landraces of sweet basil.

  14. The impact of arbuscular mycorrhizal fungi in mitigating salt-induced adverse effects in sweet basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Khalid M. Elhindi

    2017-01-01

    Full Text Available Salinity is one of the serious abiotic stresses adversely affecting the majority of arable lands worldwide, limiting the crop productivity of most of the economically important crops. Sweet basil (Osmium basilicum plants were grown in a non-saline soil (EC = 0.64 dS m−1, in low saline soil (EC = 5 dS m−1, and in a high saline soil (EC = 10 dS m−1. There were differences between arbuscular mycorrhizal (Glomus deserticola colonized plants (+AMF and non-colonized plants (−AMF. Mycorrhiza mitigated the reduction of K, P and Ca uptake due to salinity. The balance between K/Na and between Ca/Na was improved in +AMF plants. Growth enhancement by mycorrhiza was independent from plant phosphorus content under high salinity levels. Different growth parameters, salt stress tolerance and accumulation of proline content were investigated, these results showed that the use of mycorrhizal inoculum (AMF was able to enhance the productivity of sweet basil plants under salinity conditions. Mycorrhizal inoculation significantly increased chlorophyll content and water use efficiency under salinity stress. The sweet basil plants appeared to have high dependency on AMF which improved plant growth, photosynthetic efficiency, gas exchange and water use efficiency under salinity stress. In this study, there was evidence that colonization with AMF can alleviate the detrimental salinity stress influence on the growth and productivity of sweet basil plants.

  15. The impact of arbuscular mycorrhizal fungi in mitigating salt-induced adverse effects in sweet basil (Ocimum basilicum L.).

    Science.gov (United States)

    Elhindi, Khalid M; El-Din, Ahmed Sharaf; Elgorban, Abdallah M

    2017-01-01

    Salinity is one of the serious abiotic stresses adversely affecting the majority of arable lands worldwide, limiting the crop productivity of most of the economically important crops. Sweet basil ( Osmium basilicum ) plants were grown in a non-saline soil (EC = 0.64 dS m -1 ), in low saline soil (EC = 5 dS m -1 ), and in a high saline soil (EC = 10 dS m -1 ). There were differences between arbuscular mycorrhizal ( Glomus deserticola ) colonized plants (+AMF) and non-colonized plants (-AMF). Mycorrhiza mitigated the reduction of K, P and Ca uptake due to salinity. The balance between K/Na and between Ca/Na was improved in +AMF plants. Growth enhancement by mycorrhiza was independent from plant phosphorus content under high salinity levels. Different growth parameters, salt stress tolerance and accumulation of proline content were investigated, these results showed that the use of mycorrhizal inoculum (AMF) was able to enhance the productivity of sweet basil plants under salinity conditions. Mycorrhizal inoculation significantly increased chlorophyll content and water use efficiency under salinity stress. The sweet basil plants appeared to have high dependency on AMF which improved plant growth, photosynthetic efficiency, gas exchange and water use efficiency under salinity stress. In this study, there was evidence that colonization with AMF can alleviate the detrimental salinity stress influence on the growth and productivity of sweet basil plants.

  16. The response of sweet basil (Ocimum basilicum L. to the application of growth stimulators and forecrops

    Directory of Open Access Journals (Sweden)

    Cezary A. Kwiatkowski

    2012-12-01

    Full Text Available A field experiment in growing sweet basil was carried out in the period 2008-2010 in Fajsławice (Lublin region, on podzolic soil. The study evaluated the biometric traits of the plants, yield, the qualitative parameters of herbal raw material and weed infestation of the crop in dependence on growth simulators (Asahi SL, Bio-algeen, Titanit and the forecrop (winter wheat or spring barley + white mustard cover crop. Plots without foliar application of the growth stimulators were the control treatment. Tillage, mineral NPK fertilization as well as mechanical and chemical weed control were typical for this plant species and consistent with the recommendations for herbal plant protection. A hypothesis was made that the application of growth stimulators would have a positive effect on basil productivity, raw material quality and weed infestation of the basil crop. It was also assumed that the phytosanitary and fertilizing effects of the cover crop would result in higher and qualitatively better yield compared to the cereal forecrop alone (winter wheat. The best quantitative parameters of sweet basil raw material and the highest reduction in air-dry weight of weeds in the crop were observed after the application of the growth stimulators. The forecrop - spring barley + a white mustard cover crop that is ploughed in - also had a beneficial effect on yield and weed infestation of the plant in question. The traditional crop protection method used in the basil crop, without the application of the growth stimulators, resulted in a lower plant height and a smaller number of shoots per plant. This caused higher weed infestation of the crop and a decrease in yield. The positive side of the non-application of growth stimulators was a better chemical composition of basil raw material. Asahi SL and Tytanit yielded the best growth and productivity of the basil plants.

  17. Investigation the Vertical Distribution of Leaf Area and Dry Matter of Sweet Basil (Ocimum basilicum L., Borage (Borago officinalis L. and Cover Crops in Competition with Weeds

    Directory of Open Access Journals (Sweden)

    zeinab shirzadi margavi

    2017-10-01

    Full Text Available Introduction Distribution of leaf area and dry matter are the effective factors that influence on absorption the radiation, evaporation and transpiration of canopy and eventually dry matter accumulation and grain yield in plants. Plant canopy is the spatial arrangement of shoots in a plant population. In plant canopy, leaves are responsible for radiation absorption and gas exchange with the outside. Stem and branches arrange photosynthetic organs somehow, which gas exchange and light distribution best done. The effect of canopy structure on gas exchange and absorption of radiation in plant communities caused detailed study of the canopy structure to be more important. Materials and methods In order to investigate the vertical distribution of leaf area and dry matter of borage and sweet basil in competition with weeds by cover crops treatments, a field experiment was carried out in a randomized complete block design with 8 treatments and 3 replications in Agricultural Sciences and Natural Resources University of Sari in 2013. Treatments were cover crops mung bean (Vigna radiata L. and Persian clover (Trifolium resupinatum L. in the rows between the sweet basil (Ocimum basilicum L. and borage (Borago officinalis L.. Moreover, in order to evaluate the effectiveness of cover crops to control weeds, pure stand of sweet basil and borage in terms of weeding and no weed controls per replicates were used. Each plot was included 5 rows of medicinal plants. Cover crop inter-seeded simultaneously in the main crop. Estimation of leaf area and dry matter of each plant in different canopy layers (0-20, 20-40, 40-60, 80.100, 100-120 and 120-140 cm were done after 75 planting days, with 1 m × 1 m quadrate per plot. For this purpose a vertical card board frame marked in 20-cm increments was used in the field as a guide to cut standing plants (crops, cover crops and weeds into 20-cm strata increments (Mosier & Oliver, 1995. All samples were transferred to the

  18. A first linkage map and downy mildew resistance QTL discovery for sweet basil (Ocimum basilicum) facilitated by double digestion restriction site associated DNA sequencing (ddRADseq).

    Science.gov (United States)

    Pyne, Robert; Honig, Josh; Vaiciunas, Jennifer; Koroch, Adolfina; Wyenandt, Christian; Bonos, Stacy; Simon, James

    2017-01-01

    Limited understanding of sweet basil (Ocimum basilicum L.) genetics and genome structure has reduced efficiency of breeding strategies. This is evidenced by the rapid, worldwide dissemination of basil downy mildew (Peronospora belbahrii) in the absence of resistant cultivars. In an effort to improve available genetic resources, expressed sequence tag simple sequence repeat (EST-SSR) and single nucleotide polymorphism (SNP) markers were developed and used to genotype the MRI x SB22 F2 mapping population, which segregates for response to downy mildew. SNP markers were generated from genomic sequences derived from double digestion restriction site associated DNA sequencing (ddRADseq). Disomic segregation was observed in both SNP and EST-SSR markers providing evidence of an O. basilicum allotetraploid genome structure and allowing for subsequent analysis of the mapping population as a diploid intercross. A dense linkage map was constructed using 42 EST-SSR and 1,847 SNP markers spanning 3,030.9 cM. Multiple quantitative trait loci (QTL) model (MQM) analysis identified three QTL that explained 37-55% of phenotypic variance associated with downy mildew response across three environments. A single major QTL, dm11.1 explained 21-28% of phenotypic variance and demonstrated dominant gene action. Two minor QTL dm9.1 and dm14.1 explained 5-16% and 4-18% of phenotypic variance, respectively. Evidence is provided for an additive effect between the two minor QTL and the major QTL dm11.1 increasing downy mildew susceptibility. Results indicate that ddRADseq-facilitated SNP and SSR marker genotyping is an effective approach for mapping the sweet basil genome.

  19. Methyl Jasmonate-Elicited Transcriptional Responses and Pentacyclic Triterpene Biosynthesis in Sweet Basil1[C][W

    Science.gov (United States)

    Misra, Rajesh Chandra; Maiti, Protiti; Chanotiya, Chandan Singh; Shanker, Karuna; Ghosh, Sumit

    2014-01-01

    Sweet basil (Ocimum basilicum) is well known for its diverse pharmacological properties and has been widely used in traditional medicine for the treatment of various ailments. Although a variety of secondary metabolites with potent biological activities are identified, our understanding of the biosynthetic pathways that produce them has remained largely incomplete. We studied transcriptional changes in sweet basil after methyl jasmonate (MeJA) treatment, which is considered an elicitor of secondary metabolites, and identified 388 candidate MeJA-responsive unique transcripts. Transcript analysis suggests that in addition to controlling its own biosynthesis and stress responses, MeJA up-regulates transcripts of the various secondary metabolic pathways, including terpenoids and phenylpropanoids/flavonoids. Furthermore, combined transcript and metabolite analysis revealed MeJA-induced biosynthesis of the medicinally important ursane-type and oleanane-type pentacyclic triterpenes. Two MeJA-responsive oxidosqualene cyclases (ObAS1 and ObAS2) that encode for 761- and 765-amino acid proteins, respectively, were identified and characterized. Functional expressions of ObAS1 and ObAS2 in Saccharomyces cerevisiae led to the production of β-amyrin and α-amyrin, the direct precursors of oleanane-type and ursane-type pentacyclic triterpenes, respectively. ObAS1 was identified as a β-amyrin synthase, whereas ObAS2 was a mixed amyrin synthase that produced both α-amyrin and β-amyrin but had a product preference for α-amyrin. Moreover, transcript and metabolite analysis shed light on the spatiotemporal regulation of pentacyclic triterpene biosynthesis in sweet basil. Taken together, these results will be helpful in elucidating the secondary metabolic pathways of sweet basil and developing metabolic engineering strategies for enhanced production of pentacyclic triterpenes. PMID:24367017

  20. Antibacterial properties of essential oils and methanol extracts of sweet basil Ocimum basilicum occurring in Bangladesh.

    Science.gov (United States)

    Hossain, M Amzad; Kabir, M J; Salehuddin, S M; Rahman, S M Mizanur; Das, A K; Singha, Sandip Kumar; Alam, Md Khorshed; Rahman, Atiqur

    2010-05-01

    The antibacterial potential of essential oils and methanol extracts of sweet basil Ocimum basilicum L. (Lamiaceae) was evaluated for controlling the growth range of food-borne pathogenic bacteria. Essential oils extracted by hydrodistillation from the leaves and stems were analyzed by GC-MS. Fifty-seven compounds representing 94.9 and 96.1% of the total leaf and stem oils, respectively, were identified, of which methyl chavicol (36.7 and 29.9%), gitoxigenin (9.3 and 10.2%), trimethoquinol (10.3 and 8.4%), beta-guaiene (3.7 and 4.1%), aciphyllene (3.4 and 3.0%), alizarin (3.2 and 4.4%), naphthaline (2.2 and 3.8%), (-)-caryophyllene (2.0 and 1.9%), and mequinol (1.6 and 1.8%) were the major compounds. The essential oils (10 microL/disc of 1:5, v/v dilution with methanol) and methanol extracts (300 microg/disc) of O. basilicum displayed a great potential of antibacterial activity against Bacillius cereus, B. subtilis, B. megaterium, Staphylococcus aureus, Listeria monocytogenes, Escherichia coli, Shigella boydii, S. dysenteriae, Vibrio parahaemolyticus, V. mimicus, and Salmonella typhi with their respective zones of inhibition of 11.2-21.1 mm and MIC values of 62.5-500 microg/mL. The results of this study suggest that the natural products derived from O. basilicum may have potential use in the food and/or pharmaceutical industries as antimicrobial agents.

  1. Ecologically acceptable usage of derivatives of essential oil of sweet basil, Ocimum basilicum, as antifeedants against larvae of the gypsy moth, Lymantria dispar.

    Science.gov (United States)

    Popović, Zorica; Kostić, Miroslav; Stanković, Sladjan; Milanović, Slobodan; Sivčev, Ivan; Kostić, Igor; Kljajić, Petar

    2013-01-01

    Abstract Ethanol solutions of five fractions obtained from essential oil of sweet basil Ocimum basilicum L. (Lamiales: Lamiaceae) (F1-F5) were tested for their antifeedant properties against 2(nd) instar gypsy moth larvae, Lymantria dispar L. (Lepidoptera: Lymantriidae), in laboratory non-choice and feeding-choice experiments. Prior to bioassays, the chemical composition of each fraction was determined by gas chromatography analyses. Significant larval deterrence from feeding was achieved by application of tested solutions to fresh leaves of the host plant. The most effective were were F1 (0.5%), F4 (0.05, 0.1, and 0.5%), and F5 (0.1 and 0.5%), which provided an antifeedant index > 80% after five days. A low rate of larval mortality was observed in no-choice bioassay. In situ screening of chlorophyll fluorescence as an indicator of plant stress level (assessed by the induced fluorometry) confirmed that the tested compounds did not cause alternations in the photosynthetic efficiency of treated leaves.

  2. Antibacterial Activities of Green Basil (Ocimum Violaceum Essential Oil and Derivatives By MAOS (Microwave Assisted Organic Synthesis Against Staphyllococus Aureus and Escherichia Coli

    Directory of Open Access Journals (Sweden)

    Dwiarso Rubiyanto

    2014-07-01

    Full Text Available Green basil (Ocimum violaceum , Linn. plantis part of the varieties of basil (Ocimum basilicum, Linn.. Green basil essential oil (GBEO contain chemical compounds that have an anti- bacterial activities . Methyl eugenol and methyl chavikol are in green basil oil has the potential to be used as a material which is biologically active. Conversion reaction of the compounds in GBEO with MAOS methods (microwave assisted organic synthesis aims to obtain properties of the main chemical component in a wider sweet basil oil, and are also useful in an attempt to gain more valuable compounds for commercial and higher. The results showed that the optimum reaction conditions on the conversion reaction of compounds in GBEO with MAOS method with ethylene glycol as a solvent is 10 % KF/Al2O3as catalyst and reaction time 3 minutes , while the solvent is glycerol 10 % KF/Al2O3as catalyst and reaction time 2 minutes . Comparison of anti-bacterial activity resulting from this research are : the inhibitory activity to the growth of S. aureus bacteria have the following order : GBEO > green basilEG10-3 > green basil G10-2> amoxicillin with each inhibition zone diameter amounted to 30.7 mm, 21.1 mm, 18.2 mm and 13.4 mm. While the inhibitory activity to the growth of E.coli bacteria are : GBEO> green basil G10-2 >green basil EG10-3 > amoxicillin with each inhibition zone diameter of 21.1 mm, 15.6 mm , 15.2 mm and 7.9 mm . GBEO and its derivatives have minimal inhibitory concentrations below 1.25 %. From the results of the study found that the main derivates obtained are p-methoxy anisaldehyde , caryophyllene oxide , 3-methoxy cinnamaldehyde , humulena oxide and delta cadinol

  3. Hepatoprotective effect of basil ( Ocimum basilicum L.) on CCl 4 ...

    African Journals Online (AJOL)

    The hepatoprotective effect of basil (Ocimum basilicum) extract against liver fibrosis-induced by carbon tetrachloride (CCl4) was studied in rats. Rats were allocated into five groups: Group I (control group); Group II [CCl4 group; rats were injected subcutaneously with CCl4 (1 ml/kg b.w.) twice weekly for 4 weeks ...

  4. HYDROPONIC AND AQUAPONIC PRODUCTION OF SWEET BASIL (Ocimum basilicum AND GIANT RIVER PRAWN (Macrobrachium rosenbergii

    Directory of Open Access Journals (Sweden)

    Marisol Ronzón Ortega

    2012-11-01

    Full Text Available In order to promote sustainable aquaculture in production units and to take care of the water resource is needed to integrate biotechnology tools to the activity, as is the aquaponics. In the present study we evaluated the production efficiency of a crop of basil (Ocimum basilicum in a hydroponic system (SH vs. acuaponic system (SA associated with the semi-intensive culture of Malaysian prawn (Macrobrachium rosenbergii. The production of basil was conducted in two geomembrane plastic rectangular tanks (4.0 m long x 0.80 m wide and 0.30 m high, divided into two sections: in the first section setting of the seedlings were done in a substrate of silica sand and volcanic rock , whereas in the second were seeded into plastic containers using the same substrate. SH plants got their nutrients from the metabolites derived from the cultivation of 800 postlarval shrimp in two circular tanks of 25 m3 (16 organisms m-2 (Pond 1: initial weight 0.13 g, Pond 2: 2.19 g; while in the SH was used a commercial nutrient solution (1.5 g L. The results indicate that SH plants initially had higher survival (90%, height and number of leaves per plant (p

  5. First report of Alfalfa mosaic virus infecting basil (Ocimum basilicum L.) in California.

    Science.gov (United States)

    Basil (Ocimum basilicum L.) plants collected from a field in Imperial County, CA in May, 2011 were found to exhibit yellowing, chlorotic sectors and spots on leaves, resulting in plants being unmarketable. Total nucleic acid was extracted from plants and tested by RT-PCR for the presence of Alfalfa...

  6. Changes in visual quality, physiological and biochemical parameters assessed during the postharvest storage at chilling or non-chilling temperatures of three sweet basil (Ocimum basilicum L.) cultivars.

    Science.gov (United States)

    Fratianni, Florinda; Cefola, Maria; Pace, Bernardo; Cozzolino, Rosaria; De Giulio, Beatrice; Cozzolino, Autilia; d'Acierno, Antonio; Coppola, Raffaele; Logrieco, Antonio Francesco; Nazzaro, Filomena

    2017-08-15

    Leaves of three different sweet basil (Ocimum basilicum L.) cultivars (Italico a foglia larga, Cammeo, and Italiano classico) packed in macro-perforated polyethylene bags were stored at chilling (4°C) or non-chilling temperature (12°C) for 9days. During storage, visual quality, physiological (respiration rate, ethylene production, ammonium content) and chemical (antioxidant activity, total polyphenols and polyphenol profile) parameters were measured. Detached leaves stored at chilling temperature showed visual symptoms related to chilling injury, while ethylene production and ammonium content resulted associated to cultivar sensibility to damage at low temperature. Storage at 4°C caused a depletion in polyphenols content and antioxidant capability, which was preserved at 12°C. Regarding the polyphenols profile, stressful storage conditions did not enhance the phenolic metabolism. However, leaves stored at 12°C did not loss a significant amount of metabolites respect to fresh leaves, suggesting the possibility to extend the storability after the expiration date, for a possible recovery of bioactive compounds. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. The Roles of a Flavone-6-Hydroxylase and 7-O-Demethylation in the Flavone Biosynthetic Network of Sweet Basil*

    Science.gov (United States)

    Berim, Anna; Gang, David R.

    2013-01-01

    Lipophilic flavonoids found in the Lamiaceae exhibit unusual 6- and 8-hydroxylations whose enzymatic basis is unknown. We show that crude protein extracts from peltate trichomes of sweet basil (Ocimum basilicum L.) cultivars readily hydroxylate position 6 of 7-O-methylated apigenin but not apigenin itself. The responsible protein was identified as a P450 monooxygenase from the CYP82 family, a family not previously reported to be involved in flavonoid metabolism. This enzyme prefers flavones but also accepts flavanones in vitro and requires a 5-hydroxyl in addition to a 7-methoxyl residue on the substrate. A peppermint (Mentha × piperita L.) homolog displayed identical substrate requirements, suggesting that early 7-O-methylation of flavones might be common in the Lamiaceae. This hypothesis is further substantiated by the pioneering discovery of 2-oxoglutarate-dependent flavone demethylase activity in basil, which explains the accumulation of 7-O-demethylated flavone nevadensin. PMID:23184958

  8. Essential oil from Ocimum basilicum (Omani Basil): a desert crop.

    Science.gov (United States)

    Al-Maskri, Ahmed Yahya; Hanif, Muhammad Asif; Al-Maskari, Masoud Yahya; Abraham, Alfie Susan; Al-sabahi, Jamal Nasser; Al-Mantheri, Omar

    2011-10-01

    The focus of the present study was on the influence of season on yield, chemical composition, antioxidant and antifungal activities of Omani basil (Ocimum basilicum) oil. The present study involved only one of the eight Omani basil varieties. The hydro-distilled essential oil yields were computed to be 0.1%, 0.3% and 0.1% in the winter, spring and summer seasons, respectively. The major components identified were L- linalool (26.5-56.3%), geraniol (12.1-16.5%), 1,8-cineole (2.5-15.1%), p-allylanisole (0.2-13.8%) and DL-limonene (0.2-10.4%). A noteworthy extra component was beta- farnesene, which was exclusively detected in the oil extracted during winter and spring at 6.3% and 5.8%, respectively. The essential oil composition over the different seasons was quite idiosyncratic, in which the principal components of one season were either trivial or totally absent in another. The essential oil extracted in spring exhibited the highest antioxidant activity (except DPPH scavenging ability) in comparison with the oils from other seasons. The basil oil was tested against pathogenic fungi viz. Aspergillus niger, A. fumigatus, Penicillium italicum and Rhizopus stolonifer using a disc diffusion method, and by determination of minimum inhibitory concentration. Surprisingly high antifungal values were found highlighting the potential of Omani basil as a preservative in the food and medical industries.

  9. Essential-Oil Variability in a Collection of Ocimum basilicum L. (Basil) Cultivars.

    Science.gov (United States)

    Maggio, Antonella; Roscigno, Graziana; Bruno, Maurizio; De Falco, Enrica; Senatore, Felice

    2016-10-01

    Ocimum basilicum L. (Lamiaceae) is an aromatic plant of great tradition in the Mediterranean area. Its economic importance is growing up determining an expansion of cultivation. This paper evaluated the morphological traits, the chemical profiles, and antibacterial activity of 21 cultivars of basil belonging to 'Genovese', 'Napoletano', and 'Purple basil' types. The cultivars were characterized by different growth rate and morphological traits. The chemical composition of the oils analyzed by GC and GC/MS analysis, supported by the PCA analysis, underlined the strong influence of chemotype. It is noteworthy that estragole, never present in Genovese and purple basil types, occurred in Napoletano type. The high presence of eugenol, methyl eugenol, and linalool in the majority of cultivars, belonging both to Genovese and to Napoletano types was registered. Of great interest resulted the composition of the purple basil 'Opal'. All the samples tested exhibited similar antibiotic profiles with moderate antibacterial activity. The results enhanced the importance of determination of essential-oil profile in the selection of cultivars characterized by diverse morphological traits and are useful for different purposes. © 2016 Wiley-VHCA AG, Zürich.

  10. Effect of Irrigation Intervals on Some Morphophysiological Traits of Basil (Ocimum basilicum L. Ecotypes

    Directory of Open Access Journals (Sweden)

    M Goldani

    2012-10-01

    Full Text Available In order to determine the effect of different irrigation intervals on some morphophysiological traits of basil (Ocimum basilicum L., an experiment was conducted as factorial based on randomized complete block design with three replications under greenhouse conditions during 2010. Treatments included five irrigation intervals with 4, 8, 12, 16 and 20 days intervals and two ecotypes of basil (green and purple. The results showed that by increasing irrigation interval plant height, spike number, spike weight and shoot dry weight between irrigation intervals decreased. Purple basil was more tolerant than basil green ecotype to drought stress. Interaction between irrigation intervals and ecotypes showed that the best treatment related to four days irrigation interval and purple basil ecotype. The effect of irrigation intervals on root area, root diameter mean, total length, root volume and dry weight of root was significant. In all irrigation intervals, purple basil had better performance compared to green ecotype. The results showed that by increasing in irrigation interval decreased root surface area, but increased total root length. It was concluded that increasing irrigation interval up to 12 days decreased shoot and root surface areas. Increasing irrigation interval decreased chlorophyll- a, b and increased prolin amino acid content of basil leaf.

  11. Chemical composition and antimicrobial activity of the essential oil of Ocimum basilicum L. (sweet basil) from Western Ghats of North West Karnataka, India.

    Science.gov (United States)

    Joshi, Rajesh K

    2014-01-01

    Ocimum basilicum L. (Lamiaceae) commonly known as sweet basil, has been used as a traditional medicinal plant for the treatment of headaches, coughs, diarrhea, constipation, warts, worms, and kidney malfunctions. The essential oil of the flowering aerial parts of O. basilicum growing in the Western Ghats region of North West Karnataka, India, was obtained by hydro-distillation and analyzed by gas chromatography equipped with flame ionization detector and gas chromatography coupled to mass spectrometry (GC-MS). The oil was tested against six Gram-positive, eight Gram-negative bacteria, and three fungi by the tube-dilution method at a concentration range of 5.00-0.009 mg/mL. Twenty-five constituents were identified in the essential oil of O. basilicum. The major constituents were identified as methyl eugenol (39.3%) and methyl chavicol (38.3%), accounting for 98.6% of the total oil. The oil was found to be active against Gram-positive, Gram-negative bacteria, and fungi with minimal bactericidal concentration values in the range of 0.143 ± 0.031 to 0.572 ± 0.127 mg/mL, 0.781 ± 0.382 to 1.875 ± 0.684 mg/mL, and 0.312 ± 0.171 to 0.442 ± 0.207 mg/mL, respectively. The essential oil of O. basilicum of this region contains methyl eugenol/methyl chavicol chemotype and has bactericidal properties.

  12. Agronomic and physiological impacts of irrigation frequency on green basil (Ocimum basilicum L.)

    OpenAIRE

    Gao, Peng; Dodd, Ian

    2015-01-01

    Water scarcity is a major factor restricting agricultural production and irrigation globally, with sustainable agricultural development calling for less irrigation water use and more production per unit of water applied. Improved understanding of plant physiological responses to water stress, and the effect of irrigation frequency on plant biomass production and quality, may help to optimize irrigation scheduling. Glasshouse-grown basil (Ocimum basilicum L.) received three different irrigatio...

  13. UV‐B is Required for Normal Development of Oil Glands in Ocimum basilicum L. (Sweet Basil)

    Science.gov (United States)

    IOANNIDIS, DAPHNE; BONNER, LYNDA; JOHNSON, CHRISTOPHER B.

    2002-01-01

    Plants of Ocimum basilicum L. grown under glass were exposed to short treatments with supplementary UV‐B. The effect of UV‐B on volatile essential oil content was analysed and compared with morphological effects on the peltate and capitate glandular trichomes. In the absence of UV‐B, both peltate and capitate glands were incompletely developed in both mature and developing leaves, the oil sacs being wrinkled and only partially filled. UV‐B was found to have two main effects on the glandular trichomes. During the first 4 d of treatment, both peltate and capitate glands filled and their morphology reflected their ‘normal’ mature development as reported in the literature. During the following days there was a large increase in the number of broken oil sacs among the peltate glands as the mature glands broke open, releasing volatiles. Neither the number of glands nor the qualitative or quantitative composition of the volatiles was affected by UV‐B. There seems to be a requirement for UV‐B for the filling of the glandular trichomes of basil. PMID:12324268

  14. Salinity Stress Does Not Affect Root Uptake, Dissemination and Persistence of Salmonella in Sweet-basil (Ocimum basilicum).

    Science.gov (United States)

    Bernstein, Nirit; Sela Saldinger, Shlomo; Dudai, Nativ; Gorbatsevich, Elena

    2017-01-01

    Crop produce can be contaminated in the field during cultivation by bacterial human pathogens originating from contaminated soil or irrigation water. The bacterial pathogens interact with the plant, can penetrate the plant via the root system and translocate and survive in above-ground tissues. The present study is first to investigate effects of an abiotic stress, salinity, on the interaction of plants with a bacterial human pathogen. The main sources of human bacterial contamination of plants are manures and marginal irrigation waters such as treated or un-treated wastewater. These are often saline and induce morphological, chemical and physiological changes in plants that might affect the interaction between the pathogens and the plant and thereby the potential for plant contamination. This research studied effects of salinity on the internalization of the bacterial human pathogen Salmonella enterica serovar Newport via the root system of sweet-basil plants, dissemination of the bacteria in the plant, and kinetics of survival in planta . Irrigation with 30 mM NaCl-salinity induced typical salt-stress effects on the plant: growth was reduced, Na and Cl concentrations increased, K and Ca concentrations reduced, osmotic potential and anti-oxidative activity were increased by 30%, stomatal conductance was reduced, and concentrations of essential-oils in the plants increased by 26%. Despite these physical, chemical and morphological changes in the plants, root internalization of the bacteria and its translocation to the shoot were not affected, and neither was the die-off rate of Salmonella in planta . The results demonstrate that the salinity-induced changes in the sweet-basil plants did not affect the interaction between Salmonella and the plant and thereby the potential for crop contamination.

  15. Phenylpropanoid biosynthesis in leaves and glandular trichomes of basil (Ocimum basilicum L.).

    Science.gov (United States)

    Deschamps, Cícero; Simon, James E

    2010-01-01

    Basil (Ocimum basilicum L.) essential oil phenylpropenes are synthesized and accumulate in peltate glandular trichomes and their content and composition depend on plant developmental stage. Studies on gene expression and enzymatic activity indicate that the phenylpropene biosynthetic genes are developmentally regulated. In this study, the methylchavicol accumulation in basil leaves and the enzyme activities and gene expression of both chavicol O-methyltransferase (CVOMT) and eugenol O-methyltransferase (EOMT) were investigated in all leaves at four plant developmental stages. Methylchavicol accumulation decreased over time as leaves matured. There was a significant correlation between methylchavicol accumulation and CVOMT (r(2) = 0.88) enzyme activity, suggesting that the levels of biosynthetic enzymes control the essential oil content. CVOMT and EOMT transcript expression levels, which decreased with leaf age, followed the same pattern in both whole leaves and isolated glandular trichomes, providing evidence that CVOMT transcript levels are developmentally regulated in basil glandular trichomes themselves and that differences in CVOMT expression observed in whole leaves are not solely the result of differences in glandular trichome density.

  16. Extraction of basil leaves (ocimum canum) oleoresin with ethyl acetate solvent by using soxhletation method

    Science.gov (United States)

    Tambun, R.; Purba, R. R. H.; Ginting, H. K.

    2017-09-01

    The goal of this research is to produce oleoresin from basil leaves (Ocimum canum) by using soxhletation method and ethyl acetate as solvent. Basil commonly used in culinary as fresh vegetables. Basil contains essential oils and oleoresin that are used as flavouring agent in food, in cosmetic and ingredient in traditional medicine. The extraction method commonly used to obtain oleoresin is maceration. The problem of this method is many solvents necessary and need time to extract the raw material. To resolve the problem and to produce more oleoresin, we use soxhletation method with a combination of extraction time and ratio from the material with a solvent. The analysis consists of yield, density, refractive index, and essential oil content. The best treatment of basil leaves oleoresin extraction is at ratio of material and solvent 1:6 (w / v) for 6 hours extraction time. In this condition, the yield of basil oleoresin is 20.152%, 0.9688 g/cm3 of density, 1.502 of refractive index, 15.77% of essential oil content, and the colour of oleoresin product is dark-green.

  17. Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet ...

    African Journals Online (AJOL)

    Chigo Okwuosa

    basilicum (sweet basil) protect against sodium ... arsenite alone, the aqueous extracts plus sodium arsenite, and ethanolic extracts plus sodium ... properties and effects (Aruna and Sivaramakrishnan. 1992 ..... Biotransformation of the pesticide.

  18. Antioxidant and antimicrobial properties of traditional green and purple "Napoletano" basil cultivars (Ocimum basilicum L.) from Campania region (Italy).

    Science.gov (United States)

    Tenore, Gian Carlo; Campiglia, Pietro; Ciampaglia, Roberto; Izzo, Luana; Novellino, Ettore

    2017-09-01

    The present study is the first effort to a comprehensive evaluation of the antioxidant and antimicrobial activities of 'Napoletano' green and purple basil (Ocimum basilicum L.) varieties. The results obtained revealed that the basil sample extracts were characterised by a generally higher polyphenolic concentration than those reported elsewhere for other more conventional and geographically different basil varieties. Napoletano purple basil revealed higher radical-scavenging and ferric-reducing capacities than the green one probably due to its relevant anthocyanin content. As regards the antimicrobial properties, both basil varieties exhibited activity against a broad spectrum of food-borne and human pathogenic micro-organisms, revealing not only a moderate to high natural preserving capacity, but also potentially beneficial influence on human health. Results indicated Napoletano green and purple basils as a good source of antioxidants of potential nutraceutical interest.

  19. Phenolic composition of basil plants is differentially altered by plant nutrient status and inoculation with mycorrhizal fungi

    Science.gov (United States)

    Four cultivars of basil (Ocimum basilicum ‘Cinnamon’, ‘Siam Queen’, ‘Sweet Dani’, and ‘Red Rubin’) were inoculated or not with the arbuscular mycorrhizal fungus (AMF), Rhizophagus intraradices, and grown with a fertilizer containing either 64 mg/l P (low-P) or 128 mg/l P (high-P) to assess whether (...

  20. Daytime Solar Heating Controls Downy Mildew Peronospora belbahrii in Sweet Basil.

    Directory of Open Access Journals (Sweden)

    Yigal Cohen

    Full Text Available The biotrophic oomycete Peronospora belbahrii causes a devastating downy mildew disease in sweet basil. Due to the lack of resistant cultivars current control measures rely heavily on fungicides. However, resistance to fungicides and strict regulation on their deployment greatly restrict their use. Here we report on a 'green' method to control this disease. Growth chamber studies showed that P. belbahrii could hardly withstand exposure to high temperatures; exposure of spores, infected leaves, or infected plants to 35-45 °C for 6-9 hours suppressed its survival. Therefore, daytime solar heating was employed in the field to control the downy mildew disease it causes in basil. Covering growth houses of sweet basil already infected with downy mildew with transparent infra-red-impermeable, transparent polyethylene sheets raised the daily maximal temperature during sunny hours by 11-22 °C reaching 40-58 °C (greenhouse effect. Such coverage, applied for a few hours during 1-3 consecutive days, had a detrimental effect on the survival of P. belbahrii: killing the pathogen and/or suppressing disease progress while enhancing growth of the host basil plants.

  1. The Impact of Hybridization on the Volatile and Sensorial Profile of Ocimum basilicum L.

    OpenAIRE

    Andréa Santos da Costa; Maria de Fátima Arrigoni-Blank; Maria Aparecida Azevedo Pereira da Silva; Mércia Freitas Alves; Darlisson de Alexandria Santos; Péricles Barreto Alves; Arie Fitzgerald Blank

    2014-01-01

    The aim of the present study was to investigate the volatile and sensorial profile of basil (Ocimum basilicum L.) by quantitative descriptive analysis (QDA) of the essential oil of three hybrids (“Cinnamon” × “Maria Bonita,” “Sweet Dani” × “Cinnamon,” and “Sweet Dani” × “Maria Bonita”). Twelve descriptive terms were developed by a selected panel that also generated the definition of each term and the reference samples. The data were subjected to ANOVA, Tukey's test, and principal component an...

  2. The Study on Diurnal Changes in Leaf Gas Exchange of Lemon Balm, Catnip, Holy Basil and Sweet basil in Ahvaz

    Directory of Open Access Journals (Sweden)

    Mohammad Mahmoodi Sourestani

    2017-02-01

    Full Text Available Introduction: Mediterranean climate conditions induce several stresses that plants have to cope with, especially during summer months when high temperature and radiation levels along with low water availability in the soil prevail for long periods. Variation in physiological traits such as photosynthesis and plant water status and their association with morphological characters can play an important role in the adaptability of the species to environmental constraints. The previous studies show that scorching weather not only affects the rate of gas exchange, but also results in diurnal changes in activity. Thus, the impact of environmental stresses on plants growing in these conditions should be assessed by examining the evolution of their diurnal variations on leaf gas exchange. Aromatic plants represent a renewable source of valuable compounds that can be used in food, perfumery, and pharmaceutical industry. Among these plants, sweet basil (Ocimumbasilicum, holy basil (Ocimum sanctum, lemon balm (Melissa officinalisL. and catnip (Nepetacataria are very important for different industries. Studies on environmental physiology of medicinal plants are relatively scarce and very few information is available concerning the physiological basis of medicinal plant response to heat stress that is one of the most important factors limiting production of medicinal plants in Khuzestan province. Material and methods: In order to evaluate the diurnal fluctuation of gas exchange of mentioned plants, an experiment was carried out in 2013 at research farm of Horticultural Science, Shahid Chamran University (31°20'N latitude and 48°40'E longitude and 22.5m mean sea level, Ahvaz (Iran, a site characterized by a semidry and scorching weather during late spring and summer. The experiment was arranged based on randomized complete block design (RCBD with three replications and 4×8 factorial scheme (Four plants including lemon balm, catnip, holy basil and basil; and

  3. Morphological and chemical variability of Ocimum basilicum L. (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Renata Nurzyńska-Wierdak

    2013-04-01

    Full Text Available Morphological features of 17 sweet basil cultivars as well as essential oil content and composition were determined. The study clearly indicated great variability of Ocimum basilicumL. The content of essential oil in the dried herb was high and varied from 0.75% (O. basilicumvar. piperita to 1.89% (O. basilicumvar. cinnamon. Based of the primary components, three chemotypes were distinguished: citral (‘Lime’, ‘Lemon’ and var. citriodorum, E-methyl cinnamate/linalool (‘Licorice’, var. cinnamon and methyl chavicol (‘Tai’.

  4. Response of Basil (Ocimum basilicum L. to Type and Amount of Organic Fertilizer Applications in Intercropping with Sesame (Sesamum indicum L.

    Directory of Open Access Journals (Sweden)

    Alaleh Mottaghian

    2016-03-01

    Full Text Available To investigate the effect of organic fertilizer applications on yield and competition indices of basil (Ocimum basilicum L. in different combinations of intercropping with sesame (Sesamum indicum L., an experiment was carried out in split plot based on randomized complete block design with three replicates in 2011. The main plots were six fertilizer treatments consisted of 20 and 40 Mg ha-1 of vermicompost and sewage sludge plus 50% recommended chemical fertilizer, chemical fertilizer alone (100 kg ha-1 of urea, triple super phosphate and potassium sulfate and control (no fertilizer application. Subplots were different planting ratios (sole cropping of basil and sesame, 75% + 25%, 50% + 50 %, 25% + 75% of basil+sesame. In this experiment, the 25% basil+75% sesame and 50% basil + 50%sesame under40 Mg. ha-1 of enriched sewage sludge application had the highest economical yield (up to 3097.47 kg ha-1 with a land equivalent ratio (up to 1.24. According to the aggressivity coefficient estimates of two plant species basil incombination of 25% basil + 75% sesame and sesame in 50% basil + 50% sesame and 75% basil + 25% sesame under organic fertilizer application would be dominant species competitave in ranges of 0.12 to 0.30 and 0.11 to 0.57, respectively.

  5. Growth, yield, plant quality and nutrition of basil (Ocimum basilicum L. under soilless agricultural systems

    Directory of Open Access Journals (Sweden)

    Subhrajit Saha

    2016-12-01

    Full Text Available Traditional agricultural systems are challenged by globally declining resources resulting from climate change and growing population. Alternative agricultural practices such as aquaponics (includes crop plant and aquatic species and hydroponics (includes crop plant only have the potential to generate high yield per unit area using limited land, water, and no soil. A soilless agricultural study was conducted at the Georgia Southern University, Statesboro, GA, USA from August to November, 2015. The growth, yield, quality, and nutrition of basil (Ocimum basilicum L. cultivar Aroma 2, were compared between aquaponic and hydroponic systems using crayfish (Procambarus spp. as the aquatic species. Non-circulating floating raft systems were designed using 95 L polyethylene tanks. Equal amounts of start-up fertilizer dose were applied to both systems. The objective was to understand how the additional nutritional dynamics associated with crayfish influence the basil crop. Both fresh and dry basil plant weights were collected after harvest, followed by leaf nutrient analysis. Leaf chlorophyll content, water pH, nitrogen and temperature were measured periodically. Aquaponic basil (AqB showed 14%, 56%, and 65% more height, fresh weight, and dry weight, respectively, compared to hydroponic basil (HyB. It is logical to assume that crayfish waste (excreta and unconsumed feed has supplied the additional nutrients to AqB, resulting in greater growth and yield. The chlorophyll content (plant quality or leaf nutrients, however, did not differ between AqB and HyB. Further research is needed to investigate aquaponic crayfish yield, overall nutritional dynamics, cost-benefit ratio, and other plant characteristics under soilless systems.

  6. Utilization of Basil Extract as a Radioprotector in Male Rats

    Energy Technology Data Exchange (ETDEWEB)

    Farag, M. F.S. [Food Irradiation Research Dep. National Centre for Radiation Research and Technology, Atomic Energy Authority, Cairo (Egypt)

    2013-01-15

    Man is exposed to natural radiations from cosmic or terrestrial origins. Furthermore, it is well known that the gamma irradiation-induced biochemical alteration depends mostly on oxidative stress. Basil or sweet basil (Ocimum basilicum) is known to have numerous pharmacological activities. Therefore, the present study was carried out to investigate the radioprotective activity of basil in albino rats. The effect of basil aqueous extract (BAE) was evaluated on hepatic marker enzymes, sex hormones, lipid profile and antioxidant status. The results showed that - rays caused a significant increase in serum level of alanine and aspartate aminotransferase, alkaline phosphatase, gamma glutamyl transpeptidase (ALT, AST, ALP and GT), cholesterol (TC), triglyceride (TG), low and very low density lipoprotein cholesterol (LDL-C and VLDL-C) and thiobarbituric acid reactive substances (TBARS). A significant decrease in high density lipoprotein cholesterol (HDL-C), reduced glutathione (GSH), superoxide dismutase (SOD) and catalase (CAT) in serum was observed, compared with control group. Moreover, - rays induced a significant drop in the serum sex hormones levels testosterone (T), follicle stimulating hormone (FSH) and luteinizing hormone (LH). The BAE administered orally to rats has significantly modulated all the radiation-induced biochemical alterations. These findings showed that basil would exert a radioprotective properties.

  7. Utilization of Basil Extract as a Radioprotector in Male Rats

    International Nuclear Information System (INIS)

    Farag, M.F.S.

    2013-01-01

    Man is exposed to natural radiations from cosmic or terrestrial origins. Furthermore, it is well known that the gamma irradiation-induced biochemical alteration depends mostly on oxidative stress. Basil or sweet basil (Ocimum basilicum) is known to have numerous pharmacological activities. Therefore, the present study was carried out to investigate the radioprotective activity of basil in albino rats. The effect of basil aqueous extract (BAE) was evaluated on hepatic marker enzymes, sex hormones, lipid profile and antioxidant status. The results showed that - rays caused a significant increase in serum level of alanine and aspartate aminotransferase, alkaline phosphatase, gamma glutamyl transpeptidase (ALT, AST, ALP and GT), cholesterol (TC), triglyceride (TG), low and very low density lipoprotein cholesterol (LDL-C and VLDL-C) and thiobarbituric acid reactive substances (TBARS). A significant decrease in high density lipoprotein cholesterol (HDL-C), reduced glutathione (GSH), superoxide dismutase (SOD) and catalase (CAT) in serum was observed, compared with control group. Moreover, - rays induced a significant drop in the serum sex hormones levels testosterone (T), follicle stimulating hormone (FSH) and luteinizing hormone (LH). The BAE administered orally to rats has significantly modulated all the radiation-induced biochemical alterations. These findings showed that basil would exert a radioprotective properties.

  8. Avoidance behavior to essential oils by Anopheles minimus, a malaria vector in Thailand

    Science.gov (United States)

    Excito-repellency tests were used to characterize behavioral responses of laboratory colonized Anopheles minimus, a malaria vector in Thailand, using four essential oils, citronella (Cymbopogom nadus), hairy basil (Ocimum americanum), sweet basil (Ocimum basilicum), vetiver (Vetiveria zizanioides), ...

  9. Modeling of extraction process of crude polysaccharides from Basil seeds (Ocimum basilicum l.) as affected by process variables.

    Science.gov (United States)

    Salehi, Fakhreddin; Kashaninejad, Mahdi; Tadayyon, Ali; Arabameri, Fatemeh

    2015-08-01

    Basil seed (Ocimum basilicum L.) has practical amounts of gum with good functional properties. In this work, extraction of gum from Basil seed was studied. Effect of pH, temperature and water/seed ratio on the kinetic and thermodynamic parameters; entropy, enthalpy and free energy of extraction were investigated. The maximum gum yield was 17.95 % at 50 °C for pH=7 and water/seed ratio 30:1. In this study, the experimental data were fitted to a mathematical model of mass transfer and equations constants were obtained. The kinetic of Basil seed gum extraction was found to be a first order mass transfer model. Statistical results indicated that the model used in this study will be able to predict the gum extraction from Basil seed adequately. It also found that ΔH and ΔS were positive and ΔG was negative indicating that the extraction process was spontaneous, irreversible and endothermic. The ΔH, ΔS and ΔG values were 0.26-7.87 kJ/mol, 8.12-33.2 J/mol K and 1.62-4.42 kJ/mol, respectively.

  10. Phytochemical Profile and Evaluation of the Biological Activities of Essential Oils Derived from the Greek Aromatic Plant Species Ocimum basilicum, Mentha spicata, Pimpinella anisum and Fortunella margarita

    Directory of Open Access Journals (Sweden)

    Eleni Fitsiou

    2016-08-01

    Full Text Available Natural products, known for their medicinal properties since antiquity, are continuously being studied for their biological properties. In the present study, we analyzed the composition of the volatile preparations of essential oils of the Greek plants Ocimum basilicum (sweet basil, Mentha spicata (spearmint, Pimpinella anisum (anise and Fortunella margarita (kumquat. GC/MS analyses revealed that the major components in the essential oil fractions, were carvone (85.4% in spearmint, methyl chavicol (74.9% in sweet basil, trans-anethole (88.1% in anise, and limonene (93.8% in kumquat. We further explored their biological potential by studying their antimicrobial, antioxidant and antiproliferative activities. Only the essential oils from spearmint and sweet basil demonstrated cytotoxicity against common foodborne bacteria, while all preparations were active against the fungi Saccharomyces cerevisiae and Aspergillus niger. Antioxidant evaluation by DPPH and ABTS radical scavenging activity assays revealed a variable degree of antioxidant potency. Finally, their antiproliferative potential was tested against a panel of human cancer cell lines and evaluated by using the sulforhodamine B (SRB assay. All essential oil preparations exhibited a variable degree of antiproliferative activity, depending on the cancer model used, with the most potent one being sweet basil against an in vitro model of human colon carcinoma.

  11. Phytochemical Profile and Evaluation of the Biological Activities of Essential Oils Derived from the Greek Aromatic Plant Species Ocimum basilicum, Mentha spicata, Pimpinella anisum and Fortunella margarita.

    Science.gov (United States)

    Fitsiou, Eleni; Mitropoulou, Gregoria; Spyridopoulou, Katerina; Tiptiri-Kourpeti, Angeliki; Vamvakias, Manolis; Bardouki, Haido; Panayiotidis, Mihalis Ι; Galanis, Alex; Kourkoutas, Yiannis; Chlichlia, Katerina; Pappa, Aglaia

    2016-08-16

    Natural products, known for their medicinal properties since antiquity, are continuously being studied for their biological properties. In the present study, we analyzed the composition of the volatile preparations of essential oils of the Greek plants Ocimum basilicum (sweet basil), Mentha spicata (spearmint), Pimpinella anisum (anise) and Fortunella margarita (kumquat). GC/MS analyses revealed that the major components in the essential oil fractions, were carvone (85.4%) in spearmint, methyl chavicol (74.9%) in sweet basil, trans-anethole (88.1%) in anise, and limonene (93.8%) in kumquat. We further explored their biological potential by studying their antimicrobial, antioxidant and antiproliferative activities. Only the essential oils from spearmint and sweet basil demonstrated cytotoxicity against common foodborne bacteria, while all preparations were active against the fungi Saccharomyces cerevisiae and Aspergillus niger. Antioxidant evaluation by DPPH and ABTS radical scavenging activity assays revealed a variable degree of antioxidant potency. Finally, their antiproliferative potential was tested against a panel of human cancer cell lines and evaluated by using the sulforhodamine B (SRB) assay. All essential oil preparations exhibited a variable degree of antiproliferative activity, depending on the cancer model used, with the most potent one being sweet basil against an in vitro model of human colon carcinoma.

  12. Population structure, genetic diversity and downy mildew resistance among Ocimum species germplasm.

    Science.gov (United States)

    Pyne, Robert M; Honig, Josh A; Vaiciunas, Jennifer; Wyenandt, Christian A; Simon, James E

    2018-04-23

    The basil (Ocimum spp.) genus maintains a rich diversity of phenotypes and aromatic volatiles through natural and artificial outcrossing. Characterization of population structure and genetic diversity among a representative sample of this genus is severely lacking. Absence of such information has slowed breeding efforts and the development of sweet basil (Ocimum basilicum L.) with resistance to the worldwide downy mildew epidemic, caused by the obligate oomycete Peronospora belbahrii. In an effort to improve classification of relationships 20 EST-SSR markers with species-level transferability were developed and used to resolve relationships among a diverse panel of 180 Ocimum spp. accessions with varying response to downy mildew. Results obtained from nested Bayesian model-based clustering, analysis of molecular variance and unweighted pair group method using arithmetic average (UPGMA) analyses were synergized to provide an updated phylogeny of the Ocimum genus. Three (major) and seven (sub) population (cluster) models were identified and well-supported (P UPGMA analysis provided best resolution for the 36-accession, DM resistant k3 cluster with consistently strong bootstrap support. Although the k3 cluster is a rich source of DM resistance introgression of resistance into the commercially important k1 accessions is impeded by reproductive barriers as demonstrated by multiple sterile F1 hybrids. The k2 cluster located between k1 and k3, represents a source of transferrable tolerance evidenced by fertile backcross progeny. The 90-accession k1 cluster was largely susceptible to downy mildew with accession 'MRI' representing the only source of DM resistance. High levels of genetic diversity support the observed phenotypic diversity among Ocimum spp. accessions. EST-SSRs provided a robust evaluation of molecular diversity and can be used for additional studies to increase resolution of genetic relationships in the Ocimum genus. Elucidation of population structure

  13. The effect of essential oil of basil (Ocimum basilicum L.) on UV-induced mutagenesis in Escherichia coli and Saccharomyces cerevisiae

    Energy Technology Data Exchange (ETDEWEB)

    Stanojević, Jasna; Berić, Tanja; Opačić, Biljana; Vuković-Gačić, Branka; Simić, Draga; Knežević-Vukčević, Jelena [Institute of Botany, Faculty of Biology, University of Belgrade, 11000 Belgrade (Serbia)

    2008-07-01

    The antimutagenic potential of essential oil (EO) of basil (Ocimum basilicum L.) and its major constituent linalool were studied with the E. coli K12 and S. cerevisiae D7 assays. In the E. coli assay, EO and linalool inhibited UV-induced mutagenesis in a repair-proficient strain, but had no effect on spontaneous mutagenesis in repair-proficient, nucleotide excision repair-deficient, and mismatch-deficient strains. By testing participation of different mechanisms involved in antimutagenesis, it was concluded that the antimutagenic effect against UV-induced mutagenesis involved decrease of protein synthesis and cell proliferation which led to increased efficiency of nucleotide excision repair. An antimutagenic effect of basil derivatives in S. cerevisiae was not detected. (author)

  14. The effect of essential oil of basil (Ocimum basilicum L.) on UV-induced mutagenesis in Escherichia coli and Saccharomyces cerevisiae

    International Nuclear Information System (INIS)

    Stanojević, Jasna; Berić, Tanja; Opačić, Biljana; Vuković-Gačić, Branka; Simić, Draga; Knežević-Vukčević, Jelena

    2008-01-01

    The antimutagenic potential of essential oil (EO) of basil (Ocimum basilicum L.) and its major constituent linalool were studied with the E. coli K12 and S. cerevisiae D7 assays. In the E. coli assay, EO and linalool inhibited UV-induced mutagenesis in a repair-proficient strain, but had no effect on spontaneous mutagenesis in repair-proficient, nucleotide excision repair-deficient, and mismatch-deficient strains. By testing participation of different mechanisms involved in antimutagenesis, it was concluded that the antimutagenic effect against UV-induced mutagenesis involved decrease of protein synthesis and cell proliferation which led to increased efficiency of nucleotide excision repair. An antimutagenic effect of basil derivatives in S. cerevisiae was not detected. (author)

  15. The impact of hybridization on the volatile and sensorial profile of Ocimum basilicum L.

    Science.gov (United States)

    da Costa, Andréa Santos; Arrigoni-Blank, Maria de Fátima; da Silva, Maria Aparecida Azevedo Pereira; Alves, Mércia Freitas; Santos, Darlisson de Alexandria; Alves, Péricles Barreto; Blank, Arie Fitzgerald

    2014-01-01

    The aim of the present study was to investigate the volatile and sensorial profile of basil (Ocimum basilicum L.) by quantitative descriptive analysis (QDA) of the essential oil of three hybrids ("Cinnamon" × "Maria Bonita," "Sweet Dani" × "Cinnamon," and "Sweet Dani" × "Maria Bonita"). Twelve descriptive terms were developed by a selected panel that also generated the definition of each term and the reference samples. The data were subjected to ANOVA, Tukey's test, and principal component analysis. The hybrid "Cinnamon" × "Maria Bonita" exhibited a stronger global aroma that was less citric than the other samples. Hybridization favored the generation of novel compounds in the essential oil of the hybrid "Sweet Dani" × "Maria Bonita," such as canfora and (E)-caryophyllene; (E)-caryophyllene also was a novel compound in the hybrid "Sweet Dani" × "Cinnamon"; this compound was not present in the essential oils of the parents.

  16. The Effectiveness of Extracts Basil Leaves (Ocimum sanctum Linn) against Saprolegnia sp. by in Vitro

    Science.gov (United States)

    Sudarno; Luthfi Hakim, Muhammad; Kusdarwati, Rahayu

    2017-02-01

    Saprolegnia SP. is a fungi which is opportunistic and generally as a secondary pathogen on fish. Saprolegnia sp. infects epidermis tissue that begins at the head or fins and can spread over the entire surface of the body. The result of the using of chemicals to control infections of Saprolegnia spp. can cause pollution of the environment and harm the consumer. The purpose of this research was to determine the potential and the minimum concentration of extracts basil leaves (Ocimum sanctum Linn) as antifungi against the growth of Saprolegnia sp. by vitro. The research was held in Fish Quarantine Kelas I Juanda Suarabaya in January 2015. A positive result was obtained in the test of the effectiveness of basil leaves in inhibiting the growth of the fungus Saprolegnia sp. Concentration of the extract given to treatment 90% and 100% was able to inhibit the growth of Saprolegnia sp., indicated by the formation of the inhibitory zones at a concentration of treatment, and had the best results on the concentration of 100%.

  17. Rice weevil response to basil oil fumigation

    Science.gov (United States)

    Basil oil, Ocimum basilicum L., is a volatile plant essential oil that is known to have insecticidal activity against stored product pests such as rice weevil, Sitophilus oryzae (L.). Basil oil was diluted in acetone and applied to a sponge held inside a tea strainer for fumigations in containers wi...

  18. Analysis of the enzymatic formation of citral in the glands of sweet basil.

    Science.gov (United States)

    Iijima, Yoko; Wang, Guodong; Fridman, Eyal; Pichersky, Eran

    2006-04-15

    Basil glands of the Sweet Dani cultivar contain high levels of citral, a mixture of geranial and its cis-isomer neral, as well as low levels of geraniol and nerol. We have previously reported the identification of a cDNA from Sweet Dani that encodes an enzyme responsible for the formation of geraniol from geranyl diphosphate in the glands, and that these glands cannot synthesize nerol directly from geranyl diphosphate. Here, we report the identification of two basil cDNAs encoding NADP+-dependent dehydrogenases that can use geraniol as the substrate. One cDNA, designated CAD1, represents a gene whose expression is highly specific to gland cells of all three basil cultivars examined, regardless of their citral content, and encodes an enzyme with high sequence similarity to known cinnamyl alcohol dehydrogenases (CADs). The enzyme encoded by CAD1 reversibly oxidizes geraniol to produce geranial (which reversibly isomerizes to neral via keto-enol tautomerization) at half the efficiency compared with its activity with cinnamyl alcohol. CAD1 does not use nerol and neral as substrates. A second cDNA, designated GEDH1, encodes an enzyme with sequence similarity to CAD1 that is capable of reversibly oxidizing geraniol and nerol in equal efficiency, and prolonged incubation of geraniol with GEDH1 in vitro produces not only geranial and neral, but also nerol. GEDH1 is also active, although at a lower efficiency, with cinnamyl alcohol. However, GEDH1 is expressed at low levels in glands of all cultivars compared with its expression in leaves. These and additional data presented indicate that basil glands may contain additional dehydrogenases capable of oxidizing geraniol.

  19. The Impact of Hybridization on the Volatile and Sensorial Profile of Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Andréa Santos da Costa

    2014-01-01

    Full Text Available The aim of the present study was to investigate the volatile and sensorial profile of basil (Ocimum basilicum L. by quantitative descriptive analysis (QDA of the essential oil of three hybrids (“Cinnamon” × “Maria Bonita,” “Sweet Dani” × “Cinnamon,” and “Sweet Dani” × “Maria Bonita”. Twelve descriptive terms were developed by a selected panel that also generated the definition of each term and the reference samples. The data were subjected to ANOVA, Tukey’s test, and principal component analysis. The hybrid “Cinnamon” × “Maria Bonita” exhibited a stronger global aroma that was less citric than the other samples. Hybridization favored the generation of novel compounds in the essential oil of the hybrid “Sweet Dani” × “Maria Bonita,” such as canfora and (E-caryophyllene; (E-caryophyllene also was a novel compound in the hybrid “Sweet Dani” × “Cinnamon”; this compound was not present in the essential oils of the parents.

  20. Phytochemical screening and antioxidant activity of ethanolic extract and ethyl acetate fraction from basil leaf (Ocimum basilicum L.) by DPPH radical scavenging method

    Science.gov (United States)

    Warsi; Sholichah, A. R.

    2017-11-01

    Basil leaf (Ocimum basilicum L.) contains various compounds such as flavonoid, alkaloid, phenol and essential oil, so it needs to be fractionated to find out the flavonoid compound with the greatest potential as an antioxidant. This research was aimed to know the chemical compound, antioxidant potential of ethanolic extract and ethyl acetate fraction from basil leaf. The basil leaf was extracted by maceration using ethanol 70 %. The crude extract was fractionated with ethyl acetate. The ethanolic extract and ethyl acetate fraction were screened of phytochemical content including identification of flavonoids, alkaloids and polyphenolics. The antioxidant activity of the ethanolic extract and ethyl acetate fraction were tested qualitatively with 2,2-diphenyl-1-picrylhydrazyl (DPPH) and phosphomolybdate. Its antioxidant activity was determined quantitatively using DPPH radical scavenging method. Phytochemical screening test showed that ethanolic extract and ethyl acetate fraction from basil leaf contain flavonoids, polyphenolics, and alkaloids. The qualitative analysis of antioxidant activity of ethanolic extract and ethyl acetate fraction from basil leaf showed an antioxidant activity. The IC50 value of ethanolic extract, ethyl acetate fraction and quercetin were 1,374.00±6.20 389.00±1.00 2.10±0.01μg/mL, respectively. The research showed that antioxidant activity of the ethyl acetate fraction more potential than the ethanol extract of the basil leaf, but less than quercetin.

  1. The effects of different UV-B radiation intensities on morphological and biochemical characteristics in Ocimum basilicum L.

    Science.gov (United States)

    Sakalauskaitė, Jurga; Viskelis, Pranas; Dambrauskienė, Edita; Sakalauskienė, Sandra; Samuolienė, Giedrė; Brazaitytė, Aušra; Duchovskis, Pavelas; Urbonavičienė, Dalia

    2013-04-01

    The effects of short-term ultraviolet B (UV-B) irradiation on sweet basil (Ocimum basilicum L. cv. Cinnamon) plants at the 3-4 leaf pair and flowering stages were examined in controlled environment growth chambers. Plants were exposed to 0 (reference), 2 and 4 kJ UV-B m(-2) day(-1) over 7 days. Exposure of basil plants to supplementary UV-B light resulted in increased assimilating leaf area, fresh biomass and dry biomass. Stimulation of physiological functions in young basil plants under either applied UV-B dose resulted in increased total chlorophyll content but no marked variation in carotenoid content. At the flowering stage the chlorophyll and carotenoid contents of basil were affected by supplementary UV-B radiation, decreasing with enhanced UV-B exposure. Both total antioxidant activity (2,2-diphenyl-1-picrylhydrazyl free radical assay) and total phenolic compound content were increased by UV-B light supplementation. Young and mature basil plants differed in their ascorbic acid content, which was dependent on UV-B dose and plant age. UV-B radiation resulted in decreased nitrate content in young basil plants (3-4 leaf pair stage). These results indicate that the application of short-exposure UV-B radiation beneficially influenced both growth parameters and biochemical constituents in young and mature basil plants. © 2012 Society of Chemical Industry.

  2. Estudio farmacognóstico de ocimum basilicum l. (albahaca blanca

    Directory of Open Access Journals (Sweden)

    Ester Sánchez Govín

    2000-12-01

    Full Text Available Ocimum basilicum L. (albahaca blanca es una de las plantas aromáticas que se clasifican por la composición química de su aceite. Se investigó la variedad lactucaefolium que posee propiedades antisépticas, antiinflamatorias y antiespasmódicas. Se determinaron los índices numéricos en esta especie y se estandarizó el perfil cromatográfico a partir de su aceite esencial. El estudio de conservación muestra que el tiempo óptimo de almacenamiento en frasco de vidrio y sobres de polietileno es de 10 meses.Ocimum basilicum L. (white sweet basil is one of the aromatic plants that is classified according to the chemical composition of its oil. The lactucaefolium variety that has antiseptic, antiinflammatory and antispasmodic properties was investigated. The numerical indexes were determined in this species and the chromatographic profile was standardized starting from its essential oil. The conservation study shows that the optimum time of storage in glass flasks and polyethylene bags is of l0 months.

  3. Bactericidal activity of herbal volatile oil extracts against multidrug resistant Acinetobacter baumannii

    OpenAIRE

    Amornrat Intorasoot; Piyaorn Chornchoem; Siriwoot Sookkhee; Sorasak Intorasoot

    2017-01-01

    Aim: To investigate the antibacterial activity of ten volatile oils extracted from medicinal plants, including galangal (Alpinia galanga Linn.), ginger (Zingiber officinale), plai (Zingiber cassumunar Roxb.), lime (Citrus aurantifolia), kaffir lime (Citrus hystrix DC.), sweet basil (Ocimum basilicum Linn.), tree basil (Ocimum gratissimum), lemongrass (Cymbopogon citratus DC.), clove (Syzygium aromaticum) and cinnamon (Cinnamomum verum) against four standard strains of Staphylococcus aureus, E...

  4. Arbuscular Mycorrhizal Fungi Enhance Basil Tolerance to Salt Stress through Improved Physiological and Nutritional Status

    International Nuclear Information System (INIS)

    Salwa, A.; Abeer, H.; Alqarawi, A. A.; Abdullah, E.F.; Egamberdieva, D.

    2016-01-01

    Pot experiments were conducted to evaluate the influence of salinity on some physio-biochemical traits in sweet basil (Ocimum basilicum L.) cultivars with contrasting salt stress tolerance and to determine the role of arbuscular mycorrhizal fungi (AMF) in ameliorating the salt stress in plant. Salt stress (250 mM NaCl) reduced the colonization potential of AMF and inhibited photosynthetic pigments, chlorophyll and carotenoids in plant tissue. AMF inoculated plants contained higher level of chlorophyll pigments. Salt stressed plants showed increased lipid peroxidation, antioxidant enzyme activities like superoxide dismutase (SOD), ascorbate peroxidase (APX) and peroxidase (POD). Plants inoculated with AMF showed lower lipid peroxidation and enhanced antioxidant enzyme activities. Moreover, the content of lipids, proline, and soluble sugars in basil plants was improved with AMF inoculation. AMF inoculation reduced accumulation of Na+ and improved nutrient acquisition. In conclusion, AMF were capable to reduce oxidative stress via supporting of the antioxidant system. Salt tolerant cultivar showed higher antioxidant enzyme activity and accumulation of osmolytes. (author)

  5. Bactericidal activity of herbal volatile oil extracts against multidrug-resistant Acinetobacter baumannii

    OpenAIRE

    Intorasoot, Amornrat; Chornchoem, Piyaorn; Sookkhee, Siriwoot; Intorasoot, Sorasak

    2017-01-01

    Aim: The aim of the study is to investigate the antibacterial activity of 10 volatile oils extracted from medicinal plants, including galangal (Alpinia galanga Linn.), ginger (Zingiber officinale), plai (Zingiber cassumunar Roxb.), lime (Citrus aurantifolia), kaffir lime (Citrus hystrix DC.), sweet basil (Ocimum basilicum Linn.), tree basil (Ocimum gratissimum), lemongrass (Cymbopogon citratus DC.), clove (Syzygium aromaticum), and cinnamon (Cinnamomum verum) against four standard strains of ...

  6. Comparative Study of Essential Oils Extracted from Egyptian Basil Leaves (Ocimum basilicum L.) Using Hydro-Distillation and Solvent-Free Microwave Extraction.

    Science.gov (United States)

    Chenni, Mohammed; El Abed, Douniazad; Rakotomanomana, Njara; Fernandez, Xavier; Chemat, Farid

    2016-01-19

    Solvent-free microwave extraction (SFME) and conventional hydro-distillation (HD) were used for the extraction of essential oils (EOs) from Egyptian sweet basil (Ocimum basilicum L.) leaves. The two resulting EOs were compared with regards to their chemical composition, antioxidant, and antimicrobial activities. The EO analyzed by GC and GC-MS, presented 65 compounds constituting 99.3% and 99.0% of the total oils obtained by SFME and HD, respectively. The main components of both oils were linalool (43.5% SFME; 48.4% HD), followed by methyl chavicol (13.3% SFME; 14.3% HD) and 1,8-cineole (6.8% SFME; 7.3% HD). Their antioxidant activity were studied with the 2,2-diphenyl-1-picrylhydrazyl (DPPH(•)) radical scavenging method. The heating conditions effect was evaluated by the determination of the Total Polar Materials (TPM) content. The antimicrobial activity was investigated against five microorganisms: two Gram-positive bacteria, Staphylococcus aureus and Bacillus subtilis, two Gram-negative bacteria, Escherichia coli and Pseudomonas aeruginosa, and one yeast, Candida albicans. Both EOs showed high antimicrobial, but weak antioxidant, activities. The results indicated that the SFME method may be a better alternative for the extraction of EO from O. basilicum since it could be considered as providing a richer source of natural antioxidants, as well as strong antimicrobial agents for food preservation.

  7. A Set of Regioselective O-Methyltransferases Gives Rise to the Complex Pattern of Methoxylated Flavones in Sweet Basil1[C][W][OA

    Science.gov (United States)

    Berim, Anna; Hyatt, David C.; Gang, David R.

    2012-01-01

    Polymethoxylated flavonoids occur in a number of plant families, including the Lamiaceae. To date, the metabolic pathways giving rise to the diversity of these compounds have not been studied. Analysis of our expressed sequence tag database for four sweet basil (Ocimum basilicum) lines afforded identification of candidate flavonoid O-methyltransferase genes. Recombinant proteins displayed distinct substrate preferences and product specificities that can account for all detected 7-/6-/4′-methylated, 8-unsubstituted flavones. Their biochemical specialization revealed only certain metabolic routes to be highly favorable and therefore likely in vivo. Flavonoid O-methyltransferases catalyzing 4′- and 6-O-methylations shared high identity (approximately 90%), indicating that subtle sequence changes led to functional differentiation. Structure homology modeling suggested the involvement of several amino acid residues in defining the proteins’ stringent regioselectivities. The roles of these individual residues were confirmed by site-directed mutagenesis, revealing two discrete mechanisms as a basis for the switch between 6- and 4′-O-methylation of two different substrates. These findings delineate major pathways in a large segment of the flavone metabolic network and provide a foundation for its further elucidation. PMID:22923679

  8. Basil oil fumigation increases radiation sensitivity in adult Sitophilus oryzae (Coleoptera: Curculionidae).

    Science.gov (United States)

    The biological activity of basil (Ocimum basilicum L.) oil was tested against the stored product pest rice weevil, Sitophilus oryzae(L.). Adult weevils were exposed to seven different concentrations of basil oil ranging from 0.12 µl/ml-0.60 µl/ml in Petri dishes and mortality was assessed at 3,4 and...

  9. Lipid and protein oxidation in the internal part of italian type salami containing basil essential oil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Alexandre José Cichoski

    2011-06-01

    Full Text Available Different concentrations of basil essential oil (Ocimum basilicum L. (0.19; 0.38; 0.75; 1.87; 3.75 and 6.00 mg.g-1 were evaluated in relation to their antioxidant activity using the DPPH● radical methodology. From the IC50 obtained data, the concentrations of 0.19; 0.38; 0.75; 1.87; 3.75; 6.00 and 12.00 mg.mL-1 were applied directly to the product and these were sensorially evaluated by the test of control difference. The concentrations related to the highest acceptability (0.19; 0.38 and 0.75 mg.g-1 were tested for antioxidant activity in the internal part of Italian type salami - during the processing and after 30 days of storage, in terms of lipid and protein oxidation. The oxidation of lipids was determined using the method of TBARS. The method of carbonyl compounds was employed for proteins oxidation. Five different formulations of salami were elaborated: blank (without the use of antioxidant; control (using sodium eritorbate as antioxidant; and adding 0.19; 0.38 and 0.75 mg.g-1 of basil essential oil. The product was kept between 25 ºC and 18 ºC and UR between 95% and 70%, for 28 days. Analyses were carried out on the processing day and after 2, 7, 14, 21 and 28 days, and also following 30 days of storage. The basil essential oil in vitro presented an antioxidant activity of IC50 12 mg.mL-1. In the internal part of the Italian type salami the commercial antioxidant (control and the formulation containing 0.75 mg.g-1 of basil essential oil presented antioxidant activity in relation to the lipids, but not to the proteins - during processing and storage.

  10. Komposisi Kimia dan Uji Aktivitas Antibakteri Minyak Kemangi (Ocimum americanum L. Terhadap Bakteri Escherichia coli, Shigella sonnei, dan Salmonella enteritidis

    Directory of Open Access Journals (Sweden)

    Asep Kadarohman

    2011-06-01

    Full Text Available The chemical composition and antibacterial activity of basil oil (Ocimum americanum L. against Escherichia coli, Shigellasonnei and Salmonella enteritidis have been determined. Basil oils were isolated from leaves and stems of basil (Ocimum americanumL. with percolation method and analyzed by FTIR and GC-MS spectrometry. The antibacterial activity of basil oils were obtained byAgar diffusion method with various concentration (v/v 2, 4, 6, 8, and 10% with ethanol p.a. as negative control, thiamfenicol, andtetracycline 500 mg as positive control. The produces essential oils from leaves and stems of basil by percolation are 1.06 and 0.22%,respectively. There are 22 components of basil oil were identifi ed, with a major component are citral (35.58% and neral (29.56% .Basil oil has not effectively against Escherichia coli and Shigella sonnei but effectively against Salmonella enteritidis at concentration 8 and 10%, with inhibition zone diameter are 10.25 and 10.93 mm respectively.

  11. Effect of Light Spectral Quality on Essential Oil Components in Ocimum Basilicum and Salvia Officinalis Plants

    Directory of Open Access Journals (Sweden)

    A. S. IVANITSKIKH

    2014-07-01

    Full Text Available In plants grown with artificial lighting, variations in light spectral composition can be used for the directed biosynthesis of the target substances including essential oils, e.g. in plant factories. We studied the effect of light spectral quality on the essential oil composition in Ocimum basilicum and Salvia officinalis plants grown in controlled environment. The variable-spectrum light modules were designed using three types of high-power light-emitting diodes (LEDs with emission peaked in red, blue and red light, white LEDs, and high-pressure sodium lamps as reference. Qualitative and quantitative essential oil determinations were conducted using gas chromatography with mass selective detection and internal standard method.Sweet basil plant leaves contain essential oils (са. 1 % including linalool, pinene, eugenol, camphor, cineole, and other components. And within the genetic diversity of the species, several cultivar groups can be identified according to the flavor (aroma perceived by humans: eugenol, clove, camphor, vanilla basil. Essential oil components produce particular flavor of the basil leaves. In our studies, we are using two sweet basil varieties differing in the essential oil qualitative composition – “Johnsons Dwarf” (camphor as a major component of essential oils and “Johnsons Lemon Flavor” (contains large amount of citral defining its lemon flavor.In sage, essential oil composition is also very variable. As for the plant responses to the light environment, the highest amount of the essential oils was observed at the regimes with white and red + blue LED light. And it was three times less with red light LEDs alone. In the first two environments, thujone accumulation was higher in comparison with camphor, while red LED light and sodium lamp light favored camphor biosynthesis (three times more than thujone. The highest amount of eucalyptol was determined in plants grown with red LEDs.

  12. Extraction of bioactive compounds and free radical scavenging activity of purple basil (Ocimum basilicum L.) leaf extracts as affected by temperature and time.

    Science.gov (United States)

    Pedro, Alessandra C; Moreira, Fernanda; Granato, Daniel; Rosso, Neiva D

    2016-05-13

    In the current study, response surface methodology (RSM) was used to assess the effects of extraction time and temperature on the content of bioactive compounds and antioxidant activity of purple basil leaf (Ocimum basilicum L.) extracts. The stability of anthocyanins in relation to temperature, light and copigmentation was also studied. The highest anthocyanin content was 67.40 mg/100 g extracted at 30 °C and 60 min. The degradation of anthocyanins with varying temperatures and in the presence of light followed a first-order kinetics and the activation energy was 44.95 kJ/mol. All the extracts exposed to light showed similar half-lives. The extracts protected from light, in the presence of copigments, showed an increase in half-life from 152.67 h for the control to 856.49 and 923.17 h for extract in the presence of gallic acid and phytic acid, respectively. These results clearly indicate that purple basil is a potential source of stable bioactive compounds.

  13. Studies on production techniques of some herb plants: I Effect of Agryl P17 mulching on herb yield and volatile oils of basil (Ocimum basilicum L. and marjoram (Origanum majorana L.

    Directory of Open Access Journals (Sweden)

    S. Hälvä

    1987-01-01

    Full Text Available Agryl P17 fiber-mulching of cold-sensitive herbal plants, basil (Ocimum basilicum L. and marjoram (Origanum majorana L., were studied at three locations in Finland (1984—1985. The growing sites were Helsinki (60° 14' N, Sahalahti (61° 28' N, and Inari (69° 04' N for both species in 1984, and Helsinki for marjoram in 1985. Agryl P17 mulching increased basil yield at all locations. The uncovered basil yielded approximately 54 kg/100 m2 and when grown under the mulch, more than three fold, 191 kg/ 100m2. In the north (Inari, however, basil and marjoram did not give practically any yield. Marjoram did not benefit from mulching either in the south: the yield was 96 kg without and 80 kg/100m2 with mulching. The vegetation under the mulch was severely affected by fungus diseases. The volatile oil content in the dried basil herb ranged from 0.46 to 0.93 %. There were no significant differences in the total oil content whether basil was grown with or without Agryl P17. The oil content in marjoram ranged from 1.94 to 2.55 % the total content being significantly higher when grown under the cover.

  14. Regulation of Floral Terpenoid Emission and Biosynthesis in Sweet Basil (Ocimum basilicum).

    Science.gov (United States)

    Jiang, Yifan; Ye, Jiayan; Li, Shuai; Niinemets, Ülo

    2016-12-01

    Past studies have focused on the composition of essential oil of Ocimum basilicum leaves, but data on composition and regulation of its aerial emissions, especially floral volatile emissions are scarce. We studied the chemical profile, within-flower spatial distribution (sepals, petals, pistils with stamina and pedicels), diurnal emission kinetics and effects of exogenous methyl jasmonate (MeJA) application on the emission of floral volatiles by dynamic headspace collection and identification using gas chromatography-mass spectrometry (GC-MS) and proton transfer reaction mass spectrometry (PTR-MS). We observed more abundant floral emissions from flowers compared with leaves. Sepals were the main emitters of floral volatiles among the flower parts studied. The emissions of lipoxygenase compounds (LOX) and monoterpenoids, but not sesquiterpene emissions, displayed a diurnal variation driven by light. Response to exogenous MeJA treatment of flowers consisted of a rapid stress response and a longer-term acclimation response. The initial response was associated with enhanced emissions of fatty acid derivatives, monoterpenoids, and sesquiterpenoids without variation of the composition of individual compounds. The longer-term response was associated with enhanced monoterpenoid and sesquiterpenoid emissions with profound changes in the emission spectrum. According to correlated patterns of terpenoid emission changes upon stress, highlighted by a hierarchical cluster analysis, candidate terpenoid synthases responsible for observed diversity and complexity of released terpenoid blends were postulated. We conclude that flower volatile emissions differ quantitatively and qualitatively from leaf emissions, and overall contribute importantly to O. basilicum flavor, especially under stress conditions.

  15. Efficiency of n-octyl-acetate, 2-heptanone and citronellal in repelling bees from basil (Ocimum sellowii - Labiatae

    Directory of Open Access Journals (Sweden)

    Darclet Teresinha Malerbo-Souza

    2004-03-01

    Full Text Available The objective of this study was to test repellent substances for honey bees, Apis mellifera, for basil, Ocimum sellowii, and to study the most frequent insects in this crop as well as its behaviors. The frequency of honey bees did not decrease with the application of n.octyl.acetate, citronellal and 2.heptanone, used as repellents, in the concentrations 2.5, 5.0, 7.5 and 10.0% diluted in water. However, when the products (20% were diluted in water (75% and glycerine (5% were effective in repelling those bees of the basil flowers for a period of 20 minutes. The flower lasted, on average, 30 h from the bud phase until the flower withered. The flowers number opened by inflorescence was, on average, 5.65 flowers, and the inflorescence presented, on average, 160 flowers-buds. The basil was visited mainly for the honey bee (98.0%, followed by Augochloropsis electra bee - Halictidae (2.0% and visits sporadics of Diptera and Lepidoptera, collected only nectar. The honey bee frequency increased during the day to 14:00, decreasing soon after, accompanying the curve of the temperature sets registered in the experiment days.O objetivo do experimento foi estudar a polinização em manjericão (Ocimum sellowii, a fim de verificar sua atratividade para as abelhas Apis mellifera, os insetos mais freqüentes, bem como seus comportamentos e testar substâncias repelentes para as abelhas A. mellifera. A flor durou, em média, 30 horas, desde sua abertura até o murchamento. O número de flores abertas por inflorescência foi, em média, 5,65 flores, sendo que a inflorescência possuía, em média, 160 botões florais. O manjericão foi visitado quase que exclusivamente pela abelha A. mellifera africanizada (98,0%, seguida pela abelha Augochloropsis electra-Halictidae (2,0% e visitas esporádicas de dípteros e lepidópteros, sendo que todos coletavam apenas néctar. A freqüência da abelha africanizada aumentou no decorrer do dia até às 14 horas, diminuindo em

  16. Chemical composition of the essential oil of basil (Ocimum basilicum L. Lamiaceae)

    OpenAIRE

    Jelačić Slavica Ć.; Beatović Damir V.; Prodanović Slaven A.; Tasić Slavoljub R.; Moravčević Đorđe Ž.; Vujošević Ana M.; Vučković Savo M.

    2011-01-01

    In Serbia basil has been grown traditionally as a decorative, medicinal, seasoning and ritual herb, and there is a variety of different populations of basil. Basil is considered to have been brought to Serbia in the 12th century by monks returning from their pilgrimages. Essential oils isolated from herb of ten basil populations traditionally grown on the territory of the Republic of Serbia have been analyzed. The selected populations have been designated under codes from T-1 to T-10 an...

  17. Effects of various organic and chemical fertilizers on growth indices of basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    S.M.K. Tahami

    2016-05-01

    Full Text Available In order to develop the high intensive agriculture, more chemical fertilizers are applied to the soil that resulting in soil degradation and environment deterioration. Application of organic manure is an important approach for maintaining and improving the soil fertility and increasing fertilizer use efficiency. Therefore, in order to evaluate the effect of organic manures and chemical fertilizer on growth indices and biological yield of basil (Ocimum basilicum L., an experiment was conducted at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, during growing season of 2008-2009. A complete randomized block design with six treatments and three replications was used. The treatments were: cow manure, sheep manure, chicken manure, vermicompost, chemical NPK fertilizers and control (no fertilizer. The results showed that the use of organic fertilizers significantly increased seed and biological yield of basil compared with chemical fertilizer and control. The maximum and the minimum dry weights were observed at 105 days after planting, in sheep and cow manures, respectively. Gradually during the period of plant growth and development to reproduction phase percent of stem decreased and dry weight of inflorescence increased. The highest and the lowest leaf area index were observed at 90 days after planting, in cow manure and control, respectively, and then decreased in all treatments. The maximum crop growth rate in most of treatments at 90 days after planting was obtained, except the control which plant growth rate was lowest. Net assimilation rate (NAR in most treatments increased until 75 days after planting and then declined. While the highest and the lowest NAR were observed at 75 days after planting in chicken manure and chemical treatment, respectively.

  18. Yaldiz et al., Afr J Tradit Complement Altern Med. (2015) 12(6):71-76

    African Journals Online (AJOL)

    Proff.Adewunmi

    Background: Ocimum basilicum L., commonly known as sweet basil, is an important aromatic plant cultivated in many parts of the world for its essential oil. Basil does not show natural distribution in Turkey but they are cultivated as medicinal, seasoning or oil plants especially in the western and southern Anatolia. In this ...

  19. Regulation of Floral Terpenoid Emission and Biosynthesis in Sweet Basil (Ocimum basilicum)

    Science.gov (United States)

    Jiang, Yifan; Ye, Jiayan; Li, Shuai; Niinemets, Ülo

    2018-01-01

    Past studies have focused on the composition of essential oil of Ocimum basilicum leaves, but data on composition and regulation of its aerial emissions, especially floral volatile emissions are scarce. We studied the chemical profile, within-flower spatial distribution (sepals, petals, pistils with stamina and pedicels), diurnal emission kinetics and effects of exogenous methyl jasmonate (MeJA) application on the emission of floral volatiles by dynamic headspace collection and identification using gas chromatography-mass spectrometry (GC-MS) and proton transfer reaction mass spectrometry (PTR-MS). We observed more abundant floral emissions from flowers compared with leaves. Sepals were the main emitters of floral volatiles among the flower parts studied. The emissions of lipoxygenase compounds (LOX) and monoterpenoids, but not sesquiterpene emissions, displayed a diurnal variation driven by light. Response to exogenous MeJA treatment of flowers consisted of a rapid stress response and a longer-term acclimation response. The initial response was associated with enhanced emissions of fatty acid derivatives, monoterpenoids, and sesquiterpenoids without variation of the composition of individual compounds. The longer-term response was associated with enhanced monoterpenoid and sesquiterpenoid emissions with profound changes in the emission spectrum. According to correlated patterns of terpenoid emission changes upon stress, highlighted by a hierarchical cluster analysis, candidate terpenoid synthases responsible for observed diversity and complexity of released terpenoid blends were postulated. We conclude that flower volatile emissions differ quantitatively and qualitatively from leaf emissions, and overall contribute importantly to O. basilicum flavor, especially under stress conditions. PMID:29367803

  20. MORPHO-CHEMICAL DESCRIPTION AND ANTIMICROBIAL ACTIVITY OF DIFFERENT OCIMUM SPECIES

    Directory of Open Access Journals (Sweden)

    KAKARAPARTHI PANDU SASTRY

    2012-12-01

    Full Text Available Basil is a popular medicinal and culinary herb, and its essential oils have been used extensively for many years in food products, perfumery, dental and oral products. Basil essential oils and their principal constituents were found to exhibit antimicrobial activity against a wide range of Gram-negative and Gram-positive bacteria, yeast, and mould. The essential oils obtained from aerial parts of three different species of Ocimum comprising twenty one germplasm lines were investigated for their essential oil composition and antimicrobial activity during 2010. Essential oils from seventeen germplasm lines in Ocimum basilicum and two each in Ocimum tenuiflorum and Ocimum gratissimum were investigated for anti-microbial activity against four bacterial strains (Staphylococcus aureus, Bacillus sps., Escherichia coli and Pseudomonas aeruginosa. The morpho-chemotypes exhibited wide variability for morphological and chemical traits. Anti-bacterial activity was found to be high for Staphylococcus aureus, moderate for Escherichia coli, low for Bacillus and Pseudomonas aeruginosa was highly resistant. The essential oils of Pale Green-Broad Leaves (O. basilicum and CIM Ayu (O. gratissimum exhibited significant antibacterial activity against both S. aureus and E. coli signifying them promising for anti-bacterial activity. No relationship was observed between chemotype specificity and anti-bacterial activity, indicating that apart from major components of essential oil, minor components and other factors may be responsible for anti-microbial activities.

  1. Study on Corrosion Inhibition Efficiency of Stem Alkaloid Extract of Different Varieties of Holy Basil on Aluminium in HCl Solution

    Energy Technology Data Exchange (ETDEWEB)

    Kumpawat, Nutan; Chaturvedi, Alok; Upadhyay, R. K. [Synthetic and Surface Science Laboratory, Ajmer (India)

    2012-08-15

    Corrosion inhibition efficiencies of holy basil on Al in HCl solution were studied by weight loss and thermometric methods in presence and in absence of stem extract of three different varieties of holy basil viz. ocimum basilicum (E{sub B}), ocimum canum (E{sub C}) and ocimum sanctum (E{sub S}). Inhibition efficiency increases with the increasing concentration of stem extract and decreases with increases in acid strength. Results show that all varieties under study are good corrosion inhibitors, among which, E{sub B} is most effective. Maximum inhibition efficiency was found 97.09% in 0.5N HCl solution with 0.6% stem extract. The Langmuir adsorption isotherm indicates that surface coverage also increases with increasing in the concentration of extract of stem in HCl solution.

  2. Study on Corrosion Inhibition Efficiency of Stem Alkaloid Extract of Different Varieties of Holy Basil on Aluminium in HCl Solution

    International Nuclear Information System (INIS)

    Kumpawat, Nutan; Chaturvedi, Alok; Upadhyay, R. K.

    2012-01-01

    Corrosion inhibition efficiencies of holy basil on Al in HCl solution were studied by weight loss and thermometric methods in presence and in absence of stem extract of three different varieties of holy basil viz. ocimum basilicum (E B ), ocimum canum (E C ) and ocimum sanctum (E S ). Inhibition efficiency increases with the increasing concentration of stem extract and decreases with increases in acid strength. Results show that all varieties under study are good corrosion inhibitors, among which, E B is most effective. Maximum inhibition efficiency was found 97.09% in 0.5N HCl solution with 0.6% stem extract. The Langmuir adsorption isotherm indicates that surface coverage also increases with increasing in the concentration of extract of stem in HCl solution

  3. Effects of aqueous extract of Ocimum gratissimum on ...

    African Journals Online (AJOL)

    JTEkanem

    2008-04-29

    Apr 29, 2008 ... called African basil. It is a shrub commonly found in gardens and around village huts2. Scientifically, it is called. Ocimum gratissimum. It is widely distributed in tropical and warm temperature regions. It is used commonly in folk medicine to treat different diseases such as upper respiratory tract infections ...

  4. Original Research

    African Journals Online (AJOL)

    home

    2014-12-21

    Dec 21, 2014 ... Natural plant extracts are promising alternatives for chemical food additives and ... pesticides. ..... Table 2: Determination of antifungal properties of oil extracts by disk .... concentration of sweet basil (Ocimum basilicum), cassia.

  5. Chemical composition of the essential oil of basil (Ocimum basilicum L. Lamiaceae

    Directory of Open Access Journals (Sweden)

    Jelačić Slavica Ć.

    2011-01-01

    Full Text Available In Serbia basil has been grown traditionally as a decorative, medicinal, seasoning and ritual herb, and there is a variety of different populations of basil. Basil is considered to have been brought to Serbia in the 12th century by monks returning from their pilgrimages. Essential oils isolated from herb of ten basil populations traditionally grown on the territory of the Republic of Serbia have been analyzed. The selected populations have been designated under codes from T-1 to T-10 and deposited in the Plant Genes Bank at Serbia and at the Institute for Crop Sciences of the Faculty of Agriculture in Belgrade. Essential oils of all tested basil populations were light yellow and had a specific aromatic scent. The composition of essential oil in the dry herb of the tested populations ranged from 0.87 to 1.84%. The results of gas chromatographic analysis of essential oils in tested basil populations pointed to their complex chemical composition and to the fact that they belong to the most appreciated European chemotype. In total thirty three components have been identified in the essential oils. The most common fraction of components in all tested oils was terpenoides. The predominant component in all essential oils is monoterpen linalol, ranging from 51.52 to 74.73%. Phenylpropranoid methylchavicol ranged from 2.49 to 18.97%. Essential oils of populations T-6, T-7, T-8 and T-10 were characterized by elevated 1.8-cineol (4.44, 3.70, 4.01 and 3.43%, respectively. Populations T-3 and T-4 in essential oil contained higher percent of geraniol (4.27 and 3.31%, respectively. In all ten essential oils sesquiterpen fraction consisted of greater number of components, with germacrene having special significance as it was found in high percentage in all populations. The highest content of germacrene was registered in population T-9 (4.30%, T-10 (4.18%, while in others it ranged from 2.17 to 3.69%. Basil populations traditionally grown in Serbia have

  6. The Influence of Cultivars and Phenological Phases on the Accumulation of Nevadensin and Salvigenin in Basil (Ocimum basilicum).

    Science.gov (United States)

    Bernhardt, Botond; Bernáth, Jenő; Gere, Attila; Kókai, Zoltán; Komáromi, Bonifác; Tavaszi-Sárosi, Szilvia; Varga, László; Sipos, László; Szabó, Krisztina

    2015-10-01

    According to the earlier literature the optimum harvest time for basil is at the full flowering stage if accumulation of essential oil is taken into account. In this research we have investigated our gene-bank stored basil accessions to determine whether the harvest timing is variety specific or not considering their flavonoid accumulation pattern. In our work we have determined by HPLC the content of two main flavonoid compounds, salvigenin and nevadensin, of eight different gene bank accessions from 2013 of Ocimum basilicum L. Data were analysed with the nonparametric Kruskal-Wallis test. Multiple pairwise comparisons were made using the Conover-Iman procedure where the significance level was 5%. We have observed that the optimum harvest time is at the full flowering stage in the case of accessions 'Genovese' and 'Piros', but this was not verified for the others. The result of our experiment has shown that the maximum salvigenin and nevadensin content was detected both at the full- and early flowering period. Almost in all phenological phases the accession 'M. Grünes' accumulated the highest level of nevadensin, while accession 'Lengyel' produced the lowest results in all phenological phases. Generally it could be observed that compared with nevadensin more salvigenin is accumulated, and it is independent of the phenological phases. In the case of salvigenin, 'M. Grünes' accession produced the largest quantity and accession 'Dark Opal' showed the lowest values. Our analyses demonstrated that harvest at different phenological phases may result in different amounts of active agents according to the cultivar.

  7. Oxygen amendment on growth and nitrogen-use efficiency of flooded Italian Basil

    Science.gov (United States)

    Flooding is a frequent and often unavoidable cause of stress, in vegetable production in Florida. Flooding results in hypoxia i.e., oxygen deficiency. This study was conducted with traditional Italian basil (Ocimum basilicum L.), cv. Genovese OG, treated with either a fast- or slow-release solid oxy...

  8. Foliar Exposure of Cu(OH)2 Nanopesticide to Basil ( Ocimum basilicum): Variety-Dependent Copper Translocation and Biochemical Responses.

    Science.gov (United States)

    Tan, Wenjuan; Gao, Qin; Deng, Chaoyi; Wang, Yi; Lee, Wen-Yee; Hernandez-Viezcas, Jose A; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L

    2018-04-04

    In this study, low and high anthocyanin basil ( Ocimum basilicum) varieties (LAV and HAV) were sprayed with 4.8 mg Cu/per pot from Cu(OH) 2 nanowires, Cu(OH) 2 bulk (CuPro), or CuSO 4 and cultivated for 45 days. In both varieties, significantly higher Cu was determined in leaves of CuSO 4 exposed plants (691 and 672.6 mg/kg for LAV and HAV, respectively); however, only in roots of HAV, Cu was higher, compared to control ( p ≤ 0.05). Nanowires increased n-decanoic, dodecanoic, octanoic, and nonanoic acids in LAV, but reduced n-decanoic, dodecanoic, octanoic, and tetradecanoic acids in HAV, compared with control. In HAV, all compounds reduced eugenol (87%), 2-methylundecanal (71%), and anthocyanin (3%) ( p ≤ 0.05). In addition, in all plant tissues, of both varieties, nanowires and CuSO 4 reduced Mn, while CuPro increased chlorophyll contents, compared with controls ( p ≤ 0.05). Results suggest that the effects of Cu(OH) 2 pesticides are variety- and compound-dependent.

  9. The Utilization of Ocimum sanctum L. Essential Oil for Antimicrobial Edible Packaging and Its Application for Aloe Vera Dodol

    Directory of Open Access Journals (Sweden)

    Pramono Putro Utomo

    2013-12-01

    Full Text Available Aloe vera dodol is a traditional food of West Kalimantan that has short shelf life because of its microbial activity. Antimicrobial edible packaging could be used to maintain the quality of packaged food product actively.The purpose of this study is to prolong the shelf life of food products using antimicrobial edible packaging from durian peel and basil (Ocimum sanctum L. essential oil. The research was conducted through 4 phases,i.e. the extraction of pectin from durian peel, basil essential oil distillation, Aspergillus flavus inhibition assay, and antimicrobial edible coating production incorporated with Ocimum sanctum L. essential oil. The results showed that pectin extracted from durian peel at pH 4.5 could give yield of 5.9% with a clear coat (Colourless.The concentration of Ocimum sanctum L. essential oil by 0.6% could inhibit the growth of Aspergillus flavus and prolong the shelf life when applied as an antimicrobial ingredient in edible coating.

  10. Chemical composition, antioxidative and antimicrobial activity of essential oil Ocimum sanctum L.

    Directory of Open Access Journals (Sweden)

    Beatović Damir V.

    2013-01-01

    Full Text Available Ocimum sanctum L. (Lamiaceae sin. Ocimum tenuiflorum L. or Tulsi basil is a plant originating from tropical and subtropical areas of India. It is used in both the traditional and official medicine in India. Tulsi is a type of basil that is insufficiently explored and studied in Europe. The goal of this paper is to determine the chemical composition, antioxidative, and antimicrobial activity of the essential oil Ocimum sanctum L. grown in Serbia. The quantity of essential oil in 100 g of herb (v/w is 0.68%, with 41 components identified in the tested essential oil. The most represented chemical group are sesquiturpene hydrocarbonates with 80.47%. Other groups were much less represented. Sesquiturpene hydrocarbonate β-cariophyllene is a predominant component in the essential oil with 63.80%. The quantity of tested essential oil needed to achieve 50% of inhibition of DPPH radicals is 0.35 μg/ml, and it has high potential to neutralize free radicals. The essential oil exhibited antibacterial activity to all tested strains of bacteria, both Gram-positive and Gram-negative. It affected all strains in an inhibitory way in the interval 0.34-41.50 μl/ml, and in a bactericide way within the range 22.50-124.5 μl/ml. The most sensitive strains of bacteria are Salmonella typhimurium and Escherichia coli, while Listeria monocytogenes and Enterococus faecalis showed greatest resistance. The essential oil exhibited antifugal activity on all tested fungi. It affected all tested fungi in an inhibitory way in the interval 4.42-8.83 μl/ml, and in a microbicide way within the range 10.00-50.00 μl/ml. The most sensitive fungi are: Aspergillus ochraceus, Penicillium ochrochloron and Penicilium funiculosum, while the most resistent one is Aspergillus niger. The tested basil essential oil Ocimum sanctum demonstrated significant antioxidative and antimicrobial effect and may be used as a raw material in food, pharmaceutical and chemical industries.

  11. Antifungal activities of basil ( Ocimum basilicum L.) extract on ...

    African Journals Online (AJOL)

    ... and 29.27%, respectively) whereas other investigated Fusarium species exhibited much lower sensitivity. The basil extract completely inhibited the growth of investigated Fusarium spp. at the concentration of 1.50% (v/v). Higher concentrations (0.35 and 0.70% (v/v)) reduced growth of aerial mycelium in all tested species.

  12. Fibroblast and keratinocyte gene expression following exposure to the extracts of holy basil plant (Ocimum tenuiflorum, malabar nut plant (Justicia adhatoda, and emblic myrobalan plant (Phyllanthus emblica

    Directory of Open Access Journals (Sweden)

    Takao Someya

    2018-04-01

    Full Text Available This data article provides gene expression profiles, determined by using real-time PCR, of fibroblasts and keratinocytes treated with 0.01% and 0.001% extracts of holy basil plant (Ocimum tenuiflorum, sri lankan local name “maduruthala”, 0.1% and 0.01% extracts of malabar nut plant (Justicia adhatoda, sri lankan local name “adayhoda” and 0.003% and 0.001% extracts of emblic myrobalan plant (Phyllanthus emblica, sri lankan local name “nelli”, harvested in Sri Lanka. For fibroblasts, the dataset includes expression profiles for genes encoding hyaluronan synthase 1 (HAS1, hyaluronan synthase 2 (HAS2, hyaluronidase-1 (HYAL1, hyaluronidase-2 (HYAL2, versican, aggrecan, CD44, collagen, type I, alpha 1 (COL1A1, collagen, type III, alpha 1 (COL3A1, collagen, type VII, alpha 1 (COL7A1, matrix metalloproteinase 1 (MMP1, acid ceramidase, basic fibroblast growth factor (bFGF, fibroblast growth factor-7 (FGF7, vascular endothelial growth factor (VEGF, interleukin-1 alpha (IL-1α, cyclooxygenase-2 (cox2, transforming growth factor beta (TGF-β, and aquaporin 3 (AQP3. For keratinocytes, the expression profiles are for genes encoding HAS1, HAS2, HYAL1, HYAL2, versican, CD44, IL-1α, cox2, TGF-β, AQP3, Laminin5, collagen, type XVII, alpha 1 (COL17A1, integrin alpha-6 (ITGA6, ceramide synthase 3 (CERS3, elongation of very long chain fatty acids protein 1 (ELOVL1, elongation of very long chain fatty acids protein 4 (ELOVL4, filaggrin (FLG, transglutaminase 1 (TGM1, and keratin 1 (KRT1. The expression profiles are provided as bar graphs. Keywords: Real-time PCR, Gene expression profile, Fibroblast, Keratinocyte, Holy basil extract, Ocimum tenuiflorum, Maduruthala, Malabar nut plant extract, Justicia adhatoda, Adayhoda, Emblic myrobalan extract, Phyllanthus emblica, Nelli

  13. Protective Effect of Ocimum basilicum on Brain Cells Exposed to Oxidative Damage by Electromagnetic Field in Rat: Ultrastructural Study by Transmission Electron Microscopy

    Directory of Open Access Journals (Sweden)

    Khaki Arash

    2016-01-01

    Full Text Available Objective: Basil herb (Ocimum basilicum has long been used in human nutrition. Nowadays antioxidant role of this herb is known more. The aim of this study was to study the anti-oxidative property of sweet basil to protect central nervous system against oxidative damages of electromagnetic field (EMF and its affective sequences. Materials and Methods: Forty Albino male Wistar rats were randomly allocated to four groups, 10 rats per each. Group 1 received normal diet (control group, group 2 was exposed to 50 Hz EMF for 8 weeks (EMF group. Group 3 was exposed to 50 Hz EMF and fed with basil extract (0.5 g/kg body weight for 8 weeks (treatment group and group 4 was fed with basil extract (0.5 g/kg body weight for 8 weeks and named as herbal group. At the end of eighth week 5 mL blood was taken from all rats for biochemical analysis and for ultra structural study of brain neuron samples was taken. Results: The results showed level of superoxide dismutase (SOD, glutathione (GSH peroxidase and catalase activity (CAT were significantly increased in herbal and treatment groups as compared to EMF group (P < 0.05. Level of malondialdehyde (MDA was significantly decreased in treatment group as compare to EMF group (P < 0.05. Ultra structural evaluation of EMF group showed brain nucleus has a lot of heterochromatic changes and mitochondria have been ovulated and have swelling figure this changes were less in treatment group. Conclusion: Antioxidant capacity of basil extract can cause to decrease oxidative effects of EMF on brain tissue and in rats.

  14. Surface coating changes the physiological and biochemical impacts of nano-TiO2 in basil (Ocimum basilicum) plants.

    Science.gov (United States)

    Tan, Wenjuan; Du, Wenchao; Barrios, Ana C; Armendariz, Raul; Zuverza-Mena, Nubia; Ji, Zhaoxia; Chang, Chong Hyun; Zink, Jeffrey I; Hernandez-Viezcas, Jose A; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L

    2017-03-01

    Little is known about the effects of surface coating on the interaction of engineered nanoparticles (ENPs) with plants. In this study, basil (Ocimum basilicum) was cultivated for 65 days in soil amended with unmodified, hydrophobic (coated with aluminum oxide and dimethicone), and hydrophilic (coated with aluminum oxide and glycerol) titanium dioxide nanoparticles (nano-TiO 2 ) at 125, 250, 500, and 750 mg nano-TiO 2 kg -1 soil. ICP-OES/MS, SPAD meter, and UV/Vis spectrometry were used to determine Ti and essential elements in tissues, relative chlorophyll content, carbohydrates, and antioxidant response, respectively. Compared with control, hydrophobic and hydrophilic nano-TiO 2 significantly reduced seed germination by 41% and 59%, respectively, while unmodified and hydrophobic nano-TiO 2 significantly decreased shoot biomass by 31% and 37%, respectively (p ≤ 0.05). Roots exposed to hydrophobic particles at 750 mg kg -1 had 87% and 40% more Ti than the pristine and hydrophilic nano-TiO 2 ; however, no differences were found in shoots. The three types of particles affected the homeostasis of essential elements: at 500 mg kg - 1 , unmodified particles increased Cu (104%) and Fe (90%); hydrophilic increased Fe (90%); while hydrophobic increased Mn (339%) but reduced Ca (71%), Cu (58%), and P (40%). However, only hydrophobic particles significantly reduced root elongation by 53%. Unmodified, hydrophobic, and hydrophilic particles significantly reduced total sugar by 39%, 38%, and 66%, respectively, compared with control. Moreover, unmodified particles significantly decreased reducing sugar (34%), while hydrophobic particles significantly reduced starch (35%). Although the three particles affected basil plants, coated particles impacted the most its nutritional quality, since they altered more essential elements, starch, and reducing sugars. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Heavy Metals in selected Edible Vegetables and their daily intake in Sanandaj, Iran

    International Nuclear Information System (INIS)

    Alasvand Zarasvand, M.; Maleki, A.

    2009-01-01

    The levels of four different heavy metals [cadmium (Cd), lead (Pb), chromium (Cr) and copper (Cu)] were determined in various vegetables [leek (Allium ampeloprasum), sweet basil (Ocimum basilicum), parsley (Petroselium cripsum), gardem cress (lepidium sativum) and tarragon (Artemisia dracuncullus)] cultivated around the Sanandaj city. (Author)

  16. Heavy Metals in selected Edible Vegetables and their daily intake in Sanandaj, Iran

    Energy Technology Data Exchange (ETDEWEB)

    Alasvand Zarasvand, M; Maleki, A

    2009-07-01

    The levels of four different heavy metals [cadmium (Cd), lead (Pb), chromium (Cr) and copper (Cu)] were determined in various vegetables [leek (Allium ampeloprasum), sweet basil (Ocimum basilicum), parsley (Petroselium cripsum), gardem cress (lepidium sativum) and tarragon (Artemisia dracuncullus)] cultivated around the Sanandaj city. (Author)

  17. Author Details

    African Journals Online (AJOL)

    Aqueous and ethanolic leaf extracts of Ocimum basilicum (sweet basil) protect against sodium arsenite-induced hepatotoxicity in Wistar rats. Abstract PDF · Vol 29, No 1 (2014) - Articles Hepatoprotective and anticlastogenic effects of ethanol extract of Irvingia gabonensis (IG) leaves in sodium arsenite-induced toxicity in ...

  18. FEASIBILITY STUDY OF ANAEROBIC DIGESTION OF OCIMUM SANCTUM LEAF WASTE GENERATED FROM SANCTUM SANCTORUM

    Directory of Open Access Journals (Sweden)

    Korla Swapnavahini

    2010-02-01

    Full Text Available The waste originated in temples is presently piled up at one place and then disposed off in water bodies or dumped on land to decay, leading to water and soil pollution. The present work aims to determine the biogas yield and nutrient reduction potential of Ocimum sanctum (basil leaf waste obtained from temples. Laboratory scale digesters of 2.5 L capacity were used and fed with basil leaf waste, which was digested in a batch reactor for a retention period of 30 days at room temperature. Preliminary results indicate that the process is effective in reducing the pollution potential of the basil waste. The process removed up to 73% and 42% of total solids and BOD, respectively, along with biogas production.

  19. Kinetics of drying of basil leaves (Ocimum basilicum L. in the infrared Cinética de secagem de folhas de manjericão (Ocimum basilicum L. via infravermelho

    Directory of Open Access Journals (Sweden)

    Renata C. dos Reis

    2012-12-01

    Full Text Available The objective of this paper was to model the drying curves of the leaves of basil (Ocimum basilicum L. in the infrared at temperatures of 50, 60, 70 and 80 ºC and to evaluate the influence of drying temperature on the color of dried leaves. Drying was conducted in infrared dryer with temperature and greenhouse air circulation. Experimental data were fitted to eight mathematical models. The magnitude of the coefficient of determination (R², the mean relative error (P, the estimated mean error (SE and chisquare test (χ2 were used to verify the degree of fitness of the models. From the study it was concluded that: a the behavior of the drying curves of basil leaves was similar to most agricultural products, the drying times in the infrared were less than the drying times in an oven with air circulation, b the mathematical drying model proposed by Midilli et al. (2002 was the one which best adjusted to the experimental data, c the diffusion coefficient ranged from 9.10 x 10-12 to 2.92 x 10-11 m² s-1 and d the color of the samples was highly influenced by drying, becoming darker due to loss of chlorophyll with increasing temperature.Objetivou-se, neste trabalho, determinar, modelar as curvas de secagem das folhas de Manjericão (Ocimum basilicum L. por infravermelho nas temperaturas de 50, 60, 70 e 80 ºC e avaliar a influência das temperaturas de secagem na cor das folhas desidratadas. A secagem foi conduzida em secador infravermelho com controle de temperatura e em estufa com circulação de ar. Aos dados experimentais foram ajustados oito modelos matemáticos. As magnitudes do coeficiente de determinação (R², do erro médio relativo (P, do erro médio estimado (SE e do teste do qui-quadrado (χ² foram utilizadas para verificar o grau de ajuste dos modelos. Do estudo concluiu-se que: a o comportamento das curva s de secagem das folhas de manjericão foi semelhante ao da maioria dos produtos agrícolas; os tempos de secagem no infravermelho

  20. Chemical composition of the essential oil from basil (Ocimum basilicum Linn.) and its in vitro cytotoxicity against HeLa and HEp-2 human cancer cell lines and NIH 3T3 mouse embryonic fibroblasts.

    Science.gov (United States)

    Kathirvel, Poonkodi; Ravi, Subban

    2012-01-01

    This study examines the chemical composition and in vitro anticancer activity of the essential oil from Ocimum basilicum Linn. (Lamiaceae), cultivated in the Western Ghats of South India. The chemical compositions of basil fresh leaves were identified by GC-MS: 11 components were identified. The major constituents were found to be methyl cinnamate (70.1%), linalool (17.5%), β-elemene (2.6%) and camphor (1.52%). The results revealed that this plant may belong to the methyl cinnamate and linalool chemotype. A methyl thiazol tetrazolium assay was used for in vitro cytotoxicity screening against the human cervical cancer cell line (HeLa), human laryngeal epithelial carcinoma cell line (HEp-2) and NIH 3T3 mouse embryonic fibroblasts. The IC(50) values obtained were 90.5 and 96.3 µg mL(-1), respectively, and the results revealed that basil oil has potent cytotoxicity.

  1. Hypoglycemic effect of basil (Ocimum basilicum) aqueous extract is mediated through inhibition of α-glucosidase and α-amylase activities: an in vitro study.

    Science.gov (United States)

    El-Beshbishy, Ha; Bahashwan, Sa

    2012-02-01

    The present study investigated the in vitro hypoglycemic activity of basil (Ocimum basilicum) aqueous extract. Preliminary phytochemical screening of the extract revealed the presence of reducing sugars, cardiac glycosides, tannins, saponins, glycosides, flavonoids and steroids. The total polyphenols content (TPC), flavonoids content (FC), percentage diphenylpicrylhydrazyl (DPPH( · )) radical inhibition and total antioxidant status (TAS) were estimated. The FC was 41 ± 2.2 rutin/g dry extract, the TPC was 146 ± 5.26 mg catechin/g dry extract and the TAS was 5.12 ± 0.7 mmol/L. The %DPPH( · ) free radical inhibition was 60%, 54%, 49% and 43%, respectively, for different extract concentrations; 20, 18.2, 16.3 and 14.5 mg/ml, respectively. The extract elicited significant dose-dependent pattern against rat intestinal sucrase (RIS; IC(50) = 36.72 mg/ml), rat intestinal maltase (RIM; IC(50) = 21.31 mg/ml) and porcine pancreatic α-amylase (PPA; IC(50) = 42.50 mg/ml) inhibitory activities. The inhibition was greater against maltase compared with sucrase. These effects may be attributed to the high TPC and FC levels. The linear regression analysis revealed strong significant positive correlations between %DPPH( · ) radical inhibition and each of %RIS, %RIM and %PPA inhibiting activity. Also, strong significant positive correlations between %RIS and either %RIM or %PPA inhibition activity were observed. We concluded therefore that basil aqueous extract via antioxidant and possibly α-glucosidase and α-amylase inhibiting activities, offered positive benefits to control diabetes.

  2. Variation in essential oil composition within individual leaves of sweet basil (Ocimum basilicum L.) is more affected by leaf position than by leaf age.

    Science.gov (United States)

    Fischer, Ravit; Nitzan, Nadav; Chaimovitsh, David; Rubin, Baruch; Dudai, Nativ

    2011-05-11

    The aroma in sweet basil is a factor affecting the commercial value of the crop. In previous studies leaf age was considered to be a factor that influences the composition of essential oil (EO). In this study it was hypothesized that a single observation of the EO content in leaves from different positions on the main stem (young vs old) could predict the developmental changes in the plant during its life cycle. Plants harvested at week 16 demonstrated an exponential increase (R(2) = 0.92) in EO concentration in leaves on the main stem and lateral shoots, indicating higher EO concentrations in younger than in older leaves. Eugenol and methyleugenol predominated (28-77%) in the extract. Eugenol levels were higher in younger leaves (∼53%), and methyl-eugenol levels predominated in older leaves (∼68%). Linalool was lower in mature leaves than in younger leaves. This suggested that eugenol converted into methyleugenol and linalool decreased as leaf mature. However, in weekly monitored plants, the levels of these compounds in the EO had limited variation in the maturing leaf regardless of its position on the stem. This proposed that the EO composition in an individual leaf is mostly affected by the leaf position on the stem and not by its maturation process. Because leaf position is related to plant development, it is probable that the plant's physiological age at the time of leaf formation from the primordial tissue is the factor affecting the EO composition. It was concluded that interpretation of scientific observations should be carried out with caution and that hypotheses should be tested utilizing multifaceted approaches.

  3. Antimicrobial activity of basil (Ocimum basilicum) oil against Salmonella enteritidis in vitro and in food.

    Science.gov (United States)

    Rattanachaikunsopon, Pongsak; Phumkhachorn, Parichat

    2010-01-01

    Nine essential oils were examined for antimicrobial activity against reference and clinical strains of Salmonella Enteritidis. Based on the size of the inhibition zone and the minimal inhibitory concentration, basil oil had the strongest antimicrobial activity against all the tested bacteria, and S. Enteritidis SE3 was the most sensitive strain to all the tested oils. Gas chromatography/mass spectrometry analysis revealed that the major constituents of the oil were linalool (64.35%), 1,8-cineole (12.28%), eugenol (3.21%), germacrene D (2.07%), alpha-terpineol (1.64%), and rho-cymene (1.03%). When applied in nham, a fermented pork sausage, experimentally inoculated with S. Enteritidis SE3 and stored at 4 degrees C, basil oil inhibited the bacterium in a dose-dependent fashion. Basil oil at a concentration of 50 ppm reduced the number of bacteria in the food from 5 to 2log cfu/g after storage for 3 d. An unmeasurable level of the bacterium in the food was observed at days 2 and 3 of storage when 100 and 150 ppm of basil oil was used, respectively. Sensory evaluation suggested that the addition of 100 but not of 150 ppm to nham would be acceptable to consumers. The results from this study confirm the potential use of basil oil as an antimicrobial agent to control S. Enteritidis in food.

  4. Phytochemical Screening and Evaluation of Cardioprotective Activity of Ethanolic Extract of Ocimum Basilicum L. (Basil Against Isoproterenol Induced Myocardial Infarction in Rats

    Directory of Open Access Journals (Sweden)

    Hamid Soraya

    2012-01-01

    Full Text Available Background and the purpose of the study: The objectives of the present study were phytochemical screening and study of the effects of ethanolic extract of aerial parts of Ocimum basilicum (basil on cardiac functions and histopathological changes in isoproterenol-induced myocardial infarction (MI.Methods: The leaves of the plant were extracted with ethanol by maceration and subjected to colorimetry to determine flavonoids and phenolic compounds. High-performance TLC analysis and subsequent CAMAG's TLC scanning were performed to quantify rosmarinic acid content. Wistar rats were assigned to 6 groups of normalcontrol, sham, isoproterenol, and treatment with 10, 20, and 40 mg/kg of the extract two times per day concurrent with MI induction. A subcutaneous injection of isoproterenol (100 mg/kg/day for 2 consecutive days was used to induce MI.Results: Phytochemical screening indicated the presence of phenolic compounds (5.36% and flavonoids (1.86%.Rosmarinic acid was the principal phenolic compound with a 15.74% existence. The ST-segment elevation induced by isoproterenol was significantly suppressed by all doses of the extract. A severe myocardial necrosis and fibrosis with a sharp reduction in left ventricular contractility and a marked increase in left ventricular end-diastolic pressure were seen in the isoproterenol group, all of which were significantly improved by the extract treatment. In addition to in-vitro antioxidant activity, the extract significantly suppressed the elevation of malondialdehyde levels both inthe serum and the myocardium.Conclusion: The results of the study demonstrate that Ocimum basilicum strongly protected the myocardium against isoproterenol-induced infarction and suggest that the cardioprotective effects could be related to antioxidative activities.

  5. Phytochemical screening and evaluation of cardioprotective activity of ethanolic extract of Ocimum basilicum L. (basil) against isoproterenol induced myocardial infarction in rats

    Science.gov (United States)

    2012-01-01

    Background and the purpose of the study The objectives of the present study were phytochemical screening and study of the effects of ethanolic extract of aerial parts of Ocimum basilicum (basil) on cardiac functions and histopathological changes in isoproterenol-induced myocardial infarction (MI). Methods The leaves of the plant were extracted with ethanol by maceration and subjected to colorimetry to determine flavonoids and phenolic compounds. High-performance TLC analysis and subsequent CAMAG's TLC scanning were performed to quantify rosmarinic acid content. Wistar rats were assigned to 6 groups of normal control, sham, isoproterenol, and treatment with 10, 20, and 40 mg/kg of the extract two times per day concurrent with MI induction. A subcutaneous injection of isoproterenol (100 mg/kg/day) for 2 consecutive days was used to induce MI. Results Phytochemical screening indicated the presence of phenolic compounds (5.36%) and flavonoids (1.86%). Rosmarinic acid was the principal phenolic compound with a 15.74% existence. The ST-segment elevation induced by isoproterenol was significantly suppressed by all doses of the extract. A severe myocardial necrosis and fibrosis with a sharp reduction in left ventricular contractility and a marked increase in left ventricular end-diastolic pressure were seen in the isoproterenol group, all of which were significantly improved by the extract treatment. In addition to in-vitro antioxidant activity, the extract significantly suppressed the elevation of malondialdehyde levels both in the serum and the myocardium. Conclusion The results of the study demonstrate that Ocimum basilicum strongly protected the myocardium against isoproterenol-induced infarction and suggest that the cardioprotective effects could be related to antioxidative activities. PMID:23351503

  6. Phytochemical screening and evaluation of cardioprotective activity of ethanolic extract of Ocimum basilicum L. (basil against isoproterenol induced myocardial infarction in rats

    Directory of Open Access Journals (Sweden)

    Fathiazad Fatemeh

    2012-12-01

    Full Text Available Abstract Background and the purpose of the study The objectives of the present study were phytochemical screening and study of the effects of ethanolic extract of aerial parts of Ocimum basilicum (basil on cardiac functions and histopathological changes in isoproterenol-induced myocardial infarction (MI. Methods The leaves of the plant were extracted with ethanol by maceration and subjected to colorimetry to determine flavonoids and phenolic compounds. High-performance TLC analysis and subsequent CAMAG's TLC scanning were performed to quantify rosmarinic acid content. Wistar rats were assigned to 6 groups of normal control, sham, isoproterenol, and treatment with 10, 20, and 40 mg/kg of the extract two times per day concurrent with MI induction. A subcutaneous injection of isoproterenol (100 mg/kg/day for 2 consecutive days was used to induce MI. Results Phytochemical screening indicated the presence of phenolic compounds (5.36% and flavonoids (1.86%. Rosmarinic acid was the principal phenolic compound with a 15.74% existence. The ST-segment elevation induced by isoproterenol was significantly suppressed by all doses of the extract. A severe myocardial necrosis and fibrosis with a sharp reduction in left ventricular contractility and a marked increase in left ventricular end-diastolic pressure were seen in the isoproterenol group, all of which were significantly improved by the extract treatment. In addition to in-vitro antioxidant activity, the extract significantly suppressed the elevation of malondialdehyde levels both in the serum and the myocardium. Conclusion The results of the study demonstrate that Ocimum basilicum strongly protected the myocardium against isoproterenol-induced infarction and suggest that the cardioprotective effects could be related to antioxidative activities.

  7. Murcha do manjericão (Ocimum basilicum no Brasil: agente causal, círculo de plantas hospedeiras e transmissão via semente Sweet basil (Ocimum basilicum wilt in Brazil: causal agent, host range and seed transmission

    Directory of Open Access Journals (Sweden)

    Ailton Reis

    2007-06-01

    representam o mais provável veículo de introdução e potencial disseminação deste patógeno no Brasil.Sweet basil (Ocimum basilicum L is one of the most important vegetable crops in the family Lamiaceae, being employed mainly as a source of essential oils for the pharmaceutical industry. Samples of plants showing symptoms of wilt, stem blight and collar root rot were collected during the 2005 hot rainy season in the rural area of Brazlândia (Federal District in central Brazil. Two other samples displaying identical symptoms were collected under greenhouse and field conditions in Ponte Alta (DF. The fungus Fusarium oxysporum was consistently isolated in all samples. Pathogenicity tests were conducted using seedlings and stem cuttings of the O. basilicum cultivars 'Dark Opal' and 'Italian Large Leaf' as well as accessions of the species O. americanum L, O. campechianum Mill., Origanum manjorana L., O. vulgare L., Mentha arvensis L., Coleus blumei Benth., Leonorus sibiricus L. and Leonotis nepetaefolia (L. W.T. Aiton. All isolates were highly virulent on O. basilicum cultivars, whereas O. campechianum and O. americanum cultivars reacted with a slight vascular browning and with a very mild reduction in plant growth rate. All isolates were considered avirulent to O. manjorana, O. vulgaris, M. arvensis, C. blumei, L. sibiricus and L. nepetaefolia accessions. The experimental data indicated that the causal agent of this disease is the fungus F. oxysporum f. sp. basilici. This is the first formal report of this pathogen in Brazil. The remaining seeds from commercial lots that were sowed in the areas where the pathogen was first described were evaluated for the presence of F. oxysporum f. sp. basilici. This fungus was detected in four out of six seed lots and the seed-derived isolates were able to induce similar set of symptoms in the same group of plant accessions. This result strongly suggests that this new disease in Brazil was most likely introduced into the country via

  8. The relationship between growth stages and aroma composition of lemon basil Ocimum citriodorum Vis

    OpenAIRE

    Al-Kateb, H.; DONALD, M.

    2014-01-01

    Plants produce volatiles depending on the season, growth cycle and time of year. Lemon basil “Ocmium basilicum var.citrodorum” possesses three growth stages; pre-flowering, full flowering and post-flowering. The volatiles of lemon basil infusions either increased or decreased throughout the growth cycle. Oxygenated compounds were the predominant class detected. Volatiles such as citral (neral+geranial), eucalyptol and estragole contribute to the flavor profile and may contribute in the plant ...

  9. Chemical Diversity in Basil (Ocimum sp.) Germplasm

    Science.gov (United States)

    da Costa, Andréa Santos; Arrigoni-Blank, Maria de Fátima; de Carvalho Filho, José Luiz Sandes; de Santana, Aléa Dayane Dantas; Santos, Darlisson de Alexandria; Alves, Péricles Barreto; Blank, Arie Fitzgerald

    2015-01-01

    The present study aimed to chemically characterize 31 accessions and seven cultivars of basil. The percentage composition of the essential oils of the accessions and cultivars was based on the 14 most abundant constituents: 1,8-cineole, linalool, methyl chavicol, neral, nerol, geraniol, geranial, methyl cinnamate, β-bourbonene, methyl eugenol, α-trans-bergamotene, germacrene-D, epi-α-cadinol, and δ-cadinene. The genetic materials were classified into eight clusters according to the chemical composition of the essential oils: Cluster 1—mostly linalool and 1,8-cineole; Cluster 2—mostly linalool, geraniol, and α-trans-bergamotene; Cluster 3—mostly linalool, methyl chavicol, methyl cinnamate, and β-bourbonene; Cluster 4—mostly linalool, methyl chavicol, epi-α-cadinol, and α-trans-bergamotene; Cluster 5—mainly linalool, methyl eugenol, α-trans-bergamotene, and epi-α-cadinol; Cluster 6—mainly linalool, geraniol, and epi-α-cadinol; Cluster 7—mostly linalool and methyl chavicol; Cluster 8—mainly geranial and neral. PMID:25629084

  10. Chemical Diversity in Basil (Ocimum sp. Germplasm

    Directory of Open Access Journals (Sweden)

    Andréa Santos da Costa

    2015-01-01

    Full Text Available The present study aimed to chemically characterize 31 accessions and seven cultivars of basil. The percentage composition of the essential oils of the accessions and cultivars was based on the 14 most abundant constituents: 1,8-cineole, linalool, methyl chavicol, neral, nerol, geraniol, geranial, methyl cinnamate, β-bourbonene, methyl eugenol, α-trans-bergamotene, germacrene-D, epi-α-cadinol, and δ-cadinene. The genetic materials were classified into eight clusters according to the chemical composition of the essential oils: Cluster 1—mostly linalool and 1,8-cineole; Cluster 2—mostly linalool, geraniol, and α-trans-bergamotene; Cluster 3—mostly linalool, methyl chavicol, methyl cinnamate, and β-bourbonene; Cluster 4—mostly linalool, methyl chavicol, epi-α-cadinol, and α-trans-bergamotene; Cluster 5—mainly linalool, methyl eugenol, α-trans-bergamotene, and epi-α-cadinol; Cluster 6—mainly linalool, geraniol, and epi-α-cadinol; Cluster 7—mostly linalool and methyl chavicol; Cluster 8—mainly geranial and neral.

  11. The Essential Oil Compositions of Ocimum basilicum from Three Different Regions: Nepal, Tajikistan, and Yemen.

    Science.gov (United States)

    Sharopov, Farukh S; Satyal, Prabodh; Ali, Nasser A Awadh; Pokharel, Suraj; Zhang, Hanjing; Wink, Michael; Kukaniev, Muhammadsho A; Setzer, William N

    2016-02-01

    The aerial parts of Ocimum basilicum L. were collected from four different geographical locations, Sindhuli and Biratnagar (Nepal), Chormaghzak village (Tajikistan), and Sana'a (Yemen). The essential oils were obtained by hydrodistillation and analyzed by gas chromatography/mass spectrometry. A cluster analysis of 179 essential oil compositions revealed six major chemotypes: Linalool, eugenol, estragole, methyl eugenol, 1,8-cineole, and geraniol. All four of the basil oils in this study were of the linalool-rich variety. Some of the basil oils were screened for bioactivity including antimicrobial, cytotoxicity in human cancer cells, brine shrimp lethality, nematicidal, larvicidal, insecticidal, and antioxidant. The basil oils in this study were not notably antibacterial, cytotoxic, antioxidant, nor nematicidal, but were active in the brine shrimp lethality test, and did show larvicidal and insecticidal activities. Copyright © 2016 Verlag Helvetica Chimica Acta AG, Zürich.

  12. Supercritical CO2 Extracts and Volatile Oil of Basil (Ocimum basilicum L. Comparison with Conventional Methods

    Directory of Open Access Journals (Sweden)

    José Coelho

    2018-03-01

    Full Text Available Interest in new products from aromatic plants as medical and nutritional compounds is increasing. The aim of this work was to apply different extraction methods, including the use of supercritical carbon dioxide extraction, and to test the antioxidant activity of basil (Ocimum basilicum L. extracts. In vitro efficacy assessments were performed using enzymatic assays. Essential oil obtained by hydrodistillation and volatile oil obtained from supercritical fluid extraction were analyzed by gas chromatography to quantify components. The total phenolic content in the extracts ranged from 35.5 ± 2.9 to 85.3 ± 8.6 mg of gallic acid equivalents and the total flavonoid content ranged from 35.5 ± 2.9 to 93.3 ± 3.9 micromole catechin equivalents per gram of dry weight of extract. All the extracts showed an antioxidant activity with 2,2-diphenyl-1-picrylhydrazyl (DPPH, 2,2-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid (ABTS, and the reducing power test. Extracts obtained from methanol had a higher antioxidant capacity per the DPPH test results (IC50 = 3.05 ± 0.36 mg/mL and the reducing power test assay 306.8 ± 21.8 μmol of trolox equivalents per gram of extract (TE/g compared with ethanolic or supercritical fluid extracts. However, using the ABTS assay, the extract obtained by supercritical fluid extraction had a higher antioxidant capacity with an IC50 of 1.74 ± 0.05 mg/mL. Finally, the examined extracts showed practically no acetylcholinesterase (AChE inhibitory capacity and a slight inhibitory activity against tyrosinase.

  13. Different species of basil need different ammonium to nitrate ratio in hydroponics' system

    Directory of Open Access Journals (Sweden)

    M. SAADATIAN

    2015-12-01

    Full Text Available Basil is a very important medicinal plant and culinary spice, and is marketed fresh, dried or frozen. In crop nutrition, nitrogen is essential for plant growth and as a macro-element, is part of the proteins’ structure and participates in the metabolic processes involved in the synthesis and energy transfer. It has been shown that a balance between ammonium and nitrate favors plant growth and that the degree of benefit varies among crops. This study was conducted to evaluate the growth of two varieties of basil in function of four nutrient solutions containing different NH4+/NO3- ratios. Results showed that different variety response differently to nutrient solution. Although the highest yield in both varieties (sweet and purple was obtained when fed by nutrient solution without ammonium but their response on quality indices were different due to nitrate ammonium ratio in nutrient solutions. The highest total phenol content of sweet and purple basil was 92 and 100 mg gallic acid equivalent per gram of dry weight respectively, while the highest antioxidant capacity was obtained in purple variety grown in nutrient solution 2 (NH4+:1/NO3:4 and the lowest value were related to sweet variety with the same nutrient solution. Moderate content of total nitrogen can be suitable for sweet variety while for purple variety nutrient solution with low amount of ammonium can be more suitable.

  14. AKTIVITAS ANTIFUNGI EKSTRAK DAUN KEMANGI (Ocimum americanum L. TERHADAP FUNGI Fusarium oxysporum Schlecht

    Directory of Open Access Journals (Sweden)

    Zainal Berlian

    2016-01-01

    Full Text Available Fusarium oxysporum Schlecht. a parasitic fungus that cause leaf wilt disease in plants. Meanwhile, basil (Ocimum americanum L. is a plant that contains of the active compound in the form of phenols which have antifungal activity. This study aimed to test whether the extract of leaves of basil have antifungal activity againts Fusarium oxysporum Schlecht. and determine the optimum concentration to inhibit the growth of the fungus Fusarium oxysporum Schlecht. Antifungal test is done by using paper disc diffusion method. The study design used was a completely randomized design with 4 treatments and 6 replications. The treatment is K0 (0% w/v, K1 (5% w/v, K2 (10% w/v, and K3 (15% w/v. The results showed that the leaf extract of basil have antifungal activity against Fusarium oxysporum Schlecht. Inhibition zone on K0, K1, K2, and K3 are each 0,0 mm, 1,49 mm, 2,46 mm, and 2,01 mm. The optimum concentration of antifungal activity of extract of basil, namely the K2 concentration (10% w/v. Based on analysis of variance (ANOVA, the concentration of basil leaf extract provides significant differences (p > 0,05 on fungus Fusarium oxysporum Schlecht., where Fcount > Ftable is 4,5 > 3,1.

  15. The effects of kale (Brassica oleracea ssp. acephala), basil (Ocimum basilicum) and thyme (Thymus vulgaris) as forage material in organic egg production on egg quality.

    Science.gov (United States)

    Hammershøj, M; Steenfeldt, S

    2012-01-01

    1. In organic egg production, forage material as part of the diet for laying hens is mandatory. The purpose of the present study was to examine the effect of feeding with forage materials including maize silage, herbs or kale on egg production and various egg quality parameters of the shell, yolk colour, egg albumen, sensory properties, fatty acid and carotenoid composition of the egg yolk. 2. A total of 5 dietary treatments were tested for 5 weeks, consisting of a basal organic feed plus 120 g/hen.d of the following forage materials: 1) maize silage (control), 2) maize silage incl. 15 g/kg basil, 3) maize silage incl. 30 g/kg basil, 4) maize silage incl. 15 g/kg thyme, or 5) fresh kale leaves. Each was supplied to three replicates of 20 hens. A total of 300 hens was used. 3. Feed intake, forage intake and laying rate did not differ with treatment, but egg weight and egg mass produced increased significantly with the kale treatment. 4. The egg shell strength tended to be higher with the kale treatment, and egg yolk colour was significantly more red with the kale treatment and more yellow with basil and kale treatments. The albumen DM content and albumen gel strength were lowest with the thyme treatment. By sensory evaluation, the kale treatment resulted in eggs with less sulphur aroma, higher yolk colour score, and more sweet and less watery albumen taste. Furthermore, the eggs of the kale treatment had significantly higher lutein and β-carotene content. Also, violaxanthin, an orange xanthophyll, tended to be higher in kale and eggs from hens receiving kale. 5. In conclusion, forage material, especially basil and kale, resulted in increased egg production and eggs of high and differentiable quality.

  16. Molecular characterisation and similarity relationships among iranian basil (Ocimum basilicum L. accessions using inter simple sequence repeat markers Caracterização molecular de acessos de Ocimum basilicum L. por meio de marcadores ISSR

    Directory of Open Access Journals (Sweden)

    Mohammad Aghaei

    2012-06-01

    Full Text Available The study of genetic relationships is a prerequisite for plant breeding activities as well as for conservation of genetic resources. In the present study, genetic diversity among 50 Iranian basil (Ocimum basilicum L. accessions was determined using inter simple sequence repeat (ISSR markers. Thirty-eight alleles were generated at 12 ISSR loci. The number of alleles per locus ranged from 1 to 5 with an average of 3.17. The maximum number of alleles was observed at the A7, 818, 825 and 849 loci, and their size ranged from 300 to 2500 bp. A similarity matrix based on Jaccard's coefficient for all 50 basil accessions gave values from 1.00-0.60. The maximum similarity (1.00 was observed between the "Urmia" and "Shahr-e-Rey II" accessions as well as between the "Urmia" and "Qazvin II" accessions. The lowest similarity (0.60 was observed between the "Tuyserkan I" and "Gom II" accessions. The unweighted pair- group method using arithmetique average UPGMA clustering algorithm classified the studied accessions into three distinct groups. All of the basil accessions, with the exception of "Babol III", "Ahvaz II", "Yazd II" and "Ardebil I", were placed in groups I and II. Leaf colour was a specific characteristic that influenced the clustering of Iranian basil accessions. Because of this relationship, the results of the principal coordinate analysis (PCoA approximately corresponded to those obtained through cluster analysis. Our results revealed that the geographical distribution of genotypes could not be used as a basis for crossing parents to obtain high heterosis, and therefore, it must be carried out by genetic studies.O estudo das relações genéticas é um pré-requisito para atividades em reprodução de plantas assim como para conservação de recursos genéticos. Neste trabalho a diversidade genética entre 50 acessos de Manejericão Iraniano (Ocimum basilicum L. foram determinadas usando marcadores de Seqüência Simples Repetida Interna (ISSR

  17. Comparison the effect of organic and chemical fertilizers on yield and essential oil percentage of Basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    S.M.K. Tahami

    2016-04-01

    Full Text Available In order to have a sustainable agriculture it is necessary to use environmental friendly inputs to improve ecological aspects of environment. Basil (Ocimum basilicum L. is a medicinal and vegetable crop which is cultivated in different parts of the world. An experiment was conducted at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, in year 2009. A complete randomized block design with six treatments, and three replications was used. The treatments were: control (no fertilizer, cow manure, sheep manure, hen manure, vermin-compost and NPK fertilizers. Results showed that all studied organic manures were high in measured characters in compare with chemical fertilizer. The highest plant height, leaf yield, fresh and dry matter were obtained at vermicompost. Treatments have no significant affect on Essential oil percentage. The highest essential oil yield was obtained in cow manure treatments. Third cut and the first cut had the maximum and the minimum of leaf yield, fresh and dry shoot yield, respectively. Essential oil percentage in the first cut was significantly more than other cuts, but essential oil yield, were the highest in third cut because this cut produced highest leaf yield. There was no significant difference between chemical fertilizers and control treatment in all characters except green area index and fresh and dry leaf weight in a plant.

  18. Salt exclusion and mycorrhizal symbiosis increase tolerance to NaCl and CaCl2 salinity in ‘Siam Queen’ basil

    Science.gov (United States)

    A study was conducted to evaluate the effects of salinity on growth and nutrient uptake in basil (Ocimum basilicum L.). Plants were fertilized with a complete nutrient solution and exposed to no, low, or moderate levels of salinity from NaCl or CaCl2. Plants in the control and moderate salinity tre...

  19. Formulation and Evaluation of Edible Film from Basil Leaves Extract (Ocimum americanum L. as Mouth Freshener

    Directory of Open Access Journals (Sweden)

    Fifi Harmely

    2015-02-01

    Full Text Available A research on formulation of edible film from basil leaves extract as mouth freshener has been done. The extract of basil leaves were used in various concentrations which are 2.5%, 5% and 7.5%. The products were evaluated for some parameters such as organoleptic, friability, drying shrinkage, pH, thickness, flavonoid contents and respondents preference. The results of evaluation showed that edible filmsfrom basil leaves extract meet requirements as required by Standard Nasional Indonesia (SNI and have such quality as product in the market. Statistical analysis using Kruskal Wallis test showed that respondents preferred for the F0 formulation in term of their appearance and taste while as mouth freshener, respondents preferred the F3 formulation.

  20. Insecticidal effects of Ocimum sanctum var. cubensis essential oil on the diseases vector Chrysomya putoria

    Directory of Open Access Journals (Sweden)

    Idelsy Chil-Núñez

    2018-05-01

    Full Text Available Context: The blowfly Chrysomya putoria is widely distributed throughout the Neotropical region and, besides transmitting pathogens; they could cause secondary myiasis. Botanical insecticides provide an alternative to synthetic pesticides because the excessive use of synthetic insecticides resulted in a progressive resistance of the pests to these chemicals, diminishing their effectiveness and generating consequences with negative environmental impact. The essential oil extracted from Ocimum sanctum (basil has showed insecticidal activity against some insects but has no reported studies on the activity of this plant against flies. Aims: To evaluate the insecticidal effects of Ocimum sanctum var. cubensis Gomes essential oil on the post embryonic development of Chrysomya putoria. Methods: The colonies of Chrysomya putoria were established and maintained at the Laboratório de Entomologia Médica e Forense (FIOCRUZ, Rio de Janeiro, Brazil. The basil essential oil was tested in six concentrations (4.13, 8.25, 20.63, 41.25, 61.87 and 80,25 mg/mL. Mortality and changes in life cycle were recorded daily. Results: β-caryophyllene, β-selinene and eugenol, were the main constituents of the basil essential oil. The experiments demonstrated that in all concentrations tested, this essential oil shortening the duration of all post embryonic stages having a direct impact in the viability of this fly estimating the LC50 in 7.47 mg/mL of concentration. In addition, the essential oil caused morphological alterations in abdomen, wings and ptilinum at lower concentrations. Conclusions: This essential oil emerge as a good option for the control of the disease vector blowfly Chrysomya putoria.

  1. Elevated CO2 induces a global metabolic change in basil (Ocimum basilicum L.) and peppermint (Mentha piperita L.) and improves their biological activity.

    Science.gov (United States)

    Al Jaouni, Soad; Saleh, Ahmed M; Wadaan, Mohammed A M; Hozzein, Wael N; Selim, Samy; AbdElgawad, Hamada

    Many studies have discussed the influence of elevated carbon dioxide (eCO 2 ) on modeling and crop plants. However, much less effort has been dedicated to herbal plants. In this study, a robust monitoring for the levels of 94 primary and secondary metabolites and minerals in two medicinal herbs, basil (Ocimum basilicum L.) and peppermint (Mentha piperita L.), grwon under both ambient (aCO 2 , 360 ppm) and eCO 2 (620 ppm) was performed. We also assessed how the changes in herbal tissue chemistry affected their biological activity. Elevated CO 2 significantly increased herbal biomass, improved the rates of photosynthesis and dark respiration, and altered the tissue chemistry. Principal Component Analysis of the full data set revealed that eCO 2 induced a global change in the metabolomes of the two plants. Moreover, Hierarchical Clustering Analyses showed quantitative differences in the metabolic profiles of the two plants and in their responsiveness to eCO 2 . Out of 94 metabolites, 38 and 31 significantly increased in basil and peppermint, respectively, as affected by eCO 2 . Regardless of the plant species, the levels of non-structural carbohydrates, fumarate, glutamine, glutathione, ascorbate, phylloquinone (vitamin K1), anthocyanins and a majority of flavonoids and minerals were significantly improved by eCO 2 . However, some metabolites tended to show species specificity. Interestingly, eCO 2 caused enhancement in antioxidant, antiprotozoal, anti-bacterial and anticancer (against urinary bladder carcinoma; T24P) activities in both plants, which was consequent with improvement in the levels of antioxidant metabolites such as glutathione, ascorbate and flavonoids. Therefore, this study suggests that the metabolic changes triggered by eCO 2 in the target herbal plants improved their biological activities. Copyright © 2018 Elsevier GmbH. All rights reserved.

  2. Effects of the exposure of TiO2 nanoparticles on basil (Ocimum basilicum) for two generations.

    Science.gov (United States)

    Tan, Wenjuan; Du, Wenchao; Darrouzet-Nardi, Anthony J; Hernandez-Viezcas, Jose A; Ye, Yuqing; Peralta-Videa, Jose R; Gardea-Torresdey, Jorge L

    2018-09-15

    There is a lack of information about the transgenerational effects of titanium dioxide nanoparticles (nano-TiO 2 ) in plants. This study aimed to evaluate the impacts of successive exposure of nano-TiO 2 with different surface properties to basil (Ocimum basilicum). Seeds from plants exposed or re-exposed to pristine, hydrophobic, or hydrophilic nano-TiO 2 were cultivated for 65 days in soil unamended or amended with 750 mg·kg -1 of the respective particles. Plant growth, concentration of titanium and essential elements, as well as content of carbohydrates and chlorophyll were evaluated. There were no differences on Ti concentration in roots of plants sequentially exposed to pristine or hydrophobic nano-TiO 2 , or in roots of plants exposed to the corresponding particle, only in the second cycle. However, sequential exposure to hydrophilic particles resulted in 65.2% less Ti in roots, compared to roots of plants exposed the same particles, only in the second cycle. The Ti concentrations in shoots were similar in all treatments. On the other hand, pristine and hydrophilic particles reduced Mg in root by 115% and 81%, respectively, while pristine and hydrophobic particles reduced Ni in shoot by 84% and 75%, respectively, compared to unexposed plants in both cycles. Sequential exposure to pristine nano-TiO 2 increased stomatal conductance (214%, p ≤ 0.10), compared to plants that were never exposed. Hydrophobic and hydrophilic nano-TiO 2 reduced chlorophyll b (52%) and total chlorophyll (30%) but increased total sugar (186%) and reducing sugar (145%), compared to unexposed plants in both cycles. Sequential exposure to hydrophobic or hydrophilic nano-TiO 2 resulted in more adverse effects on photosynthesis but in positive effects on plant growth, compared to pristine nano-TiO 2 . Copyright © 2018 Elsevier B.V. All rights reserved.

  3. PENGARUH EKSTRAK DAUN KEMANGI (Ocimum sanctum L. TERHADAP MOTILITAS DAN KONSENTRASI SPERMATOZOA MENCIT JANTAN (Mus musculus

    Directory of Open Access Journals (Sweden)

    Safwan

    2016-10-01

    Full Text Available We have conducted a research on the effect of the extract of leaves basil (Ocimum sanctum L on male mice to investigate the consentration and motility spermatozoa mice. Twoty male mice which has age about 2 months with wight 20 – 25 g were divided into four groups. The extract was provided orally daily until the 20 th day. At 21th day were sacrificed and determine of consentration and motility. The result of the research showed that the extract of Ocimum sanctum L leaves that being given during 20 days with the dosage of 50 mg/g body weight, 100 mg/g bw, and 250 mg/g bw could signifi increase the consentration and motility spermatozoa mice.

  4. Effect of silica Nanoparticles on Basil (Ocimum basilicum Under Salinity Stress

    Directory of Open Access Journals (Sweden)

    Manizheh Kalteh

    2014-08-01

    Full Text Available Application of nanofertilizers is one of the promising methods for increasing resources use efficiency and reducing environmental pollutions. Uncontrolled application of chemical fertilizer and pesticides has caused many problems to human health and domestic animals. Nanofertilizers application could be a suitable way to reduce these problems. Accordingly, in order to assess the silicon nanoparticles effect on some vegetative features of basil under salinity stress, a factorial experiment based on a completely randomized design with three replications was conducted in greenhouse condition. Treatments included different levels of silicon fertilizer (without silicon, normal silicon fertilizer and silicon nanoparticles and salinity stress (1, 3 and 6 ds/m. Physiological traits (chlorophyll and proline content of leaves and morphological traits (shoot fresh weight and dry weight were investigated in this study. Results showed a significant reduction in growth and development indices due to the salinity stress.  Leaf dry and fresh weight reduced by increment in NaCl concentration while significantly (P≤0.01 increased with silicon nanoparticles application. The chlorophyll content reduced in salinity stress, but increased by silicon nanoparticles treatment. Proline content increased under salinity stress which was a response to stress. Moreover, proline increased by silicon nanoparticles which was due to tolerance induction in plant. Silicon nanoparticles application reduced the pollution effects originated from salinity in Basil.

  5. Quantification of character-impacting compounds in Ocimum basilicum and 'Pesto alla Genovese' with selected ion flow tube mass spectrometry.

    Science.gov (United States)

    Amadei, Gianluca; Ross, Brian M

    2012-02-15

    Basil (Ocimum basilicum) is an important flavourant plant which constitutes the major ingredient of the pasta sauce 'Pesto alla Genovese'. The characteristic smell of basil stems mainly from a handful of terpenoids (methyl cinnamate, eucalyptol, linalool and estragole), the concentration of which varies according to basil cultivars. The simple and rapid analysis of the terpenoid constituents of basil would be useful as a means to optimise harvesting times and to act as a quality control process for basil-containing foodstuffs. Classical analytical techniques such as gas chromatography/mass spectrometry (GC/MS) are, however, slow, technically demanding and therefore less suitable for routine analysis. A new chemical ionisation technique which allows real-time quantification of traces gases, Selected Ion Flow Tube Mass Spectrometry (SIFT-MS), was therefore utilised to determine its usefulness for the assay of terpenoid concentrations in basil and pesto sauce headspace. Trace gas analysis was performed using the NO(+) precursor ion which minimised interference from other compounds. Character-impacting compound concentration was measured in basil headspace with good reproducibility and statistically significant differences were observed between cultivars. Quantification of linalool in pesto sauce headspace proved more difficult due to the presence of interfering compounds. This was resolved by careful selection of reaction product ions which allowed us to detect differences between various commercial brands of pesto. We conclude that SIFT-MS may be a valid tool for the fast and reproducible analysis of flavourant terpenoids in basil and basil-derived foodstuffs. Copyright © 2011 John Wiley & Sons, Ltd.

  6. Allelopathic activity of medicinal plant essential oils on seed germination and vigor of lettuce achenes

    Directory of Open Access Journals (Sweden)

    Cíntia Alvarenga Santos Fraga de Miranda

    2015-07-01

    Full Text Available In recent years, essential oils have gained commercial interest in the agricultural area, mainly for their allelopathic, insecticidal, antifungal, antimicrobial and antioxidant properties, and, also for their natural compounds, which have generally displayed low toxicity, relatively low cost and rapid degradation in the environment. Medicinal plants have emerged as potential suppliers of essential oils because of their ethnopharmacological utility. The aim of this study was to evaluate the allelopathic potential of essential oils extracted from fresh leaves of lemon grass (Cymbopogon citratus, wild basil (Ocimum gratissimum L. and sweet basil (Ocimum basilicum L. with regard to their major constituents (citral, eugenol and cineol, respectively in different application forms (direct contact and the effect of volatile constituents on the germination and vigor of lettuce seeds (cultivar Regina SF 3500. The effects of the oils and their major components were evaluated with regard to the variables: first germination count, total germination, GVI (germination velocity index, seedling dry weight and average lengths of shoots and lettuce roots. The essential oils from lemon grass and basil displayed allelopathic potentials on seed germination and vigor of lettuce achenes that can be assigned to their respective major constituents citral and eugenol. On the other hand, the allelopathic effect of the essential oil from basil was a consequence of the combined effect of all the components, regardless the application method.

  7. Microbiological analysis of pre-packed sweet basil (Ocimum basilicum) and coriander (Coriandrum sativum) leaves for the presence of Salmonella spp. and Shiga toxin-producing E. coli.

    Science.gov (United States)

    Delbeke, Stefanie; Ceuppens, Siele; Jacxsens, Liesbeth; Uyttendaele, Mieke

    2015-09-02

    Enteric pathogens, such as Salmonella spp. and pathogenic Escherichia coli, have been detected and associated with food borne outbreaks from (imported) fresh leafy herbs. Screening on imported herbs from South East Asian countries has been described. However, limited information on prevalence of these pathogens is available from other sourcing regions. Therefore, fresh pre-packed basil and coriander leaves from a Belgian trading company were investigated for the presence of Salmonella spp., Shiga toxin-producing E. coli (STEC), generic E. coli and coliforms. In total 592 samples were collected originating from Belgium, Israel and Cyprus during 2013-2014. Multiplex PCR followed by further culture confirmation was used for the detection of Salmonella spp. and STEC, whereas the Petrifilm Select E. coli and VRBL-agar were used, respectively, for the enumeration of E. coli and coliforms. Salmonella was detected in 10 out of 592 samples (25g) (1.7%; 5 from basil and 5 from coriander), of which two samples were sourced from Israel and eight from Cyprus. The presence of STEC was suspected in 11 out of 592 samples (25g) (1.9%; 3 basil and 8 coriander), due to the detection of stx and eae genes, of which one sample originated from Belgium, four from Israel and six from Cyprus. No STEC was isolated by culture techniques, but in three samples a serotype (O26, O103 or O111) with its most likely associated eae-variant (β or θ) was detected by PCR. Generic E. coli was enumerated in 108 out of 592 samples, whereby 55, 32 and 13 samples respectively between 10-100, 100-1000 and 1000-10,000cfu/g and 8 samples exceeding 10,000cfu/g. Coliforms were enumerated in all herb samples at variable levels ranging from 1.6 to 7.5logcfu/g. Further statistics indicate that the E. coli class (categorized by level) was significantly correlated with the presence of Salmonella (pbasil and coriander sourced from different cultivation regions, may contain enteric pathogens and potentially pose a

  8. Efeito de diferentes lâminas de irrigação na produção de óleo essencial do manjericão (Ocimum basilicum L. = Effect of different water depths in basil (Ocimum basilicum L. oil production

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Pravuschi

    2010-10-01

    Full Text Available O manjericão (Ocimum basilicum L. é uma planta aromática de importância econômica no Brasil, muito usado como tempero na preparação de alimentos. É também utilizado para a obtenção de óleo essencial, importante na indústria de perfumaria. O objetivo deste experimento foi analisar o efeito de cinco lâminas de irrigação, bem como uma análise da viabilidade econômica da aplicação da irrigação na produção do manjericão. O experimento foi conduzido no período de março a outubro de 2007. As lâminas foram baseadas na evaporação do Tanque Classe A (ECA sendo: 0, 50, 75, 100 e 150% ECA. As variáveis analisadas foram matéria seca das folhas e inflorescências, teor de óleo essencial, massa seca e comprimento de raízes. Foram calculadas a produtividade de óleo essencial e a receita líquida. A terceira colheita foi viável somente utilizando irrigação. A irrigação diáriaexcessiva prejudicou o desenvolvimento da planta. A lâmina de irrigação equivalente a 100% ECA promoveu a máxima produtividade de matéria seca (4.248,67 kg ha-1, assim como a máxima produtividade de óleo essencial (58,26 kg ha-1, apresentando receita líquida anualde R$ 2.543,82 ha-1.Basil (Ocimum basilicum L. is an aromatic plant of economic importance in Brazil, very used as a spice for food preparation. It is also used to obtain essential oil, which important in the perfume industry. The purpose of this experiment was to analyze the effect of five irrigation water depths, as well as an economic viability analysis of the application of irrigation in basil production. The experiment was carried out from March to October 2007. The water depths were based in the cumulative class A pan evaporation (CPE: 0, 50, 75, 100 and 150% CPE. The analyzed variables were dry weight for leaves and flowers, content of essential oil, and dry mass and length of root zone. The essential oil yield and net return were calculated. The third harvest was possible only

  9. The molluscicidal effects of extracts of Capsicum annuum (Sweet ...

    African Journals Online (AJOL)

    Extracts of sweet pepper (Capsicum annum), black pepper (Piper nigrum) and scent leaves (Ocimum basilicum) were introduced to fresh water snail samples, the intermediate hosts of schistosomiasis, to test their molluscicidal effects. The materials were extracted using soxhlet extraction. Black pepper (Piper nigrum) was ...

  10. Effects of a wax organogel and alginate gel complex on holy basil (Ocimum sanctum) in vitro ruminal dry matter disappearance and gas production.

    Science.gov (United States)

    Templeman, James R; Rogers, Michael A; Cant, John P; McBride, Brian W; Osborne, Vern R

    2018-02-20

    The objectives of this study were to: (a) select an ideal organogel for the oil phase of a novel gel encapsulation technology, (b) optimize the formulation of an organogel and sodium alginate-based gel complex, and (c) examine the rumen protective ability of the gel by measuring 48-h in vitro ruminal dry matter disappearance and gas production from encapsulated dried and ground holy basil leaves. A rice-bran wax and canola oil organogel was selected for the oil phase of the gel complex as this combination had a 48-h dry matter disappearance of 6%, the lowest of all organogels analyzed. The gel complex was formulated by homogenizing the organogel with a sodium alginate solution to create a low-viscosity oil-in-water emulsion. Average dry matter disappearance of gel-encapsulated holy basil was 19%, compared to 42% for the free, unprotected holy basil. However, gel encapsulation of holy basil stimulated gas production. Specifically, gas production of encapsulated holy basil was four times higher than the treatment with holy basil added on top of the gel prior to incubation rather than encapsulated within the gel. Although the gel itself was highly degradable, it is speculated encapsulation thwarted holy basil's antimicrobial activity. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.

  11. Evaluation of Some Agroecological Characteristics of Basil (Ocimum basilicum L. as Affected by Simultaneous Application of Water-Saving Superabsorbent Hydrogel in Soil and Foliar Application of Humic Acid under Different Irrigation Intervals in a Low Inp

    Directory of Open Access Journals (Sweden)

    M. Jahan

    2016-02-01

    Full Text Available Introduction: Basil (Ocimum basilicum L. is an annual herbaceous plant that belongs to lamiaceae family. This plant is native of India country and other countries in south of Asia. Nowadays, the use of water superabsorbent polymers is increased in agriculture and their role in reducing the drought stress and increasing the crops production has been demonstrated in many researches. Superabsorbent polymers can absorb lots of water and keep it in their structure and give it to plant under drought stress conditions (9. Humic substances are a group of heterogeneous molecules that are bonded together by weak forces, therefore they have high chemical stability. Humic acid comprise 65 to 80 percent of total soil organic matter (6. According to medicinal importance of Basil and its roles in the food and pharmaceutical industries, beside the limited water resources and need to increase water use efficiency through using ecological inputs, this study designed and conducted aimed to evaluate agroecological characteristics of Basil as affected by application of water-saving superabsorbent and humic acid under irrigation intervals. Materials and Methods: In order to evaluate the effects of different amounts of water-saving superabsorbent and foliar application of humic acid and irrigation intervals on some quantitative characteristics of basil (Ocimum basilicum L., a split strip plot experiment was conducted based on RCBD design with three replications at The Research Farm of Ferdowsi University of Mashhad, Iran during growing season of 2012-13. Experimental factors included three levels of water-saving superabsorbent (0, 40 and 80 kg ha-1 as the main plot factor, two levels of humic acid (0 and 3 kg ha-1 as the sub plot factor and two levels of irrigation interval (5 and 10 days as the strip plot factor. Studied traits were seed number and weight per plant, plant height, number of lateral branches per plant, seed yield, biological yield and harvest index

  12. Evaluation of Some Morphological Characteristics, Water Use Efficiency and Essential Oil of Basil (Ocimum basilicum var. keshkeni luvelou under Application of Malva Leaves and Superabsorbent Polymer

    Directory of Open Access Journals (Sweden)

    S. Beigi

    2016-02-01

    Full Text Available Introduction: Medicinal plants are rich in active substances and primarily have been used in the manufacture of many drugs. Basil (Ocimum basilicum L. is one of the important medicinal plants whichbelongs to the Lamiaceae family. Basil essential oil content (between 0.5 to 1.5 percent varies according to climatic conditions of habitat location. Basilneeds a lot of water during growth period and it is very sensitive to water stress and shows wilting symptoms very soon after water shortage. Iran is located in an arid and semi-arid region which has little precipitation that is not enough for crop water requirements. Nowadays, the use of superabsorbent polymers is one of the ways to create sustainable agriculture and increase irrigation efficiency. They can store high water or aqueous solutions in root zone of plants and to reduce negative effects of drought stress. So, improvement of plant growth, increasing of irrigation intervals, reducing water loss and costs of irrigation is due to the application of superabsorbent polymers. Mucilages are also the herbal polysaccharides, soluble in water, and commonly include carbohydrates and can be used as hydrophilic polymers. The aims of this investigation were to study the effects of hydrophilic polymers on water use efficiency, morphological characteristics (dry matter, leaf area, and leaf number, essential oil quantity and yield of basil to harden plant to drought stress and to evaluate its potential to cultivate in arid regions. In addition, taking steps forward towards sustainable agriculture, by reducing the cost of agricultural production, helps protecting the environment. Materials and Methods: This research was conducted as a pot experiment at the department of Horticultural Science‚ college of Agricultural‚ Ferdowsi University of Mashhad‚ Iran, during 2012-2013.The research was set out in a factorial experiment on the basis of completely randomized block design with three replications

  13. Changes in the content of total nitrogen and mineral nitrogen in the basil herb depending on the cultivar and nitrogen nutrition

    Directory of Open Access Journals (Sweden)

    Katarzyna Dzida

    2013-04-01

    Full Text Available Among fundamental nutrients, nitrogen fertilization is considered one of the most effective factors affecting both the yield and the quality of plant material. Nitrogen form used for fertilizing is also of great importance. The aim of this study was to investigate the impact of nitrogen nutrition (calcium nitrate, ammonium nitrate, and urea as well as (green, purple, and‘Fino Verde’ on the chemical composition and yielding of basil (Ocimum basilicumL.. After drying the plant material at a temperature of 60°C and milling, total nitrogen was determined by means of Kjeldahl method, while mineral nitrogen content (N-NH 4, N-NO 3 was analyzed in 2% acetic acid extract. Yield of fresh basil matter depended significantly on the variety grown. The highest yields were obtained from a cultivar of ‘Fino Verde’ fertilized with ammonium nitrate. The purple variety plants fertilized with urea were characterized by a largest amount of total nitrogen. The‘Fino Verde’cultivar fertilized with urea accumulated the least quantities of nitrates in the basil herb.

  14. Coleoptera: Bostrichidae

    African Journals Online (AJOL)

    DR ASSUMING-BREMPONG

    castaneum is worldwide stored product pest ... oil, roots, etc. ... these with similar properties are the Ocimum gratissum (basil), and Ocimum sanctum (holy basil). It is used as an insect repellent during storage. It also works as a mosquito ...

  15. Karakterisasi Fraksi Aktif Antioksidan dari Ekstrak Etanol Biji Kemangi (Ocimum Basilicum L.

    Directory of Open Access Journals (Sweden)

    Dede Sukandar

    2016-08-01

    Full Text Available Characterization of antioxidant compounds from the seeds of basil (Ocimum basilicum L. has been done. Extraction is done by maceration method using ethanol solvent, fractionation by TLC and column chromatography, antioxidants test using DPPH method, and characterization of antioxidant compound using GCMS. Ethanol extract and results of fractionation ethanol extract of basil seeds using n-hexane, ethyl acetate, n-butanol and methanol-water extracts show that n-butanol extract has the highest antioxidant activity with IC50 values ​​of 41.90 ppm. Results of column chromatography n-butanol extract using n-hexane : ethyl acetate (1:9 as mobile phase yielded 5 fractions with fraction 4 (F4 isolate has dominant stain of active antioxidants after being sprayed DPPH reagent, it had IC50 values ​​of 39,70 ppm and total phenolic content of 0,003 mg/g. Isolate F4 suspected contains two active compounds as antioxidant which is terpenoid and phenolic compound group, namely squalene and 1,4-di-tert-buthyl-phenol identified by GCMS.DOI :http://dx.doi.org/10.15408/jkv.v0i0.3598

  16. Changes in yogurt fermentation characteristics, and antioxidant potential and in vitro inhibition of angiotensin-1 converting enzyme upon the inclusion of peppermint, dill and basil

    OpenAIRE

    Amirdivani, Shabboo

    2011-01-01

    The present study investigated the effects of peppermint (Mentha piperita), dill (Anethum graveolens) and basil (Ocimum basilicum) on yogurt formation, proteolysis and inhibition of angiotensin-1 converting enzyme (ACE). Herbal-yogurts had faster rates of pH reduction than plain-yogurt. All herbal-yogurts had higher (p < 0.05) antioxidant activities than plain-yogurt, both at the end of fermentation and throughout the storage period. The o-phthalaldehyde (OPA) peptides in herbal-yogurts in...

  17. Accumulation of anthropogenic radionuclides in crops in conditions of water stream and classical hydroponics

    Energy Technology Data Exchange (ETDEWEB)

    Mayrapetyan, Khachatur; Hovsepyan, Albert; Daryadar, Mahsa; Alexanyan, Julietta; Tovmasyan, Anahit; Ghalachyan, Laura; Tadevosyan, Anna; Mayrapetyan, Stepan [Institute of Hydroponics Problems, NAS, Noragyugh 108, 0082, Yerevan (Armenia)

    2014-07-01

    Natural and artificial radionuclides (RN) dangerous for health are emitted into ecosystems because of human anthropogenic activities in the field of nuclear energetics. Biologically artificial RN {sup 90}Sr(T{sub 1/2}=28,6 years) and {sup 137}Cs (T{sub 1/2}=30,1 years)are very dangerous. Therefore obtaining radio-ecologically safe raw material of high quality is a very urgent problem now. Taking into account the above mentioned, in order to obtain ecologically safe raw material we carried out comparative radiochemical investigations on essential oil and medicinal plants peppermint(Mentha piperita L.) and sweet basil (Ocimum basilicum L.) grown in new water-stream (continuous, gully, cylindrical) and classical hydroponics, with the aim of revealing accumulation peculiarities of {sup 90}Sr and {sup 137}Cs. The results of experiments have shown that in classical hydroponics peppermint and sweet basil exceeded the same indices of water-stream hydroponics with {sup 90}Sr and {sup 137}Cs content 1,1-1,2; 1,2-1,3 and 1,5-1,8; 1,4-1,8 times, respectively. Moreover, sweet basil exceeded peppermint in water-stream hydroponics {sup 90}Sr 1,3-1,6; {sup 137}Cs 1,2-1,4 times and in classical hydroponics {sup 90}Sr 1,6; {sup 137}Cs 1,2 times. The content of controlled artificial RN in raw material did not exceed the allowed concentration limit (ACL). New water-stream hydroponics system worked out in Institute of Hydroponics Problems is a radio-ecologically more profitable method for producing raw material than classical hydroponics. At the same time water-stream hydroponics system in comparison with classical hydroponics promoted productivity (dry raw material) increase of peppermint and sweet basil 1,1-1,4 times. (authors)

  18. Bactericidal activity of herbal volatile oil extracts against multidrug-resistant Acinetobacter baumannii.

    Science.gov (United States)

    Intorasoot, Amornrat; Chornchoem, Piyaorn; Sookkhee, Siriwoot; Intorasoot, Sorasak

    2017-01-01

    The aim of the study is to investigate the antibacterial activity of 10 volatile oils extracted from medicinal plants, including galangal ( Alpinia galanga Linn.), ginger ( Zingiber officinale ), plai ( Zingiber cassumunar Roxb.), lime ( Citrus aurantifolia ), kaffir lime ( Citrus hystrix DC.), sweet basil ( Ocimum basilicum Linn.), tree basil ( Ocimum gratissimum ), lemongrass ( Cymbopogon citratus DC.), clove ( Syzygium aromaticum ), and cinnamon ( Cinnamomum verum ) against four standard strains of Staphylococcus aureus , Escherichia coli , Pseudomonas aeruginosa , Acinetobacter baumannii , and 30 clinical isolates of multidrug-resistant A. baumannii (MDR- A. baumannii ). Agar diffusion, minimum inhibitory concentration, and minimum bactericidal concentration (MBC) were employed for the determination of bactericidal activity of water distilled medicinal plants. Tea tree oil ( Melaleuca alternifolia ) was used as positive control in this study. The results indicated the volatile oil extracted from cinnamon exhibited potent antibacterial activity against the most common human pathogens, S. aureus , E. coli , P. aeruginosa , and A. baumannii . Most of volatile oil extracts were less effective against non-fermentative bacteria, P. aeruginosa . In addition, volatile oil extracted from cinnamon, clove, and tree basil possessed potent bactericidal activity against MDR- A. baumannii with MBC 90 of 0.5, 1, and 2 mg/mL, respectively. The volatile oil extracts would be useful as alternative natural product for the treatment of the most common human pathogens and MDR- A. baumannii infections.

  19. Reduction of microbial contamination and improvement of germination of sweet basil (Ocimum basilicum L.) seeds via surface dielectric barrier discharge

    Science.gov (United States)

    Ambrico, Paolo F.; Šimek, Milan; Morano, Massimo; De Miccolis Angelini, Rita M.; Minafra, Angelantonio; Trotti, Pasquale; Ambrico, Marianna; Prukner, Václav; Faretra, Francesco

    2017-08-01

    Naturally contaminated basil seeds were treated by a surface dielectric barrier discharge driven in the humid air by an amplitude modulated AC high voltage to avoid heat shock. In order to avoid direct contact of seeds with microdischarge filaments, the seeds to be treated were placed at sufficient distance from the surface discharge. After treatment, the seeds were analyzed in comparison with control samples for their microbial contamination as well as for the capability of germination and seedling growth. Moreover, chemical modification of seed surface was observed through the elemental energy dispersive x-ray analysis and wettability tests. We found that treatment applied at 20% duty cycle (effective discharge duration up to 20 s) significantly decreases microbial load without reducing the viability of the seeds. On the other side, seedling growth was considerably accelerated after the treatment, and biometric growth parameters of seedlings (total length, weight, leaf extension) considerably increased compared to the controls. Interestingly, scanning electron microscopy images taken for the different duration of treatment revealed that seed radicle micropylar regions underwent significant morphological changes while the coat was substantially undamaged. Inside the seed, the embryo seemed to be well preserved while the endosperm body was detached from the epithelial tegument. A total of 9 different genera of fungi were recovered from the analyzed seeds. Scanning electron microscopy images revealed that conidia were localized especially in the micropylar region, and after plasma treatment, most of them showed substantial damages. Therefore, the overall effect of the treatment of naturally contaminated seeds by reactive oxygen and nitrogen species produced by plasma and the consequent changes in surface chemistry and microbial load can significantly improve seed vigor.

  20. Reduction of microbial contamination and improvement of germination of sweet basil ( Ocimum basilicum L.) seeds via surface dielectric barrier discharge

    International Nuclear Information System (INIS)

    Ambrico, Paolo F; Ambrico, Marianna; Šimek, Milan; Prukner, Václav; Morano, Massimo; De Miccolis Angelini, Rita M; Trotti, Pasquale; Faretra, Francesco; Minafra, Angelantonio

    2017-01-01

    Naturally contaminated basil seeds were treated by a surface dielectric barrier discharge driven in the humid air by an amplitude modulated AC high voltage to avoid heat shock. In order to avoid direct contact of seeds with microdischarge filaments, the seeds to be treated were placed at sufficient distance from the surface discharge. After treatment, the seeds were analyzed in comparison with control samples for their microbial contamination as well as for the capability of germination and seedling growth. Moreover, chemical modification of seed surface was observed through the elemental energy dispersive x-ray analysis and wettability tests. We found that treatment applied at 20% duty cycle (effective discharge duration up to 20 s) significantly decreases microbial load without reducing the viability of the seeds. On the other side, seedling growth was considerably accelerated after the treatment, and biometric growth parameters of seedlings (total length, weight, leaf extension) considerably increased compared to the controls. Interestingly, scanning electron microscopy images taken for the different duration of treatment revealed that seed radicle micropylar regions underwent significant morphological changes while the coat was substantially undamaged. Inside the seed, the embryo seemed to be well preserved while the endosperm body was detached from the epithelial tegument. A total of 9 different genera of fungi were recovered from the analyzed seeds. Scanning electron microscopy images revealed that conidia were localized especially in the micropylar region, and after plasma treatment, most of them showed substantial damages. Therefore, the overall effect of the treatment of naturally contaminated seeds by reactive oxygen and nitrogen species produced by plasma and the consequent changes in surface chemistry and microbial load can significantly improve seed vigor. (paper)

  1. Optimization of the Ocimum basilicum L. extraction process regarding the antioxidant activity

    Directory of Open Access Journals (Sweden)

    Vidović Senka S.

    2012-01-01

    Full Text Available The levels of input variables (temperature and extraction solvent that optimize a particular response (total phenols content, total flavonoids content and antioxidant activity of the Ocimum basilicum L. extraction process were determined by the response surface methodology (RSM. The influence of theextraction temperature on extraction process was investigated in the range from 33.8ºC to 76.2ºC, as well as of extraction solvent ethanol, in the range of concentrations from 21.7% to 78.3%. For the preparation of basil dry extract, characterized with minimal IC50 value, the calculated optimal values of temperature and ethanol concentration were: 75.33ºC and 73.66% (w/w. [Projekat Ministarstva nauke Republike Srbije, br. TR 31013

  2. Influência da temperatura e velocidade do ar na secagem de manjericão (Ocimum basilicum L. com relação aos teores de óleos essenciais e de linalol Influence of drying temperature and air velocity related to essential oil and linalol contents of the basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Rilvaynia Dantas Soares

    2007-08-01

    Full Text Available Neste trabalho, objetivou-se estudar a influência de quatro temperaturas de ar de secagem (40, 50, 60 e 70 ºC, em camada fina, e duas velocidades do ar (0,9 e 1,9 m/s sobre o teor de linalol do manjericão (Ocimum basilicum L. Utilizou-se um secador de bandejas especialmente desenvolvido, no laboratório de Secagem da UESB, Campus de Itapetinga-BA. Foram feitas quatro repetições, com 100 g de folhas frescas em cada uma das cinco bandejas da câmara de secagem. Na extração do óleo essencial, utilizou-se um sistema de destilação por arraste a vapor e a análise do óleo essencial foi realizada em um cromatógrafo conectado a um e espectrômetro de massa (CG-MS. Os maiores rendimentos de óleos essenciais de manjericão foram obtidos no processo de secagem com temperatura do ar igual a 40 ºC e 1,9 m/s de velocidade do ar. Os maiores rendimentos de linalol foram obtidos com temperatura do ar de secagem na faixa de 50 a 60 ºC e 1,9 m/s de velocidade do ar (2,23 e 2,47 ppm, respectivamente. Por análise de regressão, estimou-se que a temperatura de 54,4 ºC e a velocidade de 1,9 m/s forneceriam o maior rendimento de linalol. Concluiu-se que a composição química do óleo essencial do manjericão é afetada tanto pela temperatura como pela velocidade do ar de secagem.This work aimed to study the influence of four thin layer drying temperatures (40, 50, 60 and 70 ºC and two air velocities (0.9 and 1.9 m/s in the content of linalol of the Basil (Ocimum basilicum L.. It was used a tray dryer specially built for this experiment in the drying laboratory of the UESB at the "Campus de Itapetinga-Ba". There were made four repetitions with 100 g of fresh leaves in each one of the five trays in the dry chamber In the extraction of the essential oil, a vapor hauling system was used and the oil analysis was made in a gas chromatographer that was connected to a mass spectrometer (CG-MS. The greatest extracted profits of basil's essential oil were

  3. Effect of cultivar on phenolic levels, anthocyanin composition, and antioxidant properties in purple basil (Ocimum basilicum L.).

    Science.gov (United States)

    Flanigan, Patrick M; Niemeyer, Emily D

    2014-12-01

    In this study, we determined the effect of cultivar on total and individual anthocyanin concentrations and phenolic acid levels in eight purple basil varieties and examined the relationship between anthocyanin content, phenolic acid composition, and antioxidant properties. Cultivar had a significant influence on total anthocyanin concentrations as well as individual anthocyanin composition. The four major basil anthocyanins (labelled A-D) were quantified and cultivar had a statistically significant effect on anthocyanins B (p<0.01), C (p<0.01), and D (p<0.01), but not on anthocyanin A (p=0.94). Cultivar did not have a significant effect on total phenolic levels, although it did influence the concentration of some individual phenolic acids, including caftaric (p=0.03) and chicoric (p=0.04) acids. Although total phenolic and anthocyanin levels correlated with measured FRAP antioxidant capacities, for some cultivars the individual phenolic acid and anthocyanin composition was also an important factor affecting the antioxidant properties. Copyright © 2014 Elsevier Ltd. All rights reserved.

  4. The effect of drought stress on the expression of key genes involved in the biosynthesis of phenylpropanoids and essential oil components in basil (Ocimum basilicum L.).

    Science.gov (United States)

    Abdollahi Mandoulakani, Babak; Eyvazpour, Elham; Ghadimzadeh, Morteza

    2017-07-01

    Basil (Ocimum basilicum L.), a medicinal plant of the Lamiaceae family, is used in traditional medicine; its essential oil is a rich source of phenylpropanoids. Methylchavicol and methyleugenol are the most important constituents of basil essential oil. Drought stress is proposed to enhance the essential oil composition and expression levels of the genes involved in its biosynthesis. In the current investigation, an experiment based on a completely randomized design (CRD) with three replications was conducted in the greenhouse to study the effect of drought stress on the expression level of four genes involved in the phenylpropanoid biosynthesis pathway in O. basilicum c.v. Keshkeni luvelou. The genes studied were chavicol O-methyl transferase (CVOMT), eugenol O-methyl transferase (EOMT), cinnamate 4-hydroxylase (C4H), 4-coumarate coA ligase (4CL), and cinnamyl alcohol dehydrogenase (CAD). The effect of drought stress on the essential oil compounds and their relationship with the expression levels of the studied genes were also investigated. Plants were subjected to levels of 100%, 75%, and 50% of field capacity (FC) at the 6-8 leaf stage. Essential oil compounds were identified by gas chromatography/mass spectrometry (GC-MS) at flowering stage and the levels of gene expression were determind by real time PCR in plant leaves at the same stage. Results showed that drought stress increased the amount of methylchavicol, methyleugenol, β-Myrcene and α-bergamotene. The maximum amount of these compounds was observed at 50% FC. Real-time PCR analysis revealed that severe drought stress (50% FC) increased the expression level of CVOMT and EOMT by about 6.46 and 46.33 times, respectively, whereas those of CAD relatively remained unchanged. The expression level of 4CL and C4H reduced under drought stress conditions. Our results also demonstrated that changes in the expression levels of CVOMT and EOMT are significantly correlated with methylchavicol (r = 0.94, P ≤ 0

  5. INFLUENCE OF POLYPHENOLIC COMPOUNDS ON OCIMUM BASILICUM L. DEVELOPMENT

    Directory of Open Access Journals (Sweden)

    Adina Talmaciu

    2015-07-01

    Full Text Available The activities and role of phenolic compounds in the plant kingdom are well known. They are especially recognized for their function as plant growth regulators, but also for the important role in the biosynthesis process. Based on that, the aim of this work is to establish the influence of polyphenolic compounds, on the main physiological processes involved in basil cultivation under controlled conditions. Studies were carried out on sweet basil seeds (Ocimumbasilicum L. treated with different spruce bark polyphenolic extracts (aqueous extract and ultrasound assisted aqueous extract on several concentrations. The germination energy and germination capacity, plants vegetative organelles development and photoassimilatory pigments content were investigated. The results show that the Picea abies extracts, rich in phenolic compounds, have an influence on the global development of plantlets. An increased value for the growth parameters and pigments concentration was observed, compare with a control sample. Also it was shown that the effect of phenolic compounds on plants development significantly depends on their concentration.

  6. Caracterização morfológica e agronômica de acessos de manjericão e alfavaca Morphologic and agronomic characterization of basil accessions

    Directory of Open Access Journals (Sweden)

    Arie F. Blank

    2004-03-01

    Full Text Available O manjericão (Ocimum basilicum L. pode ser considerado cultura anual ou perene, conforme o local de cultivo. Existem diversas finalidades para seu uso na culinária, como planta ornamental, medicinal e aromática, sendo o seu oleo essencial valorizado no mercado internacional pelo teor de linalol. Caracterizou-se morfológica e agronômicamente, acessos de Ocimum sp. visando a seleção de genótipos com alto rendimento de óleo essencial rico em linalol. O delineamento experimental foi de blocos casualizados, com duas repetições, avaliando 55 genótipos do Banco de Germoplasma de Ocimum da UFS. Avaliou-se a altura de plantas, peso da matéria seca da parte aérea, teor e rendimento de óleo essencial. Observou-se grande diversidade entre os genótipos para todas as variáveis morfológicas e agronômicas avaliadas. Houve grande amplitude entre os genótipos quanto ao teor de óleo essencial, variando de 0,202 a 2,536 ml/100g e para o rendimento de óleo essencial, variando de 1,103 a 21,817 l/ha. Avaliando as variáveis teor e rendimento de óleo essencial de O. basilicum pode-se selecionar os genótipos NSL6421, PI197442, PI358464, PI414194, PI531396 e 'Fino Verde' para o programa de melhoramento genético que visa a obtenção de novas cultivares de manjericão com alto rendimento de óleo essencial rico em linalol.The sweet basil (Ocimum basilicum L., can be an annual or a perennial plant depending on the place where it is grown. This plant has several culinary, ornamental, medicinal and aromatic uses. The value of its essential oil in the international market depends on the percentage of linalool. We characterized the morphologic and agronomic qualities of the Ocimum accessions, to select genotypes with higher yield of essential oil rich in linalool. Experiment design consisted of randomized blocks with two replications, evaluating 55 genotypes of the Germplasm Bank of Ocimum from the Universidade Federal do Sergipe, Brazil. The plant

  7. Bactericidal activity of herbal volatile oil extracts against multidrug resistant Acinetobacter baumannii

    Directory of Open Access Journals (Sweden)

    Amornrat Intorasoot

    2017-06-01

    Full Text Available Aim:\tTo investigate the antibacterial activity of ten volatile oils extracted from medicinal plants, including galangal (Alpinia galanga Linn., ginger (Zingiber officinale, plai (Zingiber cassumunar Roxb., lime (Citrus aurantifolia, kaffir lime (Citrus hystrix DC., sweet basil (Ocimum basilicum Linn., tree basil (Ocimum gratissimum, lemongrass (Cymbopogon citratus DC., clove (Syzygium aromaticum and cinnamon (Cinnamomum verum against four standard strains of Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa, Acinetobacter baumannii and thirty clinical isolates of multidrug-resistant A. baumannii (MDR-A. baumannii. Methods:\tAgar diffusion, minimal inhibitory concentration (MIC and minimal bactericidal concentration (MBC were employed for determination of bactericidal activity of water distillated medicinal plants. Tea tree oil (Melaleuca alternifolia was used as positive control in this study. Results:\tThe results indicated the volatile oil extracted from cinnamon exhibited potent antibacterial activity against the most common human pathogens, S. aureus, E. coli, P. aeruginosa and A. baumannii. Most of volatile oil extracts were less effective against non-fermentative bacteria, P. aeruginosa. In addition, volatile oil extracted from cinnamon, clove and tree basil possessed potent bactericidal activity against MDR-A. baumannii with MBC90 of 0.5, 1 and 2 mg/mL, respectively. Conclusions: The volatile oil extracts would be useful as alternative natural product for treatment of the most common human pathogens and MDR-A. baumannii infections. [J Complement Med Res 2017; 6(2.000: 218-222

  8. The effect of different solvents and number of extraction steps on the polyphenol content and antioxidant capacity of basil leaves (Ocimum basilicum L.) extracts.

    Science.gov (United States)

    Złotek, Urszula; Mikulska, Sylwia; Nagajek, Małgorzata; Świeca, Michał

    2016-09-01

    The objectives of this study were to determine best conditions for the extraction of phenolic compounds from fresh, frozen and lyophilized basil leaves. The acetone mixtures with the highest addition of acetic acid extracted most of the phenolic compounds when fresh and freeze-dried material have been used. The three times procedure was more effective than once shaking procedure in most of the extracts obtained from fresh basil leaves - unlike the extracts derived from frozen material. Surprisingly, there were not any significant differences in the content of phenolics between the two used procedures in the case of lyophilized basil leaves used for extraction. Additionally, the positive correlation between the phenolic compounds content and antioxidant activity of the studied extracts has been noted. It is concluded that the acetone mixtures were more effective than the methanol ones for polyphenol extraction. The number of extraction steps in most of the cases was also a statistically significant factor affecting the yield of phenolic extraction as well as antioxidant potential of basil leaf extracts.

  9. Stomatal density and metabolic determinants mediate salt stress adaptation and water use efficiency in basil (Ocimum basilicum L.).

    Science.gov (United States)

    Barbieri, Giancarlo; Vallone, Simona; Orsini, Francesco; Paradiso, Roberta; De Pascale, Stefania; Negre-Zakharov, Florence; Maggio, Albino

    2012-11-15

    Increasing salinity tolerance and water-use efficiency in crop plants are two major challenges that agriculture must face in the next decades. Many physiological mechanisms and molecular components mediating crop response to environmental stresses have been identified. However, the functional inter-links between stress adaptation responses have not been completely understood. Using two basil cultivars (Napoletano and Genovese) with contrasting ability to respond to salt stress, here we demonstrate that reduced stomatal density, high ascorbate level and polyphenol oxidase (PPO) activity coordinately contribute to improve basil adaptation and water use efficiency (WUE) in saline environment. The constitutively reduced stomatal density was associated with a "delayed" accumulation of stress molecules (and growth inhibiting signals) such as abscisic acid (ABA) and proline, in the more tolerant Genovese. Leaf volatile profiling also revealed cultivar-specific patterns, which may suggest a role for the volatile phenylpropanoid eugenol and monoterpenes in conferring stress tolerance via antioxidant and signalling functions. Copyright © 2012 Elsevier GmbH. All rights reserved.

  10. Microextracción en fase sólida de compuestos volátiles en albahaca (Ocimum basilicum L. Microextracción en fase sólida de compuestos volátiles en albahaca (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Isaac Andrade-González

    2012-02-01

    Full Text Available Volatile compounds of basil (Ocimum basilicum L. were extracted with solid phase microextraction(SPME and analyzed with gas chromatography-mass spectrometry (GC-MS. TwoSPME fiber coatings, Polydimethylsiloxane/Divinylbenzene (PDMS/DVB, 65 μm and Carbowax/Divinylbenzene (CW/DVB, 65 μm were evaluated in order to compare the extraction ofcomponents. Among the 25 volatile compounds detected were phenylpropanoids, monoterpenes,sesquiterpenes, esters, and aldehydes. There were significant (P Los compuestos volátiles de la albahaca (Ocimum basilicum L. fueron extraídos mediante la microextracción en fase sólida (SPME y analizados con cromatografía de gases-espectrometría de masas (GC-MS. Se evaluaron dos fibras, Polidimetilsiloxano/Divinilbenceno (PDMS/DVB, 65 μm y Carbowax/Divinilbenceno (CW/DVB, 65 μm, para comparar la extracción de componentes. Entre los 25 compuestos volátiles recuperados en la albahaca, se identificaron fenilpropanoides, monoterpenos, sesquiterpenos, ésteres, y aldehídos. Hubieron diferencias significativas (P Cuantitativamente, el componente más importante fue el cinamato de metilo, seguido por el linalol.

  11. AKTIVITAS ANTIOKSIDAN DAN ANTIBAKTERI EKSTRAK POLAR DAN NON POLAR BIJI SELASIH (Ocimum sanctum Linn [Antioxidant and Antibacterial Activities from Polar and Non Polar Basil (Ocimum sanctum Linn Seed Extracts

    Directory of Open Access Journals (Sweden)

    Agustina D. R. Nurcahyanti1*

    2011-06-01

    Full Text Available The aims of this study were to determine total phenolic content, antioxidant activity and antibacterial activity of polar and nonpolar extracts of basil (O. sanctum L. seed. Seeds of basil (O. sanctum L. were extracted using a soxhlet extractor using four types organic solvent, i.e. chloroform, ethyl acetate, acetone, and methanol for eight hours each. The total phenolic content was determined using Folin Ciocalteu method, antioxidant activity was determined using reducing power and DPPH (1,1-diphenyl,2-picrylhydrazyl scavenging activity methods, while antibacterial activity was tested using agar diffusion method. The result showed that the highest total phenolic content and antioxidant activity was obtained in methanol extract with 3.63 ± 0.21 mgGAE/g phenolic total, 58.39 ± 3.81 ek/g using reducing power method and 85.73 ± 0.86% free radical scavenging activity. Furthermore the result of antibacterial activity testing showed that the highest diameter of inhibition zone was observed in ethyl acetate extract inhibition on E.coli, P.aeruginosa, B.subtilis, and S.aureus where its inhibition zone were 13.53 ± 0.63; 10.67 ± 1.05; 14.93 ± 0.80, and 13.46 ± 0.79 mm, respectively. This result suggests that both polar and nonpolar basil seed extracts possess specific biological activity. This data provide valuable and strong database for exploration of natural antibacterial agents and antioxidant for food and health industry application.

  12. Characterization of Essential Oil Composition in Different Basil Species and Pot Cultures by a GC-MS Method

    Directory of Open Access Journals (Sweden)

    Andrea Muráriková

    2017-07-01

    Full Text Available Basil (Ocimum L. species are used as medicinal plants due to their essential oils exhibiting specific biological activity. The present work demonstrated that both the variety and season/conditions of cultivation had a significant effect on (i the produced amount (extraction yield, (ii qualitative, as well as (iii quantitative profile of basil essential oil. Among studied basil varieties, a new variety, ‘Mánes’, was characterized for the first time. Based on our quantitative evaluation of GC-MS profiles, the following chemotypes and average concentrations of a main component were detected in the studied basil varieties: ‘Ohře’, ‘Lettuce Leaf’, ‘Purple Opaal’, ‘Dark Green’ (linalool, 5.99, 2.49, 2.34, 2.01 mg/mL, respectively, and ‘Mammolo Genovese’, ‘Mánes’, ‘Red Rubin’ (eucalyptol, 1.34, 0.96, 0.76 mg/mL, respectively. At the same time, when considering other compounds identified in GC-MS profiles, all the studied varieties, except from ‘Lettuce Leaf’, were methyl eugenol-rich with a strong dependence of the eugenol:methyl eugenol ratio on the seasonal changes (mainly solar irradiation, but also temperature and relative humidity. More complex and/or variable (depending on the season and cultivation chemotypes were observed with ‘Lettuce Leaf’ (plus estragole, 2.27 mg/mL, ‘Dark Green’ (plus eucalyptol, 1.36 mg/mL, ‘Mammolo Genovese’ (plus eugenol, 1.19 mg/mL, ‘Red Rubin’ (plus linalool and eugenol, 0.46 and 0.56 mg/mL, respectively, and ‘Mánes’ (plus linalool and eugenol, 0.58 and 0.40 mg/mL, respectively. When considering superior extraction yield (ca. 17 mL·kg−1, i.e., two to five times higher than other examined varieties and consistent amounts (yields of essential oil when comparing inter-seasonal or inter-year data (RSD and inter-year difference in mean yield values ˂2.5%, this new basil variety is very promising for use in the pharmaceutical, food, and cosmetic industries.

  13. Effect of jasmonic acid elicitation on the yield, chemical composition, and antioxidant and anti-inflammatory properties of essential oil of lettuce leaf basil (Ocimum basilicum L.).

    Science.gov (United States)

    Złotek, Urszula; Michalak-Majewska, Monika; Szymanowska, Urszula

    2016-12-15

    The effect of elicitation with jasmonic acid (JA) on the plant yield, the production and composition of essential oils of lettuce leaf basil was evaluated. JA-elicitation slightly affected the yield of plants and significantly increased the amount of essential oils produced by basil - the highest oil yield (0.78±0.005mL/100gdw) was achieved in plants elicited with 100μM JA. The application of the tested elicitor also influenced the chemical composition of basil essential oils - 100μM JA increased the linalool, eugenol, and limonene levels, while 1μM JA caused the highest increase in the methyl eugenol content. Essential oils from JA-elicited basil (especially 1μM and 100μM) exhibited more effective antioxidant and anti-inflammatory potential; therefore, this inducer may be a very useful biochemical tool for improving production and composition of herbal essential oils. Copyright © 2016 Elsevier Ltd. All rights reserved.

  14. The effects of alcoholic leaf extract Ocimum basilicum on angiogenesis in chick chorioallantoic membrane

    Directory of Open Access Journals (Sweden)

    Niazi Fateme

    2016-10-01

    Full Text Available Abstract Background: Angiogenesis is an important biological processes of new blood vessels in many pathological stages of development and embryo development occurs and a complex and dynamic phenomenon that is needed for development and other physiological processes. This study aimed to investigate the effect of alcoholic Ocimum basilicum leaf extract on angiogenesis chick chorioallantoic membrane is done. Materials and Methods: In this experimental study 40 Ross fertilized eggs were randomly divided into four groups: control, sham-exposed and experimental groups were divided. The second day of incubation the eggs window was opened. Eighth day of the alcoholic extract of basil doses of 50 and 150 mg/kg on chick chorioallantoic membrane was injected. On day 12, embryos length and weight and chorioallantoic membrane (CAM was photographed by photostereomicroscope Then the numbers and lengths of vessels in special area on CAM were measured with Image J. analyzed through by t-test and ANOVA (P<0.05. Results: The data does not show significant difference between embryos length and weight in sham compare to all experimental groups. In the study vessels number just with 150 mg/kg observed significant. Conclusion: Alcoholic extract of basil is an increase in the number of vessels and in this sense the healing and growth processes associated with them as well as effective.

  15. Acaricidal effect and chemical composition of essential oils extracted from Cuminum cyminum, Pimenta dioica and Ocimum basilicum against the cattle tick Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Martinez-Velazquez, Moises; Castillo-Herrera, Gustavo Adolfo; Rosario-Cruz, Rodrigo; Flores-Fernandez, Jose Miguel; Lopez-Ramirez, Julisa; Hernandez-Gutierrez, Rodolfo; Lugo-Cervantes, Eugenia del Carmen

    2011-02-01

    Acaricidal activity of essential oils extracted from cumin seeds (Cuminum cyminum), allspice berries (Pimenta dioica) and basil leaves (Ocimum basilicum) were tested on 10-day-old Rhipicephalus (Boophilus) microplus tick larvae using the LPT. Two-fold dilutions of the three essential oils were tested from a starting dilution of 20% down to 1.25%. Results showed a high toxicological effect for cumin, producing 100% mortality in all tested concentrations on R. microplus larvae. Similarly, allspice essential oil produced 100% mortality at all concentrations with the exception of a dramatic decrease at 1.25% concentration. Conversely, basil essential oil was not shown to be toxic against R. microplus larvae. The most common compounds detected by gas chromatography-mass spectrometry were as follows: cumin: cuminaldehyde (22.03%), γ-terpinene (15.69%) and 2-caren-10-al (12.89%); allspice: methyl eugenol (62.7%) and eugenol (8.3%); basil: linalool (30.61%) and estragole (20.04%). Results clearly indicate that C. cyminum and P. dioica essential oils can be used as an effective alternative for R. microplus tick control, and there is a high probability they can be used for other ticks affecting cattle in Mexico and throughout the world, thereby reducing the necessity for traditional and unfriendly synthetic acaricides.

  16. Chemical composition and antimicrobial properties of different basil essential oils chemotypes from Togo

    Directory of Open Access Journals (Sweden)

    Koffi Koba

    2009-06-01

    Full Text Available The aerial parts essential oils of Ocimum basilicum (Lamiaceae from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; t-anethole type. The in vitro microbiological experiments revealed that only the methyleugenol and methyleugenol/t-anethole chemotypes were active against tested fungi and bacteria. Their minimum inhibitory concentrations (MIC ranged from 80 to 150 µl.l-1 and from 200 to 500 µl.l-1 respectively. Likewise, on tested bacteria the MIC varied from 200 µl.l-1 to 400 µl.l-1 and from 250 to 500 µl.l-1 respectively. These findings are supportive of the potential of both basil oil chemotypes for use as active ingredients in natural antibiotic drugs.

  17. Chemical composition and antimicrobial properties of different basil essential oils chemotypes from Togo

    Directory of Open Access Journals (Sweden)

    Koffi Koba

    2009-03-01

    Full Text Available The aerial parts essential oils of Ocimum basilicum (Lamiaceae from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; t-anethole type. The in vitro microbiological experiments revealed that only the methyleugenol and methyleugenol/t-anethole chemotypes were active against tested fungi and bacteria. Their minimum inhibitory concentrations (MIC ranged from 80 to 150 µl.l-1 and from 200 to 500 µl.l-1 respectively. Likewise, on tested bacteria the MIC varied from 200 µl.l-1 to 400 µl.l-1 and from 250 to 500 µl.l-1 respectively. These findings are supportive of the potential of both basil oil chemotypes for use as active ingredients in natural antibiotic drugs.

  18. Chemistry and bioactivities of essential oils of some Ocimum species: an overview

    Directory of Open Access Journals (Sweden)

    Abhay Kumar Pandey

    2014-09-01

    Full Text Available Essential oils of different species of the genus Ocimum are natural flavouring materials of commercial importance. The data given in current literature are pertaining to the chemical composition of essential oils of different Ocimum species viz., Ocimum basilicum Linn. (alt. Ocimum basilicum var. minimum, Ocimum basilicum var. purpurience, Ocimum campechianum Mill., Ocimum canum Sims. (Ocimum americanum, Ocimum citriodorum, Ocimum gratissimum Linn., Ocimum kilimandscharicum Linn., Ocimum micranthum Willd., Ocimum sanctum Linn., (alt. Ocimum tenuiflorum Linn., Ocimum selloi Benth., Ocimum trichodon, Ocimum utricifolium from different geographical regions. A considerable difference in chemical composition of a particular species is found, which may be due to their occurrence in different eco-climatic zones and changes in edaphic factors. Attention is also focused on the biological properties of Ocimum oils which are related to their various interesting applications as antimicrobial, antioxidant, repellent, insecticidal, larvicidal, nematicidal and therapeutic (anti-inflammatory, antinociceptive, antipyretic, antiulcer, analgesic, anthelmintic, anticarcinogenic, skin permeation enhancer, immunomodulatory, cardio-protective, antilipidemic agents.

  19. Basil, tea tree and clove essential oils as analgesics and anaesthetics in Amphiprion clarkii (Bennett, 1830

    Directory of Open Access Journals (Sweden)

    A. M. Correia

    2017-11-01

    Full Text Available Abstract In this study were evaluated the anaesthesia and analgesic effects of clove Eugenia caryophyllata, tea tree Melaleuca alternifolia and basil Ocimum basilicum essential oils (EO during handling of yellowtail clownfish Amphiprion clarkii. Juveniles (3.70 ± 0.75 cm and 1.03 ± 0.50 g; mean ± standard deviation were submitted to concentrations of 40, 50, 60, 70 and 80 µl L-1 of clove, 150, 200, 250, 300 and 350 µl L-1 of basil and 200, 300, 400, 500 and 600 µl L-1 of tea tree oils (n=10/concentration, previously defined in pilot tests. Individually and only once, fish from each treatment were placed in a glass recipient containing 1 L of seawater at a temperature of 25 °C, salinity of 35 g L-1 and the specific concentration of diluted EO (stock solution. Control (only seawater and blank (seawater and ethanol at the highest concentration used to dilute the oils treatments were also conducted. After reaching the stage of surgical anaesthesia, fish were submitted to biometry and a sensibility test. After that, they were transferred to clean seawater for anaesthesia recovery. The times of induction needed to reach each anaesthesia stage and anaesthesia recovery were recorded. Animals were observed for 72 hours after the procedures. All the EO provoked anaesthesia and analgesic effects in A. clarkii, but basil oil is not recommended because it caused involuntary muscle contractions and mortality in 100% and 12% of fish, respectively. The lower concentrations that promote suitable induction and recovery times are 50 µl L-1 of clove oil and 500 µl L-1 of tea tree oil. However, due to its complementary high analgesic efficiency, clove oil is recommended as the ideal anaesthetic for A. clarkii.

  20. Extraction optimization of mucilage from Basil (Ocimum basilicum L.) seeds using response surface methodology.

    Science.gov (United States)

    Nazir, Sadaf; Wani, Idrees Ahmed; Masoodi, Farooq Ahmad

    2017-05-01

    Aqueous extraction of basil seed mucilage was optimized using response surface methodology. A Central Composite Rotatable Design (CCRD) for modeling of three independent variables: temperature (40-91 °C); extraction time (1.6-3.3 h) and water/seed ratio (18:1-77:1) was used to study the response for yield. Experimental values for extraction yield ranged from 7.86 to 20.5 g/100 g. Extraction yield was significantly ( P  < 0.05) affected by all the variables. Temperature and water/seed ratio were found to have pronounced effect while the extraction time was found to have minor possible effects. Graphical optimization determined the optimal conditions for the extraction of mucilage. The optimal condition predicted an extraction yield of 20.49 g/100 g at 56.7 °C, 1.6 h, and a water/seed ratio of 66.84:1. Optimal conditions were determined to obtain highest extraction yield. Results indicated that water/seed ratio was the most significant parameter, followed by temperature and time.

  1. Determinação de óleos essenciais de alfavaca (Ocimum gratissimum L., orégano (Origanum vulgare L. e tomilho (Thymus vulgaris L. Determination of essential oils of basil (Ocimum gratissimum L., oregano (Ocimum gratissimum L. and thyme (Thymus vulgaris L.

    Directory of Open Access Journals (Sweden)

    A.M. Borges

    2012-01-01

    apresentam potencial para o enriquecimento dos alimentos ou para a obtenção dos óleos essenciais.This study aimed to characterize commercial fresh and dry medicinal plants (basil, oregano and thyme, to obtain essential oil by the steam distillation method and to quantify chemical compounds by means of GC/MS. The fresh and dry plants were subjected to the following analyses moisture, ether extract, protein, crude fiber, ash, non-nitrogenous extract, caloric value, essential oil content and identification of major compounds by gas chromatography-mass spectrometry. Considering the obtained characterization, the following results on dry basis proved promising: protein and ash content in commercial dry basil with 17.34 g 100 g-1 and 8.12 g 100 g-1, respectively; crude fiber in commercial dry oregano with 15.65 g 100 g-1; ether extract, non-nitrogenous extract and caloric value in commercial dry thyme with 9.30 g 100 g-1, 52.72 g 100 g-1 and 356.74 Kcal 100 g-1, respectively. The highest essential oil yield was obtained for commercial dry basil with 1.02% and the lowest yield was obtained for fresh basil with only 0.13%. Chromatography indicated 87.38% eugenol and 6.27% thymol in fresh basil. For commercial dry basil, the chromatogram showed a reduction in eugenol (71.12% and an increase in thymol (13.28%. Four peaks were quantified for fresh oregano the γ-terpinene (33.45%, 4-terpineol (25.59%, thymol (14.21% and carvacrol (2.30%. For the essential oil of commercial dry oregano, there was a decrease in γ-terpinene (28.73% and an increase in 4-terpineol (27.58%, thymol (19.71% and carvacrol (3.67%. In the chromatogram of the essential oil of fresh thyme, three peaks were quantified: borneol (66.66%, thymol (13.41% and linalool (3.24%. On the other hand, in the chromatogram of the essential oil of commercial dry thyme, there was a decrease in borneol (37.90% and an increase in thymol (20.61% and linalool (10.34%. It can be concluded that commercial dry leaves of basil, oregano

  2. Influence of the harvesting time, temperature and drying period on basil (Ocimum basilicum L. essential oil

    Directory of Open Access Journals (Sweden)

    José Luiz S. Carvalho Filho

    Full Text Available Ocimum basilicum L. essential oil with high concentration of linalool is valuable in international business. O. basilicum essential oil is widely used as seasoning and in cosmetic industry. To assure proper essential oil yield and quality, it is crucial to determine which environmental and processing factors are affecting its composition. The goal of our work is to evaluate the effects of harvesting time, temperature, and drying period on the yield and chemical composition of O. basilicum essential oil. Harvestings were performed 40 and 93 days after seedling transplantation. Harvesting performed at 8:00 h and 12:00 h provided higher essential oil yield. After five days drying, the concentration of linalool raised from 45.18% to 86.80%. O. basilicum should be harvested during morning and the biomass dried at 40ºC for five days to obtain linalool rich essential oil.

  3. Characterization of new biodegradable edible film made from basil seed (Ocimum basilicum L.) gum.

    Science.gov (United States)

    Khazaei, Naimeh; Esmaiili, Mohsen; Djomeh, Zahra Emam; Ghasemlou, Mehran; Jouki, Mohammad

    2014-02-15

    It is well known that the market for edible films is experiencing remarkable growth and expected to continue. This study investigated the using of basil seed gum (BSG) as a new film-forming material under the influence of addition of glycerol (GLY) as plasticizer. Edible films based on BSG and three different concentrations of GLY (25%, 35%, and 50% w/w BSG) were developed, and their water vapor permeability (WVP), as well as physical, thermal and mechanical properties were measured. The addition of glycerol significantly increased water vapor permeability and solubility of the film (p<0.05). As expected, the increase in GLY concentration from 25% to 50% (w/w) increased the extensibility, but decreased tensile strength. This suggests weaker mechanical strength and higher mobility of polymer chains by plasticizing effect of GLY. The color measurement values showed that increasing the glycerol concentration in polymer matrix caused the b and L values increased while ΔE value decreased. The electron scanning micrograph showed plasticized films as smooth, and uniform which lacked pores or cracks compared with those were not plasticized. This study revealed that the BSG had a good potential to be used in producing edible films for various food applications. Copyright © 2013 Elsevier Ltd. All rights reserved.

  4. Étude ethnobotanique, phytochimique et écotoxicologique de ...

    African Journals Online (AJOL)

    ... Plante Médicinale a caractère de Légumes feuilles, gage de bonne santé et de Développement Durable. Mots clés: Ocimum gratissimum ; Légume feuille ; Plante médicinale ; Ethnobotanique ; Cotonou ; Bénin. English Abstract. Objective: The use of Ocimum gratissimum Lamiaceae (African Basil) is widespread in Benin.

  5. Comparative reproduction mechanisms of three species of Ocimum L. (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Matthew Oziegbe

    2016-03-01

    Full Text Available Ocimum species have a combination of reproductive system which varies with the locality and cultivar. We have studied here the reproductive mechanisms of five variants of three Ocimum species in Nigeria, namely: Ocimum canum Sims., O. basilicum L., and O. americanum L. Flowers from each variant were subjected to open and bagged pollination treatments of hand self-pollination, spontaneous self-pollination and emasculation. All open treatments of the five Ocimum variants produced more fruit and seed than the corresponding bagged treatments. The two O. canum variants and O. basilicum ‘b1’ produced high fruit and seed set in the open and bagged treatments of spontaneous self-pollination. Ocimum basilicum ‘b2’ and O. americanum produced higher fruit and seed set in the self-pollination open treatment but significantly lower fruit and seed set in the bagged treatment. Fewer fruit and seeds were produced in the emasculated open treatments but none in the emasculated bagged treatments of the five Ocimum variants. The floral foragers comprising of bees, wasps and butterflies visited the Ocimum species to collect pollen or nectar in the open treatments. The two O. canum variants and O. basilicum ‘b1’ variant reproduced mainly through autogamy but O. basilicum ‘b2’ and O. americanum showed mixed reproduction of autogamy and outcrosssing. Insect visitation to the flowers enhanced pollination resulting in higher fruit and seed set in all the Ocimum species studied.

  6. SELENIUM ACCUMULATION BY BASIL PLANTS (OCINUM BASILICUM L.

    Directory of Open Access Journals (Sweden)

    N. A. Golubkina

    2014-01-01

    Full Text Available Selenium accumulation level in basil plants is investigated. A direct correlation between selenium concentration and essential oil content is demonstrated for basil and other aroma plants. No correlation is found between selenium and flavonoids.

  7. Densitometric Validation and Optimisation of Polyphenols in Ocimum sanctum Linn by High Performance Thin-layer Chromatography.

    Science.gov (United States)

    U K, Ilyas; Katare, Deepshikha P; Aeri, Vidhu

    2015-01-01

    Ocimum sanctum Linn (Sanskrit: Tulasi; family: Libiaceae), popularly known as holy basil or Ocimum teinufolium, is found throughout the semitropical and tropical parts of India. In Ayurveda, Tulasi has been well known for its therapeutic potentials. To optimise and develop a standard method to quantify seven polyphenols simultaneously by HPTLC. A three-level factor Box-Behnken statistical design was used for optimisation, where extraction time (min), temperature (°C) and methanol:water ratio (% v/v) are the independent variables with polyphenols as the dependent variable. The separation was archived on a silica-gel 60 F254 HPTLC plate using toluene:ethyl acetate:formic acid:methanol (3:3:0.8:0.2 v/v) as the mobile phase. Densitometric analysis of polyphenols was carried out in the absorbance mode at 366 nm. The quantification of polyphenols was carried out based on peak area with a linear calibration curve at concentration ranges of 60-240, 20-200, 100-1600, 40-200, 200-1400, 10-160, 200-1400, 100-5000 ng/band for caffeic acid, ellagic acid, rutin, kaempferol, catechin, quercetin, eupalitin and epicatechin respectively. The method was validated for peak purity, precision, accuracy, limit of detection (LOD) and quantification (LOQ). Method specificity was confirmed using the retention factor value and visible spectra correlation of marker compounds. A validated HPTLC method was newly developed for simultaneous quantification of seven polyphenols in an Ayurvedic preparation of O. sanctum. The proposed method is simple, precise, specific, accurate, cost-effective, less time consuming and has the ability to separate the polyphenols from other constituents. Copyright © 2015 John Wiley & Sons, Ltd.

  8. Efficiency of essential oils of Ocimum basilicum and Cymbopogum flexuosus in the sedation and anaesthesia of Nile tilapia juveniles

    Directory of Open Access Journals (Sweden)

    JOSÉ D. LIMMA NETTO

    2017-08-01

    Full Text Available ABSTRACT This study aimed to verify the sedative and anaesthetic effect of the essential oils of basil (Ocimum basilicum (EOOB and lemongrass (Cymbopogum flexuosus (EOCF in Nile tilapia juveniles. The fish were transferred to aquaria containing different concentrations of each essential oil: 10, 25, 50, 100, 200, 400 and 600 μL L-1. The time of sedation ranged from 7 to 31 seconds and the recommended concentration was 10 or 25 μL L-1 for both essential oils. The best times for anaesthesia and recovery were found for the concentrations of 400 μL L-1 for EOOB (135.2 and 199.1 seconds, respectively and 600 μL L-1 for EOCF (327.1 and 374.8 seconds, respectively. In conclusion, we recommend the use of EOOB and EOCF for the sedation and anaesthesia of Nile tilapia at concentrations of 10-25 (for both, 400 and 600 μL L-1, respectively.

  9. Superação de dormência em sementes de manjericão (Ocimum basilicum L. Overcoming dormancy in seeds of basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    H.T.R. Amaro

    2012-01-01

    Full Text Available O objetivo do trabalho foi avaliar a eficiência de tratamentos pré-germinativos na superação da dormência de sementes de manjericão, produzidas no Horto de Plantas Medicinais da Unimontes, em fevereiro de 2011. Foram realizadas as seguintes determinações para avaliação da qualidade fisiológica das sementes: teor de água, germinação, primeira contagem de germinação, emergência de plântulas e índice de velocidade de emergência. O delineamento experimental utilizado foi inteiramente casualizado com quatro repetições de 50 sementes por tratamento, sendo T1- testemunha; T2 - pré esfriamento das sementes em câmara tipo BOD sob temperatura de 10ºC por 4 dias; T3 - embebição das sementes em água destilada por 24 horas; T4 - embebição das sementes em solução contendo KNO3 a 0,2 % por 5 minutos e T5 - sementes submetidas em água destilada a temperatura de 70ºC por 5 minutos. Os dados foram submetidos à análise de variância e as médias comparadas pelo teste Scott - Knott a 5% de probabilidade. O tratamento pré esfriamento em câmara tipo BOD a 10ºC por 4 dias reduz a dormência e promove incrementos na qualidade fisiológica das sementes do manjericão.Aiming in order to assess the effectiveness of treatments to overcome dormancy in seeds of basil, an experiment was conducted at the Laboratory of Seed Analysis of Unimontes. Following determinations were performed to evaluate the physiological quality of seeds, water content, germination, first count germination, seedling emergence and emergence speed index. The experimental design was completely randomized design with four replications of 50 seeds per treatment, which consisted of: T1 - control, T2 - pre-cooling of the seed chamber BOD at a temperature of 10ºC for 4 days, T3 - soaking the seeds in water distilled for 24 hours, T4 - soaking the seeds in a solution containing 0,2% for 5 minutes and T5 - submitted seeds in distilled water at 70ºC for 5 minutes. Data

  10. Comportamento fenotípico e genotípico de populações de manjericão Phenotypic and genotypic behavior of basil populations

    Directory of Open Access Journals (Sweden)

    Arie F Blank

    2010-09-01

    Full Text Available Genótipos de manjericão (Ocimum basilicum L. apresentam diferentes teores, rendimentos e composições químicas de óleos essenciais. Fatores influenciam na produção do óleo essencial de manjericão, como a cultivar plantada e o método de cultivo. O estudo dos parâmetros genéticos tem sido ferramenta útil na identificação de genótipos superiores. Este trabalho teve o objetivo de estimar alguns parâmetros genéticos associados ao comportamento produtivo de seis populações de manjericão nos anos agrícola 2004/05 e 2005/06. As características massa seca de folha + inflorescência e rendimento de óleo essencial apresentaram grande variabilidade por forte influência dos anos estudados. Já o teor de linalol manteve sua produtividade estável ao longo dos dois anos. Teor e rendimento de óleo essencial e teor de linalol no óleo essencial apresentaram herdabilidades altas na análise conjunta, indicando controle genético e grande possibilidade de serem transmitidas para as gerações futuras. Na análise conjunta as populações PI 197442-S3-bulk 3, PI 197442-S3-bulk 5 e PI 197442-S3-bulk 8 apresentaram os maiores teores e rendimentos de óleo essencial. Quanto ao constituinte químico majoritário do óleo essencial, o linalol, todas as populações apresentaram teores semelhantes, diferindo apenas na presença de alguns constituintes químicos minoritários.Basil (Ocimum basilicum L. genotypes present different contents, yields and chemical constituents in its essential oils. Factors influence the essential oil production of basil, such as cultivar and cultivation method. The study of genetic parameters is a useful tool to identify superior genotypes. In this work we estimated some genetic parameters associated to the production behavior of six basil populations cultivated in 2004/05 and 2005/06. The variables dry weight of leaves + inflorescences and essential oil yield presented high variability because of strong influence of

  11. Floral biology and reproductive mechanisms of the Ocimum canum Sims (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Cláudio Lúcio Fernandes Amaral

    2008-06-01

    Full Text Available The Ocimum genus (Lamiaceae presents essential oils used in the pharmaceutical, perfume, cosmetics and culinary industries. The aim of this paper was to study the fl oral biology and breeding mechanisms of Ocimum canum Sims. in relation to improved plant breeding. Ocimum canum has inflorescences with white, protandrous and hermaphoditic flowers. The osmophores are located at the anthers and stigma. Anthesis occurs between 10:30 and 11:30 a.m. The main fl oral visitors were bees of the Apis and Augochloropsis genuses. Ocimum canum presents a breeding system with a predominance of outcrossing that possibly demonstrates the wide reproductive flexibility of this species.

  12. The potential effects of Ocimum basilicum on health: a review of pharmacological and toxicological studies.

    Science.gov (United States)

    Sestili, Piero; Ismail, Tariq; Calcabrini, Cinzia; Guescini, Michele; Catanzaro, Elena; Turrini, Eleonora; Layla, Anam; Akhtar, Saeed; Fimognari, Carmela

    2018-06-11

    Basil (Ocimum basilicum L., OB) is a plant world widely used as a spice and a typical ingredient of the healthy Mediterranean diet. In traditional medicine, OB is indicated for many maladies and conditions; OB-containing nutritional supplements are increasingly sold. Conversely, safety concerns have been raised about the promutagens and procarcinogens alkenylbenzenes contained in OB. Areas covered: A critical review of the current status of OB as a nutraceutical, the pharmacology of its bioactive components, the rationale for its indications, and its safety. Expert opinion: Due to the polyphenolic and flavonoidic content, OB can be considered as an important ingredient in healthy diets; OB preparations may be effective as chemopreventive agents or adjunctive therapy in the treatment of different clinical conditions. From a toxicological perspective, since the tumorigenic potential of alkenylbenzenes is counteracted by other OB constituents such as nevadensin, it can be concluded that OB consumption in food and preparations is safe. The only concern relates to OB essential oils: in this case, a concentration limit for alkenylbenzenes should be precautionary defined, and the use of plant chemotypes with no or low levels of these alkylbenzenes for the preparation of essential oils should be made compulsory.

  13. Antioxidant properties of various solvent extracts from purple basil

    Science.gov (United States)

    Yeşiloğlu, Yeşim; Şit, Latifşah

    2012-09-01

    Water, ethanol and acetone extracts from leaves and flowers of purple basil, one of the most popular spices consumed in the Thrace region of Turkey, were tested in vitro for their ability to inhibit peroxidation of lipids, to scavenge DPPH, hydrogen peroxide, superoxide anion, to reduce Fe(III) to Fe(II) and to chelate Fe(II) ions. The results showed that purple basil contained naturally occurring antioxidant components and possessed antioxidant activity which may be attributed to its lipid peroxidation inhibitory, radical scavenging and metal chelating activities. It was concluded that purple basil might be a potential source of antioxidants.

  14. Effect of different concentrations of cadmium growth and morphological changes in basil (ocimum basilicum)

    International Nuclear Information System (INIS)

    Nazarian, M.; Amouzgar, D.; Sedghianzadeh, H.

    2016-01-01

    This study was conducted on four treatments (0, 3, 5 and 10 milligrams per liter of cadmium nitrate solution) and three replications in a completely randomized design. The morphological characteristics including fresh weight, dry weight, stem length, root length, leaf weight ratio, measuring index of the imposed stress, specific leaf area and water availability per unit leaf area, and the amount of cadmium in stems and roots were measured. By increasing cadmium treatment at 10 ppm concentration, the root growth varied between 3.47 and 1.93 cm and the lowest root growth belonged to the treatment at 10 ppm concentration measured 1.93 ± 0.4 cm. The rising stem growth was also indicated. Fresh and dry weight analysis indicates their descending growth. The growth reduction was observed by increasing cadmium treatment at 10 ppm concentration in the study of the trait of weight and specific leaf area. Relative water content (RWC) of the leaves varies between 81 to 89 percent which represents the greatest amount of stress in the treatment at 10 ppm concentration. A notable decline in transport from the root to stem and a significant reduction in plant tolerance index were observed through the analysis of transfer factor and tolerance index in plants. The process of reducing metal transition from the root to stem has become slower by increasing the substance concentration. Basil can absorb and accumulate cadmium and its root is able to accumulate more quantity of the metal than its stem. The morphological signs of cadmium toxicity are remarkable through discolored roots, shortening the distance between nodes, creating an amorphous spots on the leaves, reducing the leaves extent and a slight pallor of the leaves. (author)

  15. Effects of water stress and inoculation with plant growth promoting rhizobacteria (PGPR on antioxidant status and photosynthetic pigments in basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    Mostafa Heidari

    2012-01-01

    Full Text Available Effects of water stress and inoculation with plant growth promoting rhizobacteria (PGPR on antioxidant activity and photosynthetic pigments were studied in basil plants. A field experiment was conducted at the University of Zabol in Iran during 2010 growing season. The experiment laid out as split plot based on randomized complete block design with three replications. Three levels of water stress W1 = 80 (control, W2 = 60 and W3 = 40% of the field capacity (FC as main plots and four levels of bacterial species consisting of S1 = Pseudomonades sp., S2 = Bacillus lentus, S3 = Azospirillum brasilens, S4 = combination of three bacterial species and S5 = control (without use of bacterial as sub plots. The results revealed that water stress caused a significant change in the antioxidant activity. The highest concentration CAT and GPX activity were in W3 treatments. By increasing water stress from control to W3, chlorophyll content in leaves was increased but Fv/Fm and APX activity decreased. Application of rhizobacteria under water stress improved the antioxidant and photosynthetic pigments in basil plants. S1 = Pseudomonades sp. under water stress, significantly increased the CAT enzyme activity, but the highest GPX and APX activity and chlorophyll content in leaves under water stress were in S4 = combination of three bacterial species.

  16. 986-IJBCS-Article-Dr Niebie Roger

    African Journals Online (AJOL)

    DR GATSING

    basilicum L. sur le rendement d'extraction, la composition chimique de l'huile essentielle et son pouvoir ... parfumerie cosmétique et pesticides (Darrah, ...... Protective effect of basil (Ocimum ... composition and antimicrobial properties.

  17. Using of the herb in space foods

    Science.gov (United States)

    Katayama, Naomi

    2016-07-01

    The astronaut must do much work in a short time. The astronaut is exposed to much stress. For examples; Break of the hormone balance, Inappetence, Sleep shortage. Therefore the role that the meal serves as becomes big. It greatly participates in not only the health maintenance but also the mental health to consume a meal. Most of space foods are freeze dry, and the mineral is abundant, but it is necessary for the vitamins to add it particularly. When I think about it, the cultivation of the fresh vegetables with the spaceship is necessary. The Asian project team suggested cultivation of the herb in the space. The herbs were sweet basil, Dukung Abak, Hempedu Bumi and Chinese holly basil. Each herb has a fragrance ingredient. The fragrance ingredient stimulates human sense of smell. The fragrance ingredient increases an appetite. The good fragrance derives a good sleep. I can feel passage of time by observing a plant being brought up. It helps mental health to bring up a plant. We try that we bring up herb under a condition of the space. Because an experiment on the ground was over, we report it. The sweet basil which a germination rate has good is the first candidate when we think about temperature and light quantity in the space. Three kinds of other herbs are slow-growing and germination-rate is lower than sweet basil. We think that probably we will send a sweet basil to the spaceship in space. After a sweet basil grew up in a spaceship, we analyze a fragrance ingredient. We will cook the sweeter basil and want to eat.

  18. Application of response surface methodology to optimize pressurized liquid extraction of antioxidant compounds from sage (Salvia officinalis L.), basil (Ocimum basilicum L.) and thyme (Thymus vulgaris L.).

    Science.gov (United States)

    Hossain, M B; Brunton, N P; Martin-Diana, A B; Barry-Ryan, C

    2010-12-01

    The present study optimized pressurized liquid extraction (PLE) conditions using Dionex ASE® 200, USA to maximize the antioxidant activity [Ferric ion Reducing Antioxidant Power (FRAP)] and total polyphenol content (TP) of the extracts from three spices of Lamiaceae family (sage, basil and thyme). Optimal conditions with regard to extraction temperature (66-129 °C) and solvent concentration (32-88% methanol) were identified using response surface methodology (RSM). For all three spices, results showed that 129 °C was the optimum temperature with regard to antioxidant activity. Optimal methanol concentrations with respect to the antioxidant activity of sage and basil extracts were 58% and 60% respectively. Thyme showed a different trend with regard to methanol concentration and was optimally extracted at 33%. Antioxidant activity yields of the optimal PLE were significantly (p < 0.05) higher than solid/liquid extracts. Predicted models were highly significant (p < 0.05) for both total phenol (TP) and FRAP values in all the spices with high regression coefficients (R(2)) ranging from 0.651 to 0.999.

  19. Dicty_cDB: Contig-U15883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ndgk*kktrggygcwttniqfnq*ifne* q**fetnigvittfntiisitwfnfdangickcivistinsieyvtfigavlstnvti*k e*kqqk*q*e*iskfrgem...IA --- ---nnnnnnnnnnnkliihksiviiriqhsqivtqlnhtryhtimtigghphlvpkh*fl liiqpiliqlktitifyslmi...ab1. 38 0.33 2 ( DY330556 ) OB_MEa0005L07.f OB_MEa Ocimum basilicum cDNA clon... 38 0.36 2 ( EY305365 ) CAWX...ZGC_9 Danio rerio cDNA clo... 42 1.3 2 ( DY338804 ) OB_SEa09A12.r OB_SEa Ocimum basil...nnnnnnnflmqqhq qyqqqyqlmqqhyqqqlsqqhhqqvwvqiqlhvv*vvvvvvvvvvvvvvvi*pvelnqvv vvveekvdliimvmdmvmdhmvmvvkvqevhvvvniiythiytlnitsivi

  20. Application of Ocimum basilicum Essential Oil as Vapor on Postharvest Storage of Plum Fruit cv. ‘Golden Drop’

    Directory of Open Access Journals (Sweden)

    Zahra FAKHAR

    2014-12-01

    Full Text Available Increased interest in theuse of natural compounds instead of chemicals is due to concerns about the effect of synthetic ingredients on humans’ health and over environment. Therefore, in this study essential oil from Ocimum basilicum as a natural and safe compound, was applied at three levels (100, 200 and 300 μl/l as vapor and its effects on postharvest quality and storage life of ‘Golden Drop’ plums was evaluated. After application of treatments, the fruits were stored at +1 °C and 80-85% relative humidity for 42 days. During the storage period, samplings were carried out every week and to simulate market condition, they were kept at room temperate for 24 h. Then some of the qualitative and quantitative traits, such as total soluble solids (TSS, titrable acidity (TA, TSS/TA ratio, weight loss, firmness, ascorbic acid, total antioxidants, as well as color (L*,  hue angle were measured. Results showed that the basil essential oil contributed to a better maintenance of

  1. Correlated accumulation of anthocyanins and rosmarinic acid in mechanically stressed red cell suspensions of basil (Ocimum basilicum).

    Science.gov (United States)

    Strazzer, Pamela; Guzzo, Flavia; Levi, Marisa

    2011-02-15

    A red basil cell line (T2b) rich in rosmarinic acid (RA) was selected for the stable production of anthocyanins (ACs) in the dark. Cell suspension cultures were subjected to mechanical stress through increased agitation (switch from 90 to 150 rpm) to determine the relationship between AC and RA accumulation. Cell extracts were analyzed by HPLC and LC-MS, and the resulting data were processed with multivariate statistical analysis. MS and MS/MS spectra facilitated the putative annotation of several complex cyanidin-based ACs, which were esterified with coumaric acid and, in some cases, also with malonic acid. It was also possible to identify various RA-related molecules, some caffeic and coumaric acid derivatives and some flavanones. Mechanical stress increased the total AC and RA contents, but reduced biomass accumulation. Many metabolites were induced by mechanical stress, including RA and some of its derivatives, most ACs, hydroxycinnamic acids and flavonoids, whereas the abundance of some RA dimers was reduced. Although AC and RA share a common early biosynthetic pathway (from phenylalanine to 4-coumaroyl-CoA) and could have similar or overlapping functions providing antioxidant activity against stress-generated reactive oxygen species, there appeared to be no competition between their individual pathways. Copyright © 2010 Elsevier GmbH. All rights reserved.

  2. Basil conservation affected by cropping season, harvest time and storage period Armazenamento e conservação de manjericão após diferentes épocas e horários de colheita

    Directory of Open Access Journals (Sweden)

    Franceli da Silva

    2005-04-01

    Full Text Available Fresh basil (Ocimum basilicum L. is used in food, phytotherapic industry, and in traditional therapeutic, due to its essential oil content and composition. Nevertheless basil can not be kept for long periods after harvest and its quality can be reduced. This work aimed to assess the influence of the season and harvest time in the postharvest conservation of basil stored for different periods. Basil was harvested at 8 am and 4 pm both in August/1999 and January/2000. Cuttings were conditioned in PVC packages and stored for 3, 6, and 9 days. During storage, chlorophyll content, essential oil content and composition were determined as well as microbiological analyses were carried out. Harvest season and the days of storage influenced the final content of essential oil. There was a linear decrease in the content of essential oil, in the chlorophyll content and in the number of mold and yeast colonies during storage. There was no effect of cropping season or harvest hour on essential oil composition, but the eugenol and linalool content increased during storage. Coliforms were under 0.3 MPN g-1 and the number of Staphylococcus aureus was under 1.0x10² UFC g-1.O manjericão (Ocimum basilicum L. é empregado tanto na indústria culinária quanto fitoterápica e na medicina tradicional, devido ao teor e composição de seu óleo essencial. No entanto, o manjericão não pode ser conservado por longo período após a colheita e sua qualidade pode ser prejudicada. O objetivo deste trabalho foi verificar a influência da época e do horário de colheita sobre a conservação de manjericão armazenado por diferentes períodos. O manjericão foi colhido às 8h e às 16h em agosto/1999 e em janeiro/2000. Os ramos foram acondicionados em filmes de PVC e armazenados por 3, 6 e 9 dias. Durante o armazenamento, o teor de clorofila, e o teor e a composição do óleo essencial foram determinados e foram conduzidas análises microbiológicas. A época de colheita

  3. Anderson, Prof. Basil Williams

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1964 Honorary. Anderson, Prof. Basil Williams. Date of birth: 3 July 1901. Date of death: 24 February 1984. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held ...

  4. Survival of pathogenic Escherichia coli on basil, lettuce, and spinach

    Science.gov (United States)

    The contamination of lettuce, spinach and basil with pathogenic E. coli has caused numerous illnesses over the past decade. E. coli O157:H7, E. coli O104:H4 and avian pathogenic E. coli (APECstx- and APECstx+) were inoculated on basil plants and in promix soiless substrate using drip and overhead ir...

  5. "??sa ??? ? ????s?? ?? ?µ??? ??et?? ?st?? ?pa????": Greek Poetry and "Paideia" in the Homiletic Tradition of Basil

    Science.gov (United States)

    Klitenic Wear, Sarah

    2018-01-01

    Based on a reading of Basil's "Ad Adulescentes" and the epistles, it is clear that Basil finds moral value in Homer and Hesiod. The trickier issue is to what extent Basil uses Homer and Hesiod in his homilies. It seems that Basil does not abandon his respect for the utility of Hellenic "paideia" for the Christian in his…

  6. A Modified Technique of Basilic Vein Transposition for Haemodialysis

    International Nuclear Information System (INIS)

    Chaudhary, F. A.; Parvez, Z.

    2014-01-01

    Objective: To modify the technique of basilic vein transposition for vascular accesss for haemodialysis aiming at better maturation rate, longer survival of fistula and lesser complications. Study Design: Case series. Place and Duration of Study: Shaikh Zayed Hospital and Omer Hospital, Lahore, from February 2008 to July 2011. Methodology: Patients referred for basilic vein transposition for haemodialysis vascular access were prospectively enrolled. The surgical technique included small tracking incisions, an extra 3 - 4 cm of vein length harvesting to avoid tension in the vein in its new course, an oval arteriotomy and a smooth curved pathway, away from vein harvesting incision to avoid entrapment of vein in the scar. Maturation rate, fistula survival and other complications were noted. Results: There was no immediate failure in 51 patients. The complications during follow-up period were infection and thrombosis, bleeding and non-development of basilic vein in 2 patients each; and false aneurysm formation in one. Four patients died during follow-up period. The maturation time was 4.9 A +- 1.1 weeks. The early patency rate was 92.2%, same at 6 months and 90.7% at 12 months. Conclusion: Arteriovenous fistula constructed with modified technique of basilic vein transposition is an acceptable and valid option of vascular access for haemodialysis. (author)

  7. Inflorescence and leaves essential oil composition of hydroponically grown Ocimum basilicum L

    Directory of Open Access Journals (Sweden)

    MOHAMMAD BAGHER HASSANPOURAGHDAM

    2010-10-01

    Full Text Available In order to characterize the essential oils of leaves and inflorescences, water distilled volatile oils of hydroponically grown Ocimum basilicum L. were analyzed by GC/EI-MS. Fifty components were identified in the inflorescence and leaf essential oils of the basil plants, accounting for 98.8 and 99.9 % of the total quantified components respectively. Phenylpropanoids (37.7 % for the inflorescence vs. 58.3 % for the leaves were the predominant class of oil constituents, followed by sesquiterpenes (33.3 vs. 19.4 % and monoterpenes (27.7 vs. 22.1 %. Of the monoterpenoid compounds, oxygenated monoterpenes (25.2 vs. 18.9 % were the main subclass. Sesquiterpene hydrocarbons (25 vs. 15.9 % were the main subclass of sesquiterpenoidal compounds. Methyl chavicol, a phenylpropane derivative, (37.2 vs. 56.7 % was the principle component of both organ oils, with up to 38 and 57 % of the total identified components of the inflorescence and leaf essential oils, respectively. Linalool (21.1 vs. 13.1 % was the second common major component followed by α-cadinol (6.1 vs. 3 %, germacrene D (6.1 vs. 2.7 % and 1,8-cineole (2.4 vs. 3.5 %. There were significant quantitative but very small qualitative differences between the two oils. In total, considering the previous reports, it seems that essential oil composition of hydroponically grown O. basilicum L. had volatile constituents comparable with field grown counterparts, probably with potential applicability in the pharmaceutical and food industries.

  8. Effects of irradiation in medicinal and eatable herbs

    International Nuclear Information System (INIS)

    Koseki, Paula M.; Villavicencio, A.L.C.H.; Brito, M.S.; Nahme, Ligia C.; Sebastiao, K.I.Katia I.; Rela, Paulo R.; Almeida-Muradian, Ligia B.; Mancini-Filho, Jorge; Freitas, Paulo C.D.

    2002-01-01

    For ages, herbs have been used as medicine and food. Nowadays, the interest in phytotherapeutics is increasing as well as the consumer attention. Some biochemical compounds synthesized by plants as alkaloids, phenolics, flavonoids, essential oils, tannins and vitamins, influence the composition of these plant pharmacologicals, which may produce various reactions in the human body. The microbial contamination in these raw plant materials is common, and the radiation processing is one appropriate technique for the reduction of microorganism. In herbs used as food products, the changes in total β-carotene and flavonoids upon the radiation treatment were tested. The powdered and dehydrated herbs were irradiated with 60 Co gamma rays applying doses of 0, 10, 20 and 30 kGy. The botanical species investigated were rosemary (Rosmarinus officinalis Linne), watercress (Nasturtium officinale R. Br), artichoke (Cynara scolymus Linne) and sweet basil (Ocimum basilicum Linne). The alterations in the active principles in the herbs following increasing doses of radiation were analyzed employing various methods of extraction and chromatography

  9. Effects of irradiation in medicinal and eatable herbs

    Energy Technology Data Exchange (ETDEWEB)

    Koseki, Paula M; Villavicencio, A L.C.H.; Brito, M S; Nahme, Ligia C; Sebastiao, K.I.Katia I.; Rela, Paulo R; Almeida-Muradian, Ligia B; Mancini-Filho, Jorge; Freitas, Paulo C D

    2002-03-01

    For ages, herbs have been used as medicine and food. Nowadays, the interest in phytotherapeutics is increasing as well as the consumer attention. Some biochemical compounds synthesized by plants as alkaloids, phenolics, flavonoids, essential oils, tannins and vitamins, influence the composition of these plant pharmacologicals, which may produce various reactions in the human body. The microbial contamination in these raw plant materials is common, and the radiation processing is one appropriate technique for the reduction of microorganism. In herbs used as food products, the changes in total {beta}-carotene and flavonoids upon the radiation treatment were tested. The powdered and dehydrated herbs were irradiated with {sup 60}Co gamma rays applying doses of 0, 10, 20 and 30 kGy. The botanical species investigated were rosemary (Rosmarinus officinalis Linne), watercress (Nasturtium officinale R. Br), artichoke (Cynara scolymus Linne) and sweet basil (Ocimum basilicum Linne). The alterations in the active principles in the herbs following increasing doses of radiation were analyzed employing various methods of extraction and chromatography.

  10. Chemical Composition and Antifungal Activity of Ocimum basilicum L. Essential Oil

    Directory of Open Access Journals (Sweden)

    Neveen Helmy Abou El-Soud

    2015-07-01

    Full Text Available BACKGROUND: The leaves of Ocimum basilicum L. (basil are used in traditional cuisine as spices; its essential oil has found a wide application in perfumery, dental products as well as antifungal agents. AIM: To assess the chemical composition as well as the in vitro antifungal activity of O. basilicum L. essential oil against Aspergillus flavus fungal growth and aflatoxin B1 production. MATERIAL AND METHODS: The essential oil of O. basilicum was obtained by hydrodistillation and analysed using gas chromatography (GC and GC coupled with mass spectrometry (GC/MS. The essential oil was tested for its effects on Aspergillus flavus (A. flavus mycelial growth and aflatoxin B1 production in Yeast Extract Sucrose (YES growth media. Aflatoxin B1 production was determined by high performance liquid chromatography (HPLC. RESULTS: Nineteen compounds, representing 96.7% of the total oil were identified. The main components were as follows: linalool (48.4%, 1,8-cineol (12.2%, eugenol (6.6%, methyl cinnamate (6.2%, α-cubebene (5.7%, caryophyllene (2.5%, β-ocimene (2.1% and α-farnesene (2.0%.The tested oil showed significant antifungal activity that was dependent on the used oil concentration. The complete inhibition of A. flavus growth was observed at 1000 ppm oil concentration, while marked inhibition of aflatoxin B1 production was observed at all oil concentrations tested (500, 750 and 1000 ppm. CONCLUSION: These results confirm the antifungal activities of O. basilicum L. oil and its potential use to cure mycotic infections and act as pharmaceutical preservative against A. flavus growth and aflatoxin B1 production.

  11. Germination and vigor of clove basil seeds (Ocimum gratissimum L. submitted to accelerated aging/ Germinação e vigor de sementes de alfavaca-cravo (Ocimum gratissimum L. submetidas ao envelhecimento acelerado

    Directory of Open Access Journals (Sweden)

    Nair Mieko Takaki Bellettini

    2006-06-01

    Full Text Available The present work had as objective to verify the effect of treatment with fungicide on the germination and vigor of four lots of clove basil seeds, submitted to the traditional aging and with saturated salt solution, for periods of 36, 48, 60 and 72 hours, at 42ºC. After these periods, the seeds were evaluated by the germination test, using the first count of the number of normal seedlings as vigor indicative. The vigor and the germination of the seeds decreased as increased the time of aging. In the use of saturated salt solution, the seeds water content was lower and more uniform. The fungicide treatment increased the percentage average of germination, without provoking significant modifications in the contrasts among the lots. The periods of 36 and 48 hours were efficient in evaluating of the physiologic quality of the clove basil seeds.O presente trabalho teve como objetivo verificar o efeito do período de exposição, tipos de solução e tratamento com fungicida sobre a germinação e o vigor de quatro lotes de sementes de alfavaca-cravo, submetidas ao teste de envelhecimento acelerado tradicional e com uso de solução saturada de NaCl, por períodos de 36, 48, 60 e 72 horas na temperatura de 42ºC. Após estes períodos, as sementes foram avaliadas pelo teste de germinação, utilizando-se a primeira contagem do teste de germinação como indicativo de vigor. Tanto o vigor quanto a germinação das sementes analisadas, diminuíram conforme se aumentou o tempo de envelhecimento. Na utilização de solução salina, o teor e a variabilidade de água das sementes foram menores. O tratamento fungicida aumentou a média percentual de germinação, mas não provocou modificações acentuadas nos contrastes entre os lotes. Os períodos de 36 e 48 horas foram eficientes na avaliação da qualidade fisiológica das sementes de alfavaca-cravo.

  12. Research Paper ISSN 0189-6016©2008

    African Journals Online (AJOL)

    AJTCAM

    inflammatory, antitumor and antioxidant properties (Sharada et al., 1996; Bhattacharya et al., ... Withaferin-A (WA) was extracted and isolated from commercially available Withania somnifera root ..... Chemomodulatory efficacy of Basil leaf (Ocimum ... In vitro human phase I metabolism of xenobiotics I: pesticides and related.

  13. Antifungal Activities of Some Leaf Extracts on Seed-borne Fungi of ...

    African Journals Online (AJOL)

    The efficacy of leaf extracts of basil (Ocimum basilicum), bitter leaf (Vernonia amygdalina), lemon grass (Cymbopogen citratus), neem (Azadirachta indica) and paw-paw (Carica papaya) on major seed-borne fungi: Aspergillus niger, Aspergillus flavus, Botryodiplodia theobromae and Fusarium moniliforme of African yam ...

  14. Starch accumulation during hydroponic growth of spinach and basil plants under carbon dioxide enrichment

    Energy Technology Data Exchange (ETDEWEB)

    Holbrook, G P; Hansen, J; Wallick, K; Zinnen, T M [North Illinois University, de Kalb, IL (USA). Dept. of Biological Sciences

    1993-04-01

    The effects of CO[sub 2] enrichment, photoperiod duration, and inorganic phosphate levels on growth and starch accumulaton by spinach and basil plants were studied in a commercial hydroponic facility. During a 3-week growth period, both species exhibited increased whole-plant fresh weight as a result of an increase in atmospheric CO[sub 2] concentration from 400 to 1500 mul/1. However, basil leaves exhibited a 1.5- to 2-fold greater increase in specific leaf weight (SLW), and accumulated starch to much greater levels than did leaves of spinach. At 1500 mul CO[sub 2]/1, starch accounted for up to 38% of SLW with basil compared to [lt] 10% of SLW with spinach. The maximum ratio of starch/chlorophyll was 55.0 in basil leaves vs 8.0 in spinach leaves. High ratio values were associated with the appearance of chlorotic symptoms in leaves of basil grown under CO[sub 2] enrichment, whereas spinach did not exhibit chlorosis. Increasing inorganic phosphate concentrations from 0.7 to 1.8 mM in the hydroponic medium did not appreciably affect leaf starch accumulation in either species. Starch accumulation in basil leaves was not consistently related to the duration of the photoperiod. However, photoperiod-induced changes in leaf starch levels were much greater in basil than spinach. The results clearly indicate that different horticultural crops can show diverse responses to CO[sub 2] enrichment, and thus highlight the need to develop individual growth strategies to optimize production quality of each species.

  15. Imunno-modulatory effect of Ocimum sanctum against endosulfan induced immunotoxicity in Wistar Rat

    Directory of Open Access Journals (Sweden)

    Bharath B.K.

    2011-02-01

    Full Text Available The present experiment was designed to make a systematic study of experimentally induced immunotoxicity of endosulfan and its amelioration with Ocimum sanctum in male Wistar rats at 6, 3 and 1.5 mg / Kg b.wt to groups II, III and IV by mixing in ground nut oil for 6 weeks. To the groups V, VI and VII in addition to endosulfan as above mentioned dose, Ocimum sanctum was given at 200 mg / kg b.wt daily per orally for the same duration to study immuno modulatory effect. Group I served as oil control and Group VIII as Ocimum sanctum control. Significant reduction in the both HA titer and DNCB contact sensitivity score was observed in the endosulfan treated groups indicates endosulfan has immunotoxic effect. But significant improvement in the immunity was observed in the Ocimum sanctum treated groups indicates the immuno modulatory property. [Veterinary World 2011; 4(1.000: 25-27

  16. Radiosensitization of Aspergillus niger and Penicillium chrysogenum using basil essential oil and ionizing radiation for food decontamination.

    Science.gov (United States)

    The Minimum Inhibitory Concentration (MIC) of basil oil, was determined for two pathogenic fungi of rice, Aspergillus niger and Penicillium chrysogenum. The antifungal activity of the basil oil in combination with ionising radiation was then investigated to determine if basil oil caused radiosensit...

  17. Effects of Foliar Application of Nano Zinc Chelate and Zinc Sulfate on Zinc Content, Pigments and Photosynthetic Indices of Holy Basil (Ocimum sanctum(

    Directory of Open Access Journals (Sweden)

    Zohreh Moghimi pour

    2017-02-01

    Full Text Available Introduction: Holy basil is a perennial plant belongs to Lamiaceae family. The plant is a perennial and thrives well in the hot and humid climate. Its aerial parts have been in use for food, pharmaceuticals, cosmetics and perfumery industries. Leaves contain 0.5-1.5% essential oil and main oil components are eugenol, methyl eugenol, carvacrol, methyl chavicol and1,8-cineole. A balanced fertilization program with macro and micronutrients is very important in producing high quality yield. Zinc is involved in IAA production, chlorophyll biosynthesis, carbon assimilation, saccharids accumulation, reactive oxygen radicals scavenging and finally carbon utilization in volatile oil biosynthesis. Material and methods: In order to evaluate the effect on zinc foliar application on zinc content of leaves, photosynthetic indices and pigments of holy basil, an experiment was carried out in 2013 at a research farm of Horticultural Science, Shahid Chamran University (31°20'N latitude and 48°40'E longitude and 22.5 m mean sea level, Ahvaz (Iran, a region characterized by semi-dry climate. The experiment was arranged based on Randomized Complete Block Design (RCBD with six treatments and three replications. The treatments were nano zinc chelate (0, 0.5, 1 and 1.5 g.l-1 and zinc sulfate (1 and 1.5 g.l-1 fertilizers. Land preparation includes disking and the formation of raising beds (15cm high and 45cm wide across the top using a press-pan-type bed shaper. Holy basil seeds were sown on two rows on each bed, with 15 cm in-row and 40 cm between-row spacing. The plants were irrigated weekly as needed. Foliar application of zinc fertilizers was done at six-eight leaf stage and were repeated with interval 15 days until full bloom stage. Zinc content, stomata conductance (gs, CO2 under stomata (Ci, transpiration rate (E, net photosynthesis (Pn, light use efficiency (LUE, water use efficiency (WUE and also chlorophyll a, chlorophyll b, chlorophyll a+b and carotenoid

  18. In vitro inhibition of the bovine viral diarrhoea virus by the essential oil of Ocimum basilicum (basil) and monoterpenes.

    Science.gov (United States)

    Kubiça, Thaís F; Alves, Sydney H; Weiblen, Rudi; Lovato, Luciane T

    2014-01-01

    The bovine viral diarrhoea virus (BVDV) is suggested as a model for antiviral studies of the hepatitis C virus (HCV). The antiviral activity of the essential oil of Ocimum basilicum and the monoterpenes camphor, thymol and 1,8-cineole against BVDV was investigated. The cytotoxicities of the compounds were measured by the MTT (3-(4.5-dimethylthiazol-2-yl)-2.5-diphenyltetrazolium bromide) test, and the antiviral activities were tested by the plaque reduction assay. The oil or compounds were added to the assay in three different time points: a) pre-treatment of the virus (virucidal assay); b) pre-treatment of the cells; or c) post-treatment of the cells (after virus inoculation). The percentage of plaques inhibition for each compound was determined based on the number of plaques in the viral control. The results were expressed by CC50 (50% cytotoxic concentration), IC50 (inhibitory concentration for 50% of plaques) and SI (selectivity index = CC50/IC50). Camphor (CC50 = 4420.12 μg mL(-1)) and 1,8-cineole (CC50 = 2996.10 μg mL(-1)) showed the lowest cytotoxicities and the best antiviral activities (camphor SI = 13.88 and 1,8-cineol SI = 9.05) in the virucidal assay. The higher activities achieved by the monoterpenes in the virucidal assay suggest that these compounds act directly on the viral particle.

  19. Microbiological Status and Food Safety Compliance of Commercial Basil Production Systems.

    Science.gov (United States)

    de Bruin, Willeke; Otto, Denise; Korsten, Lise

    2016-01-01

    Basil has been implicated in a number of microbe-associated foodborne illnesses across the world, and the source of contamination has often been traced back to the production and/or processing stages of the supply chain. The aim of this study was to evaluate the microbiological quality of fresh basil from the point of production to the retail outlet in the Gauteng and Northwest Provinces of South Africa. A total of 463 samples were collected over a 3-month period from two large-scale commercial herb producing and processing companies and three retail outlets. The microbiological quality of the samples was assessed based on the presence or absence of Escherichia coli O157:H7 and Salmonella Typhimurium and the levels of the indicator bacteria E. coli and total coliforms. Salmonella Typhimurium was detected on four basil samples (0.9%) arriving at the processing facility and at dispatch, but no E. coli O157:H7 was detected throughout the study. Total coliform counts were 0.4 to 4.1 CFU/g for basil, 1.9 to 3.4 log CFU/ml for water, and 0.2 to 1.7 log CFU/cm(2) for contact surfaces, whereas E. coli was detected in the water samples and only once on basil. The Colilert-18 and membrane filter methods were used to analyze water samples, and a comparison of results revealed that the Colilert-18 method was more sensitive. Strong evidence suggests that high numbers of coliforms do not necessarily indicate the presence of Salmonella Typhimurium. The study results highlight the importance of effective implementation of food safety management systems in the fresh produce industry.

  20. ANXIOLYTIC ACTIVITY OF OCIMUM SANCTUM LEAF EXTRACT

    OpenAIRE

    Chattopadhyay, R.R.

    1994-01-01

    The anxiolytic activity of Ocimum sanctum leaf extract was studied in mice. O.sanctum leaf extract produced significant anxiolytic activity in plus – maze and open field behaviour test models. The effect was compared with diazepam, a standard antianxiety drug.

  1. Author Details

    African Journals Online (AJOL)

    Herb yield and chemical composition of basil (Ocimum basilicum L) essential oil in relation to the different harvest period and cultivation conditions. Abstract PDF · Vol 13, No 2 (2016) - Articles Relationship between total phenolic, total flavonoid and oleuropein in different aged olive (Olea europaea l.) Cultivar leaves

  2. Germination and accelerated aging in the analysis of the physiological quality of seeds of wild basilGerminação e envelhecimento acelerado na análise da qualidade fisiológica de sementes de alfavaca-cravo

    Directory of Open Access Journals (Sweden)

    Natália de Almeida Batista

    2011-08-01

    Full Text Available The study aimed to contribute to establish parameters for analyzing the physiological quality of seed-clove basil (Ocimum gratissimum L., since the species is not among those described in the Rules for Testing Seeds. Seeds of basil, clove, gathered on the campus of UENP-CLM, Bandeirantes, PR, analyzed for water content, germination, accelerated aging water and saline tetrazolium and seedling emergence. The temperature of 30 ° C for the germination test and the sand substrate for the emergence test are conditions and procedures for evaluating the physiological quality of seeds of O. gratissimum. The aging test, regardless of the type of solution used, the test is correlated with seedling emergence in soil. The low germination and seed viability of O. gratissimum occurring due to deterioration and lack of internal tissue.O estudo teve como propósito contribuir para o estabelecimento de parâmetros para análise da qualidade fisiológica de sementes de alfavaca-cravo (Ocimum gratissimum L., uma vez que a referida espécie não se encontra entre as descritas nas Regras para Análise de Sementes. Foram utilizadas sementes de alfavaca-cravo, colhidas no Campus da UENP-CLM, Bandeirantes-PR, submetidas a análises de teor de água, germinação, envelhecimento acelerado com água e solução salina, tetrazólio e emergência de plântulas. A temperatura de 30 ºC para o teste de germinação e o substrato areia para o teste de emergência de plântulas são condições e procedimentos apropriados para avaliação da qualidade fisiológica de sementes de O. gratissimum. O teste de envelhecimento, independente do tipo de solução utilizada, apresenta correlação com o teste de emergência de plântulas em solo. O baixo potencial germinativo e viabilidade das sementes de O. gratissimum ocorrem em função da deterioração e ausência dos tecidos internos.

  3. Treatment with methanolic extract of Ocimum gratissimum (Linn ...

    African Journals Online (AJOL)

    2017-01-10

    Jan 10, 2017 ... effects can be achieved using a potent antioxidant. Engaging ... experimental evidence on the effects of Ocimum ... animal (Wistar rat) model of drug-induced kidney injury. ...... cyclophosphamide-induced reproductive toxicity.

  4. Teor, rendimento e composição química do óleo essencial de manjericão sob doses de cama de frango Content, yield and chemical composition of the essential basil oil under chicken manure levels

    Directory of Open Access Journals (Sweden)

    José Magno Q Luz

    2009-09-01

    Full Text Available Óleo essencial de manjericão (Ocimum basilicum L. com alta concentração de linalol é valorizado no mercado internacional e amplamente usado nas indústrias de condimentos e cosméticos. Há poucas informações a respeito do cultivo de manjericão e, portanto o presente trabalho teve o objetivo de avaliar o teor, o rendimento e a qualidade de óleo essencial de genótipos de manjericão em função de níveis de adubação orgânica com cama de frango nas condições de inverno sob irrigação. O experimento foi conduzido na Fazenda Experimental do Glória, pertencente à Universidade Federal de Uberlândia. Foram testados cinco níveis de adubação, sendo 2; 4; 6; 8 e 10 kg de cama de frango por m². O delineamento experimental utilizado foi de blocos ao acaso em esquema fatorial 5 x 2, com quatro repetições. Foram semeados os genótipos Manjericão PI 197442-S3 (G1 e Manjericão NSL 6421-S3 (G2. O óleo essencial foi extraído por hidrodestilações com aparelho tipo Clevenger modificado. Avaliou-se a altura da planta; comprimento e largura de folha; relação comprimento/largura (C/L; teor e rendimento de óleo essencial, e teor de linalol no óleo essencial extraído de folhas e inflorescências frescas e secas. As doses de adubo influenciaram significativamente o teor de linalol do óleo essencial destilado a partir de parte aérea fresca e seca dos genótipos 1 e 2. As outras variáveis não apresentaram diferenças significativas.Basil (Ocimum basilicum L., essential oil with high linalool content, is appreciated in the international market and widely used in spice and cosmetics industries. There are few informations available for basil cultivation, and therefore, the aim of this work was to evaluate the content, yield and quality of the essential oil of basil genotypes depending on organic fertilizer levels in the winter and using irrigation. The experiment was carried out in the Universidade Federal de Uberlândia. Five

  5. Chemical composition and antimicrobial activity of essential oils of Ocimum canum Sims. and Ocimum selloi Benth.

    Directory of Open Access Journals (Sweden)

    Jeferson C. Nascimento

    2011-09-01

    Full Text Available This work describes the chemical composition and antimicrobial activity of the volatile oils of Ocimum canum and Ocimum selloi, both occurring in Jequié/BA, northeastern Brazil. The plants were collected in the winter/2005 andsummer/2006, the oils extracted by steam distillation and further analyzed by GC-MS. A total of 30 and 31 compounds was identified from the oils of O. selloi and O. canum, respectively. It was observed that the oil content of O. canum showed variation during the seasons, while the oils of O. selloi did not. Methylchavicol and linalool were the main chemical components found in the aerial parts and leaves of O. canum. This finding permitted to characterize this specimen as a new chemotype of O. canum. Regarding the aerial parts of O. selloi, eugenol, 1,8-cineole, transcaryophyllene and linalool were identified as their major components. All extracted oils from the aerial parts showed biological activity against gram-positive cocci - Staphylococcus aureus ATCC 25923 - but only the O. canum one showed activity against gram-negative bacilli - Escherichia coli ATCC 25922.Este trabalho descreve a composição química e a atividade antimicrobiana dos óleos voláteis de Ocimum canum e Ocimum selloi, que ocorrem em Jequié/BA, nordeste do Brasil. As plantas foram colhidas no inverno de 2005 e verão de 2006 e os óleos extraídos por destilação a vapor foram posteriormente analisados por GC-MS. Um total de 30 e 31 compostos foi identificado a partir dos óleos de O. selloi e O. canum, respectivamente. Foi observado que o teor de óleo de O. canum apresentou variação durante as estações do ano, enquanto o óleo de O. selloi não. Metilchavicol e linalol foram os principais componentes químicos encontrados na parte aérea e folhas de O. canum. Esta descoberta permitiu caracterizar este espécime como um novo quimiotipo de O. canum. Com relação às partes aéreas de O. selloi, eugenol, 1,8-cineol, trans-cariofileno e

  6. Evaluation of Ocimum basilicum L. seed mucilage as rate controlling matrix for sustained release of propranolol HCl

    Directory of Open Access Journals (Sweden)

    Majid Saeedi

    2015-01-01

    Full Text Available Polysaccharide mucilage derived from the seeds of Ocimum basilicum L. (family Lamiaceae was investigated for use in matrix formulations containing propranolol hydrochloride. Basil mucilage was extracted and several tablets were formulated. The effect of mucilage on drug release rate was evaluated in comparison with tablets containing two kinds of hydroxypropyl methylcellulose (HPMC K4M and HPMC K100M as standard polymer. The release data were fitted to several models for kinetic evaluation. The results showed that hardness decreased and friability of tablets increased as the concentration of mucilage increased. The rate of release of propranolol HCl from O. basilicm mucilage matrices was mainly controlled by the drug: mucilage ratio. Drug release was slower from the HPMC K4M and HPMCK100M containing tablets compared to the mucilage containing matrices than the drug release from matrices containing O. basilicum seed mucilage in similar ratios.  Formulations containing O. basilicm mucilage were found to exhibit suitable release pattern. The results of kinetic analysis showed that in tablets containing O. basilicm mucilage the highest correlation coefficient was achieved with the zero order model. The swelling and erosion studies revealed that, as the proportion of mucilage in tablets was increased, there was a corresponding increase in percent swelling and a decrease in percent erosion of tablets.

  7. Selective extraction of high-value phenolic compounds from distillation wastewater of basil (Ocimum basilicum L.) by pressurized liquid extraction.

    Science.gov (United States)

    Pagano, Imma; Sánchez-Camargo, Andrea Del Pilar; Mendiola, Jose Antonio; Campone, Luca; Cifuentes, Alejandro; Rastrelli, Luca; Ibañez, Elena

    2018-01-31

    During the essential oil steam distillation from aromatic herbs, huge amounts of distillation wastewaters (DWWs) are generated. These by-products represent an exceptionally rich source of phenolic compounds such as rosmarinic acid (RA) and caffeic acid (CA). Herein, the alternative use of dried basil DWWs (dDWWs) to perform a selective extraction of RA and CA by pressurized liquid extraction (PLE) employing bio-based solvent was studied. To select the most suitable solvent for PLE, the theoretical modelling of Hansen solubility parameters (HSP) was carried out. This approach allows reducing the list of candidate to two solvents: ethanol and ethyl lactate. Due to the composition of the sample, mixtures of water with those solvents were also tested. An enriched PLE extract in RA (23.90 ± 2.06 mg/g extract) with an extraction efficiency of 75.89 ± 16.03% employing a water-ethanol mixture 25:75 (% v/v) at 50°C was obtained. In the case of CA, a PLE extract with 2.42 ± 0.04 mg/g extract, having an extraction efficiency of 13.86 ± 4.96% using ethanol absolute at 50°C was achieved. DWWs are proposed as new promising sources of natural additives and/or functional ingredients for cosmetic, nutraceutical, and food applications. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  8. Longitudinal evaluation of Ocimum and other plants effects on the feeding behavioral response of mosquitoes (Diptera: Culicidae in the field in Tanzania

    Directory of Open Access Journals (Sweden)

    Tenu Filemoni

    2008-10-01

    Full Text Available Abstract Background The use of repellent materials from plants against nuisance insects is common with great potential to compliment existing malaria control programmes and this requires evaluation in the field. Ocimum plant species, Ocimum suave (Willd and O. kilimandscharicum (Guerke materials and their essential oils extracted by steam distillation were evaluated in the field and experimental huts for repellence, exophily and feeding inhibition effects against three mosquito species, Anopheles arabiensis (Patton, An. gambiae ss (Giles and Culex quinquefasciatus (Say. The protective effect of essential oils from Ocimum plants were compared with N, N-diethly-3- methylbenzamide (DEET, a standard synthetic repellent. Also, the protective effect of fumigation by burning of repellent plants; Ocimum suave, Ocimum kilimandscharicum, Azadirachta indica, Eucalyptus globules and Lantana camara were tested in experimental huts and selected local houses. Results In the field, protection by Ocimum plants from mosquito bites was high and there was small variation among different mosquito species. Protection efficiency was 93.4%, 91.98% and 89.75% for An. arabiensis while for Cx. quinquefaciatus it was 91.30%, 88.65% and 90.50% for DEET, Ocimum suave and O. kilimandscharicum respectively. In the experimental hut, deterrence induced by burning of Ocimum and other plants ranged from 73.1.0% to 81.9% for An. arabiensis and 56.5% to 67.8% for Cx. quinquefaciatus, while feeding inhibition was 61.1% to 100% for An. arabiensis and 50% to 100% for Cx. quinquefaciatus. Evaluations under field conditions confirmed high protective efficacy, enhanced feeding inhibition and house entry inhibition (Deterrence. Conclusion This study shows the potential of Ocimum suave and Ocimum kilimandscharicum crude extracts and whole plants of Ocimum suave, Ocimum kilimandscharicum, Azadirachta indica, Eucalyptus globules and Lantana camara for use in protecting against human biting

  9. Re-Reading and Rehabilitating Basil Bernstein

    Science.gov (United States)

    Bolander, Brook; Watts, Richard J.

    2009-01-01

    This article constitutes a re-reading of and an attempt to rehabilitate Basil Bernstein, both of which are important in light of the interpretation of Bernstein as a proponent of the verbal deficit view, and the general discrediting of his work on social class differences in the British educational system, as related to what he later called…

  10. Comparison ofYield of TwelveBasilCultivarsinTwo Provinces:Isfahan and Mazandaran

    Directory of Open Access Journals (Sweden)

    Nahid Amoli

    2017-12-01

    Full Text Available Introduction: Basil(Ocimumbasilicum L.is a diploid plant with48chromosomes. Basil isthe aromatic annual herbofthe Lamiaceae familyofleafy vegetablesandhas mentionedand originated inIndiaandIran. Basilhasiron, calcium, magnesium, potassiumandvitamins Aand B. More than 60 varietiesof basilhave been identifiedthathavegreenleavesandredto purple.The performance of15varietiesof basilin Mazandaran province were studied, genotypescollected fromSari(darkgreen withthe23.63 tha-1(fresh weight had thehighestyield. In comparison, 38the massbasil, withtwocultivars(Opal andKashkanyLulu, localpopulationsofmanyof the traits(e.g.,length and width ofleavesandfresh and dry weight showed superiority than cultivars. Incomparing the performance of38varietiesof basilinItaly, drymatter yieldper hectarerangedfrom1812 to6165kg ha-1thatthis wasmore attributestobegenetic aspects. Landraces ofbasilhavevaluabletraitssuch asdrought resistance, saltresistance, resistancetodisease, resistancetocoldandheat. In order to achieveoptimalpopulationpurple basil with high-performance inIsfahan andMazandaran, the present studywas conducted usingsomeof the populationinthese two provinces. Materials and Methods: The number of populations of purple basil wasstudied toselect superior genotypes according to the yield and adaptation to climatic conditions in two provinces at Agricultural Research Station Gharahil of Mazandaran and Kabootarabad of Isfahan. The experiment was conducted as a randomized complete block design with three replications with seeds collected from two areas of the province (a total of 12 varieties of basil during one year. Land preparationwas consisted ofplowanddiscperpendicular to each other(for crushinghunk and thenlevelingandplotsofland. Inprovinces, nitrogen, phosphorusandpotassiumfertilizerwas used based on soiltest.In this experiment,harvest time was4st. for every two region. Duringthe growing seasonweed controlwascarried outmechanically. Result and Discussions: In

  11. Role of mycorrhizal fungi and salicylic acid in salinity tolerance of ...

    African Journals Online (AJOL)

    Most researchers showed that inoculation of plants with mycorrhizal fungi and using salicylic acid increase tolerance of plants due to salinity. In this study, the effect of mycorrhizal fungi, including Glomus mosseae, Glomus intraradices, and salicylic acid (0.2 mM) on tolerance of green basil (Ocimum basilicum L.) to salinity ...

  12. Insect repellent activity of medicinal plant oils against Aedes aegypti (Linn.), Anopheles minimus (Theobald) and Culex quinquefasciatus Say based on protection time and biting rate.

    Science.gov (United States)

    Phasomkusolsil, Siriporn; Soonwera, Mayura

    2010-07-01

    This study investigated insect bite protection and length of the protection with 30 repellents which were divided into 3 categories: plant oil, essential oil and essential oil with ethyl alcohol, tested against three mosquito species, Aedes aegypti, Anopheles minimus and Culex quinquefasciatus, under laboratory conditions. The plant oil group was comprised of Phlai (Zingiber cassumunar) and Sweet basil (Ocimum basilicum). Both substances were effective as repellents and feeding deterrents against An. minimus (205 minutes protection time and a biting rate of 0.9%), Cx. quinquefasciatus (165 minutes protection time and 0.9% biting rate) and Ae. aegypti (90 minutes protection time and 0.8% biting rate). Essential oil from citronella grass (Cymbopogon nardus) exhibited protection against biting from all 3 mosquito species: for An. minimus, Cx. quinquefasciatus and Ae. aegypti, the results were 130 minutes and 0.9%, 140 minutes and 0.8%, and 115 minutes and 0.8%, respectively. The period of protection time against Ae. aegypti for all repellent candidates tested was lower than the Thai Industrial Standards Institute (TISI) determined time of greater than 2 hours.

  13. Effects of irradiation in medicinal and eatable herbs

    Science.gov (United States)

    Koseki, Paula M.; Villavicencio, Anna Lúcia C. H.; Brito, Mônica S.; Nahme, Ligia C.; Sebastião, Kátia I.; Rela, Paulo R.; Almeida-Muradian, Ligia B.; Mancini-Filho, Jorge; Freitas, Paulo C. D.

    2002-03-01

    For ages, herbs have been used as medicine and food. Nowadays, the interest in phytotherapeutics is increasing as well as the consumer attention. Some biochemical compounds synthesized by plants as alkaloids, phenolics, flavonoids, essential oils, tannins and vitamins, influence the composition of these plant pharmacologicals, which may produce various reactions in the human body. The microbial contamination in these raw plant materials is common, and the radiation processing is one appropriate technique for the reduction of microorganism. In herbs used as food products, the changes in total β-carotene and flavonoids upon the radiation treatment were tested. The powdered and dehydrated herbs were irradiated with 60Co gamma rays applying doses of 0, 10, 20 and 30 kGy. The botanical species investigated were rosemary ( Rosmarinus officinalis Linné), watercress ( Nasturtium officinale R. Br), artichoke ( Cynara scolymus Linné) and sweet basil ( Ocimum basilicum Linné). The alterations in the active principles in the herbs following increasing doses of radiation were analyzed employing various methods of extraction and chromatography.

  14. Is Sweet Taste Perception Associated with Sweet Food Liking and Intake?

    Science.gov (United States)

    Jayasinghe, Shakeela N; Kruger, Rozanne; Walsh, Daniel C I; Cao, Guojiao; Rivers, Stacey; Richter, Marilize; Breier, Bernhard H

    2017-07-14

    A range of psychophysical taste measurements are used to characterize an individual's sweet taste perception and to assess links between taste perception and dietary intake. The aims of this study were to investigate the relationship between four different psychophysical measurements of sweet taste perception, and to explore which measures of sweet taste perception relate to sweet food intake. Forty-four women aged 20-40 years were recruited for the study. Four measures of sweet taste perception (detection and recognition thresholds, and sweet taste intensity and hedonic liking of suprathreshold concentrations) were assessed using glucose as the tastant. Dietary measurements included a four-day weighed food record, a sweet food-food frequency questionnaire and a sweet beverage liking questionnaire. Glucose detection and recognition thresholds showed no correlation with suprathreshold taste measurements or any dietary intake measurement. Importantly, sweet taste intensity correlated negatively with total energy and carbohydrate (starch, total sugar, fructose, glucose) intakes, frequency of sweet food intake and sweet beverage liking. Furthermore, sweet hedonic liking correlated positively with total energy and carbohydrate (total sugar, fructose, glucose) intakes. The present study shows a clear link between sweet taste intensity and hedonic liking with sweet food liking, and total energy, carbohydrate and sugar intake.

  15. Musca domestica laboratory susceptibility to three ethnobotanical culinary plants.

    Science.gov (United States)

    El Zayyat, Elham A; Soliman, Mohammed I; Elleboudy, Noha A; Ofaa, Shaimaa E

    2015-10-01

    Throughout history, synanthropic Musca domestica had remained a worldwide problem whenever poor sanitation and bad hygienic conditions exists. Houseflies growing resistance to chemical insecticides are a rising environmental problem that necessitates search for alternatives. Mentha cervina, Ocimum basilicum, and Coriandrum sativum were tested for bioactivity on M. domestica adults and larvae. They are culinary Mediterranean plants. In adulticidal bioassay, using both CDC bottles and fumigation techniques, basil was the most effective extract with LC50 1.074 and 34.996 g/L, respectively. Concerning larvicidal bioassay by fumigation technique, coriander had the highest toxicity index with LC50 29.521 g/L. In both dipping and feeding technique, basil had the highest toxicity with LC50 32.643 and 0.749 g/L, respectively. Basil showed the highest toxicity results in four out of the five models tested followed by coriander then mint; this result highlights the potentiality of basil as a green insecticide in management of flies and opens new insight in the industrialization of basil-based fly control products.

  16. Matrix-derived combination effect and risk assessment for estragole from basil-containing plant food supplements (PFS)

    NARCIS (Netherlands)

    Berg, van den S.J.P.L.; Klaus, V.; Alhusainy, W.; Rietjens, I.

    2013-01-01

    Basil-containing plant food supplements (PFS) can contain estragole which can be metabolised into a genotoxic and carcinogenic 1'-sulfoxymetabolite. This study describes the inhibition of sulfotransferase (SULT)-mediated bioactivation of estragole by compounds present in basil-containing PFS.

  17. Metode Cepat Identifikasi Flavonoid dari Daun Ocimum sanctum L. (Selasih

    Directory of Open Access Journals (Sweden)

    Diah Dhianawaty

    2012-03-01

    Full Text Available A plant’s effectiveness as a herbal drug comes from its chemical content such as flavonoids. Flavonoids are useful for human body health. Therefore flavonoids content can be used as a marker from the usefulness of a plant, and rapid identification method of flavonoid is needed. The objective of the research was to get a rapid method of flavonoid content identification from Ocimum sanctum. The extraction, isolation and identification of flavonoids from Ocimum sanctum leaves has been done at Medical Chemistry laboratory Faculty of Medicine Universitas Padjadjaran in 2005. Flavonoids were extracted continually by 95% ethanol, were isolated with paper chromatography/cellulose TLC and 2% acetic acid, then continued with elucidation reagents: n-butanol–acetic acid–water, chloroform–acetic acid–water, forestall, 5%, 15%, 35% and 50% acetic acids. Flavonoids were identified with diagnostic reagents and ultraviolet light. Isolation with 2% and 35% acetic acids respectively gave two spots of flavonoids as flavon, FOAc-1 had Rf=0.69 and FOAc-2 had Rf=0.57. The other elucidation reagents gave one spot of flavonoid. In conclusion, isolation with 2% and 35% acetic acids respectively and identification with diagnostic reagent and ultraviolet light is a rapid method for identification of flavonoids content in Ocimum sanctum

  18. In Vitro Anti-Cariogenic Plaque Effects of Essential Oils Extracted from Culinary Herbs.

    Science.gov (United States)

    Wiwattanarattanabut, Kornsit; Choonharuangdej, Suwan; Srithavaj, Theerathavaj

    2017-09-01

    Cariogenic bacteria including mutans streptococci and lactobacilli are partly but significantly involved in dental caries development. An effective prevention strategy against dental caries is to decrease the accumulation of this microbiota either in planktonic or in biofilm form. To examine the antimicrobial and anti-plaque effects of some culinary herbs (spices), so the herbs are plausibly used as alternative and effective herbal plaque control supplements to promote good oral health. Essential oils extracted from sweet basil (Ocimum basilicum) , cinnamon bark (Cinnamomum zeylanicum) , sweet fennel (Foeniculum vulgare) , kaffir lime (Citrus hystrix) , black pepper (Piper nigrum) , peppermint (Mentha piperita) , and spearmint (Mentha spicata) were primarily examined for their antimicrobial activities against the cariogenic bacteria (Streptococcus mutans KPSK2 and Lactobacillus casei) using the agar disk diffusion and broth microdilution methods, respectively. These essential oils were then analysed for anti-plaque effects (retardation of S. mutans biofilm formation and reduction of the in vitro established biofilm). This experimental study was performed at the Department of Oral Microbiology, Faculty of Dentistry, Mahidol University during June 2015 till August 2016. All selected essential oils showed different degrees of antimicrobial activity against the planktonic form of both cariogenic bacteria. Cinnamon bark essential oil expressed the strongest inhibitory effect against S. mutans {MIC of 0.08% (v/v)} and L. casei {MIC of 0.16% (v/v)}, whereas the weakest effect was found in kaffir lime essential oil {MIC values of 2.5% and 5.0% (v/v) for S. mutans and L. casei , respectively}. Up to 80% of S. mutans biofilm was retarded to form on the substratum primed with these spice essential oils, especially cinnamon oil. The preventive effect of these oils was in dose- and exposure time-dependent manners. For reductive effect against the 24-hour pre-established S

  19. An efficient system for in vitro multiplication of Ocimum basilicum ...

    African Journals Online (AJOL)

    Yomi

    2012-03-15

    Mar 15, 2012 ... Key words: Axillary shoot sprouting, L-glutamine, medicinal plant, micropropagation, Ocimum basilicum. INTRODUCTION ... different combinations and concentrations in 25 × 145 mm glass .... Glossary of Indian Medicinal.

  20. Characterization of the Bacterial Community Naturally Present on Commercially Grown Basil Leaves: Evaluation of Sample Preparation Prior to Culture-Independent Techniques

    Directory of Open Access Journals (Sweden)

    Siele Ceuppens

    2015-08-01

    Full Text Available Fresh herbs such as basil constitute an important food commodity worldwide. Basil provides considerable culinary and health benefits, but has also been implicated in foodborne illnesses. The naturally occurring bacterial community on basil leaves is currently unknown, so the epiphytic bacterial community was investigated using the culture-independent techniques denaturing gradient gel electrophoresis (DGGE and next-generation sequencing (NGS. Sample preparation had a major influence on the results from DGGE and NGS: Novosphingobium was the dominant genus for three different basil batches obtained by maceration of basil leaves, while washing of the leaves yielded lower numbers but more variable dominant bacterial genera including Klebsiella, Pantoea, Flavobacterium, Sphingobacterium and Pseudomonas. During storage of basil, bacterial growth and shifts in the bacterial community were observed with DGGE and NGS. Spoilage was not associated with specific bacterial groups and presumably caused by physiological tissue deterioration and visual defects, rather than by bacterial growth.

  1. Enrichment, development, and assessment of Indian basil oil based antiseptic cream formulation utilizing hydrophilic-lipophilic balance approach.

    Science.gov (United States)

    Yadav, Narayan Prasad; Meher, Jaya Gopal; Pandey, Neelam; Luqman, Suaib; Yadav, Kuldeep Singh; Chanda, Debabrata

    2013-01-01

    The present work was aimed to develop an antiseptic cream formulation of Indian basil oil utilizing hydrophilic-lipophilic balance approach. In order to determine the required-hydrophilic lipophilic balance (rHLB) of basil oil, emulsions of basil oil were prepared by phase inversion temperature technique using water, Tween 80, and Span 80. Formulated emulsions were assessed for creaming (BE9; 9.8, BE10; 10.2), droplet size (BE18; 3.22 ± 0.09 μ m), and turbidity (BE18; 86.12 ± 2.1%). To ensure correctness of the applied methodology, rHLB of light liquid paraffin was also determined. After rHLB determination, basil oil creams were prepared with two different combinations of surfactants, namely, GMS : Tween 80 (1 : 3.45) and SLS : GMS (1 : 3.68), and evaluated for in vitro antimicrobial activity, skin irritation test, viscosity and consistency. The rHLB of basil oil and light liquid paraffin were found to be 13.36 ± 0.36 and 11.5 ± 0.35, respectively. Viscosity, and consistency parameters of cream was found to be consistent over 90 days. Cream formulations showed net zone of growth inhibition in the range of 5.0-11.3 mm against bacteria and 4.3-7.6 mm against fungi. Primary irritation index was found to be between 0.38 and1.05. Conclusively stable, consistent, non-irritant, enriched antiseptic basil oil cream formulations were developed utilizing HLB approach.

  2. Wound healing properties of ointment formulations of Ocimum ...

    African Journals Online (AJOL)

    present work evaluated the phyto-constituents and wound healing properties of ointments formulated with the n-hexane crude bark extract of a plant used folklorically in wound healing, Ocimum gratissimum. The excision wound model was employed in the wound healing studies. The air-dried, size-reduced barks were ...

  3. Quantitative and Qualitative Analysis of Phenolic and Flavonoid Content in Moringa oleifera Lam and Ocimum tenuiflorum L.

    Science.gov (United States)

    Sankhalkar, Sangeeta; Vernekar, Vrunda

    2016-01-01

    Number of secondary compounds is produced by plants as natural antioxidants. Moringa oleifera Lam. and Ocimum tenuiflorum L. are known for their wide applications in food and pharmaceutical industry. To compare phenolic and flavonoid content in M. oleifera Lam and O. tenuiflorum L. by quantitative and qualitative analysis. Phenolic and flavonoid content were studied spectrophotometrically and by paper chromatography in M. oleifera Lam. and O. tenuiflorum L. Higher phenolic and flavonoid content were observed in Moringa leaf and flower. Ocimum flower showed higher phenolic content and low flavonoid in comparison to Moringa. Flavonoids such as biflavonyl, flavones, glycosylflavones, and kaempferol were identified by paper chromatography. Phytochemical analysis for flavonoid, tannins, saponins, alkaloids, reducing sugars, and anthraquinones were tested positive for Moringa and Ocimum leaf as well as flower. In the present study higher phenolic and flavonoid content, indicated the natural antioxidant nature of Moringa and Ocimum signifying their medicinal importance. Moringa oleifera Lam. and Ocimum tenuiflorum L. are widly grown in India and are known for their medicinal properties. Number of secondary metabolites like phenolics and flavonoids are known to be present in both the plants. The present study was conducted with an objective to qualitatively and quantitatively compare the phenolics and flavanoids in these two medicinally important plants.Quantitation of total phenolics and flavanoids was done by spectrophotometrically while qualitative analysis was perfomed by paper chromatography and by phytochemical tests. Our results have shown higher phenolics and flavanoid content in Moringa leaf and flower. However, higher phenolic content was absent in Ocimum flower compared to that of Moringa. Phytochemical analysis of various metabolites such as flavonoids, tanins, sapponins, alkaloids, anthraquinones revealed that both the plant extracts were rich sources of

  4. VOLATILE LEAF OIL CONSTITUENTS OF OCIMUM AMERICANUM ...

    African Journals Online (AJOL)

    Steam distilled volatile oils from the leaves of Ocimum americanum L. growing in Western Kenya were analysed by GC and GC-MS. A total of 36 compounds, representing a total of 88.51% of the total oil, were identified. The oil was classified as terpinen-4-ol-type according to the terpinen-4-ol content (43.21%). To the best ...

  5. Radio protectors from Thai edible plants

    International Nuclear Information System (INIS)

    Thongphasuk, Jarunee; Thongphasuk, Piyanuch

    2005-11-01

    Antioxidants have been used as radioprotectors in cosmetics and radiation therapy to protect normal tissues in cancer patients. The objective of this study is to determine the activities of antioxidants in Thai edible plants (holy basil, sesame (white and black). durian (Chanee and Monthong), parsley, morning glory, guava, chilies, pepper, sweet pepper, ash pumpkin, pumpkin, tomato, peppermint, and sweet basil) by using I, I-diphenyl-2-picryl-hydrazyl radical and to determine their capability to inhibit radiation-induced hemolysis. Gamma rays (10 KGy) from cobalt-60 was used to induce hemolysis of human red blood cells, and ascorbic acid was used as standard antioxidant. The extracts from all samples showed antioxidant activities. However, only the extracts (0.1-1,000 μg/8 x 10 9 red blood cells) from parsley, guava, peppermint, and sweet basil could significantly inhibit (p<0.05) radiation-induced hemolysis. Although ascorbic acid is a strong antioxidant, its ability to inhibit radiation-induced hemolysis was lower than the extracts. This maybe due to its hydrophilic property which limits its ability to penetrate cell membrane

  6. Unravelling the genome of Holy basil: an "incomparable" "elixir of life" of traditional Indian medicine.

    Science.gov (United States)

    Rastogi, Shubhra; Kalra, Alok; Gupta, Vikrant; Khan, Feroz; Lal, Raj Kishori; Tripathi, Anil Kumar; Parameswaran, Sriram; Gopalakrishnan, Chellappa; Ramaswamy, Gopalakrishna; Shasany, Ajit Kumar

    2015-05-28

    Ocimum sanctum L. (O. tenuiflorum) family-Lamiaceae is an important component of Indian tradition of medicine as well as culture around the world, and hence is known as "Holy basil" in India. This plant is mentioned in the ancient texts of Ayurveda as an "elixir of life" (life saving) herb and worshipped for over 3000 years due to its healing properties. Although used in various ailments, validation of molecules for differential activities is yet to be fully analyzed, as about 80 % of the patents on this plant are on extracts or the plant parts, and mainly focussed on essential oil components. With a view to understand the full metabolic potential of this plant whole nuclear and chloroplast genomes were sequenced for the first time combining the sequence data from 4 libraries and three NGS platforms. The saturated draft assembly of the genome was about 386 Mb, along with the plastid genome of 142,245 bp, turning out to be the smallest in Lamiaceae. In addition to SSR markers, 136 proteins were identified as homologous to five important plant genomes. Pathway analysis indicated an abundance of phenylpropanoids in O. sanctum. Phylogenetic analysis for chloroplast proteome placed Salvia miltiorrhiza as the nearest neighbor. Comparison of the chemical compounds and genes availability in O. sanctum and S. miltiorrhiza indicated the potential for the discovery of new active molecules. The genome sequence and annotation of O. sanctum provides new insights into the function of genes and the medicinal nature of the metabolites synthesized in this plant. This information is highly beneficial for mining biosynthetic pathways for important metabolites in related species.

  7. Variation in the volatile terpenoids of two industrially important basil (Ocimum basilicum L.) cultivars during plant ontogeny in two different cropping seasons from India.

    Science.gov (United States)

    Verma, Ram Swaroop; Padalia, Rajendra Chandra; Chauhan, Amit

    2012-02-01

    Two Ocimum basilicum cultivars, 'Vikarsudha' and 'CIM-Saumya', grown in the Kumaon region of western Himalaya were evaluated for their essential oil yield and composition at different stages of plant growth during two distinct cropping seasons (spring-summer and rain-autumn). The highest yield of essential oil was obtained at full bloom stage in both cultivars in both cropping seasons. The essential oils obtained from different stages in two cropping seasons were analysed by capillary gas chromatography with flame ionisation detection, and gas chromatography-mass spectrometry. The major component of cultivar 'Vikarsudha' was methyl chavicol (84.3-94.3%), while for cultivar 'CIM-Saumya' the main components were methyl chavicol (62.5-77.6%) and linalool (14.4-34.1%). This study clearly indicated that cultivar, cropping season, plant ontogeny and plant part had significant effects on the yield and quality of the essential oil of O. basilicum. Further, the amount of methyl chavicol in the cultivars grown in this region was higher than in cultivars from other parts of India. Copyright © 2011 Society of Chemical Industry.

  8. Antimicrobial activity of leaf extracts of Ocimum gratissimum on ...

    African Journals Online (AJOL)

    The antibacterial activity of different extracts from the leaves of Ocimum gratissimum was tested against Staphylococcus aureus, Escherichia coli, Salmonella typhi and Salmonella typhimurium, pathogenic bacteria that cause diarrhea. These extracts evaluated include cold water extract (CWE), hot water extract (HWE) and ...

  9. Exploring the potential effect of Ocimum sanctum in vincristine-induced neuropathic pain in rats

    Directory of Open Access Journals (Sweden)

    Jaggi Amteshwar

    2010-01-01

    Full Text Available Abstract The present study was designed to investigate the ameliorative potential of Ocimum sanctum and its saponin rich fraction in vincristine-induced peripheral neuropathic pain in rats. Peripheral neuropathy was induced in rats by administration of vincristine sulfate (50 μg/kg i.p. for 10 consecutive days. The mechanical hyperalgesia, cold allodynia, paw heat hyperalgesia and cold tail hyperalgesia were assessed by performing the pinprick, acetone, hot plate and cold tail immersion tests, respectively. Biochemically, the tissue thio-barbituric acid reactive species (TBARS, super-oxide anion content (markers of oxidative stress and total calcium levels were measured. Vincristine administration was associated with the development of mechanical hyperalgesia, cold allodynia, heat and cold hyperalgesia. Furthermore, vincristine administration was also associated with an increase in oxidative stress and calcium levels. However, administration of Ocimum sanctum (100 and 200 mg/kg p.o. and its saponin rich fraction (100 and 200 mg/kg p.o. for 14 days significantly attenuated vincristine-induced neuropathic pain along with decrease in oxidative stress and calcium levels. It may be concluded that Ocimum sanctum has ameliorative potential in attenuating chemotherapy induced-painful neuropathic state, which may be attributed to decrease in oxidative stress and calcium levels. Furthermore, saponin rich fraction of Ocimum sanctum may be responsible for its noted beneficial effect in neuropathic pain in rats.

  10. Effect of Gamma irradiation on the Production of Four Species of Some Labiateae Family

    International Nuclear Information System (INIS)

    El-Sharnouby, M.E.

    2013-01-01

    This investigation was carried out on four species of Labiateae family (Sweet basil, Marjoram, Rosemary and Thyme), plants cultured on Taif region in KSA and seeds were exposed to gamma rays treatments at 20, 40, 60 and 80 Gy. The results indicated increase the number of shoots of all labiateae species with control plants after 2 and 4 months (except Rosmary seeds irradiated with 20 Gy of gamma irradiation which produced maximum number of shoots (3.1) after four months from seeds culturing). The highest dose of gamma rays (80 Gy), significantly decreased the average shoot number on Marjoram plants. Exposing to gamma irradiation, the irradiated sweet basil plants with gamma rays at 40 and 60 Gy formed significantly longer shoots after 4 months from culturing compared with the control plants. The high dose of gamma rays (80 Gy), significantly decreased the average of Marjoram shoot length. The Rosmary plants, showed a significant increase in the shoot length with gamma irradiation at 20 Gy which produced (4.0 cm) than other gamma irradiation treatments. Stem diameter and plant dry weight of the Rosmary, Marjoram and Thyme plants were the best on control than other gamma rays treatments after 2 and 4 months respectively. The highest number of leaves percentage (12.2) was recorded with the control of marjoram plants. Most of the irradiation treatments decreased the number of leaves of all labiateae plants except sweet basil plants specially gamma ray at 60 Gy which reached more number of leaves than sweet basil control plants after 4 months from seeds culturing.

  11. QCM-Arrays for Sensing Terpenes in Fresh and Dried Herbs via Bio-Mimetic MIP Layers

    Directory of Open Access Journals (Sweden)

    Naseer Iqbal

    2010-06-01

    Full Text Available A piezoelectric 10 MHz multichannel quartz crystal microbalance (MQCM, coated with six molecularly imprinted polystyrene artificial recognition membranes have been developed for selective quantification of terpenes emanated from fresh and dried Lamiaceae family species, i.e., rosemary (Rosmarinus Officinalis L., basil (Ocimum Basilicum and sage (Salvia Officinalis. Optimal e-nose parameters, such as layer heights (1–6 KHz, sensitivity

  12. Phytochemical characterization of essential oil from Ocimum selloi

    Directory of Open Access Journals (Sweden)

    LILIA A.S. MORAES

    2002-03-01

    Full Text Available Ocimum selloi Benth, a native plant of Brazil, has medicinal uses as anti-diarrheic, antispasmodic and anti-inflammatory product. The yield of essential oils of the inflorescences, containing flowers and seeds, was 0.6%, and the yield of leaves, collected in two different seasons, was 0.25% (June 2000 and 0.20% (January 2001, respectively. The essential oils of the inflorescences and leaves presented as major constituents trans-anethol (41.34%, 45.42%, 58.59% and methyl chavicol (27.10%, 24.14%, 29.96%.Ocimum selloi Benth, planta nativa do Brasil de uso medicinal, tem sido utilizada como antidiarréico, antiespasmódico e antiinflamatório. O rendimento dos óleos essenciais das inflorescências, contendo flores e sementes, foi de 0,6% e das folhas, coletadas em duas épocas do ano, foi de 0,25% (junho/00 e 0,20% (janeiro/01, respectivamente. Os óleos essenciais das inflorescências e folhas apresentaram como constituintes majoritários o trans-anethol (41,34%, 45,42%, 58,59% e methyl chavicol (27,10%, 24,14%, 29,96%.

  13. Variation of Ursolic Acid Content in Eight Ocimum Species from Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Selene M. Morais

    2008-10-01

    Full Text Available Ursolic acid is a very important compound due to its biological potential as an anti-inflammatory, trypanocidal, antirheumatic, antiviral, antioxidant and antitumoral agent. This study presents the HPLC analysis of ursolic acid (UA content in eight different Ocimum species: O. americanum L., O. basilicum L, O. basilicum var purpurascens Benth, O. basilicum var. minimum L, O. gratissimum L, O. micranthum Willd, O. selloi Benth. and O. tenuiflorum L. grown in Northeastern Brazil. In these Ocimum species, UA was detected in different yields, with O. tenuiflorum showing the highest content (2.02%. This yield is very significant when compared with other sources of UA.

  14. Calycomyza hyptidis Spencer (Diptera,Agromyzidae: descriptions, redescriptions and first record in Ocimum basilicum (Lamiaceae in Brazil

    Directory of Open Access Journals (Sweden)

    Viviane Rodrigues de Sousa

    2013-06-01

    Full Text Available Calycomyza hyptidis Spencer (Diptera, Agromyzidae: descriptions, redescriptions and first record in Ocimum basilicum (Lamiaceae in Brazil. All phases of the leafminer Calycomyza hyptidis Spencer are for the first time described, including the larva, puparium and adult female. Illustrations are presented for male and female terminalia, mine, larva and pupa. The species is first recorded in leaves of Ocimum basilicum L. (Lamiaceae in Brazil.

  15. Thermal and oxidative stability of the Ocimum basilicum L. essential oil/β-cyclodextrin supramolecular system

    Directory of Open Access Journals (Sweden)

    Daniel I. Hădărugă

    2014-11-01

    Full Text Available Ocimum basilicum L. essential oil and its β-cyclodextrin (β-CD complex have been investigated with respect to their stability against the degradative action of air/oxygen and temperature. This supramolecular system was obtained by a crystallization method in order to achieve the equilibrium of complexed–uncomplexed volatile compounds in an ethanol/water solution at 50 °C. Both the raw essential oil and its β-CD complex have been subjected to thermal and oxidative degradation conditions in order to evaluate the protective capacity of β-CD. The relative concentration of the O. basilicum L. essential oil compounds, as determined by GC–MS, varies accordingly with their sensitivity to the thermal and/or oxidative degradation conditions imposed. Furthermore, the relative concentration of the volatile O. basilicum L. compounds found in the β-CD complex is quite different in comparison with the raw material. An increase of the relative concentration of linalool oxide from 0.3% to 1.1%, in addition to many sesquiterpene oxides, has been observed. β-CD complexation of the O. basilicum essential oil modifies the relative concentration of the encapsulated volatile compounds. Thus, linalool was better encapsulated in β-CD, while methylchavicol (estragole was encapsulated in β-CD at a concentration close to that of the raw essential oil. Higher relative concentrations from the degradation of the oxygenated compounds such as linalool oxide and aromadendren oxide were determined in the raw O. basilicum L. essential oil in comparison with the corresponding β-CD complex. For the first time, the protective capability of natural β-CD for labile basil essential oil compounds has been demonstrated.

  16. Thermal and oxidative stability of the Ocimum basilicum L. essential oil/β-cyclodextrin supramolecular system.

    Science.gov (United States)

    Hădărugă, Daniel I; Hădărugă, Nicoleta G; Costescu, Corina I; David, Ioan; Gruia, Alexandra T

    2014-01-01

    Ocimum basilicum L. essential oil and its β-cyclodextrin (β-CD) complex have been investigated with respect to their stability against the degradative action of air/oxygen and temperature. This supramolecular system was obtained by a crystallization method in order to achieve the equilibrium of complexed-uncomplexed volatile compounds in an ethanol/water solution at 50 °C. Both the raw essential oil and its β-CD complex have been subjected to thermal and oxidative degradation conditions in order to evaluate the protective capacity of β-CD. The relative concentration of the O. basilicum L. essential oil compounds, as determined by GC-MS, varies accordingly with their sensitivity to the thermal and/or oxidative degradation conditions imposed. Furthermore, the relative concentration of the volatile O. basilicum L. compounds found in the β-CD complex is quite different in comparison with the raw material. An increase of the relative concentration of linalool oxide from 0.3% to 1.1%, in addition to many sesquiterpene oxides, has been observed. β-CD complexation of the O. basilicum essential oil modifies the relative concentration of the encapsulated volatile compounds. Thus, linalool was better encapsulated in β-CD, while methylchavicol (estragole) was encapsulated in β-CD at a concentration close to that of the raw essential oil. Higher relative concentrations from the degradation of the oxygenated compounds such as linalool oxide and aromadendren oxide were determined in the raw O. basilicum L. essential oil in comparison with the corresponding β-CD complex. For the first time, the protective capability of natural β-CD for labile basil essential oil compounds has been demonstrated.

  17. Basil Willey, Sixty Years after (October 22, 2007)

    DEFF Research Database (Denmark)

    Schatz-Jakobsen, Claus

    2008-01-01

    On the occasion of the sixtieth anniversary of the foundation of the Danish Association of English Teachers' newsletter, Anglo Files, the essay reconsiders the contents of the first issue from December 1947, Cambridge professor Basil Willey's address to the Association on October 22, 1947, 'Poetr...... and Life', and puts Willey's life and text into historical context....

  18. In vitro multiplication of Ocimum gratissimum L. through direct ...

    African Journals Online (AJOL)

    The objective of this study was to develop a rapid system for regeneration of the important medicinal plant, Ocimum gratissimum L, from nodal explant. Single node explants were inoculated on basal MS (Murashige and Skoog, 1962) medium containing 3% (w/v) sucrose, supplemented with different concentrations and ...

  19. FORMULASI SEDIAAN SABUN CAIR ANTIBAKTERI MINYAK ATSIRI DAUN KEMANGI (Ocimumamericanum L. DAN UJI TERHADAP BAKTERI Staphylococcus epidermidis dan Staphylococcus aureus

    Directory of Open Access Journals (Sweden)

    Febry Astuti Abu

    2015-10-01

    Full Text Available Basil (Ocimum americanum L. is a plant that has antibacterial activity against Staphylococcus aureus and Staphylococcus epidermidis that is a bacteria can cause infection. Basil contains essential oils that act as an antibacterial. This research aims to formulate the essential oil of basil leaves into a liquid soap, determine antibacterial activity against S.aureus and S.epidermidis bacteria with the agar diffusion method using wells and determine the stability of the preparation. Antibacterial activity data that gain was analyzed by one-way ANOVA with a level of trust 95% followed by Duncan test. The results of the research showed basil essential oil liquid soap preparation has antibacterial activity. The analysis results showed that there were significant differences in the concentration of 2%, 3%, 4%, and the Duncan test results showed no significant difference between the concentration of 4% with control (+. The results of the t-student analysis of liquid soap include viscosity, pH and dispersive capacity does not fill the parameters of stability during the storage period of 28 days

  20. 40 CFR 180.185 - DCPA; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 5.0 Watermelon 1.0 (b) Section 18 emergency exemptions. [Reserved] (c) Tolerances with regional...: Commodity Parts per million Basil, dried leaves 20.0 Basil, fresh leaves 5.0 Bean, dry 2.0 Bean, mung, seed... husks removed 0.05 Corn, sweet, stover 0.4 Cotton, undelinted seed 0.2 Cucumber 1.0 Dill 5.0 Eggplant 1...

  1. short communication the effect of ocimum sanctum and ledum

    African Journals Online (AJOL)

    Preferred Customer

    SHORT COMMUNICATION. THE EFFECT OF OCIMUM SANCTUM AND LEDUM PALUSTRE ON SERUM URIC. ACID LEVEL IN PATIENTS ... It is a metabolic disorder characterized by abnormally high levels of uric acid in the blood. The pain and swelling due to gout can be sudden and may appear and disappear over ...

  2. [Effectiveness of antimicrobial formulations for acne based on orange (Citrus sinensis) and sweet basil (Ocimum basilicum L) essential oils].

    Science.gov (United States)

    Matiz, Germán; Osorio, María R; Camacho, Francisco; Atencia, Maira; Herazo, Jennifer

    2012-01-01

    Currently, the antimicrobial resistance has developed in bacterial strains involved in the development of acne. Therefore, alternatives to antibiotic treatment have become necessary. Gel formulations were designed based on essential oils and acetic acid, and their effectiveness was evaluated in patients affected by acne. Masked simple experimental study of three gel formulations on 28 volunteer patients, separated in four groups of seven patients. Treatments were applied daily for eight weeks and consisted of (1) antibacterial (essential oils), (2) keratolytic medication (3) essential oils mixed with acetic acetic, and (4) kerolytic medication with acetic acid. Weekly checks were conducted to evaluate patient improvement. All groups reported an improvement of the acne condition, which ranged between 43% and 75% clearance of lesions. Evidence of treatment disappeared within minutes, showing little discomfort or side effects after application. The essential oil formulations were chemically and physically stable during application of treatments. This was demonstrated by gas chromatography, where no evidence no change neither the composition profiles of essential oils nor in acetic acid. The results were ranked good to excellent, particularly for the acetic acid mixture, which achieved improvements of 75%. This appeared to be a result of their joint antiseptic and keratolytic activity. Side effects (burning and redness) disappeared within a few minutes of completing the application, therefore, did not interfere with adherence to treatment.

  3. Chemical composition, acute toxicity, and antinociceptive activity of the essential oil of a plant breeding cultivar of basil (Ocimum basilicum L.).

    Science.gov (United States)

    Venâncio, Antônio Medeiros; Onofre, Alexandre Sherlley; Lira, Amintas Figueiredo; Alves, Péricles Barreto; Blank, Arie Fitzgerald; Antoniolli, Angelo Roberto; Marchioro, Murilo; Estevam, Charles dos Santos; de Araujo, Brancilene Santos

    2011-05-01

    Ocimum basilicum L. is an aromatic herb used in Brazil to treat illnesses such as respiratory and rheumatic problems, vomiting, and pain. In the present study, the chemical composition, acute toxicity, and antinociceptive effects of the essential oil (EO) of the cultivar "Maria Bonita" obtained from O. basilicum L. PI 197442 genotype were evaluated in Swiss mice (20-35 g each). Lethal dose to cause 50 % death (LD50) was calculated from a dose-response curve (100-5000 mg/kg body wt.; n = 6) as 532 mg/kg body wt. In the acetic acid-induced writhing test (0.6 % i. p.), EO (50, 100, and 200 mg/kg body wt., n = 8, s. c.) was effective in reducing the abdominal contractions at all doses (48-78 %). In the hot-plate test, EO significantly increased the latency at 50 mg/kg body wt. at all times (37-52 %, n = 8, s. c.). However, the effects of morphine and EO at 50 mg/kg were reverted in the presence of naloxone, an opioid antagonist. In the formalin test, EO significantly reduced paw licking time in the first and second phases of pain at 200 mg/kg body wt. (38 and 75 %, respectively, n = 8, s. c.). The results suggested that the peripheral and central antinociceptive effects of EO are related to the inhibition of the biosynthesis of pain mediators, such as prostaglandins and prostacyclins, and its ability to interact with opioid receptors. © Georg Thieme Verlag KG Stuttgart · New York.

  4. Phyto-metals screening of selected anti-diabetic herbs and infused concoctions

    OpenAIRE

    Olanrewaju O. Olujimi; Olusegun N. Onifade; Adeleke T. Towolawi; Temilade F. Akinhanmi; Adeniyi A. Afolabi; Kabir A. Olanite

    2017-01-01

    Objective: To determine the levels of some selected heavy metals in both the selected anti-diabetic herbal plants and infused concoctions for diabetes treatment. Methods: Ten anti-diabetic plant samples: pawpaw leaves (Carica papaya), bitter melon leaves (Momordica charantia), holy basil leaves (Ocimum sanctum), bitter leaf (Vernonia amygdalina), ginger rhizome (Zingiber officinale), garlic (Allium sativum), African red pepper fruits (Capsicum frutescens), negro pepper grain (Xylopia aethi...

  5. Fungi colonizing dead leaves of herbs

    Directory of Open Access Journals (Sweden)

    Maria Kowalik

    2013-04-01

    Full Text Available The material was collected from the Botanical Garden and the Collegium Medicum Medicinal Plant Garden of the Jagiellonian University in Krakow. The investigated species were: lemon balm (Mellisa officinalis L., common lavender (Lavendula angustifolia Mill., horsemint (Mentha longifolia L., sage (Salvia officinalis L., sweet basil (Ocimum basilicum L., and wild marjoram (Origanum vulgare L.. The aim of the investigation was to identify fungi causing the death of leaf tissues of herbs from the mint family Lamiaceae. In mycological investigations, 180 fragments of each plant leaves (1,080 dead leaf fragments in total were placed in a 2% PDA medium. Over 970 colonies of fungi belonging to 48 species were isolated from the dead leaf tissues of the six herb species. Alternaria alternata (toxin-producing, Epicoccum nigrum and Sordaria fimicola were the most frequently isolated. The largest numbers of colonies and species of fungi were isolated from horsemint, while the lowest numbers were from wild marjoram leaves. It was shown that the death of leaves of selected herb species from the Lamiaceae family was caused by various fungi. The results of the mycological analysis confirmed the diversity of species colonizing the leaves of the herbs.

  6. Detection of sweet potato virus C, sweet potato virus 2 and sweet potato feathery mottle virus in Portugal.

    Science.gov (United States)

    Varanda, Carla M R; Santos, Susana J; Oliveira, Mônica D M; Clara, Maria Ivone E; Félix, Maria Rosário F

    2015-06-01

    Field sweet potato plants showing virus-like symptoms, as stunting, leaf distortion, mosaic and chlorosis, were collected in southwest Portugal and tested for the presence of four potyviruses, sweet potato virus C (SPVC), sweet potato virus 2 (SPV2), sweet potato feathery mottle virus (SPFMV), sweet potato virus G (SPVG), and the crinivirus sweet potato chlorotic stunt virus (SPCSV). DsRNA fractions were extracted from symptomatic leaves and used as templates in single and multiplex RT-PCR assays using previously described specific primers for each analyzed virus. The amplified reaction products for SPVC, SPV2 and SPFMV were of expected size, and direct sequencing of PCR products revealed that they correspond to the coat protein gene (CP) and showed 98%, 99% and 99% identity, respectively, to those viruses. Comparison of the CP genomic and amino acid sequences of the Portuguese viral isolates recovered here with those of ten other sequences of isolates obtained in different countries retrieved from the GenBank showed very few differences. The application of the RT-PCR assays revealed for the first time the presence of SPVC and SPFMV in the sweet potato crop in Portugal, the absence of SPVG and SPCSV in tested plants, as well as the occurrence of triple virus infections under field conditions.

  7. Antifungal activity of the basil (Ocimmum basilicum L. extract on Penicillium aurantiogriseum, P. glabrum, P. chrysogenum, and P. brevicompactum

    Directory of Open Access Journals (Sweden)

    Kocić-Tanackov Sunčica D.

    2012-01-01

    Full Text Available This study was aimed at investigating the antifungal potential of basil (Ocimmum basilicum L. extract against toxin-producing Penicillium spp. (P. aurantiogriseum, P. glabrum, P. chrysogenum, and P. brevicompactum isolated from food. The basil extract composition was determined by the GC-MS method. The major component identified in the extract was estragole (86.72%. The determination of the antifungal activity of basil extract on Penicillium spp. was performed using the agar plate method. Basil extract reduced the growth of Penicillium spp. at all applied concentration levels (0.16, 0.35, 0.70, and 1.50 mL/100mL with the colony growth inhibition from 3.6 (for P. glabrum to 100% (for P. chrysogenum. The highest sensitivity showed P. chrysogenum, where the growth was completely inhibited at the basil extract concentration of 1.50 mL/100mL. The growth of other Penicillium spp. was partially inhibited with the colony growth inhibition of 63.4 % (P. brevicompactum, 67.5% (P. aurantiogriseum, and 71.7% (P. glabrum. Higher concentrations (0.70 and 1.50 mL/100mL reduced the growth of the aerial mycelium of all tested Penicillium species. In addition, at the same extract concentrations, the examination of microscopic preparation showed the deformation of hyphae with the frequent occurrence of fragmentations and thickenings, occurrence of irregular vesicle, frequently without metulae and phialides, enlarged metulae. The results obtained in this investigation point to the possibility of using basil extract for the antifungal food protection. [Projekat Ministarstva nauke Republike Srbije, br. TR-31017

  8. Cama-de-frango em mono e policultivo de fáfia com cravo-de-defunto e manjericão Poultry manure in mono and intercrop of Brazilian ginseng with marigold and basil

    Directory of Open Access Journals (Sweden)

    Valdenise C Barboza

    2010-09-01

    os policultivos foram efetivos.This study was carried out in field of the Universidade Federal da Grande Dourados, in Dourados, Brazil, during the period from March 2005 to September 2006. The aim of the experiment was to evaluate Pfaffia glomerata (Spreng Pedersen yield under monocropping system or intercropped with Tagetes erecta L. and Ocimum basilicum L, in a Distroferric Red Latosol (sand loam Rhodic Oxisol, using semi-decomposed poultry manure (PM. The study objects were Brazilian ginseng (BG, marigold (M and basil (B under monocropping and the intercropping of two Brazilian ginseng, three marigold (BG2M3 and three basil (BG2B3 lines, all of them with or without semi-decomposed poultry manure (PM as fertilizer. Ten treatments were arranged in randomized blocks design, with four replications. Fresh and dry weight production from shoot of Brazilian ginseng were higher (13.22 t ha-1 and 4.39 t ha-1, respectively under monocropping, independently of the use of poultry manure. Nevertheless, none of experimental designs influenced the dry and fresh weight production or root number of Brazilian ginseng which produced average values of 10.02 and 2.07 t ha-1 and 417,916 roots ha-1, respectively. Root diameter was higher (23.5 mm under intercropping system with basil. Dry and fresh weight of marigold flowers were higher (14.28 t ha-1and 1.278 t ha-1, respectively when intercropped with Brazilian ginseng, but only fresh weight of the flowers was increased (14.17 t ha-1 by poultry manure application. Basil shoot production was higher (52.91 t ha-1 when intercropped, independently of the used species; however, they were not influenced by the use of poultry manure. Land equivalent ration (LER for the Brazilian ginseng intercropped with marigold was 2.15 under poultry manure application and 1.99 without it, and for the basil 2.44 under poultry manure application and 3.08 without it. Values higher than 1.0 indicate that the intercropping systems were effective.

  9. The Effect Of Ocimum Gratissimum (Ram Tulsi) On Sexual ...

    African Journals Online (AJOL)

    The suspension of the extract of Ocimum gratissimum Linn. was administered orally at the dose of 100, 250, and 500 mg / kg body weight, to different groups of male rats (n = 6) once a day for seven days. The female Swiss Albino mice involved in mating were made receptive by hormonal treatment. The general mating ...

  10. Radioprotective effects of ocimum flavonoids on leukocyte oxidants and antioxidants in oral cancer

    International Nuclear Information System (INIS)

    Reshma, K.; Rao, A.V.; Dinesh, M.; Vasudevan, D.M.

    2008-01-01

    Oxidants (NADPH oxidase and myeloperoxidase) and antioxidants (GSH, GSH peroxidase, SOD and glucose 6 phosphate dehydrogenase, that provides NADPH for antioxidants) were assayed in the neutrophils from oral cancer patients, in three stages viz, baseline samples, 15 days after radiation and 30 days following radiation. These samples were obtained from 2 groups of patients. Group A that received radiation alone and Group B that received radiation and ocimum flavonoids, a radioprotector. The results showed a significant fall in the SOD levels in the second follow up of group B. Glucose 6 phosphate dehydrogenase showed significant increase only in the first follow up of patients who received Ocimum flavonoids. Except for these findings all other parameters remained statistically nonsignificant. (author)

  11. Radioprotective effects of ocimum flavonoids on leukocyte oxidants and antioxidants in oral cancer

    Energy Technology Data Exchange (ETDEWEB)

    Reshma, K [Department of Biochemistry, Kasturba Medical College, Mangalore (India); Rao, A V [Fr. Muller' s Medical College, Mangalore (India); Dinesh, M [Department of Oncology, Amritha Institute of Medical Sciences, Cochin (India); Vasudevan, D M [Dept. of Biochemistry, Amritha Institute of Medical Sciences, Cochin (India)

    2008-04-15

    Oxidants (NADPH oxidase and myeloperoxidase) and antioxidants (GSH, GSH peroxidase, SOD and glucose 6 phosphate dehydrogenase, that provides NADPH for antioxidants) were assayed in the neutrophils from oral cancer patients, in three stages viz, baseline samples, 15 days after radiation and 30 days following radiation. These samples were obtained from 2 groups of patients. Group A that received radiation alone and Group B that received radiation and ocimum flavonoids, a radioprotector. The results showed a significant fall in the SOD levels in the second follow up of group B. Glucose 6 phosphate dehydrogenase showed significant increase only in the first follow up of patients who received Ocimum flavonoids. Except for these findings all other parameters remained statistically nonsignificant. (author)

  12. High pressure-temperature processing as an alternative for preserving basil

    NARCIS (Netherlands)

    Krebbers, B.; Matser, A.; Koets, M.; Bartels, P.; Berg, van den R.

    2002-01-01

    In this study the effect of sterilisation by high pressure (HP) on the quality of basil was compared to conventional processing techniques. By means of freezing, or blanching followed by drying, microbial reduction of spores was maximal one-log. Pulsed HP-temperature treatment yielded a reduction of

  13. Plant compounds insecticide activity against Coleoptera pests of stored products

    OpenAIRE

    MOREIRA, M.D.; PICANÇO, M.C.; BARBOSA, L.C. de A.; GUEDES, R.N.C.; CAMPOS, M.R. de; SILVA, G.A.; MARTINS, J.C.

    2008-01-01

    The objective of this work was to screen plants with insecticide activity, in order to isolate, identify and assess the bioactivity of insecticide compounds present in these plants, against Coleoptera pests of stored products: Oryzaephilus surinamensis L. (Silvanidae), Rhyzopertha dominica F. (Bostrichidae) and Sitophilus zeamais Mots. (Curculionidae). The plant species used were: basil (Ocimum selloi Benth.), rue (Ruta graveolens L.), lion's ear (Leonotis nepetifolia (L.) R.Br.), jimson weed...

  14. Sweet eating: a definition and the development of the Dutch Sweet Eating Questionnaire.

    Science.gov (United States)

    van den Heuvel, Margot; Hörchner, Rogier; Wijtsma, Anneke; Bourhim, Noufissa; Willemsen, Dascha; Mathus-Vliegen, Elisabeth M H

    2011-06-01

    Previous studies have suggested that patients who are defined as so-called sweet eaters have more difficulties to lose weight and to maintain weight loss after both conservative treatment and restrictive bariatric surgery, such as gastric banding. There is, however, no agreement on the definition of sweet eating. Also, a questionnaire to measure sweet eating is not available. Therefore, the aim of our study was to agree on a definition of sweet eating and to construct a valid and reliable questionnaire that might be of help to assess the influence of sweet eating on weight loss after bariatric surgery. A Delphi Study design was chosen to define sweet eating. Based on the Delphi rounds, a questionnaire with self-reported sweets intake was constructed and validated. Nine experts with different scientific backgrounds participated in the Delphi Study which consisted of four rounds. They finally agreed on the definition that sweet eating can be defined as an eating behavior in which at least 50% of daily consumed carbohydrates consist of simple carbohydrates and which can be triggered by emotional factors (i.e., stress). They did not include the intake of artificial sweeteners in the definition. The Dutch Sweet Eating Questionnaire built on the four Delphi rounds was tested in 138 female patients and appeared to be both valid and reliable. A shortcoming of this study is that the results may not be applicable to males and to non-Western populations. The definition and the questionnaire may be useful in future research regarding sweet eating and bariatric surgery outcomes in morbidly obese patients.

  15. In vitro regeneration of a common medicinal plant, Ocimum sanctum ...

    African Journals Online (AJOL)

    Embracing micro-propagation method for large scale production of plantlets and also for protection of appropriate germplasm is a prerequisite that needs to be undertaken in order to develop a rapid in vitro regeneration protocol for Ocimum sanctum L. Shoot tips as well as nodal segments were subjected to numerous ...

  16. Integration of Gamma Irradiation and Some Botanical oils To Protect Cowpea And Chickpea Seeds From Infestation With The Bruchid Beetle Callosobruchus Maculatus

    International Nuclear Information System (INIS)

    Hassan, R.S.; Mikhaiel, A.A.; Sileem, Th.M.

    2013-01-01

    The lethal effect of gamma radiation doses of 0.75 or 1.0 kGy on the adults Callosobruchus maculates reared on cowpeas and chickpeas were slow during the first and third days post-treatments. By increasing the dose to 1.5 kGy, the values of the percent mortality of adults in both seeds 24 h posttreatment were 53 and 40%, respectively. On the other hand, the dose 2 kGy caused sooner mortality for adults post-treatment for cowpeas. Different concentrations from eight plant oils; lemon grass, pinus sylvestris, parsley, fennel, geranium, peppermint, petitgrain and sweet basil, were used for protection of cowpea and chickpea seeds from infestation by Callosobruchus maculates. The results showed that sweet basil and geranium caused 89 and 79 % larval mortality, respectively, in case of cowpeas at concentration 0.5 % with exposure period of 48 hour while 71.0 and 63.33% adult mortality was occurred at the same concentration of both oils in chickpeas. The latent effects of tested plant oils on adult stage when beetles of C. maculatus were fed on seeds treated with the lowest two concentrations (0.0312, 0.0625%) of tested oils, the number of eggs laid per female was decreased in female exposed to all tested oils especially in case of cowpea treated with sweet basil and lemongrass. Most of the tested oils caused high reduction in larval penetration in both types of seeds. The adult weight was non significantly reduced at all treatments. The use of different plant oils leads to reduction in the progeny comparing to the control and sweet basil or geranium was found to be highly effective in decreasing the percentage of emergence (30 and 40% , respectively). No harmful effect was observed on germination of plant oils treated cowpea and chickpea seeds with concentration 2%.

  17. CHEMICAL COMPOSITION AND ANTIMICROBIAL PROPERTIES OF DIFFERENT BASIL OILS

    OpenAIRE

    H.C. Srivastava, Pankaj Shukla, Ajay Singh Maurya and Sonia Tripathi*

    2013-01-01

    ABSTRACT: The aerial parts essential oils of Ocimum basilicum (Lamiaceae) from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS) and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; tanethole type. The in vitro microbiological experiments revealed that only the methyleugenol...

  18. Evaluation the effects of organic, biological and chemical fertilizers on morphological traits, yield and yield components of Basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    S. M.K Tahhami Zarandi

    2015-04-01

    Full Text Available The use of organic manure and biofertilizers containing beneficial microorganisms instead of chemical fertilizers are known to improve plant growth through supply of plant nutrients and can help sustain environmental health and soil productivity. Because of special priority of the medicinal plants production in sustainable agricultural systems and lack of studies on assessment of different sources of fertilizer on basil plants, an experiment was conducted at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, in 2009. A complete randomize block design with ten treatments, and three replications was used. The treatments were: 1cow manure, 2sheep manure, 3hen manure, 4compost 5vermicompost, 6biological fertilizer nitroxin (consisting of Azotobacter and Azospirillum, 7biological fertilizer consisting of Phosphate Solubilizing Bacteria (Pseudomonas and Bacillus, 8mixture of biological fertilizer nitroxin and Phosphate Solubilizing Bacteria 9NPK fertilizers, and 10control (no fertilizer. Results showed plant height in sheep manure was higher than other treatments. Number of branches in vermicompost and number of inflorescence in cow manure were significantly higher than other treatments. The number of whorled flowers in compost, sheep and cow manure were more than other treatments. Highest leaf and green area index was observed in nitroxin treatment and biological yield in sheep manure have significant difference with other treatments (except cow manure. The highest seed yield were obtained from plants treated with compost (1945 kg/h and the lowest of that observed in NPK fertilizer and control treatments. In all measured traits (except number of inflorescence NPK fertilizer and control treatment did not have any significant difference.

  19. Effects of antibiotic growth promoter, probiotic and basil essential oil supplementation on the intestinal microflora of broiler chickens

    Directory of Open Access Journals (Sweden)

    SEYYED REZA RIYAZI

    2015-08-01

    Full Text Available Effects of the probiotic ‘Protexin', basil essential oil and the antibiotic growth promoter ‘Avilamycin' were studied on the ileum microbial flora of broilers when these substances are used as broiler feed additives. A total of six hundred Arian broilers were divided into 6 treatment groups, with 4 replicates of 25 birds. Treatments have been performed with a plant essential oil at 3 levels (200, 400 and 600 ppm, the probiotic ‘Protexin' (150 ppm, the antibiotic ‘Avilamycin' (150 ppm and a control group with no additives. Birds in different treatments received the same diets during the experimental period. The results showed that the probiotic treatment significantly decreased the total bacteria counts (P0.05. The lowest and highest lactic acid bacteria in ileum were obtained in the control group and in birds receiving 400 ppm basil essential oil, respectively. Moreover, addition of 600 ppm of basil essential oil into diet decreased the number of E. coli colonies as compared to other treatments (P< 0.05. It could be speculated that the basil essential oil and ‘Protexin' could replace the antibiotics, which have been banned to use as growth promoter in animal feeds.

  20. The effect of fresh leaf Ocimum gratissimum and dried buds Eugenia ...

    African Journals Online (AJOL)

    Bulletin of Animal Health and Production in Africa ... Abstract. The use of antibiotics has lead to antibiotic resistance and residual effects among others in fish tissue thus necessitate the advocate for alternative natural plants for ... Keywords: Antimicrobial, aquaculture, Eugenia caryophyllata, extracts, Ocimum gratissimum ...

  1. Phenolic Substances from Ocimum Species Enhance Glucose- Stimulated Insulin Secretion and Modulate the Expression of Key Insulin Regulatory Genes in Mice Pancreatic Islets

    DEFF Research Database (Denmark)

    Casanova, Livia Marques; Gu, Wenqian; Costa, Sônia Soares

    2017-01-01

    ABSTRACT: Ocimum gratissimum and Ocimum basilicum are plants ethnopharmacologically used to treat diabetes mellitus, a life-threatening disease that affects millions of people worldwide. In order to further understand their antidiabetic potential, which has been previously demonstrated in animal...

  2. Effect of water cooking on antioxidant capacity of carotenoid-rich vegetables in Taiwan

    Directory of Open Access Journals (Sweden)

    Fuh-Juin Kao

    2014-06-01

    Full Text Available Carotenoid-rich green leafy vegetables including cilantro, Thai basil leaves, sweet potato leaves, and choy sum were selected to evaluate the effects of water cooking or boiling on their total carotenoid content (TCC, total phenolic content (TPC, and total antioxidant capacity (TAC. The percentage inhibition of peroxidation (%IP, Trolox equivalent antioxidant capacity (TEAC, and metal-chelating effect were used to evaluate TAC. The results indicated that TCC reached the maximum after boiling cilantro, Thai basil leaves, and sweet potato leaves for 10 minutes, 5 minutes, and 5 minutes, respectively, and choy sum remained almost unchanged after 30 minutes of boiling. Boiling cilantro and choy sum had a negative effect on their TPC, whereas there was a significant increase in TPC of Thai basil leaf and sweet potato leaf at 1 minute and 5 minutes of boiling, respectively. During water cooking, TAC of the vegetables did not demonstrate a consistent trend. However, TCC was a vital contributor to %IP, whereas TPC showed a strong association with TEAC. Our findings suggest that a boiling time of ≤5 minutes would be better for preserving or enhancing TCC and TPC as well as revealing a higher %IP, TEAC, or metal-chelating effect for the four vegetables investigated in this study.

  3. Preparation of basil seed mucilage aerogels loaded with paclitaxel nanoparticles by the combination of phase inversion technique and gas antisolvent process

    Directory of Open Access Journals (Sweden)

    Seyyed Ghoreishi

    2017-09-01

    Full Text Available Objective(S: In this work, paclitaxel (PX, a promising anticancer drug, was loaded in the basil seed mucilage (BSM aerogels by implementation of supercritical carbon dioxide (SC-CO2 technology. Then, the effects of operating conditions were studied on the PX mean particle size (MPS, particle size distribution (PSD and drug loading efficiency (DLE. Methods: The employed SC-CO2 process in this research is the combination of phase inversion technique and gas antisolvent (GAS process. The effect of DMSO/water ratio (4 and 6 (v/v, pressure (10-20 MPa, CO2 addition rate (1–3 mL/min and ethanol concentration (5-10% were studied on MPS, PSD and DLE. Scanning electron microscopy (SEM and Zetasizer were used for particle analysis. DLE was investigated by utilizing the high-performance liquid chromatography (HPLC. Results: Nanoparticles of paclitaxel (MPS of 82–131 nm depending on process variables with narrow PSD were successfully loaded in BSM aerogel with DLE of 28–52%. Experimental results indicated that higher DMSO/water ratio, ethanol concentration, pressure and CO2 addition rate reduced MPS and DLE. Conclusions: A modified semi batch SC-CO2 process based on the combination of gas antisolvent process and phase inversion methods using DMSO as co-solvent and ethanol as a secondary solvent was developed for the loading of an anticancer drug, PX, in ocimum basilicum mucilage aerogel. The experimental results determined that the mean particle size, particle size distribution, and drug loading efficiency be controlled with operating conditions.

  4. Sweet Play

    Science.gov (United States)

    Leung, Shuk-kwan S.; Lo, Jane-Jane

    2010-01-01

    This article features Sweet play math, a "math by the month" activity that involves decorating and making sugar cubes. Teachers may want to substitute straws, paper squares, alphabet blocks, or such commercially made manipulatives as Unifix[R] cubes for the real sweets. Given no allergy concerns, teachers and students alike would enjoy some sweet…

  5. Reduction of microbial contamination and improvement of germination of sweet basil (Ocimum basilicum L.) seeds via surface dielectric barrier discharge

    Czech Academy of Sciences Publication Activity Database

    Ambrico, P. F.; Šimek, Milan; Morano, M.; De Miccolis Angelini, R.M.; Minafra, A.; Trotti, P.; Ambrico, M.; Prukner, Václav; Faretra, F.

    2017-01-01

    Roč. 50, č. 30 (2017), č. článku 305401. ISSN 0022-3727 R&D Projects: GA ČR(CZ) GA15-04023S Institutional support: RVO:61389021 Keywords : dielectric barrier discharges (DBD) * bio-decontamination * etching * polymers * biomolecules * spores * surface treatment Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 2.588, year: 2016 https://doi.org/10.1088/1361-6463/aa77c8

  6. Anti-diabetic Potential of the Aqueous Leaf Extracts of Ocimum ...

    African Journals Online (AJOL)

    The anti-diabetic potential of aqueous extracts of leaves of both Ocimum gratissimum and Vernonia amygdalina were investigated in rabbits. Ten female rabbits were grouped into five groups (1-5) of two rabbits each. Group 1 is the control. Groups (2-5) was alloxan induced diabetic. Group 3 was then treated with 200mg/kg ...

  7. Sclerotinia Rot on Basil Caused by Sclerotinia sclerotiorum in Korea

    Directory of Open Access Journals (Sweden)

    Soo Sang Hahm

    2017-03-01

    Full Text Available During growing season of 2011 to 2013, Sclerotinia rot symptoms consistently have been observed on basil in Yesan-gun, Chungcheongnam-do in Korea. The typical symptom formed initially brownish spot on leaf and stem, and then advancing margins, wilting the whole plant and blighting, eventually died. On the surface of diseased lesions was observed cottony, white, dense mat of mycelial growth, and sclerotia (30–100 µm diameter formed on stem and leaf. Morphological and cultural characteristic on potato dextrose agar, color of colony was white and colorless chocolate, sclerotium of irregular shape of the oval was black and 5–50 µm diameter in size. In pathogenicity test, necrosis and wilt of the inoculated stem were observed in all plants and the pathogen was reisolated from stems. On the basis of mycological characteristics, pathogenicity, and internal transcribed spacer rDNA sequence analysis, this fungus was identified as Sclerotinia sclerotiorum. This is the first report of Sclerotinia rot on basil caused by S. sclerotiorum in Korea.

  8. Effects of biocides on chlorophyll contents of detached basil leaves

    Directory of Open Access Journals (Sweden)

    Titima Arunrangsi

    2013-06-01

    Full Text Available Herbicides and insecticides have been widely and intensively used in agricultural areas worldwide to enhance crop yield. However, many biocides cause serious environmental problems. In addition, the biocides may also have some effects on the treated agricultural crops. To study effects of biocides on chlorophyll content in detached basil leaves, 2,4-D dimethylamine salt (2,4 D-Amine, paraquat, carbosulfan, and azadirachtin, were chosen as representatives of biocide. After applying the chemicals to detached basil leaves overnight in darkness, chlorophyll contents were determined. Only treatment with 2,4 D-Amine resulted in reduction of chlorophyll contents significantly compared to treatment with deionized (DI water. In the case of paraquat and carbosulfan, chlorophyll contents were not significantly changed, while slightly higher chlorophyll contents, compared to DI water, after the treatment with azadirachtin, were observed. The results indicated that 2,4 D-Amine shows an ability to accelerate chlorophyll degradation, but azadirachtin helps to retard chlorophyll degradation, when each biocide is used at the concentration recommended by the manufacturer.

  9. Sweet Conclusion

    Science.gov (United States)

    Shirley, Britt M.; Wooldridge, Barbara Ross; Camp, Kerri M.

    2012-01-01

    Jen Harrington is the owner and pastry chef of Sweet Conclusion, a bakery in Tampa, Florida. Most of Harrington's business comes from baking wedding cakes, but she has been attempting to attract customers to her retail bakery, where she sells cupcakes, pies, ice cream, and coffee. Nearly four years she opened Sweet Conclusion, the retail part of…

  10. Biological evaluation of 32 different essential oils against ...

    African Journals Online (AJOL)

    USER

    2016-01-27

    Jan 27, 2016 ... Among the various components of cinnamon oil, benzaldehyde and cinnamaldehyde ..... cinnamaldehyde have antimicrobial properties against .... Plant essential oils for pest and disease management. ... Needle. Sweet basil.

  11. The extraction and chromatographic determination of the essentials oils from Ocimum basilicum L. by different techniques

    Energy Technology Data Exchange (ETDEWEB)

    Soran, Maria Loredana; Varodi, Codruta; Lung, Ildiko; Surducan, Emanoil; Surducan, Vasile [National Institute for Research and Development of Isotopic and Molecular Technologies, 65-103 Donath, 400293 Cluj-Napoca (Romania); Cobzac, Simona Codruta, E-mail: loredana.soran@itim-cj.r [Babes-Bolyai University, Faculty of Chemistry and Chemical Engineering, 11 Arany Janos, 400028 Cluj-Napoca (Romania)

    2009-08-01

    Three different techniques (maceration, sonication and extraction in microwave field) were used for extraction of essential oils from Ocimum basilicum L. The extracts were analyzed by TLC/HPTLC technique and the fingerprint informations were obtained. The GC-FID was used to characterized the extraction efficiency and for identify the terpenic bioactive compounds. The most efficient extraction technique was maceration followed by microwave and ultrasound. The best extraction solvent system was ethyl ether + ethanol (1:1, v/v). The main compounds identified in Ocimum basilicum L. extracts were: {alpha} and {beta}-pinene (mixture), limonene, citronellol, and geraniol.

  12. The extraction and chromatographic determination of the essentials oils from Ocimum basilicum L. by different techniques

    International Nuclear Information System (INIS)

    Soran, Maria Loredana; Varodi, Codruta; Lung, Ildiko; Surducan, Emanoil; Surducan, Vasile; Cobzac, Simona Codruta

    2009-01-01

    Three different techniques (maceration, sonication and extraction in microwave field) were used for extraction of essential oils from Ocimum basilicum L. The extracts were analyzed by TLC/HPTLC technique and the fingerprint informations were obtained. The GC-FID was used to characterized the extraction efficiency and for identify the terpenic bioactive compounds. The most efficient extraction technique was maceration followed by microwave and ultrasound. The best extraction solvent system was ethyl ether + ethanol (1:1, v/v). The main compounds identified in Ocimum basilicum L. extracts were: α and β-pinene (mixture), limonene, citronellol, and geraniol.

  13. Basil Bernstein and Emile Durkheim: Two Theories of Change in Educational Systems

    Science.gov (United States)

    Cherkaoui, Mohamed

    1977-01-01

    Attempts to draw out parallels and differences between Emile Durkheim's and Basil Bernstein's theories of educational systems and highlights Bernstein's reformulation of certain features of Durkheim's thought. Focuses on the role of the school, curriculum change, and social conflict. (Author/RK)

  14. Can Ocimum basilicum relieve chronic unpredictable mild stress-induced depression in mice?

    Science.gov (United States)

    Ayuob, Nasra Naeim; Firgany, Alaa El-Din L; El-Mansy, Ahmed A; Ali, Soad

    2017-10-01

    Depression is one of the important world-wide health problems. This study aimed to assess the ameliorative effect of Ocimum basilicum (OB) essential oil on the behavioral, biochemical and histopathological changes resulted from exposure to chronic unpredictable mild stress (CUMS). It also aimed to investigate the underlying mechanism in an animal model of depression. Forty male Swiss albino mice were divided into four groups (n=10): control, CUMS (exposed to CUMS for 4weeks), CUMS plus fluoxetine, and CUMS plus OB. At the end of the experiment, behavioral changes, serum corticosterone level, protein and gene expressions of brain derived neurotropic factor (BDNF) and glucocorticoid receptors (GR) in the hippocampus was all assessed. Immunoexpression of surface makers of glial fibrillary acidic protein (GFAP), Ki67, Caspase-3, BDNF and GR in the hippocampus were estimated. Data were analyzed by using the statistical package for the social sciences (SPSS). OB alleviated both behavioral and biochemical changes recorded in mice after exposure to CUMS. It also reduced neuronal atrophy observed in the hippocampal region III cornu ammonis (CA3) and dentate gyrus and restored back astrocyte number. OB decreased apoptosis in both neurons and glial cells and increased neurogenesis in the dentate gyrus in a pattern comparable to that of fluoxetine. Increased BDNF and GR gene and protein expressions seems to be behind the antidepressant-like effect of OB. Ocimum basilicum ameliorates the changes induced after exposure to the chronic stress. Assessing Ocimum basilicum efficacy on human as antidepressant is recommended in further studies. Copyright © 2017. Published by Elsevier Inc.

  15. Undergraduate Sustainable Learning: Effects of Sustainable Soilless Media on Production and Sensory Evaluation of Cucumbers, Basil, Parsley, and Lettuce

    Directory of Open Access Journals (Sweden)

    Victoria Russell

    2011-08-01

    Full Text Available Modern greenhouse production has been ~100% reliant on fossil fuels for all inputs (glazing, heating, fertilization, lighting, post-harvest. Recent innovations may reduce fossil fuel dependence but their effectiveness may not be thoroughly tested. To promote education in sustainable production, undergraduate students in Greenhouse Management class (Hort 3002W; University of Minnesota tested the effectiveness of two organic or ‘sustainable’ soilless media (Sunshine Natural and Organic Growing Mix, Sungro Metro-Mix Special Blend with a control (Sunshine LC8 Professional for crop production (height, leaf/flower number, yield and sensory evaluations (appearance, texture, taste, purchase of cucumbers (‘Big Burpless Hybrid’, ‘Sweet Burpless Hybrid’, basil (‘Opal Purple’, ‘Redleaf’, parsley (‘Green River’, ‘Extra Curled Dwarf’, ‘Hamburg’, and lettuce (Flying Saucer ‘Green’, ‘Red’. Significant differences between sustainable vs. control soils occurred for plant growth, depending on vegetative or reproductive traits, crops, and cultivars. These differences occasionally disappeared for sensory evaluation of edible components. In most crops, however, cultivars were highly significant factors. Undergraduate research can be used to provide directionality for future vegetable and herb plant breeding to focus on creating cultivars with increased yield and high consumer acceptance when grown in sustainable greenhouse soilless mixes.

  16. Acaricidal Effect of Foam Soap Containing Essential Oil of Ocimum ...

    African Journals Online (AJOL)

    Acaricidal effect of foam soap containing essential oil of Ocimum gratissimum leaves was tested on Rhipicephalus lunulatus in western highland of Cameroon. Five doses of essential oil (0.00; 0.04; 0.06; 0.08; 0.10 μl/g) with four replications for each dose were tested in vitro. Each replication consisted of 10 ticks in Petri dish ...

  17. Determining the Threshold Value of Basil Yield Reduction and Evaluation of Water Uptake Models under Salinity Stress Condition

    OpenAIRE

    M. Sarai Tabrizi; H. Babazadeh; M. Homaee; F. Kaveh Kaveh; M. Parsinejad

    2016-01-01

    Introduction: Several mathematical models are being used for assessing the plant response to the salinity of the root zone. The salinity of the soil and water resources is a major challenge for agricultural sector in Iran. Several mathematical models have been developed for plant responses to the salinity stress. However, these models are often applicable in particular conditions. The objectives of this study were to evaluate the threshold value of Basil yield reduction, modeling Basil respon...

  18. Antibacterial Activity of Different Plant Extracts and Phenolic Phytochemicals Tested on Paenibacillus Larvae Bacteria

    Directory of Open Access Journals (Sweden)

    Liviu Mărghitaş

    2011-10-01

    Full Text Available Paenibacillus larvae, a Gram-positive and spore-forming bacterium is responsible for American foulbrood disease inbees. The antimicrobial activity of different plant extracts and phenolic phytochemical was evaluated onPaenibacillus larvae bacteria. In addition possible correlation with antioxidant activity of the same plant extracts wasstudied. Extracts of the following plants were utilized: Achillea millefolium (yarrow, Ocimum basilicum (basil,Thymus vulgaris (thyme and Urtica dioica (nettle. The extracts that showed antimicrobial activity were later testedto determine the Minimal Inhibitory Concentration (MIC. Although nettle present the lowest polyphenolic contentcompared with the other plant extracts, exhibit the highest antimicrobial activity, measured as the inhibition zoneusing Mueller-Hinton agar plates. Basil presented both polyphenolic content and antimicrobial activity at higherlevels, while thyme had the lowest antimicrobial activity, even it present high amount of polyphenols.

  19. Thyme and basil essential oils included in edible coatings as a natural preserving method of oilseed kernels.

    Science.gov (United States)

    Riveros, Cecilia G; Nepote, Valeria; Grosso, Nelson R

    2016-01-15

    Sunflower seeds are susceptible to developing rancidity and off-flavours through lipid oxidation. Edible coatings and essential oils have proven antioxidant properties in different food products. The purpose of this study was to evaluate the combined effect of using an edible coating and thyme and basil essential oils to preserve the chemical and sensory quality parameters of roasted sunflower seeds during storage. 50% DPPH inhibitory concentration (IC50) values of 0.278 and 0.0997 µg mL(-1) were observed for thyme and basil, respectively. On storage day 40, peroxide values were 80.68, 70.28, 68.43, 49.31 and 33.87 mEq O2 kg(-1) in roasted sunflower seeds (RS), roasted sunflower seeds coated with carboxymethyl cellulose (CMC) (RS-CMC), roasted sunflower seeds coated with CMC added with basil (RS-CMC-A), thyme (RS-CMC-T) and butylated hydroxytoluene (RS-CMC-BHT), respectively. RS-CMC-T and RS-CMC-BHT presented the lowest peroxide values, conjugated dienes and p-anisidine values during storage. RS-CMC-BHT, RS-CMC-T, and RS-CMC-A showed the lowest oxidized and cardboard flavour intensity ratings. On storage day 40, roasted sunflower flavour intensity ratings were higher in RS-CMC-T and RS-CMC-A. Thyme and basil essential oils added to the CMC coating improved the sensory stability of this product during storage, but only thyme essential oil increased their chemical stability. © 2015 Society of Chemical Industry.

  20. A de-novo-assembly-based Data Analysis Pipeline for Plant Obligate Parasite Metatranscriptomic Studies

    Directory of Open Access Journals (Sweden)

    Li Guo

    2016-07-01

    Full Text Available Current and emerging plant diseases caused by obligate parasitic microbes such as rusts, downy mildews, and powdery mildews threaten worldwide crop production and food safety. These obligate parasites are typically unculturable in the laboratory, posing technical challenges to characterize them at the genetic and genomic level. Here we have developed a data analysis pipeline integrating several bioinformatic software programs. This pipeline facilitates rapid gene discovery and expression analysis of a plant host and its obligate parasite simultaneously by next generation sequencing of mixed host and pathogen RNA (i.e. metatranscriptomics. We applied this pipeline to metatranscriptomic sequencing data of sweet basil (Ocimum basilicum and its obligate downy mildew parasite Peronospora belbahrii, both lacking a sequenced genome. Even with a single data point, we were able to identify both candidate host defense genes and pathogen virulence genes that are highly expressed during infection. This demonstrates the power of this pipeline for identifying genes important in host-pathogen interactions without prior genomic information for either the plant host or the obligate biotrophic pathogen. The simplicity of this pipeline makes it accessible to researchers with limited computational skills and applicable to metatranscriptomic data analysis in a wide range of plant-obligate-parasite systems.

  1. Genetics of sweet taste preferences†

    OpenAIRE

    Bachmanov, Alexander A; Bosak, Natalia P; Floriano, Wely B; Inoue, Masashi; Li, Xia; Lin, Cailu; Murovets, Vladimir O; Reed, Danielle R; Zolotarev, Vasily A; Beauchamp, Gary K

    2011-01-01

    Sweet taste is a powerful factor influencing food acceptance. There is considerable variation in sweet taste perception and preferences within and among species. Although learning and homeostatic mechanisms contribute to this variation in sweet taste, much of it is genetically determined. Recent studies have shown that variation in the T1R genes contributes to within- and between-species differences in sweet taste. In addition, our ongoing studies using the mouse model demonstrate that a sign...

  2. Effect of heat treatment to sweet potato flour on dough properties and characteristics of sweet potato-wheat bread.

    Science.gov (United States)

    Pérez, Isela Carballo; Mu, Tai-Hua; Zhang, Miao; Ji, Lei-Lei

    2017-12-01

    The effect of heat treatment at 90, 100, 110 and 120 ℃ for 20 min to sweet potato flour on dough properties and characteristics of sweet potato-wheat bread was investigated. The lightness (L*) and a* of sweet potato flour samples after heat treatment were increased, while the b* were decreased significantly, as well as the particle size, volume and area mean diameter ( p sweet potato flour was observed, where the number of irregular granules increased as the temperature increased from 90 to 120 ℃. Compared with sweet potato flour samples without heat treatment and with heat treatment at 90, 100 and 120 ℃, the gelatinization temperature and enthalpy change of sweet potato flour at 110 ℃ were the lowest, which were 77.94 ℃ and 3.67 J/g, respectively ( p sweet potato flour increased significantly from 1199 ml without heat treatment to 1214 ml at 90 ℃ ( p sweet potato-wheat bread with sweet potato flour after heat treatment increased significantly, which was the largest at 90 ℃ (2.53 cm 3 /g) ( p sweet potato flour could be potentially used in wheat bread production.

  3. The Effect of Biofertilizers and Winter Cover Crops on Essential Oil Production and Some Agroecological Characteristics of Basil (Ocimum basilicum L.

    Directory of Open Access Journals (Sweden)

    M Jahan

    2013-04-01

    basil in an ecological production system framework.

  4. Drug versus sweet reward: greater attraction to and preference for sweet versus drug cues.

    Science.gov (United States)

    Madsen, Heather B; Ahmed, Serge H

    2015-05-01

    Despite the unique ability of addictive drugs to directly activate brain reward circuits, recent evidence suggests that drugs induce reinforcing and incentive effects that are comparable to, or even lower than some nondrug rewards. In particular, when rats have a choice between pressing a lever associated with intravenous cocaine or heroin delivery and another lever associated with sweet water delivery, most respond on the latter. This outcome suggests that sweet water is more reinforcing and attractive than either drug. However, this outcome may also be due to the differential ability of sweet versus drug levers to elicit Pavlovian feeding-like conditioned responses that can cause involuntary lever pressing, such as pawing and biting the lever. To test this hypothesis, rats first underwent Pavlovian conditioning to associate one lever with sweet water (0.2% saccharin) and a different lever with intravenous cocaine (0.25 mg) or heroin (0.01 mg). Choice between these two levers was then assessed under two operant choice procedures: one that permitted the expression of Pavlovian-conditioned lever press responses during choice, the other not. During conditioning, Pavlovian-conditioned lever press responses were considerably higher on the sweet lever than on either drug lever, and slightly greater on the heroin lever than on the cocaine lever. Importantly, though these differences in Pavlovian-conditioned behavior predicted subsequent preference for sweet water during choice, they were not required for its expression. Overall, this study confirms that rats prefer the sweet lever because sweet water is more reinforcing and attractive than cocaine or heroin. © 2014 Society for the Study of Addiction.

  5. Activity of Ocimum basilicum, Ocimum canum, and Cymbopogon citratus essential oils against Plasmodium falciparum and mature-stage larvae of Anopheles funestus s.s.

    Directory of Open Access Journals (Sweden)

    Akono Ntonga Patrick

    2014-01-01

    Full Text Available The biological activities of essential oils from three plants grown in Cameroon: Ocimum basilicum, Ocimum canum, and Cymbopogon citratus were tested against Plasmodium falciparum and mature-stage larvae of Anopheles funestus. Gas chromatography and gas chromatography – mass spectrometry analyses showed that the main compounds are geranial, 1,8-cineole and linalool in C. citratus, O. canum and O. basilicum, respectively. Larvicidal tests carried out according to the protocol recommended by the World Health Organization showed that the essential oil of leaves of C. citratus is the most active against larvae of An. funestus (LC50 values = 35.5 ppm and 34.6 ppm, respectively, for larval stages III and IV after 6 h of exposure. Besides, the in vitro anti-plasmodial activity evaluated by the radioisotopic method showed that the C. citratus oil is the most active against P. falciparum, with an IC50 value of 4.2 ± 0.5 μg/mL compared with O. canum (20.6 ± 3.4 μg/mL and O. basilicum (21 ± 4.6 μg/mL. These essential oils can be recommended for the development of natural biocides for fighting the larvae of malaria vectors and for the isolation of natural products with anti-malarial activity.

  6. Inhibitory effect of leaves extracts of Ocimum basilicum and Ocimum gratissimum on two key enzymes involved in obesity and hypertension in vitro

    Directory of Open Access Journals (Sweden)

    Emmanuel Anyachukwu Irondi

    2016-12-01

    Full Text Available Aim: To evaluate the phenolics composition and inhibitory effect of the leaves extracts of Ocimum basilicum (O. basilicum and Ocimum gratissimum (O. gratissimum on two key enzymes [pancreatic lipase (PL and angiotensin 1-converting enzyme (ACE] involved in obesity and hypertension in vitro. Methods: The phenolics (flavonoids and phenolic acids were quantified using high performance liquid chromatrography coupled with diode array detection (HPLC-DAD. PL and ACE inhibitory effects; and DPPH* and ABTS*+ scavenging activities of the extracts were tested using Spectrophotometric methods. Results: O. basilicum had the following major phenolics: rutin, quercetin and quercitrin (flavonoids; caffeic, chlorogenic and gallic acids (phenolic acids; while O. gratissimum had the following major phenolics: rutin, quercitrin and luteolin (flavonoids; ellagic and chlorogenic acids (phenolic acids. Extracts of both plants inhibited PL and ACE; and scavenged DPPH* in a dose-dependent manner. O. gratissimum extract was more potent in inhibiting PL (IC50: 20.69 μg/mL and ACE (IC50: 29.44 μg/mL than O. basilicum (IC50: 52.14 μg/mL and IC50: 64.99 μg/mL, against PL and ACE, respectively. O. gratissimum also scavenged DPPH* and ABTS*+ more than O. basilicum. Conclusion: O. basilicum and O. gratissimum leaves could be used as functional foods for the management of obesity and obesity-related hypertension. However, O. gratissimum may be more effective than O. basilicum. [J Complement Med Res 2016; 5(4.000: 396-402

  7. Mosquitocidal and water purification properties of Ocimum sanctum and Phyllanthus emblica

    Directory of Open Access Journals (Sweden)

    Kadarkarai Murugan

    2012-12-01

    Full Text Available Ocimum sanctum was tested for its larvicidal and water sedimentation properties; the fruit ethanol and methanol extracts of Phyllanthus emblica were tested for phytochemical, larvicidal, oviposition-deterrent and ovicidal activities. Results emphasized that plant extracts have high toxicity against the egg and larvae of the malarial vector Anopheles stephensi and also have water sedimentation properties. LC50 of Phyllanthus emblica against Anopheles stephensi larvae ranged from 33.08 ppm to 81.26 ppm and from 23.44 to 54.19 ppm for ethanol and methanol extracts, respectively. Phyllanthus emblica also showed excellent ovipositional deterrent and ovicidal activities. The oviposition activity index value of ethanol and methanol extracts of Phyllanthus emblica at 500 ppm were -0.80 and -0.92, respectively. Ocimum sanctum includes both insecticidal secondary compounds, amino acids (glycine, lysine, vitamin C and other substances, that make treated water suitable for human consumption. Water quality parameters such as color, turbidity and pH were analyzed in the water samples (pre-treatment and post-treatment of plant extracts taken from the breeding sites of mosquitoes. Hence, the plant product can be used as both mosquitocidal and water purifier.

  8. Effect of essential oil from fresh leaves of Ocimum gratissimum L. on mycoflora during storage of peanuts in Benin.

    Science.gov (United States)

    Adjou, Euloge S; Kouton, Sandrine; Dahouenon-Ahoussi, Edwige; Soumanou, Mohamed M; Sohounhloue, Dominique C K

    2013-02-01

    The aim of this study was to evaluate the effect of essential oil from fresh leaves of Sweet Fennel (Ocimum gratissimum) on mycoflora and Aspergillus section Flavi populations in stored peanuts. Aspergillus, Fusarium and Mucor spp. were the most common genera identified from peanuts at post-harvest in Benin by using a taxonomic schemes primarily based on morphological characters of mycelium and conidia. The isolated fungi include Aspergillus niger, A. parasiticus, A. flavus, A. ochraceus, Fusarium graminearum, F. solani, F. oxysporum and Mucor spp. The most prevalent fungi recorded were A. niger (94.18 %), A. flavus (83.72 %), A. parasiticus (77.90 %), A. ochraceus (72.09 %), F. graminearum (59.30 %) and F. oxysporum (51.16 %). Antifungal assay, performed by the agar medium assay, indicated that essential oil exhibited high antifungal activity against the growth of A. flavus, A. parasiticus, A. ochraceus and F. oxysporium. The minimal inhibitory concentration (MIC) of the essential oil was found to be 7.5 μl/ml for A. flavus and A. parasiticus and 5.5 μl/ml for A. ochraceus and F. oxysporium. The minimal fungicidal concentration (MFC) was recorded to be 8.0 μl/ml for A. flavus and A. parasiticus, 6,5 μl/ml for A. ochraceus and 6.0 μl/ml for F. oxysporium. The essential oil was found to be strongly fungicidal and inhibitory to aflatoxin production. Chemical analysis by GC/MS of the components of the oil led to the identification of 31 components characterized by myrcene (6.4 %), α-thujene (8.2 %), p-cymene (17.6 %), γ-terpinene (20.0 %), and thymol (26.9 %) as major components. The essential oil of Sweet Fennel, with fungal growth and mycotoxin inhibitory properties, offers a novel approach to the management of storage, thus opening up the possibility to prevent mold contamination in stored peanuts.

  9. Toxicological Study of Ocimum sanctum Linn Leaves: Hematological, Biochemical, and Histopathological Studies

    Directory of Open Access Journals (Sweden)

    M. K. Gautam

    2014-01-01

    Full Text Available The present study was aimed to study the acute and subacute toxicity studies with orally administered 50% ethanolic leaves extract of Ocimum sanctum Linn (OSE. In acute toxicity tests, four groups of mice (n=6/group/sex were orally treated with doses of 200, 600, and 2000 mg/kg, and general behavior, adverse effects, and mortality were recorded for up to 14 days. In subacute toxicity study, rats received OSE by gavage at the doses of 200, 400, and 800 mg/kg/day (n=6/group/sex for 28 days, and biochemical, hematological, and histopathological changes in tissues (liver, kidney, spleen, heart, and testis/ovary were determined. OSE did not produce any hazardous symptoms or death and CNS and ANS toxicities in the acute toxicity test. Subacute treatment with OSE did not show any change in body weight, food and water consumption, and hematological and biochemical profiles. In addition, no change was observed both in macroscopic and microscopic aspects of vital organs in rats. Our result showed that Ocimum sanctum extract could be safe for human use.

  10. Assessment of compost for suppression of Fusarium oxysporum and ...

    African Journals Online (AJOL)

    user

    2012-08-28

    Aug 28, 2012 ... Biological characteristics including compost inhabiting microbial ... A solid-liquid extraction was carried out then; pH was determined by using AS-501 pH ...... oxysporum in sweet basil. Crop Prot. ... Pesticide Biochem. Physiol.

  11. BitterSweetForest: A random forest based binary classifier to predict bitterness and sweetness of chemical compounds

    Science.gov (United States)

    Banerjee, Priyanka; Preissner, Robert

    2018-04-01

    Taste of a chemical compounds present in food stimulates us to take in nutrients and avoid poisons. However, the perception of taste greatly depends on the genetic as well as evolutionary perspectives. The aim of this work was the development and validation of a machine learning model based on molecular fingerprints to discriminate between sweet and bitter taste of molecules. BitterSweetForest is the first open access model based on KNIME workflow that provides platform for prediction of bitter and sweet taste of chemical compounds using molecular fingerprints and Random Forest based classifier. The constructed model yielded an accuracy of 95% and an AUC of 0.98 in cross-validation. In independent test set, BitterSweetForest achieved an accuracy of 96 % and an AUC of 0.98 for bitter and sweet taste prediction. The constructed model was further applied to predict the bitter and sweet taste of natural compounds, approved drugs as well as on an acute toxicity compound data set. BitterSweetForest suggests 70% of the natural product space, as bitter and 10 % of the natural product space as sweet with confidence score of 0.60 and above. 77 % of the approved drug set was predicted as bitter and 2% as sweet with a confidence scores of 0.75 and above. Similarly, 75% of the total compounds from acute oral toxicity class were predicted only as bitter with a minimum confidence score of 0.75, revealing toxic compounds are mostly bitter. Furthermore, we applied a Bayesian based feature analysis method to discriminate the most occurring chemical features between sweet and bitter compounds from the feature space of a circular fingerprint.

  12. Yellow sweet potato flour: use in sweet bread processing to increase β-carotene content and improve quality.

    Science.gov (United States)

    Nogueira, Amanda C; Sehn, Georgia A R; Rebellato, Ana Paula; Coutinho, Janclei P; Godoy, Helena T; Chang, Yoon K; Steel, Caroline J; Clerici, Maria Teresa P S

    2018-01-01

    Yellow sweet potato is mostly produced by small farmers, and may be a source of energy and carotenoids in the human diet, but it is a highly perishable crop. To increase its industrial application, yellow sweet potato flour has been produced for use in bakery products. This study aimed to evaluate the technological quality and the carotenoids content in sweet breads produced with the replacement of wheat flour by 0, 3, 6, and 9% yellow sweet potato flour. Breads were characterized by technological parameters and β-carotene levels during nine days of storage. Tukey's test (p<0.05) was used for comparison between means. The increase in yellow sweet potato flour concentrations in bread led to a decrease of specific volume and firmness, and an increase in water activity, moisture, orange coloring, and carotenoids. During storage, the most significant changes were observed after the fifth day, with a decrease in intensity of the orange color. The β-carotene content was 0.1656 to 0.4715 µg/g in breads with yellow sweet potato flour. This work showed a novel use of yellow sweet potato in breads, which brings benefits to consumers' health and for the agricultural business.

  13. Determining the Threshold Value of Basil Yield Reduction and Evaluation of Water Uptake Models under Salinity Stress Condition

    Directory of Open Access Journals (Sweden)

    M. Sarai Tabrizi

    2016-10-01

    Full Text Available Introduction: Several mathematical models are being used for assessing the plant response to the salinity of the root zone. The salinity of the soil and water resources is a major challenge for agricultural sector in Iran. Several mathematical models have been developed for plant responses to the salinity stress. However, these models are often applicable in particular conditions. The objectives of this study were to evaluate the threshold value of Basil yield reduction, modeling Basil response to salinity and to evaluate the effectiveness of available mathematical models for the yield estimation of the Basil . Materials and Methods: The extensive experiments were conducted with 13 natural saline water treatments including 1.2, 1.8, 2, 2.2, 2.5, 2.8, 3, 3.5, 4, 5, 6, 8, and 10 dSm-1. Water salinity treatments were prepared by mixing Shoor River water with fresh water. In order to quantify the salinity effect on Basil yield, seven mathematical models including Maas and Hoffman (1977, van Genuchten and Hoffman (1984, Dirksen and Augustijn (1988, and Homaee et al., (2002 were used. One of the relatively recent methods for soil water content measurements is theta probes instrument. Theta probes instrument consists of four probes with 60 mm long and 3 mm diameter, a water proof container (probe structure, and a cable that links input and output signals to the data logger display. The advantages that have been attributed to this method are high precision and direct and rapid measurements in the field and greenhouse. The range of measurements is not limited like tensiometer and is from saturation to wilting point. In this study, Theta probes instrument was calibrated by weighing method for exact irrigation scheduling. Relative transpiration was calculated using daily soil water content changes. A coarse sand layer with 2 centimeters thick was used to decrease evaporation from the surface soil of the pots. Quantity comparison of the used models was done

  14. Dicty_cDB: Contig-U15678-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nating seedlings, TAMU Sola... 52 6e-10 3 ( DY336852 ) OB_SEa04P11.r OB_SEa Ocimum basil...efly Bemisia tabaci... 50 6e-10 2 ( T34713 ) EST73889 Human Bone Homo sapiens cDNA 5' end simi...qyiyiffiyiffffpklyif*kiilhpstqkkkkkkkkniisqhtv fcisi*ssp*nyffykkkik*ivfvfvliivifffpllnk*kkksffffliiyivi...qmyqphfkciliqaqtlte*lveqvmiqitf*lilq *rvklsiveplkfsinslinvlilvstlqvnkmqiplvevlkmf*dpskvvhnnhhhkyq nhnhnnhhnh... ... 60 5e-14 4 ( GE464933 ) 294762759 Nasonia vitripennis Adult Female Nasoni... 70 5e-14 2 ( BU819448 ) UA43BPG03 Populus trem

  15. Authentication of organically and conventionally grown basils by gas chromatograpy/mass spectrometry chemical profiles

    Science.gov (United States)

    Basil plants cultivated by organic and conventional farming practices were differentiated using gas chromatography/mass spectrometry (GC/MS) and chemometric methods. The two-way GC/MS data sets were baseline-corrected and retention time-aligned prior to data processing. Two self-devised fuzzy clas...

  16. Control of sweet potato virus diseases.

    Science.gov (United States)

    Loebenstein, Gad

    2015-01-01

    Sweet potato (Ipomoea batatas) is ranked seventh in global food crop production and is the third most important root crop after potato and cassava. Sweet potatoes are vegetative propagated from vines, root slips (sprouts), or tubers. Therefore, virus diseases can be a major constrain, reducing yields markedly, often more than 50%. The main viruses worldwide are Sweet potato feathery mottle virus (SPFMV) and Sweet potato chlorotic stunt virus (SPCSV). Effects on yields by SPFMV or SPCSV alone are minor, or but in complex infection by the two or other viruses yield losses of 50%. The orthodox way of controlling viruses in vegetative propagated crops is by supplying the growers with virus-tested planting material. High-yielding plants are tested for freedom of viruses by PCR, serology, and grafting to sweet potato virus indicator plants. After this, meristem tips are taken from those plants that reacted negative. The meristems were grown into plants which were kept under insect-proof conditions and away from other sweet potato material for distribution to farmers after another cycle of reproduction. © 2015 Elsevier Inc. All rights reserved.

  17. Hepatoprotective effects of parsley, basil, and chicory aqueous extracts against dexamethasone-induced in experimental rats

    Science.gov (United States)

    Soliman, Hanan A.; El-Desouky, Mohamed A.; Hozayen, Walaa G.; Ahmed, Rasha R.; Khaliefa, Amal K.

    2016-01-01

    Aim: The objective of this study is to investigate the hypoglycemic, hypolipidemic, and hepatoprotective effects of the aqueous extract of parsley, basil, and chicory whole plant in normal and dexamethasone (Dex) rats. Materials and Methods: 50 female albino rats were used in this study and divided into 5 groups (for each 10). Group (1) fed basal diet and maintained as negative control group. Group (2) received Dex in a dose of (0.1 mg/kg b. wt.). Groups 3, 4, and 5 were treated with Dex along with three different plant extracts of parsley, basil, and chicory (2 g/kg b. wt.), (400 mg/kg b. wt.), and (100 mg/kg b. wt.), respectively. Results: All these groups were treated given three times per week for 8 consecutive weeks. Dex-induced alterations in the levels of serum glucose, triglyceride, cholesterol, low-density lipoprotein-cholesterol levels and cardiovascular indices and serum alanine aminotransferase, aspartate aminotransferase and lactate dehydrogenase activities, liver thiobarbituric acid (TBARS) levels increased, while high-density lipoprotein-cholesterol, total protein, albumin, and liver glutathione (GSH) levels decreased. On the other hand, plant extracts succeeded to modulate these observed abnormalities resulting from Dex as indicated by the reduction of glucose, cholesterol, TBARS, and the pronounced improvement of the investigated biochemical and antioxidant parameters. Conclusions: It was concluded that probably, due to its antioxidant property, parsley, basil, and chicory extracts have hepatoprotective effects in Dex-induced in rats. PMID:27069727

  18. Yellow sweet potato flour: use in sweet bread processing to increase β-carotene content and improve quality

    Directory of Open Access Journals (Sweden)

    AMANDA C. NOGUEIRA

    2018-02-01

    Full Text Available ABSTRACT Yellow sweet potato is mostly produced by small farmers, and may be a source of energy and carotenoids in the human diet, but it is a highly perishable crop. To increase its industrial application, yellow sweet potato flour has been produced for use in bakery products. This study aimed to evaluate the technological quality and the carotenoids content in sweet breads produced with the replacement of wheat flour by 0, 3, 6, and 9% yellow sweet potato flour. Breads were characterized by technological parameters and β-carotene levels during nine days of storage. Tukey’s test (p<0.05 was used for comparison between means. The increase in yellow sweet potato flour concentrations in bread led to a decrease of specific volume and firmness, and an increase in water activity, moisture, orange coloring, and carotenoids. During storage, the most significant changes were observed after the fifth day, with a decrease in intensity of the orange color. The β-carotene content was 0.1656 to 0.4715 µg/g in breads with yellow sweet potato flour. This work showed a novel use of yellow sweet potato in breads, which brings benefits to consumers’ health and for the agricultural business.

  19. Formulation and in Vivo Evaluation for Anti-Aging Effects of an Emulsion Containing Basil Extract Using non- Invasive Biophysical Techniques

    Directory of Open Access Journals (Sweden)

    N. Akhtar

    2011-12-01

    Full Text Available Background and the purpose of study: Skin aging is a complex process induced by constant exposure to ultraviolet (UV irradiation and damages human skin. UV generates reactive oxygen species leading to collagen deficiency and eventually skin wrinkling. Basil contains a number of phenolics and favonoids which possess antioxidant properties. The aim of this study was to formulate and investigate the antiaging potential of a cream containing Basil extract. Methods: A single blinded study was conducted using non-invasive methods. Formulation containing 3% of the concentrated extract of Basil was developed by entrapping in the inner aqueous phase of w/o emulsion and base contained no extract. Both creams were stored at different storage conditions of 8°C, 25°C, 40°C and 40°C+ 75% relative humidity to predict their stabilities. The formulation and base were evaluated for their effects on various skin parameters i.e., moisture and trans epidermal water loss (TEWL, volume, energy and surface evaluation of the living skin (SELS. Results: Significant effects (p≤0.05 were observed for both creams in the case of TEWL. The base showed insignificant (p≤0.05 while formulation showed significant effects on skin moisture. Volume, SELS SEr (skin roughness, SEsc (skin scaliness, SEsm (skin smoothness, SEw (skin wrinkles parameter showed significant decline while texture parameter of ‘Energy' showed significant increase. Conclusion: The results statistically indicated that the active formulation containg extract of Basil exert antiaging effects when applied topically.

  20. Effect of irradiation on sweet corn preservation

    International Nuclear Information System (INIS)

    Fu Junjie

    2002-01-01

    60 Co γ-ray was used to irradiate newly-harvested sweet corn and the results showed that the effects of irradiation on soluble solids, sucrose, starch and total sugar were not significant. The viscosity of starch decreased with the increasing of irradiation dose. The preservation duration of irradiated sweet corn was 7 days longer than that of CK, and the sweet, smell, taste of sweet corn had no abnormal change

  1. Motifs et manifestations de l’amour de l’homme pour Dieu et l’amour du prochain selon Saint Basile le Grand

    Directory of Open Access Journals (Sweden)

    Ernest Janczyk

    2017-04-01

    Full Text Available This article addresses the issue of the motivation of the fundamental order of love for God and the neighbour which Saint Basil the Great used in his doctrine. Based on an analysis of the texts of Saint Basil, this article demonstrates the intimate relationship that should exist between the love for God and the love for man. The ideal of this relationship is represented, according to the analysis, by Jesus Christ, the only Saviour of the world.

  2. Storage performance of Taiwanese sweet potato cultivars.

    Science.gov (United States)

    Huang, Che-Lun; Liao, Wayne C; Chan, Chin-Feng; Lai, Yung-Chang

    2014-12-01

    Three sweet potato cultivars (TNG57, TNG66, and TNG73), provided by the Taiwanese Agricultural Research Institute (TARI), were stored at either 15 °C or under ambient conditions (23.8 ~ 28.4 °C and 77.1 ~ 81.0 % of relative humidity). Sweet potato roots were randomly chosen from each replicate and evaluated for measurement of weight loss, sugar content analysis, and sprouting after 0, 14, 24, 48, 56, 70, 84, and 98 days of storage. Fresh sweet potato roots were baked at 200 °C for 60 min then samples were taken for sugar analysis. After 14 days of ambient condition storage, the sprouting percentages for TNG57, TNG66, and TNG73 were 100, 85, and 95 % respectively. When sweet potatoes were stored at 15 °C, the weight loss became less and no sweet potato root sprouted after 14 days of storage. Because manufacturers can store sweet potatoes at 15 °C for almost 2 month without other treatments, the supply capacity shortage in July and September can be reduced. The total sugar content slowly increased along with increasing the storage time. After baking, the total sugar content of sweet potatoes significantly increased due to the formation of maltose. Maltose became the major sugar of baked sweet potatoes. Raw sweet potatoes stored at 15 °C had higher total sugar contents after baking than those stored under ambient conditions. Raw sweet potatoes were recommended to be stored at 15 °C before baking.

  3. Sweet Marjoram

    Science.gov (United States)

    Bina, Fatemeh; Rahimi, Roja

    2016-01-01

    Origanum majorana L. commonly known as sweet marjoram has been used for variety of diseases in traditional and folklore medicines, including gastrointestinal, ocular, nasopharyngeal, respiratory, cardiac, rheumatologic, and neurological disorders. Essential oil containing monoterpene hydrocarbons and oxygenated monoterpenes as well as phenolic compounds are chemical constituents isolated and detected in O majorana. Wide range of pharmacological activities including antioxidant, hepatoprotective, cardioprotective, anti-platelet, gastroprotective, antibacterial and antifungal, antiprotozoal, antiatherosclerosis, anti-inflammatory, antimetastatic, antitumor, antiulcer, and anticholinesterase inhibitory activities have been reported from this plant in modern medicine. This article summarizes comprehensive information concerning traditional uses, phytochemistry, and pharmacological activities of sweet marjoram. PMID:27231340

  4. Alcoholic fermentation of stored sweet potatoes

    Energy Technology Data Exchange (ETDEWEB)

    Yutaka, Y; One, H

    1958-01-01

    Sweet potatoes were ground and stored in a ground hold. The stored sweet potatoes gave about 90% fermentation efficiency by the koji process. A lower fermentation efficiency by the amylo process was improved by adding 20 to 30 mg/100 ml of organic N. Inorganic N has no effect in improving the fermentation efficiency of the stored sweet potatoes by the amylo process.

  5. dbSWEET: An Integrated Resource for SWEET Superfamily to Understand, Analyze and Predict the Function of Sugar Transporters in Prokaryotes and Eukaryotes.

    Science.gov (United States)

    Gupta, Ankita; Sankararamakrishnan, Ramasubbu

    2018-04-14

    SWEET (Sweet Will Eventually be Exported Transporter) proteins have been recently discovered and form one of the three major families of sugar transporters. Homologs of SWEET are found in both prokaryotes and eukaryotes. Bacterial SWEET homologs have three transmembrane segments forming a triple-helical bundle (THB) and the functional form is dimers. Eukaryotic SWEETs have seven transmembrane helical segments forming two THBs with a linker helix. Members of SWEET homologs have been shown to be involved in several important physiological processes in plants. However, not much is known regarding the biological significance of SWEET homologs in prokaryotes and in mammals. We have collected more than 2000 SWEET homologs from both prokaryotes and eukaryotes. For each homolog, we have modeled three different conformational states representing outward open, inward open and occluded states. We have provided details regarding substrate-interacting residues and residues forming the selectivity filter for each SWEET homolog. Several search and analysis options are available. The users can generate a phylogenetic tree and structure-based sequence alignment for selected set of sequences. With no metazoan SWEETs functionally characterized, the features observed in the selectivity filter residues can be used to predict the potential substrates that are likely to be transported across the metazoan SWEETs. We believe that this database will help the researchers to design mutational experiments and simulation studies that will aid to advance our understanding of the physiological role of SWEET homologs. This database is freely available to the scientific community at http://bioinfo.iitk.ac.in/bioinfo/dbSWEET/Home. Copyright © 2018. Published by Elsevier Ltd.

  6. Extracts of edible and medicinal plants damage membranes of Vibrio cholerae.

    Science.gov (United States)

    Sánchez, Eduardo; García, Santos; Heredia, Norma

    2010-10-01

    The use of natural compounds from plants can provide an alternative approach against food-borne pathogens. The mechanisms of action of most plant extracts with antimicrobial activity have been poorly studied. In this work, changes in membrane integrity, membrane potential, internal pH (pH(in)), and ATP synthesis were measured in Vibrio cholerae cells after exposure to extracts of edible and medicinal plants. A preliminary screen of methanolic, ethanolic, and aqueous extracts of medicinal and edible plants was performed. Minimal bactericidal concentrations (MBCs) were measured for extracts showing high antimicrobial activity. Our results indicate that methanolic extracts of basil (Ocimum basilicum L.), nopal cactus (Opuntia ficus-indica var. Villanueva L.), sweet acacia (Acacia farnesiana L.), and white sagebrush (Artemisia ludoviciana Nutt.) are the most active against V. cholera, with MBCs ranging from 0.5 to 3.0 mg/ml. Using four fluorogenic techniques, we studied the membrane integrity of V. cholerae cells after exposure to these four extracts. Extracts from these plants were able to disrupt the cell membranes of V. cholerae cells, causing increased membrane permeability, a clear decrease in cytoplasmic pH, cell membrane hyperpolarization, and a decrease in cellular ATP concentration in all strains tested. These four plant extracts could be studied as future alternatives to control V. cholerae contamination in foods and the diseases associated with this microorganism.

  7. Extracts of Edible and Medicinal Plants Damage Membranes of Vibrio cholerae▿

    Science.gov (United States)

    Sánchez, Eduardo; García, Santos; Heredia, Norma

    2010-01-01

    The use of natural compounds from plants can provide an alternative approach against food-borne pathogens. The mechanisms of action of most plant extracts with antimicrobial activity have been poorly studied. In this work, changes in membrane integrity, membrane potential, internal pH (pHin), and ATP synthesis were measured in Vibrio cholerae cells after exposure to extracts of edible and medicinal plants. A preliminary screen of methanolic, ethanolic, and aqueous extracts of medicinal and edible plants was performed. Minimal bactericidal concentrations (MBCs) were measured for extracts showing high antimicrobial activity. Our results indicate that methanolic extracts of basil (Ocimum basilicum L.), nopal cactus (Opuntia ficus-indica var. Villanueva L.), sweet acacia (Acacia farnesiana L.), and white sagebrush (Artemisia ludoviciana Nutt.) are the most active against V. cholera, with MBCs ranging from 0.5 to 3.0 mg/ml. Using four fluorogenic techniques, we studied the membrane integrity of V. cholerae cells after exposure to these four extracts. Extracts from these plants were able to disrupt the cell membranes of V. cholerae cells, causing increased membrane permeability, a clear decrease in cytoplasmic pH, cell membrane hyperpolarization, and a decrease in cellular ATP concentration in all strains tested. These four plant extracts could be studied as future alternatives to control V. cholerae contamination in foods and the diseases associated with this microorganism. PMID:20802077

  8. De novo production of six key grape aroma monoterpenes by a geraniol synthase-engineered S. cerevisiae wine strain.

    Science.gov (United States)

    Pardo, Ester; Rico, Juan; Gil, José Vicente; Orejas, Margarita

    2015-09-16

    Monoterpenes are important contributors to grape and wine aroma. Moreover, certain monoterpenes have been shown to display health benefits with antimicrobial, anti-inflammatory, anticancer or hypotensive properties amongst others. The aim of this study was to construct self-aromatizing wine yeasts to overproduce de novo these plant metabolites in wines. Expression of the Ocimum basilicum (sweet basil) geraniol synthase (GES) gene in a Saccharomyces cerevisiae wine strain substantially changed the terpene profile of wine produced from a non-aromatic grape variety. Under microvinification conditions, and without compromising other fermentative traits, the recombinant yeast excreted geraniol de novo at an amount (~750 μg/L) well exceeding (>10-fold) its threshold for olfactory perception and also exceeding the quantities present in wines obtained from highly aromatic Muscat grapes. Interestingly, geraniol was further metabolized by yeast enzymes to additional monoterpenes and esters: citronellol, linalool, nerol, citronellyl acetate and geranyl acetate, resulting in a total monoterpene concentration (~1,558 μg/L) 230-fold greater than that of the control. We also found that monoterpene profiles of wines derived from mixed fermentations were found to be determined by the composition of the initial yeast inocula suggesting the feasibility of producing 'à la carte' wines having predetermined monoterpene contents. Geraniol synthase-engineered yeasts demonstrate potential in the development of monoterpene enhanced wines.

  9. ‘Norine’, a cinnamon-linalool hybrid cultivar of basil

    Directory of Open Access Journals (Sweden)

    Arie Fitzgerald Blank

    2015-12-01

    Full Text Available 'Norine’ is a hybrid cultivar of basil, adapted to the Northeastern Brazil, which is derived from the cultivars ‘Cinnamon’ and ‘Maria Bonita’. It has essential oil content of 2.91% and yield of 2.37 mL plant-1. The main chemical compounds of the essential oil are (E-methyl cinnamate (41.93 % and linalool (34.92 %. ‘Norine’ is characterized by presenting upright growth habit, rounded crown, mean height of 55 cm, mean crown diameter of 59 cm, mean leaf length of 8.4 cm, and mean leaf width of 4.5 cm.

  10. Bitter and sweet tasting molecules: It's complicated.

    Science.gov (United States)

    Di Pizio, Antonella; Ben Shoshan-Galeczki, Yaron; Hayes, John E; Niv, Masha Y

    2018-04-19

    "Bitter" and "sweet" are frequently framed in opposition, both functionally and metaphorically, in regard to affective responses, emotion, and nutrition. This oppositional relationship is complicated by the fact that some molecules are simultaneously bitter and sweet. In some cases, a small chemical modification, or a chirality switch, flips the taste from sweet to bitter. Molecules humans describe as bitter are recognized by a 25-member subfamily of class A G-protein coupled receptors (GPCRs) known as TAS2Rs. Molecules humans describe as sweet are recognized by a TAS1R2/TAS1R3 heterodimer of class C GPCRs. Here we characterize the chemical space of bitter and sweet molecules: the majority of bitter compounds show higher hydrophobicity compared to sweet compounds, while sweet molecules have a wider range of sizes. Importantly, recent evidence indicates that TAS1Rs and TAS2Rs are not limited to the oral cavity; moreover, some bitterants are pharmacologically promiscuous, with the hERG potassium channel, cytochrome P450 enzymes, and carbonic anhydrases as common off-targets. Further focus on polypharmacology may unravel new physiological roles for tastant molecules. Copyright © 2018 Elsevier B.V. All rights reserved.

  11. A Shigella sonnei outbreak traced to imported basil--the importance of good typing tools and produce traceability systems, Norway, 2011.

    Science.gov (United States)

    Guzman-Herrador, B R; Nilsen, E; Cudjoe, K S; Jensvoll, L; Kvamme, J M; Lindegård Aanstad, A; Lindstedt, B A; Nygård, K; Severinsen, G; Werner-Johansen, Ø; Wester, A L; Wiklund, M; Vold, L

    2013-12-05

    On 9 October 2011, the University Hospital of North Norway alerted the Norwegian Institute of Public Health (NIPH) about an increase in Shigella sonnei infections in Tromsø. The isolates had an identical ‘multilocus variable-number tandem repeat analysis’ (MLVA) profile. Most cases had consumed food provided by delicatessen X. On 14 October, new S. sonnei cases with the same MLVA-profile were reported from Sarpsborg, south-eastern Norway. An outbreak investigation was started to identify the source and prevent further cases. All laboratory-confirmed cases from both clusters were attempted to be interviewed. In addition, a cohort study was performed among the attendees of a banquet in Tromsø where food from delicatessen X had been served and where some people had reported being ill. A trace-back investigation was initiated. In total, 46 cases were confirmed (Tromsø= 42; Sarpsborg= 4). Having eaten basil pesto sauce or fish soup at the banquet in Tromsø were independent risk factors for disease. Basil pesto was the only common food item that had been consumed by confirmed cases occurring in Tromsø and Sarpsborg. The basil had been imported and delivered to both municipalities by the same supplier. No basil from the specific batch was left on the Norwegian market when it was identified as the likely source. As a result of the multidisciplinary investigation, which helped to identify the source, the Norwegian Food Safety Authority, together with NIPH, planned to develop recommendations for food providers on how to handle fresh plant produce prior to consumption.

  12. Chemical composition and antimicrobial properties of different basil essential oils chemotypes from Togo

    OpenAIRE

    Koffi Koba; P.W. Poutouli; Christine Raynaud; Jean-Pierre Chaumont; Komla Sanda

    2009-01-01

    The aerial parts essential oils of Ocimum basilicum (Lamiaceae) from Togo were steam-distilled and investigated for their percentage composition (GC and GC/MS) and in vitro antimicrobial activities. Five oil chemotypes were identified and classified as follows in line with their principal components: estragole type; linalool/estragole type; methyleugenol type; methyleugenol/t-anethole type; t-anethole type. The in vitro microbiological experiments revealed that only the methyleugenol and meth...

  13. Preliminary investigation into the pressing process of sweet pearl millet and sweet sorghum biomass for ethanol production

    Energy Technology Data Exchange (ETDEWEB)

    Crepeau, M.; Khelifi, M.; Vanasse, A. [Laval Univ., Quebec City, PQ (Canada). Dept. of Soil Science and Agri-Food Engineering

    2010-07-01

    Corn is the main source for biofuel production in North America. However, both sweet pearl millet and sweet sorghum crops represent an interesting alternative to corn for ethanol production because of their high biomass yield under a wide range of environmental conditions and high concentration of readily fermentable sugars. Coproducts such as pressing residues can be also be utilized so that nothing is lost in the process. However, in order to improve the extraction of juice for ethanol production, the pressing process of this biomass must be optimized. Preliminary experiments were therefore conducted to optimize the juice extraction from sweet pearl millet and sweet sorghum using 2 different presses, notably a screw press and a manually operated hydraulic press. Both types of biomass were either chopped finely or coarsely and were exposed to various pressures with the hydraulic press. The volume of juice extracted from both crops increased linearly with increasing pressure. Sweet sorghum appeared to be a better feedstock for ethanol production because it produced about 0.03 to 0.06 litre of juice per kg of biomass more than sweet pearl millet. Juice extraction was more effective with the screw press, but only a small difference was noted between the 2 chopping modes.

  14. The Impact of Location and Growing Medium on Harvest Yield and Flavor of Basil and Squash Microgreens

    Science.gov (United States)

    Leal, J.; Ventura, C. J.

    2016-12-01

    The purpose of this experiment is to discover the most efficient, feasible way to produce a high yield of flavorful microgreens within the best growing medium and building location at the Stanford Educational Farm. In recent years, microgreens, young, small edible greens utilized as flavor garnishes for fine dining, have evolved into an immensely profitable market that will continue to expand and prosper. To capitalize on such opportunities, the primary metrics focused upon are harvest yield and flavor of basil and squash microgreens, as they develop in different concentrations of quick root and compost while located in either a greenhouse or lath house. It was hypothesized that if basil and squash microgreens were grown in a mixture of 50% compost and 50% quick root in the greenhouse, then they would produce the greatest harvest yield and maximum amount of flavor. The general experimental protocol includes monitoring the growth of the microgreens, then harvesting directly after the first true leaves begin to emerge. Upon harvest, each set of microgreens are separated into different clear glass jars to place on a small scale for weighing to determine the yield and tasting the leaves to analyze the flavor content. The highest yield of basil (63 grams) developed in a tray of 100% quick root in the lath house, while the greatest yield of squash (51 grams) succeeded in 100% quick root in the greenhouse. Overall however, the basil grew fastest in the greenhouse but tasted stronger in the lath house. Additionally, because the harvest yield and flavor results were so poor in all other locations and growing mediums for squash during the first trial, it cannot be considered a viable microgreen. In the future, more trials should be conducted for greater numbers of trays of microgreens to collect more data. The nutritional value of microgreens should also be explored further to obtain a holistic approach to the value of these plants from seed to harvest to consumption.

  15. Phenolic extract from Ocimum basilicum restores lipid metabolism in Triton WR-1339-induced hyperlipidemic mice and prevents lipoprotein-rich plasma oxidation

    Directory of Open Access Journals (Sweden)

    Ilham Touiss

    2017-03-01

    Full Text Available In this study we investigated the hypolipidemic and anti-lipoprotein-oxidation activities of phenolic extract from sweet basil a popular culinary herb. The hypolipidemic activity was studied in mice model injected intraperitoneally with Triton WR-1339 at a dose of 200 mg/kg body weight. The animals were grouped as follows: normolipidemic control group (n = 8, hyperlipidemic control group (n = 8 and phenolic extract-treated group (n = 8 at a dose of 200 mg/kg body weight. After 7 h and 24 h treatment, the oral administration of the phenolic extract exerts a significant reduction of plasma total cholesterol, triglycerides and LDL-cholesterol concentrations (P < 0.001. On the other hand, we demonstrated that the phenolic extract prevents plasma lipid oxidation by 16% (P < 0.001, 20% (P < 0.001, 32% (P < 0.001 and 44% (P < 0.001 at a doses of 10, 25, 50 and 100 μg/mL, respectively. The results were compared with ascorbic acid used as standard synthetic antioxidant. HPLC analysis shows that the extract contains 4 major phenolics and is especially rich in rosmarinic acid. This finding indicates that the phenolic extract might be beneficial in lowering hyperlipidemia and preventing atherosclerosis.

  16. Kernel compositions of glyphosate-tolerant and corn rootworm-protected MON 88017 sweet corn and insect-protected MON 89034 sweet corn are equivalent to that of conventional sweet corn (Zea mays).

    Science.gov (United States)

    Curran, Kassie L; Festa, Adam R; Goddard, Scott D; Harrigan, George G; Taylor, Mary L

    2015-03-25

    Monsanto Co. has developed two sweet corn hybrids, MON 88017 and MON 89034, that contain biotechnology-derived (biotech) traits designed to enhance sustainability and improve agronomic practices. MON 88017 confers benefits of glyphosate tolerance and protection against corn rootworm. MON 89034 provides protection against European corn borer and other lepidopteran insect pests. The purpose of this assessment was to compare the kernel compositions of MON 88017 and MON 89034 sweet corn with that of a conventional control that has a genetic background similar to the biotech sweet corn but does not express the biotechnology-derived traits. The sweet corn samples were grown at five replicated sites in the United States during the 2010 growing season and the conventional hybrid and 17 reference hybrids were grown concurrently to provide an estimate of natural variability for all assessed components. The compositional analysis included proximates, fibers, amino acids, sugars, vitamins, minerals, and selected metabolites. Results highlighted that MON 88017 and MON 89034 sweet corns were compositionally equivalent to the conventional control and that levels of the components essential to the desired properties of sweet corn, such as sugars and vitamins, were more affected by growing environment than the biotech traits. In summary, the benefits of biotech traits can be incorporated into sweet corn with no adverse effects on nutritional quality.

  17. Adopting adequate leaching requirement for practical response models of basil to salinity

    Science.gov (United States)

    Babazadeh, Hossein; Tabrizi, Mahdi Sarai; Darvishi, Hossein Hassanpour

    2016-07-01

    Several mathematical models are being used for assessing plant response to salinity of the root zone. Objectives of this study included quantifying the yield salinity threshold value of basil plants to irrigation water salinity and investigating the possibilities of using irrigation water salinity instead of saturated extract salinity in the available mathematical models for estimating yield. To achieve the above objectives, an extensive greenhouse experiment was conducted with 13 irrigation water salinity levels, namely 1.175 dS m-1 (control treatment) and 1.8 to 10 dS m-1. The result indicated that, among these models, the modified discount model (one of the most famous root water uptake model which is based on statistics) produced more accurate results in simulating the basil yield reduction function using irrigation water salinities. Overall the statistical model of Steppuhn et al. on the modified discount model and the math-empirical model of van Genuchten and Hoffman provided the best results. In general, all of the statistical models produced very similar results and their results were better than math-empirical models. It was also concluded that if enough leaching was present, there was no significant difference between the soil salinity saturated extract models and the models using irrigation water salinity.

  18. The bamboo-eating giant panda (Ailuropoda melanoleuca) has a sweet tooth: behavioral and molecular responses to compounds that taste sweet to humans.

    Science.gov (United States)

    Jiang, Peihua; Josue-Almqvist, Jesusa; Jin, Xuelin; Li, Xia; Brand, Joseph G; Margolskee, Robert F; Reed, Danielle R; Beauchamp, Gary K

    2014-01-01

    A growing body of behavioral and genetic information indicates that taste perception and food sources are highly coordinated across many animal species. For example, sweet taste perception is thought to serve to detect and motivate consumption of simple sugars in plants that provide calories. Supporting this is the observation that most plant-eating mammals examined exhibit functional sweet perception, whereas many obligate carnivores have independently lost function of their sweet taste receptors and exhibit no avidity for simple sugars that humans describe as tasting sweet. As part of a larger effort to compare taste structure/function among species, we examined both the behavioral and the molecular nature of sweet taste in a plant-eating animal that does not consume plants with abundant simple sugars, the giant panda (Ailuropoda melanoleuca). We evaluated two competing hypotheses: as plant-eating mammals, they should have a well-developed sweet taste system; however, as animals that do not normally consume plants with simple sugars, they may have lost sweet taste function, as has occurred in strict carnivores. In behavioral tests, giant pandas avidly consumed most natural sugars and some but not all artificial sweeteners. Cell-based assays revealed similar patterns of sweet receptor responses toward many of the sweeteners. Using mixed pairs of human and giant panda sweet taste receptor units (hT1R2+gpT1R3 and gpT1R2+hT1R3) we identified regions of the sweet receptor that may account for behavioral differences in giant pandas versus humans toward various sugars and artificial sweeteners. Thus, despite the fact that the giant panda's main food, bamboo, is very low in simple sugars, the species has a marked preference for several compounds that taste sweet to humans. We consider possible explanations for retained sweet perception in this species, including the potential extra-oral functions of sweet taste receptors that may be required for animals that consume

  19. The bamboo-eating giant panda (Ailuropoda melanoleuca has a sweet tooth: behavioral and molecular responses to compounds that taste sweet to humans.

    Directory of Open Access Journals (Sweden)

    Peihua Jiang

    Full Text Available A growing body of behavioral and genetic information indicates that taste perception and food sources are highly coordinated across many animal species. For example, sweet taste perception is thought to serve to detect and motivate consumption of simple sugars in plants that provide calories. Supporting this is the observation that most plant-eating mammals examined exhibit functional sweet perception, whereas many obligate carnivores have independently lost function of their sweet taste receptors and exhibit no avidity for simple sugars that humans describe as tasting sweet. As part of a larger effort to compare taste structure/function among species, we examined both the behavioral and the molecular nature of sweet taste in a plant-eating animal that does not consume plants with abundant simple sugars, the giant panda (Ailuropoda melanoleuca. We evaluated two competing hypotheses: as plant-eating mammals, they should have a well-developed sweet taste system; however, as animals that do not normally consume plants with simple sugars, they may have lost sweet taste function, as has occurred in strict carnivores. In behavioral tests, giant pandas avidly consumed most natural sugars and some but not all artificial sweeteners. Cell-based assays revealed similar patterns of sweet receptor responses toward many of the sweeteners. Using mixed pairs of human and giant panda sweet taste receptor units (hT1R2+gpT1R3 and gpT1R2+hT1R3 we identified regions of the sweet receptor that may account for behavioral differences in giant pandas versus humans toward various sugars and artificial sweeteners. Thus, despite the fact that the giant panda's main food, bamboo, is very low in simple sugars, the species has a marked preference for several compounds that taste sweet to humans. We consider possible explanations for retained sweet perception in this species, including the potential extra-oral functions of sweet taste receptors that may be required for animals

  20. Economic feasibility of intercropping of chili with sweet gourd

    Directory of Open Access Journals (Sweden)

    J Hossain

    2015-12-01

    Full Text Available A field experiment was conducted at Regional Agricultural Research Station, Bangladesh Agricultural Research Institute (BARI, Ishurdi, Pabna during two consecutive years of 2012-2013 and 2013-2014 to find out the suitable combination of intercropping of chili with sweet gourd for increasing the productivity and economic return. The treatments were T1=100% sweet gourd (2m x 2m + 40% chili (50cm x 100cm + 100% recommended fertilizer (RF of chili, T2=100% sweet gourd (2m x 2m + 40% chili (50cm x 100cm + 75% RF of chili, T3=100% sweet gourd (2m x 2m + 40% chili (50cm x 100cm + 50% RF of chili, T4=100% sweet gourd (2m x 2m + 50% chili (50cm x 80cm + 100% RF of chili, T5=100% sweet gourd (2m x 2m + 50% chili (50cm x 80cm + 75% RF of chili, T6=100% sweet gourd (2m x 2m + 50% chili (50cm x 80cm + 50% RF of chili, T7=Sole sweet gourd, T8= Sole chili. The experiment was laid out in a randomized complete block design with three replications. Fruit yield was calculated for sweet gourd and chili in ton per hectare considering the whole plot as harvested area. Results revealed that the yield of both sweet gourd and chili significantly affected by plant population and fertilizer dose in the intercropping systems. The highest equivalent yield of sweet gourd (21.21 t ha-1, land equivalent ratio (1.59, gross return (Tk. 318150.00 ha-1, gross margin (Tk. 237935.00 ha-1 and benefit cost ratio (3.97 were obtained from 100% sweet gourd (2m x 2m + 50% chili (50cm x 80cm + 100% RF of chili (T4. Sole crop of chili (T8 gave the lowest equivalent yield of sweet gourd (7.38 t ha-1, gross return (Tk. 110700.00 ha-1, gross margin (Tk. 37455.00 ha-1 and benefit cost ratio (1.51. Therefore, sweet gourd (100% and chili (50% with recommended fertilizer (100% of chili might be economically profitable for chili with sweet gourd intercropping system.

  1. The current incidence of viral disease in korean sweet potatoes and development of multiplex rt-PCR assays for simultaneous detection of eight sweet potato viruses.

    Science.gov (United States)

    Kwak, Hae-Ryun; Kim, Mi-Kyeong; Shin, Jun-Chul; Lee, Ye-Ji; Seo, Jang-Kyun; Lee, Hyeong-Un; Jung, Mi-Nam; Kim, Sun-Hyung; Choi, Hong-Soo

    2014-12-01

    Sweet potato is grown extensively from tropical to temperate regions and is an important food crop worldwide. In this study, we established detection methods for 17 major sweet potato viruses using single and multiplex RT-PCR assays. To investigate the current incidence of viral diseases, we collected 154 samples of various sweet potato cultivars showing virus-like symptoms from 40 fields in 10 Korean regions, and analyzed them by RT-PCR using specific primers for each of the 17 viruses. Of the 17 possible viruses, we detected eight in our samples. Sweet potato feathery mottle virus (SPFMV) and sweet potato virus C (SPVC) were most commonly detected, infecting approximately 87% and 85% of samples, respectively. Furthermore, Sweet potato symptomless virus 1 (SPSMV-1), Sweet potato virus G (SPVG), Sweet potato leaf curl virus (SPLCV), Sweet potato virus 2 ( SPV2), Sweet potato chlorotic fleck virus (SPCFV), and Sweet potato latent virus (SPLV) were detected in 67%, 58%, 47%, 41%, 31%, and 20% of samples, respectively. This study presents the first documented occurrence of four viruses (SPVC, SPV2, SPCFV, and SPSMV-1) in Korea. Based on the results of our survey, we developed multiplex RT-PCR assays for simple and simultaneous detection of the eight sweet potato viruses we recorded.

  2. The Current Incidence of Viral Disease in Korean Sweet Potatoes and Development of Multiplex RT-PCR Assays for Simultaneous Detection of Eight Sweet Potato Viruses

    Directory of Open Access Journals (Sweden)

    Hae-Ryun Kwak

    2014-12-01

    Full Text Available Sweet potato is grown extensively from tropical to temperate regions and is an important food crop worldwide. In this study, we established detection methods for 17 major sweet potato viruses using single and multiplex RT-PCR assays. To investigate the current incidence of viral diseases, we collected 154 samples of various sweet potato cultivars showing virus-like symptoms from 40 fields in 10 Korean regions, and analyzed them by RT-PCR using specific primers for each of the 17 viruses. Of the 17 possible viruses, we detected eight in our samples. Sweet potato feathery mottle virus (SPFMV and sweet potato virus C (SPVC were most commonly detected, infecting approximately 87% and 85% of samples, respectively. Furthermore, Sweet potato symptomless virus 1 (SPSMV-1, Sweet potato virus G (SPVG, Sweet potato leaf curl virus (SPLCV, Sweet potato virus 2 ( SPV2, Sweet potato chlorotic fleck virus (SPCFV, and Sweet potato latent virus (SPLV were detected in 67%, 58%, 47%, 41%, 31%, and 20% of samples, respectively. This study presents the first documented occurrence of four viruses (SPVC, SPV2, SPCFV, and SPSMV-1 in Korea. Based on the results of our survey, we developed multiplex RT-PCR assays for simple and simultaneous detection of the eight sweet potato viruses we recorded.

  3. Genome-wide identification of the SWEET gene family in wheat.

    Science.gov (United States)

    Gao, Yue; Wang, Zi Yuan; Kumar, Vikranth; Xu, Xiao Feng; Yuan, De Peng; Zhu, Xiao Feng; Li, Tian Ya; Jia, Baolei; Xuan, Yuan Hu

    2018-02-05

    The SWEET (sugars will eventually be exported transporter) family is a newly characterized group of sugar transporters. In plants, the key roles of SWEETs in phloem transport, nectar secretion, pollen nutrition, stress tolerance, and plant-pathogen interactions have been identified. SWEET family genes have been characterized in many plant species, but a comprehensive analysis of SWEET members has not yet been performed in wheat. Here, 59 wheat SWEETs (hereafter TaSWEETs) were identified through homology searches. Analyses of phylogenetic relationships, numbers of transmembrane helices (TMHs), gene structures, and motifs showed that TaSWEETs carrying 3-7 TMHs could be classified into four clades with 10 different types of motifs. Examination of the expression patterns of 18 SWEET genes revealed that a few are tissue-specific while most are ubiquitously expressed. In addition, the stem rust-mediated expression patterns of SWEET genes were monitored using a stem rust-susceptible cultivar, 'Little Club' (LC). The resulting data showed that the expression of five out of the 18 SWEETs tested was induced following inoculation. In conclusion, we provide the first comprehensive analysis of the wheat SWEET gene family. Information regarding the phylogenetic relationships, gene structures, and expression profiles of SWEET genes in different tissues and following stem rust disease inoculation will be useful in identifying the potential roles of SWEETs in specific developmental and pathogenic processes. Copyright © 2017 Elsevier B.V. All rights reserved.

  4. Analyzing the structural aspects of Isoprenoid biosynthesis pathway proteins in Ocimum species

    Directory of Open Access Journals (Sweden)

    Muktesh Chandra

    2017-10-01

    Full Text Available Generally thought that the extremely diverse array of secondary metabolites observed within Ocimum species defends against a comparable diverse array of biotic pests, pathogens and herbivores encountered around its natural range. Along with defense the diverse array of secondary metabolite also leads to the therapeutic and remedial property which justifies Ocimum as natural medicinal and aromatic casket. Many of the defense compounds, aroma compounds and medicinal derivatives are secondary metabolites isolated from trichome glands, mainly consist of terpenoids as well as phenylpropanoids. Various pathways fabricating these compounds are known viz. mevalonate pathway (MVA, phenylpropanoid pathway and MEP pathways. The enzyme cascade responsible for various secondary metabolites, need to be explored in various aspects. Here we had studied the MVA pathway enzymes in O. basilicum and O. gratissimum to figure out variations in enzyme structures due to speciation. Hence, in depth analysis of the transcriptome of O. basilicum and O. gratissimum, varrying in qualitative and quantitative aspects of essential oil were carried out. The transcriptome data from NCBI server was assembled using bioinformatic approaches. nr database at NCBI repository used for annotation, which assigned 60% contigs to known functions. Contigs corresponding to Mevalonate pathway enzymes are isolated using perl pipelines developed in our lab, which were further assembled using CLC workbench to remove redundancy and make larger stretch of sequence. Blastx of these larger sequences assigned them function and they are mapped to validated sequences to make full length. Data from both species led us to overall seven enzymes (total 14 of MVA pathway. These enzymes are studied in detail for various physio-chemical properties, steriochemical properties and motif/domain for protein-protein interaction (PPI study. Homolog models of all enzymes were predicted, against templates from RCSB

  5. Medieval emergence of sweet melons, Cucumis melo (Cucurbitaceae).

    Science.gov (United States)

    Paris, Harry S; Amar, Zohar; Lev, Efraim

    2012-07-01

    Sweet melons, Cucumis melo, are a widely grown and highly prized crop. While melons were familiar in antiquity, they were grown mostly for use of the young fruits, which are similar in appearance and taste to cucumbers, C. sativus. The time and place of emergence of sweet melons is obscure, but they are generally thought to have reached Europe from the east near the end of the 15th century. The objective of the present work was to determine where and when truly sweet melons were first developed. Given their large size and sweetness, melons are often confounded with watermelons, Citrullus lanatus, so a list was prepared of the characteristics distinguishing between them. An extensive search of literature from the Roman and medieval periods was conducted and the findings were considered in their context against this list and particularly in regard to the use of the word 'melon' and of adjectives for sweetness and colour. Medieval lexicographies and an illustrated Arabic translation of Dioscorides' herbal suggest that sweet melons were present in Central Asia in the mid-9th century. A travelogue description indicates the presence of sweet melons in Khorasan and Persia by the mid-10th century. Agricultural literature from Andalusia documents the growing of sweet melons, evidently casabas (Inodorous Group), there by the second half of the 11th century, which probably arrived from Central Asia as a consequence of Islamic conquest, trade and agricultural development. Climate and geopolitical boundaries were the likely causes of the delay in the spread of sweet melons into the rest of Europe.

  6. Molecular mechanisms for sweet-suppressing effect of gymnemic acids.

    Science.gov (United States)

    Sanematsu, Keisuke; Kusakabe, Yuko; Shigemura, Noriatsu; Hirokawa, Takatsugu; Nakamura, Seiji; Imoto, Toshiaki; Ninomiya, Yuzo

    2014-09-12

    Gymnemic acids are triterpene glycosides that selectively suppress taste responses to various sweet substances in humans but not in mice. This sweet-suppressing effect of gymnemic acids is diminished by rinsing the tongue with γ-cyclodextrin (γ-CD). However, little is known about the molecular mechanisms underlying the sweet-suppressing effect of gymnemic acids and the interaction between gymnemic acids versus sweet taste receptor and/or γ-CD. To investigate whether gymnemic acids directly interact with human (h) sweet receptor hT1R2 + hT1R3, we used the sweet receptor T1R2 + T1R3 assay in transiently transfected HEK293 cells. Similar to previous studies in humans and mice, gymnemic acids (100 μg/ml) inhibited the [Ca(2+)]i responses to sweet compounds in HEK293 cells heterologously expressing hT1R2 + hT1R3 but not in those expressing the mouse (m) sweet receptor mT1R2 + mT1R3. The effect of gymnemic acids rapidly disappeared after rinsing the HEK293 cells with γ-CD. Using mixed species pairings of human and mouse sweet receptor subunits and chimeras, we determined that the transmembrane domain of hT1R3 was mainly required for the sweet-suppressing effect of gymnemic acids. Directed mutagenesis in the transmembrane domain of hT1R3 revealed that the interaction site for gymnemic acids shared the amino acid residues that determined the sensitivity to another sweet antagonist, lactisole. Glucuronic acid, which is the common structure of gymnemic acids, also reduced sensitivity to sweet compounds. In our models, gymnemic acids were predicted to dock to a binding pocket within the transmembrane domain of hT1R3. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

  7. Raman spectroscopy for the evaluation of the effects of different concentrations of Copper on the chemical composition and biological activity of basil essential oil

    Science.gov (United States)

    Nawaz, Haq; Hanif, Muhammad Asif; Ayub, Muhammad Adnan; Ishtiaq, Faiqa; Kanwal, Nazish; Rashid, Nosheen; Saleem, Muhammad; Ahmad, Mushtaq

    2017-10-01

    The present study is performed to evaluate the effect of different concentrations of Cu as fertilizer on the chemical composition of basil essential oil and its biological activity including antioxidant and antifungal activities by employing Raman spectroscopy. Moreover, the effect of Cu is also determined on the vegetative growth and essential oil yield. Both, antifungal and antioxidant activities were found to be maximum with essential oils obtained at 0.04 mg/l concentration of Cu fertilizer. The results of the GC-MS and Raman spectroscopy have revealed that the linalool and estragole are found to be as a major chemical compound in basil essential oil. The Raman spectral changes associated with these biological components lead to the conclusion that estragole seems to have dominating effect in the biological activities of the basil essential oil as compared to linalool although the latter is observed in greater concentration.

  8. Association of Sweet's Syndrome and Systemic Lupus Erythematosus

    Directory of Open Access Journals (Sweden)

    J. L. Barton

    2011-01-01

    Full Text Available Sweet's syndrome is an acute febrile neutrophilic dermatosis which usually presents as an idiopathic disorder but can also be drug induced, associated with hematopoetic malignancies and myelodysplastic disorders, and more, infrequently, observed in autoimmune disorders. Sweet's syndrome has been reported in three cases of neonatal lupus, three cases of hydralazine-induced lupus in adults, and in nine pediatric and adult systemic lupus erythematosus (SLE patients. We describe three additional adult cases of Sweet's associated with SLE and provide a focused review on nondrug-induced, nonneonatal SLE and Sweet's. In two of three new cases, as in the majority of prior cases, the skin rash of Sweet's paralleled underlying SLE disease activity. The pathogenesis of Sweet's remains elusive, but evidence suggests that cytokine dysregulation may be central to the clinical and pathological changes in this condition, as well as in SLE. Further research is needed to define the exact relationship between the two conditions.

  9. "Antimicrobial and antiproliferative activity of essential oil, aqueous and ethanolic extracts of Ocimum micranthum Willd leaves".

    Science.gov (United States)

    Caamal-Herrera, Isabel O; Carrillo-Cocom, Leydi M; Escalante-Réndiz, Diana Y; Aráiz-Hernández, Diana; Azamar-Barrios, José A

    2018-02-08

    Ocimum micranthum Willd is a plant used in traditional medicine practiced in the region of the Yucatan peninsula. In particular, it is used for the treatment of cutaneous infections and wound healing, however there are currently no existing scientific studies that support these applications. The aim of the present study was to evaluate the antimicrobial and the in vitro proliferative activity (on healthy mammalian cell lines) of the essential oil and extracts (aqueous and ethanolic) of this plant. The minimal inhibitory concentration (MIC) of essential oil and aqueous and ethanolic extracts of Ocimum micranthum leaves against Staphylococcus aureus, Bacillus subtilis, Pseudomonas aeruginosa and Candida albicans was determined using the microdilution technique. The in vitro proliferative activity of human fibroblast (hFB) and Chinese hamster ovary (CHO-K1) cells treated with these extracts was evaluated using the MTT test. The hFB cell line was also evaluated using Trypan Blue assay. Candida albicans was more susceptible to the ethanolic extract and the aqueous extract (MIC value of 5 μL/mL and 80 μL/mL respectively). In the case of Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa, the MIC of the aqueous and ethanolic extract was 125 μL/mL. The aqueous extract showed a significant (p essential oil and extracts of Ocimum micranthum leaves are sufficient to cause an antiproliferative effect on the hFB cell line but do not produce an antimicrobial effect against the microorganisms evaluated. More studies are necessary to improve understanding of the mechanism of action of the compounds implicated in the bioactivities shown by the crude extracts.

  10. Dissipation rate of acetamiprid in sweet cherries

    Directory of Open Access Journals (Sweden)

    Sanja Lazić

    2014-03-01

    Full Text Available Degradation of acetamiprid in sweet cherry samples was evaluated at several intervals from the product application until the end of the pre-harvest interval. An orchard of sweet cherries located at Stepanovićevo village near Novi Sad was used in this study. Acetamiprid was applied according to the manufacturer’s recommendation for protecting sweet cherries from their most important pests. Sweet cherry fruit samples were collected at eight intervals: immediately after acetamiprid application and 2, 4, 6, 8, 10, 12 and 14 days after application. The extraction of acetamiprid from sweet cherry samples was performed using a QuEChERS-based method. Determination was carried out using an HPLC-UV diode array detection system (Agilent 1100, United States with an Agilent Zorbax Eclipse C18 column (50 mm × 4.6 mm internal diameter, 1.8 μm particle size. The method was subjected to a thorough validation procedure. The recovery data were obtained by spiking blank sweet cherry samples at three concentration levels (0.1-0.3 mg/ kg, yielding 85.4% average recovery. Precision values expressed as relative standard deviation (RSD were below 1.61% for the intraday precision. Acetamiprid showed linear calibrations from 0.05 to 2.5 μg/ml with correlation coefficient (R2 of 0.995%. The limit of detection and limit of quantification were found to be 5 μg/kg and 14 μg/kg, respectively. The validated method was applied in the analysis of acetamiprid in sweet cherry samples. During the study period, the concentration of acetamiprid decreased from 0.529 mg/kg to 0.111 mg/kg. The content of acetamiprid in sweet cherry samples at the end of the pre-harvest interval was below the maximum permissible level specified by the Serbian and EU MRLs.

  11. 7 CFR 956.5 - Walla Walla Sweet Onions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Walla Walla Sweet Onions. 956.5 Section 956.5... Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE SWEET ONIONS GROWN IN THE WALLA WALLA VALLEY OF SOUTHEAST WASHINGTON AND NORTHEAST OREGON Definitions § 956.5 Walla Walla Sweet Onions...

  12. Histiocytoid Sweet Syndrome in a Child without Underlying Systemic Disease.

    Science.gov (United States)

    Yeom, Seung Dohn; Ko, Hye Soo; Moon, Jong Hyuk; Kang, Min Ji; Byun, Ji Won; Choi, Gwang Seong; Shin, Jeonghyun

    2017-10-01

    Sweet syndrome (acute, febrile, neutrophilic dermatosis) is characterized by the acute onset of an eruption of painful nodules or erythematous or violaceous plaques on the limbs, face and neck. These symptoms are accompanied by fever. The diagnostic features include histopathological findings of dermal neutrophilic infiltration without leukocytoclastic vasculitis or peripheral blood leukocytosis. Sweet syndrome is associated with infection, malignancies, autoimmune disease, pregnancy, and drugs. Patients with Sweet syndrome demonstrate a complete and rapid response to systemic steroid administration. Recently, a distinct variant of Sweet syndrome was reported, termed "histiocytoid Sweet syndrome", in which the infiltration of myeloperoxidase-positive histiocytoid mononuclear cells are observed (in contrast to the infiltration of neutrophils). The other clinical features are similar to those of classic Sweet syndrome. Pediatric Sweet syndrome is uncommon, and the histiocytoid type is even rarer. To date, four cases of histiocytoid Sweet syndrome have been reported in children. Herein, we describe a case of histiocytoid Sweet syndrome in an otherwise healthy 10-year-old boy with no underlying systemic disease in whom non-steroidal, anti-inflammatory drug treatment was successful.

  13. Effect of levulose containing sweets on blood and salivary glucose levels.

    Science.gov (United States)

    Subramaniam, Priya; K L, Girish Babu; Gona, Harsha

    2015-06-01

    It is common that many diabetic patients crave for sweets which are normally prohibited. To satisfy their desire to have sweets, alternative sweeteners have been introduced to provide sweetness to some items of their diabetic diet. To (1) assess the effect of sweets containing levulose on glucose levels in blood and saliva, and (2) compare it with effect of sweets containing sucrose on blood and saliva levels of glucose. The study consisted of 20 healthy participants, aged 17-20 years. Two sweet preparations of 36 g each were selected for the study. One preparation was sweetened with levulose (diabetic sweet; Group I) and the other with sucrose (regular sweet; Group II). Blood sugar and salivary glucose levels were estimated before and after the consumption of diabetic and regular sweets. The mean increase in salivary glucose level was lower in Group I than in Group II. Similarly, increase in blood glucose levels in Group I was lower and highly significant. In comparison with regular sweets, consumption of levulose containing sweet resulted in significantly lower blood and salivary glucose levels.

  14. Antibacterial activity of Ocimum gratissimum L. essential oil

    Directory of Open Access Journals (Sweden)

    Celso Vataru Nakamura

    1999-09-01

    Full Text Available The essential oil (EO of Ocimum gratissimum inhibited Staphylococcus aureus at a concentration of 0.75 mg/ml. The minimal inhibitory concentrations (MICs for Shigella flexineri, Salmonella enteritidis, Escherichia coli, Klebsiella sp., and Proteus mirabilis were at concentrations ranging from 3 to 12 mg/ml. The endpoint was not reached for Pseudomonas aeruginosa (>=24 mg/ml. The MICs of the reference drugs used in this study were similar to those presented in other reports. The minimum bactericidal concentration of EO was within a twofold dilution of the MIC for this organism. The compound that showed antibacterial activity in the EO of O. gratissimum was identified as eugenol and structural findings were further supported by gas chromatography/mass spectra retention time data. The structure was supported by spectroscopic methods.

  15. Clinicopathologic, Immunohistochemical, and Molecular Features of Histiocytoid Sweet Syndrome.

    Science.gov (United States)

    Alegría-Landa, Victoria; Rodríguez-Pinilla, Socorro María; Santos-Briz, Angel; Rodríguez-Peralto, José Luis; Alegre, Victor; Cerroni, Lorenzo; Kutzner, Heinz; Requena, Luis

    2017-07-01

    Histiocytoid Sweet syndrome is a rare histopathologic variant of Sweet syndrome. The nature of the histiocytoid infiltrate has generated considerable controversy in the literature. The main goal of this study was to conduct a comprehensive overview of the immunohistochemical phenotype of the infiltrate in histiocytoid Sweet syndrome. We also analyze whether this variant of Sweet syndrome is more frequently associated with hematologic malignancies than classic Sweet syndrome. This is a retrospective case series study of the clinicopathologic, immunohistochemical, and molecular features of 33 patients with a clinicopathologic diagnosis of histiocytoid Sweet syndrome was conducted in the dermatology departments of 5 university hospitals and a private laboratory of dermatopathology. The clinical, histopathological, immunohistochemical, and follow-up features of 33 patients with histiocytoid Sweet syndrome were analyzed. In some cases, cytogenetic studies of the dermal infiltrate were also performed. We compare our findings with those of the literature. The dermal infiltrate from the 33 study patients (20 female; median age, 49 years; age range, 5-93 years; and 13 male; median age, 42 years; age range, 4-76 years) was mainly composed of myeloperoxidase-positive immature myelomonocytic cells with histiocytoid morphology. No cytogenetic anomalies were found in the infiltrate except in 1 case in which neoplastic cells of chronic myelogenous leukemia were intermingled with the cells of histiocytoid Sweet syndrome. Authentic histiocytes were also found in most cases, with a mature immunoprofile, but they appeared to be a minor component of the infiltrate. Histiocytoid Sweet syndrome was not more frequently related with hematologic malignancies than classic neutrophilic Sweet syndrome. The dermal infiltrate of cutaneous lesions of histiocytoid Sweet syndrome is composed mostly of immature cells of myeloid lineage. This infiltrate should not be interpreted as leukemia cutis.

  16. Leaf sodium accumulation facilitates salt stress adaptation and preserves photosystem functionality in salt stressed Ocimum basilicum

    NARCIS (Netherlands)

    Mancarella, S.; Orsini, F.; Oosten, van M.J.; Sanoubar, R.; Stanghellini, C.; Kondo, S.; Gianquinto, G.; Maggio, A.

    2016-01-01

    In this study, plant growth, water relations, ABA levels, ion accumulation patterns and chlorophyll fluorescence were functionally linked to salt stress tolerance of two basil cultivars (Napoletano and Genovese) with different stress sensitivity levels. Plants were treated with salty water at 0,

  17. Proximate analysis of Sweet Potato Toasted Granules | Meludu ...

    African Journals Online (AJOL)

    Sweet potato is an important root crop in the food system of many African countries. The yield, nutrition and economic potential of sweet potato have been identified as very high. In this study, sweet potato was processed and toasted into granules. The proximate analysis performed on the toasted granules showed protein, ...

  18. Sweet and bitter taste perception of women during pregnancy

    DEFF Research Database (Denmark)

    Nanou, Evangelia; Brandt, Sarah Østergaard; Weenen, Hugo

    2016-01-01

    and bitterness, respectively. Pregnant women completed also a self-administered questionnaire on changes in sweet and bitter taste perception due to pregnancy. Results: Perceived intensity of sweetness and bitterness was not different between pregnant and nonpregnant women for any of the products. However......Introduction: Changes in sweet and bitter taste perception during pregnancy have been reported in a limited number of studies leading, however, to inconclusive results. The current study aimed to investigate possible differences in perceived intensity and liking of sweetness and bitterness between......, the liking of the least sweet apple + berry juice was significantly higher, and the optimal preferred sugar content was significantly lower in pregnant compared to nonpregnant women. With regards to self-report, pregnant women who reported higher sensitivity in sweet or bitter taste did not have...

  19. Síndrome de Sweet asociado a neoplasias Sweet's syndrome associated with neoplasms

    Directory of Open Access Journals (Sweden)

    Mariana Franco

    2006-10-01

    Full Text Available El síndrome de Sweet fue descrito en el año 1964 por Robert Douglas Sweet, como una entidad a la cual denominó dermatosis neutrofílica febril y aguda. Se caracteriza por cinco rasgos principales: 1 aparición brusca de placas eritemato-dolorosas en cara, cuello y extremidades; 2 fiebre; 3 leucocitosis polimorfonuclear; 4 denso infiltrado dérmico a predominio neutrofilico; 5 rápida respuesta al tratamiento esteroideo. Se puede clasificar en cinco grupos: idiopático, parainflamatorio, paraneoplásico, secundario a drogas y asociado a embarazo. En el 20% de los casos se asocia a enfermedades malignas, representando las hematológicas el 85% y los tumores sólidos el 15% restante. Se presenta una serie de siete casos de síndrome de Sweet asociado a neoplasias, diagnosticados durante el período 2002-2006, de los cuales seis correspondieron a enfermedades oncohematológicas y el restante a tumores sólidos. Como comentario de dicha casuística, se hace hincapié en la importancia del diagnóstico de este síndrome, debido a que puede anunciar la recaída del tumor o la progresión de la enfermedad de base. De esta manera, mediante el uso de métodos de diagnóstico y tratamiento oportunos, se lograría mejorar la calida de vida de estos pacientes. También debe tenerse en cuenta, que los pacientes oncológicos reciben múltiples medicaciones (factor estimulante de colonias, que pueden estar implicadas en la aparición de esta entidad, debiendo ser las mismas descartadas como posibles causas.Sweet's syndrome was described in 1964 by Robert Douglas Sweet, as an entity he named acute febrile neutrophilic dermatosis. It is characterized by five main features: 1 sudden appearance of erythematous and tender plaques on the face, neck and extremities; 2 fever; 3 polymorphonuclear leukocytes; 4 predominantly neutrophilic dense infiltrate in the dermis, and 5 rapid response to steroid therapy. Sweet's syndrome can be classified into five groups

  20. Basil Bernstein's Theory of the Pedagogic Device and Formal Music Schooling: Putting the Theory into Practice

    Science.gov (United States)

    Wright, Ruth; Froehlich, Hildegard

    2012-01-01

    This article describes Basil Bernstein's theory of the pedagogic device as applied to school music instruction. Showing that educational practices are not personal choices alone, but the result of socio-political mandates, the article traces how education functions as a vehicle for social reproduction. Bernstein called this process the…

  1. Dicty_cDB: Contig-U12922-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2e-11 2 ( EA053492 ) Sequence 221 from patent US 7157621. 62 2e-11 4 ( DY329960 ) OB_MEa0004O04.r OB_MEa Ocimum basil...hql*mvfiknfkkkkkkkk Frame B: llaywxyyyyskyifvyt*niyk*fllvvnfv*lisivsnf*nnkekkngxk...CP001124 |pid:none) Geobacter bemidjiensis Bem, comp... 70 2e-10 (A4JHJ8) RecName...... 56 4e-06 CP000852_1193( CP000852 |pid:none) Caldivirga maquilingensis IC-16... 55 5e-06 ...cc*frfw**awklw*i fr*sk*rgys*icmhfnfignqks*f*tksiinwwwyc*fy*cgchfqryh*sn*rvs** yh*iksfhfr*krwsklsigfttyernws*ity

  2. Leptin Suppresses Mouse Taste Cell Responses to Sweet Compounds.

    Science.gov (United States)

    Yoshida, Ryusuke; Noguchi, Kenshi; Shigemura, Noriatsu; Jyotaki, Masafumi; Takahashi, Ichiro; Margolskee, Robert F; Ninomiya, Yuzo

    2015-11-01

    Leptin is known to selectively suppress neural and behavioral responses to sweet-tasting compounds. However, the molecular basis for the effect of leptin on sweet taste is not known. Here, we report that leptin suppresses sweet taste via leptin receptors (Ob-Rb) and KATP channels expressed selectively in sweet-sensitive taste cells. Ob-Rb was more often expressed in taste cells that expressed T1R3 (a sweet receptor component) than in those that expressed glutamate-aspartate transporter (a marker for Type I taste cells) or GAD67 (a marker for Type III taste cells). Systemically administered leptin suppressed taste cell responses to sweet but not to bitter or sour compounds. This effect was blocked by a leptin antagonist and was absent in leptin receptor-deficient db/db mice and mice with diet-induced obesity. Blocking the KATP channel subunit sulfonylurea receptor 1, which was frequently coexpressed with Ob-Rb in T1R3-expressing taste cells, eliminated the effect of leptin on sweet taste. In contrast, activating the KATP channel with diazoxide mimicked the sweet-suppressing effect of leptin. These results indicate that leptin acts via Ob-Rb and KATP channels that are present in T1R3-expressing taste cells to selectively suppress their responses to sweet compounds. © 2015 by the American Diabetes Association. Readers may use this article as long as the work is properly cited, the use is educational and not for profit, and the work is not altered.

  3. Evolution and Stress Responses of Gossypium hirsutum SWEET Genes.

    Science.gov (United States)

    Li, Wei; Ren, Zhongying; Wang, Zhenyu; Sun, Kuan; Pei, Xiaoyu; Liu, Yangai; He, Kunlun; Zhang, Fei; Song, Chengxiang; Zhou, Xiaojian; Zhang, Wensheng; Ma, Xiongfeng; Yang, Daigang

    2018-03-08

    The SWEET (sugars will eventually be exported transporters) proteins are sugar efflux transporters containing the MtN3_saliva domain, which affects plant development as well as responses to biotic and abiotic stresses. These proteins have not been functionally characterized in the tetraploid cotton, Gossypium hirsutum , which is a widely cultivated cotton species. In this study, we comprehensively analyzed the cotton SWEET gene family. A total of 55 putative G. hirsutum SWEET genes were identified. The GhSWEET genes were classified into four clades based on a phylogenetic analysis and on the examination of gene structural features. Moreover, chromosomal localization and an analysis of homologous genes in Gossypium arboreum , Gossypium raimondii , and G. hirsutum suggested that a whole-genome duplication, several tandem duplications, and a polyploidy event contributed to the expansion of the cotton SWEET gene family, especially in Clade III and IV. Analyses of cis -acting regulatory elements in the promoter regions, expression profiles, and artificial selection revealed that the GhSWEET genes were likely involved in cotton developmental processes and responses to diverse stresses. These findings may clarify the evolution of G. hirsutum SWEET gene family and may provide a foundation for future functional studies of SWEET proteins regarding cotton development and responses to abiotic stresses.

  4. Sweet potato in gluten-free pancakes.

    Science.gov (United States)

    Gluten-free pancakes were prepared using rice flour, and rice flour replaced with various amounts, at 10, 20, and 40% of sweet potato flour. At 40% sweet potato, the apparent viscosity became comparable to that of the traditional wheat pancake batter. Texture properties of the cooked pancakes, such...

  5. Sweet taste exposure and the subsequent acceptance and preference for sweet taste in the diet: systematic review of the published literature.

    Science.gov (United States)

    Appleton, K M; Tuorila, H; Bertenshaw, E J; de Graaf, C; Mela, D J

    2018-03-01

    There are consistent, evidence-based global public health recommendations to reduce intakes of free sugars. However, the corresponding evidence for recommending reduced exposure to sweetness is less clear. Our aim was to identify and review the published evidence investigating the impact of dietary exposure to sweet-tasting foods or beverages on the subsequent generalized acceptance, preference, or choice of sweet foods and beverages in the diet. Systematic searches were conducted to identify all studies testing relations of variation in exposure to sweetness through foods and beverages with subsequent variation in the generalized acceptance, preference, or choice of sweetened foods or beverages, in humans aged >6 mo. Twenty-one studies met our inclusion criteria, comprising 7 population cohort studies involving 2320 children and 14 controlled trials involving 1113 individuals. These studies were heterogeneous in study design, population, exposure, and outcomes measured, and few were explicitly designed to address our research question. The findings from these were inconsistent. We found equivocal evidence from population cohort studies. The evidence from controlled studies suggests that a higher sweet taste exposure tends to lead to reduced preferences for sweetness in the shorter term, but very limited effects were found in the longer term. A small and heterogeneous body of research currently has considered the impact of varying exposure to sweet taste on subsequent generalized sweet taste preferences, and this evidence is equivocal regarding the presence and possible direction of a relation. Future work should focus on adequately powered studies with well-characterized exposures of sufficient duration. This review was registered with PROSPERO as CRD42016051840, 24 November 2016.

  6. Sweet Potato [Ipomoea batatas (L.) Lam].

    Science.gov (United States)

    Song, Guo-qing; Yamaguchi, Ken-ichi

    2006-01-01

    Among the available transformation methods reported on sweet potato, Agrobacterium tumefaciens-mediated transformation is more successful and desirable. Stem explants have shown to be ideal for the transformation of sweet potato because of their ready availability as explants, the simple transformation process, and high-frequency-regeneration via somatic embryogenesis. Under the two-step kanamycin-hygromycin selection method and using the appropriate explants type (stem explants), the efficiency of transformation can be considerably improved in cv. Beniazuma. The high efficiency in the transformation of stem explants suggests that the transformation protocol described in this chapter warrants testing for routine stable transformation of diverse varieties of sweet potato.

  7. Basil extract inhibits the sulfotransferase mediated formation of DNA adducts of the procarcinogen 1'-hydroxyestragole by rat and human liver S9 homogenates and in HepG2 human hepatoma cells

    NARCIS (Netherlands)

    Jeurissen, S.M.F.; Punt, A.; Delatour, T.; Rietjens, I.M.C.M.

    2008-01-01

    The effects of a basil extract on the sulfation and concomitant DNA adduct formation of the proximate carcinogen 1¿-hydroxyestragole were studied using rat and human liver S9 homogenates and the human hepatoma cell line HepG2. Basil was chosen since it contains the procarcinogen estragole that can

  8. Food preservative potential of essential oils and fractions from Cymbopogon citratus, Ocimum gratissimum and Thymus vulgaris against mycotoxigenic fungi

    DEFF Research Database (Denmark)

    Nguefack, J.; Dongmo, J. B. Lekagne; Dakole, C. D.

    2009-01-01

    The food preservative potential of essential oils from three aromatic plants Cymbopogon citratus, Ocimum gratissimum and Thymus vulgaris and their fractions was investigated against two mycotoxigenic strains each of Aspergillus ochraceus, Penicillium expansum and P. verrucosum. The fungicidal...

  9. 21 CFR 163.153 - Sweet chocolate and vegetable fat coating.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Sweet chocolate and vegetable fat coating. 163.153... § 163.153 Sweet chocolate and vegetable fat coating. (a) Description. Sweet chocolate and vegetable fat... requirements for label declaration of ingredients for sweet chocolate in § 163.123, except that one or more...

  10. Nasal Foreign Bodies: A Sweet Experiment.

    Science.gov (United States)

    Leopard, D C; Williams, R G

    2015-10-01

    It is generally accepted that paediatric intranasal foreign bodies should be removed in the emergency setting. In the case of a difficult to access dissolvable foreign body in an uncooperative child, the question must be raised regarding whether or not a watch and wait strategy is more appropriate. We ask: How long does it take for popular sweets (candy) to dissolve in the human nose? Five popular UK sweets were placed in the right nasal cavity of a 29-year-old male (the author) with no sino-nasal disease. Time taken to dissolve was recorded. All five sweets were completely dissolved in under one hour. A watch and wait strategy in favour of examination under anaesthetic may be a viable option in some cases. Limitations of the study include the age of the participant and size of the sweets. It is also important in practice that the clinician is able to elicit an accurate history regarding the exact nature of the foreign body. It remains prudent to perform an examination under anaesthetic of an uncooperative child with a solid or unknown nasal foreign body. However, if the clinician can be certain the foreign body is a small sugar or chocolate based sweet only, a watch and wait strategy may be a reasonable choice. © 2015 John Wiley & Sons Ltd.

  11. Children's understandings and motivations surrounding novelty sweets: a qualitative study.

    Science.gov (United States)

    Stewart, Kate F; Fairchild, Ruth M; Jones, Rhiannon J; Hunter, Lindsay; Harris, Carole; Morgan, Maria Z

    2013-11-01

    Novelty sweets resemble or can be used as toys, are brightly coloured, with striking imagery, and sold at pocket money prices. They encourage regular consumption as packaging can be resealed, leading to prolonged exposure of these high-sugar and low pH products to the oral tissues, risk factors for dental caries and erosion, respectively. To determine how children conceptualise novelty sweets and their motivations for buying and consuming them. Focus groups conducted using a brief schedule of open-ended questions, supported by novelty sweets used as prompts in the latter stages. Participants were school children (aged 9-10) from purposively selected state primary schools in Cardiff, UK. Key findings related to the routine nature of sweet eating; familiarity with and availability of novelty sweets; parental awareness and control; lack of awareness of health consequences; and the overall appeal of novelty sweets. Parents reported vagueness regarding consumption habits and permissiveness about any limits they set may have diluted the concept of treats. Flexible permissiveness to sweet buying applied to sweets of all kinds. Parents' reported lack of familiarity with novelty sweets combined with their low cost, easy availability, high sugar content, and acidity give cause for concern. © 2012 John Wiley & Sons Ltd, BSPD and IAPD.

  12. Determination and risk assessment of naturally occurring genotoxic and carcinogenic alkenylbenzenes in basil-containing sauce of pesto

    NARCIS (Netherlands)

    Al-Malahmeh, Amer J.; Al-Ajlouni, Abdalmajeed M.; Wesseling, Sebas; Vervoort, Jacques; Rietjens, Ivonne M.C.M.

    2017-01-01

    A risk assessment of basil-based pesto sauces containing methyleugenol and related alkenylbenzenes was performed based on their levels detected in a series of pesto sauces available on the Dutch market. The estimated daily intake (EDI) values of alkenylbenzenes as a result of consumption of the

  13. Characterization of Digestion Resistance Sweet Potato Starch ...

    African Journals Online (AJOL)

    Purpose: To analyze the physicochemical properties and in vitro digestibility of sweet potato starchphosphodiester prepared using sodium trimetaphosphate. Methods: The physicochemical properties of sweet potato starch phosphodiester were analyzed by using infrared spectrometry (IR), differential scanning calorimetry ...

  14. Diverse Geological Applications For Basil: A 2d Finite-deformation Computational Algorithm

    Science.gov (United States)

    Houseman, Gregory A.; Barr, Terence D.; Evans, Lynn

    Geological processes are often characterised by large finite-deformation continuum strains, on the order of 100% or greater. Microstructural processes cause deformation that may be represented by a viscous constitutive mechanism, with viscosity that may depend on temperature, pressure, or strain-rate. We have developed an effective com- putational algorithm for the evaluation of 2D deformation fields produced by Newto- nian or non-Newtonian viscous flow. With the implementation of this algorithm as a computer program, Basil, we have applied it to a range of diverse applications in Earth Sciences. Viscous flow fields in 2D may be defined for the thin-sheet case or, using a velocity-pressure formulation, for the plane-strain case. Flow fields are represented using 2D triangular elements with quadratic interpolation for velocity components and linear for pressure. The main matrix equation is solved by an efficient and compact conjugate gradient algorithm with iteration for non-Newtonian viscosity. Regular grids may be used, or grids based on a random distribution of points. Definition of the prob- lem requires that velocities, tractions, or some combination of the two, are specified on all external boundary nodes. Compliant boundaries may also be defined, based on the idea that traction is opposed to and proportional to boundary displacement rate. In- ternal boundary segments, allowing fault-like displacements within a viscous medium have also been developed, and we find that the computed displacement field around the fault tip is accurately represented for Newtonian and non-Newtonian viscosities, in spite of the stress singularity at the fault tip. Basil has been applied by us and colleagues to problems that include: thin sheet calculations of continental collision, Rayleigh-Taylor instability of the continental mantle lithosphere, deformation fields around fault terminations at the outcrop scale, stress and deformation fields in and around porphyroblasts, and

  15. Functional and evolution characterization of SWEET sugar transporters in Ananas comosus.

    Science.gov (United States)

    Guo, Chengying; Li, Huayang; Xia, Xinyao; Liu, Xiuyuan; Yang, Long

    2018-02-05

    Sugars will eventually be exported transporters (SWEETs) are a group of recently identified sugar transporters in plants that play important roles in diverse physiological processes. However, currently, limited information about this gene family is available in pineapple (Ananas comosus). The availability of the recently released pineapple genome sequence provides the opportunity to identify SWEET genes in a Bromeliaceae family member at the genome level. In this study, 39 pineapple SWEET genes were identified in two pineapple cultivars (18 AnfSWEET and 21 AnmSWEET) and further phylogenetically classified into five clades. A phylogenetic analysis revealed distinct evolutionary paths for the SWEET genes of the two pineapple cultivars. The MD2 cultivar might have experienced a different expansion than the F153 cultivar because two additional duplications exist, which separately gave rise to clades III and IV. A gene exon/intron structure analysis showed that the pineapple SWEET genes contained highly conserved exon/intron numbers. An analysis of public RNA-seq data and expression profiling showed that SWEET genes may be involved in fruit development and ripening processes. AnmSWEET5 and AnmSWEET11 were highly expressed in the early stages of pineapple fruit development and then decreased. The study increases the understanding of the roles of SWEET genes in pineapple. Copyright © 2018 Elsevier Inc. All rights reserved.

  16. Improving the sweet aftertaste of green tea infusion with tannase.

    Science.gov (United States)

    Zhang, Ying-Na; Yin, Jun-Feng; Chen, Jian-Xin; Wang, Fang; Du, Qi-Zhen; Jiang, Yong-Wen; Xu, Yong-Quan

    2016-02-01

    The present study aims to improve the sweet aftertaste and overall acceptability of green tea infusion by hydrolyzing (-)-epigallocatechin gallate (EGCG) and (-)-epicatechin gallate (ECG) with tannase. The results showed that the intensity of the sweet aftertaste and the score of overall acceptability of the green tea infusion significantly increased with the extension of the hydrolyzing treatment. (-)-Epigallocatechin (EGC) and (-)-epicatechin (EC) were found to be the main contributors for the sweet aftertaste, based on a trial compatibility with EGCG, ECG, EGC, and EC monomers, and a synergistic action between EGC and EC to sweet aftertaste was observed. A 2.5:1 (EGC/EC) ratio with a total concentration of 3.5 mmol/L gave the most satisfying sweet aftertaste, and the astringency significantly inhibited the development of the sweet aftertaste. These results can help us to produce a tea beverage with excellent sweet aftertaste by hydrolyzing the green tea infusion with tannase. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Basil extract inhibits the sulfotransferase mediated formation of DNA adducts of the procarcinogen 1′-hydroxyestragole by rat and human liver S9 homogenates and in HepG2 human hepatoma cells

    NARCIS (Netherlands)

    Jeurissen, S.M.F.; Punt, A.; Delatour, T.; Rietjens, I.M.C.M.

    2008-01-01

    The effects of a basil extract on the sulfation and concomitant DNA adduct formation of the proximate carcinogen 1′-hydroxyestragole were studied using rat and human liver S9 homogenates and the human hepatoma cell line HepG2. Basil was chosen since it contains the procarcinogen estragole that can

  18. Investigating the effect of aqueous extracts of basil and savory on antioxidant activity, microbial and sensory properties of probiotic yogurt.

    Science.gov (United States)

    Mosiyani, Zohreh Ghaleh; Pourahmad, Rezvan; Eshaghi, Mohammad Reza

    2017-01-01

    The low viability of probiotics causes the short shelf life of fermented products. Therefore compounds which prolong the viability of probiotic bacteria can increase or at least maintain the health- benefiting properties of these products. On the other hand, the addition of antioxidants is one of the methods to increase the shelf life of food products which has recently become more prevalent. In this respect, herbal extracts which are a good source of antioxidants can be appropriate alternative. The aim of this study was  to evaluate the effect of adding basil and savory extracts on antioxidant activity, and on the microbial and organoleptic characteristics of probiotic yogurt. The effect of adding basil extract (8% and 10%) and savory extract (6% and 8%) separately to low fat yogurt (1.5% fat) containing Lactobacillus paracasei subsp. paracasei was investigated. The samples were stored at 4°C. The viability of Lactobacillus paracasei subsp. paracasei, antioxidant activ- ity and sensory properties of probiotic yogurt were evaluated on the 1st, 7th, 14th and 21st days. Basil and savory extracts significantly increased the viability of probiotic bacteria (p 0.05). During storage, there was no significant difference between the organoleptic scores of the samples (p > 0.05), but the taste score did increase significantly (p yogurt.

  19. Development of pitanga nectar with different sweeteners by sensory analysis: ideal pulp dilution, ideal sweetness, and sweetness equivalence

    Directory of Open Access Journals (Sweden)

    Mírian Luisa Faria Freitas

    2014-03-01

    Full Text Available The objective of this study was to develop pitanga nectar formulations in which sucrose was replaced with different sweeteners. Consumer tests were conducted with 50 fruit juice consumers, and a just-about-right scale was used to determine the ideal pulp dilution and ideal sweetness with sucrose. Furthermore, the adequate concentrations of six sweeteners were determined to obtain the equivalent sweetness of sucrose using relative to these concentrations the magnitude estimation model with 19 selected assessors. The ideal dilution test resulted in 25% pulp, and the ideal sweetness test, 10% sucrose. Sweetener concentrations to replace sucrose were 0.0160%, 0.0541%, 0.1000%, 0.0999%, 0.0017%, and 0.0360%, respectively, for sucralose, aspartame, stevia 40% rebaudioside A, stevia 95% rebaudioside A, neotame, and a 2:1 cyclamate/saccharin blend. These results can be used to prepare pitanga nectar with different sweeteners and obtain the same sweetness intensity in less caloric products than that of nectar prepared with sucrose.

  20. The natural basil flavonoid nevadensin protects against induction of markers of hepatocarcinogenicity by methyleugenol in male F344 rat

    NARCIS (Netherlands)

    Alhusainy, W.; Williams, G.; Jeffrey, A.M.; Iatropoulos, M.J.; Taylor, S.; Adams, T.B.; Rietjens, I.

    2014-01-01

    The alkenylbenzene methyleugenol occurs naturally in a variety of spices and herbs, including basil, and their essential oils. At high dose levels methyleugenol induces hepatocarcinogenicity in rodents following bioactivation to 1'-sulfooxymethyleugenol which forms DNA adducts. This study

  1. 7 CFR 318.13-25 - Sweet potatoes from Hawaii.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Sweet potatoes from Hawaii. 318.13-25 Section 318.13... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE STATE OF HAWAII AND TERRITORIES QUARANTINE NOTICES Regulated Articles From Hawaii and the Territories § 318.13-25 Sweet potatoes from Hawaii. (a) Sweet potatoes may be...

  2. In-vivo study for anti-hyperglycemic potential of aqueous extract of Basil seeds (Ocimum basilicum Linn) and its influence on biochemical parameters, serum electrolytes and haematological indices.

    Science.gov (United States)

    Chaudhary, Sachin; Semwal, Amit; Kumar, Hitesh; Verma, Harish Chandra; Kumar, Amit

    2016-12-01

    The study introduced anti-hyperglycemic influence of aqueous extract of Ocimum basilicum seeds (AEOBS) in Streptozotocin (STZ) induced diabetic rats and estimating its potential to ameliorate altered level of biochemical parameters, serum electrolytes level and haematological indices along with its effect on body weight of treated rats. The albino rats were selected to observe oral glucose tolerance test by oral intake of aq. glucose solution (4g/kg, body weight) in normal rats and estimation of blood glucose level after administration of AEOBS at 250mg/kg, 500mg/kg and standard drug glibenclamide at 0.6mg/kg, body weight. Antidiabetic activity was evaluated in chronic study models by STZ induced diabetes in rats followed by blood glucose estimation. Chronic study model was selected to carry out further studies to evaluate the effect of AEOBS at 250mg/kg, 500mg/kg and standard drug on body weight, alterations in biochemical parameters including AST, ALT, ALP, total bilirubin and total protein, alterations in serum electrolytes like Na + , K + , Cl - , HCO 3 - along with estimation of haematological indices like red blood cells (RBC), white blood cells (WBC), hemoglobin (Hb), lymphocytes, neutrophils, eosinophils, monocytes and basophils. AEOBS significantly reduced the blood glucose level of diabetic rats at both doses. Body weight was also improved significantly. Similarly, the levels of biochemical parameters, serum electrolytes, and haematological indices were significantly ameliorated at both doses of AEOBS. The histopathological results revealed reconstitution of pancreatic islets towards normal cellular architecture in rats treated with AEOBS. The results illustrated that AEOBS have eminent antidiabetic potential in STZ effectuated diabetes in rats and can be extensively used for the treatment of diabetes mellitus-II and its associated complications including anaemia, diabetic nephropathy, liver dysfunction, and immunosuppression. Copyright © 2016 Elsevier

  3. The availability of novelty sweets within high school localities.

    Science.gov (United States)

    Aljawad, A; Morgan, M Z; Rees, J S; Fairchild, R

    2016-06-10

    Background Reducing sugar consumption is a primary focus of current global public health policy. Achieving 5% of total energy from free sugars will be difficult acknowledging the concentration of free sugars in sugar sweetened beverages, confectionery and as hidden sugars in many savoury items. The expansion of the novelty sweet market in the UK has significant implications for children and young adults as they contribute to dental caries, dental erosion and obesity.Objective To identify the most available types of novelty sweets within the high school fringe in Cardiff, UK and to assess their price range and where and how they were displayed in shops.Subjects and methods Shops within a ten minute walking distance around five purposively selected high schools in the Cardiff aea representing different levels of deprivation were visited. Shops in Cardiff city centre and three supermarkets were also visited to identify the most commonly available novelty sweets.Results The ten most popular novelty sweets identified in these scoping visits were (in descending order): Brain Licker, Push Pop, Juicy Drop, Lickedy Lips, Big Baby Pop, Vimto candy spray, Toxic Waste, Tango candy spray, Brain Blasterz Bitz and Mega Mouth candy spray. Novelty sweets were located on low shelves which were accessible to all age-groups in 73% (14 out of 19) of the shops. Novelty sweets were displayed in the checkout area in 37% (seven out of 19) shops. The price of the top ten novelty sweets ranged from 39p to £1.Conclusion A wide range of acidic and sugary novelty sweets were easily accessible and priced within pocket money range. Those personnel involved in delivering dental and wider health education or health promotion need to be aware of recent developments in children's confectionery. The potential effects of these novelty sweets on both general and dental health require further investigation.

  4. The productive potentials of sweet sorghum ethanol in China

    International Nuclear Information System (INIS)

    Zhang, Caixia; Xie, Gaodi; Li, Shimei; Ge, Liqiang; He, Tingting

    2010-01-01

    As one of the important non-grain energy crops, sweet sorghum has attracted the attention of scientific community and decision makers of the world since decades. But insufficient study has been done about the spatial suitability distribution and ethanol potential of sweet sorghum in China. This paper attempts to probe into the spatial distribution and ethanol potential of sweet sorghum in China by ArcGIS methods. Data used for the analysis include the spatial data of climate, soil, topography and land use, and literatures relevant for sweet sorghum studies. The results show that although sweet sorghum can be planted in the majority of lands in China, the suitable unused lands for large-scale planting (unit area not less than 100 hm 2 ) are only as much as 78.6 x 10 4 hm 2 ; and the productive potentials of ethanol from these lands are 157.1 x 10 4 -294.6 x 10 4 t/year, which can only meet 24.8-46.4% of current demand for E10 (gasoline mixed with 10% ethanol) in China (assumption of the energy efficiency of E10 is equivalent to that of pure petroleum). If all the common grain sorghum at present were replaced by sweet sorghum, the average ethanol yield of 244.0 x 10 4 t/year can be added, and thus the productive potentials of sweet sorghum ethanol can satisfy 63.2-84.9% of current demand for E10 of China. In general, Heilongjiang, Jilin, Inner Mongolia and Liaoning rank the highest in productive potentials of sweet sorghum ethanol, followed by Hebei, Shanxi, Sichuan, and some other provinces. It is suggested that these regions should be regarded as the priority development zones for sweet sorghum ethanol in China.

  5. Artificial LED lighting enhances growth characteristics and total phenolic content of Ocimum basilicum, but variably affects transplant success

    NARCIS (Netherlands)

    Bantis, Filippos; Ouzounis, Theoharis; Radoglou, Kalliopi

    2016-01-01

    The morphological and phytochemical characteristics of two Ocimum basilicum cultivars (Lettuce Leaf, and Red Rubin-mountain Athos hybrid) under artificial lighting were investigated. Four LED light treatments [AP673L (high red and high red:far-red), G2 (high red and low red:far-red), AP67

  6. Essential oils from Taiwan: Chemical composition and antibacterial activity against Escherichia coli

    Directory of Open Access Journals (Sweden)

    Po-Chen Lin

    2016-07-01

    Full Text Available The chemical compositions of seven essential oils from Taiwan were analyzed by gas chromatography-mass spectrometry. The eluates were identified by matching the mass fragment patents to the National Institute of Standards and Technology (NIST 08 database. The quantitative analysis showed that the major components of lemon verbena are geranial (26.9% and neral (23.1%; those of sweet marjoram are γ-terpinene (18.5%, thymol methyl ether (15.5%, and terpinen-4-ol (12.0%; those of clove basil are eugenol (73.6%, and β-(Z-ocimene (15.4%; those of patchouli are carvacrol (47.5% and p-cymene (15.2%; those of rosemary are α-pinene (54.8% and 1,8-cineole (22.2%; those of tea tree are terpinen-4-ol (33.0% and 1,8-cineole (27.7%; and those of rose geranium are citronellol (28.9% and 6,9-guaiadiene (20.1%. These components are somewhat different from the same essential oils that were obtained from other origins. Lemon verbena has the same major components everywhere. Tea tree, rose geranium, and clove basil have at least one major component throughout different origins. The major components and their amounts in sweet marjoram, patchouli, and rosemary vary widely from one place to another. These results demonstrate that essential oils have a large diversity in their composition in line with their different origins. The antibacterial activity of essential oils against Escherichia coli was evaluated using the optical density method (turbidimetry. Patchouli is a very effective inhibitor, in that it completely inhibits the growth of E. coli at 0.05%. Clove basil and sweet marjoram are good inhibitors, and the upper limit of their minimum inhibitory concentration is 0.1%.

  7. 7 CFR 457.129 - Fresh market sweet corn crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 6 2010-01-01 2010-01-01 false Fresh market sweet corn crop insurance provisions. 457... sweet corn crop insurance provisions. The fresh market sweet corn crop insurance provisions for the 2008... Reinsured Policies Fresh Market Sweet Corn Crop Provisions 1. Definitions Allowable cost.—The dollar amount...

  8. SuperSweet--a resource on natural and artificial sweetening agents.

    Science.gov (United States)

    Ahmed, Jessica; Preissner, Saskia; Dunkel, Mathias; Worth, Catherine L; Eckert, Andreas; Preissner, Robert

    2011-01-01

    A vast number of sweet tasting molecules are known, encompassing small compounds, carbohydrates, d-amino acids and large proteins. Carbohydrates play a particularly big role in human diet. The replacement of sugars in food with artificial sweeteners is common and is a general approach to prevent cavities, obesity and associated diseases such as diabetes and hyperlipidemia. Knowledge about the molecular basis of taste may reveal new strategies to overcome diet-induced diseases. In this context, the design of safe, low-calorie sweeteners is particularly important. Here, we provide a comprehensive collection of carbohydrates, artificial sweeteners and other sweet tasting agents like proteins and peptides. Additionally, structural information and properties such as number of calories, therapeutic annotations and a sweetness-index are stored in SuperSweet. Currently, the database consists of more than 8000 sweet molecules. Moreover, the database provides a modeled 3D structure of the sweet taste receptor and binding poses of the small sweet molecules. These binding poses provide hints for the design of new sweeteners. A user-friendly graphical interface allows similarity searching, visualization of docked sweeteners into the receptor etc. A sweetener classification tree and browsing features allow quick requests to be made to the database. The database is freely available at: http://bioinformatics.charite.de/sweet/.

  9. Bioactivity of basil ( Ocimum basicilum L.) on control of the spider ...

    African Journals Online (AJOL)

    Essential plant oils contain biopesticides that could be used to control many crop pests. Tetranychus spp. are mites that cause damage to several crops and are primarily controlled by synthetic pesticides. Literature showed that mites can be controlled with essential oils of plants containing eugenol. In this work, we ...

  10. Phytochemical investigation of dichloromethanic fraction on Ocimum gratissimum L. extract/ Estudo químico da fração diclorometânica do extrato de Ocimum gratissimum L.

    Directory of Open Access Journals (Sweden)

    José Roberto Pinto de Souza

    2005-06-01

    Full Text Available Previous studies showed that ethanolic extract of Ocimum gratissimum inhibited growth of Penicillium chrysogenum, Rhizoctonia sp, Aspergillus niger and Alternaria sp, isolated from tomato and carrot. The aim of this study was to identify the chemical constituents of Ocimum gratissim. Aerial parts of the plant were treated with hexane-dichloromethane-ethanol mixture (1:3:1 at room temperature. The obtained extract was chromatographed on silica gel column eluted with hexane, dichloromethane and ethanol. Fractions eluted with dichloromethane were rechromatographed on a column of silica gel to yield alyphatic hydrocarbon mixture (C31, C33, C34 e C35, eugenol, caryophyllene oxide and a mixture of stigmasterol and sitosterol. The structures of the compounds were deduced by spectral data analysis and by comparison with literature values. Recent studies showed that eugenol is probably one of the responsibles for antifungal activity of O. gratissimum.Ensaios anteriores de atividade antifúngica do extrato etanólico de Ocimum gratissimum, utilizando a técnica de difusão em meio sólido, evidenciaram a inibição do crescimento de Penicillium chrysogenum, Rhizoctonia sp, Aspergillus niger e de duas espécies de Alternaria sp isoladas de tomate e de cenoura. O objetivo deste trabalho foi identificar os possíveis constituintes químicos responsáveis pela atividade antifúngica da planta, por meio de estudo químico do extrato hexano-diclorometano-etanol (1:3:1 das partes aéreas de O. gratissimum. O extrato foi cromatografado em coluna de sílica gel, eluída com hexano, diclorometano e etanol. A purificação em coluna cromatográfica de sílica gel das frações eluídas com diclorometano (5,9g resultou na obtenção de quatro constituintes: uma mistura de hidrocarbonetos saturados de cadeia longa (C31, C33, C34 e C35, eugenol, óxido de cariofileno e uma mistura de estigmasterolsitosterol. Os constituintes foram identificados através das an

  11. Agronomic performance of locally adapted sweet potato (Ipomoea ...

    African Journals Online (AJOL)

    SERVER

    ELISA established that field plants had a higher virus titre compared to the tissue culture regenerated plants. Key words: Sweet potato (Ipomoea batatas), tissue culture, ..... Commercial Vegetable Production Guides (CVPG) (2003). Sweet.

  12. Oxygen introduction during extraction and the improvement of antioxidant activity of essential oils of basil, lemon and lemongrass

    Directory of Open Access Journals (Sweden)

    Daniele de Freitas Ferreira

    Full Text Available ABSTRACT: Essential oil extraction is commonly carried out by using the hydrodistillation method, which is described in official compendia of food quality control and medicinal plants. Despite the widespread use of this method, few studies have evaluated the effect of the atmosphere change during extraction on the composition and antioxidant activity of essentials oils. Therefore, a study of oxygen introduction influence during the extraction of essential oils from basil, lemongrass and lemon by hydrodistillation was performed. Total amount of oxygenated compounds (e.g., linalool, camphor, α-terpineol, neral, geranial, eugenol and α-muurolol increased for all essential oils extracted under oxygen flow. Antioxidant activity evaluated by using the ORAC method significantly increased (P<0.0001 with oxygen from 618 to 906, 355 to 613 and 72 to 262µmol Trolox g-1 oil for basil, lemongrass and lemon, respectively. Therefore, the simple modification proposed could be considered a suitable alternative to obtain essential oils with higher antioxidant activity.

  13. Sweet syndrome revealing systemic lupus erythematosus.

    LENUS (Irish Health Repository)

    Quinn, N

    2015-02-01

    Sweet Syndrome is an acute inflammatory skin eruption which is rare in children. We report a case of childhood Systemic Lupus Erythematosus (SLE) that presented with Sweet syndrome. This case is a unique presentation of a common disorder which provides a new facet for the differential diagnosis of SLE in children. It is also the first paediatric case to be reported in a Caucasian child.

  14. Minimally invasive basilic vein transposition in the arm or forearm for autogenous haemodialysis access: A less morbid alternative to the conventional technique

    Directory of Open Access Journals (Sweden)

    Ankush Jairath

    2017-06-01

    Conclusion: Minimally invasive dissection of the basilic vein for vascular access transposition is a safe, reliable procedure with patency and functional outcomes comparable with those of conventional BVT.

  15. Influence of Sweetness and Ethanol Content on Mead Acceptability

    Directory of Open Access Journals (Sweden)

    Gomes Teresa

    2015-06-01

    Full Text Available Mead is a traditional alcoholic beverage obtained by fermenting mead wort; however, its production still remains frequently an empirical exercise. Different meads can be produced, depending on fermentation conditions. Nevertheless, to date few studies have been developed on factors that may influence mead quality. The main objective of this work was to study the influence of sweetness and ethanol content on mead acceptability. Different meads were produced with two sweetness levels (sweet and dry meads and three ethanol contents (18, 20, 22% (v/v, adjusted by brandy addition. Afterwards, meads acceptability was evaluated by sensory analysis through a consumers’ panel (n=108 along with chemical analysis by HPLC-RID of glucose, fructose, ethanol, glycerol and acetic acid. The sweet (75 gglucose+fructose/L and dry (23 gglucose+fructose/L meads presented glycerol contents equal to 5.10±0.54 and 5.96±0.95 g/L, respectively, that were desirable since glycerol improves mead quality. Low concentrations of acetic acid were determined (0.46±0.08 and 0.57±0.09 g/L, avoiding the vinegar off-character. Concerning sensory analysis, the alcohol content of mead had no effect on the sensory attributes studied, namely, aroma, sweetness, flavour, alcohol feeling and general appreciation. Regarding sweetness, the “sweet meads” were the most appreciated by the consumers (score of 5.4±2.56, whereas the “dry meads” (score of 2.7±2.23 showed low acceptability. In conclusion, this work revealed that sweetness is a sensory key attribute for mead acceptance by the consumers, whereas ethanol content (18 to 22% (v/v is not.

  16. Physiological seed quality of varieties of Ocimum produced under conditions of Valle del Cauca, Colombia

    Directory of Open Access Journals (Sweden)

    Leila Aceneth Durán Gaviria

    2016-01-01

    Full Text Available The genus Ocimum with over 150 species is characterized by high morphological variability and Chemotypes of great value in the industries of perfumery, cosmetics, food and pharmaceutical features. In order to evaluate the physiological quality of the seeds, in the Experimental Center and the Laboratory of Plant Physiology at the National University of Colombia at Palmira, germination and viability tests were performed with 2,3,5 triphenyl tetrazolium, TTZ. In trials, using a factorial design with five varieties of seeds, three treatments and three replications, the effect of imbibing the seeds for five minutes in Potassium nitrate 0.2% KNO3 and gibberellic acid GA3 250 ppm and 500 ppm respectively as first irrigation and a control (water was evaluated. The results showed that the seeds from the species O. selloi had the highest percentage (90% of viability in TTZ and germination (46.2%. The seeds soaked in 0.2% KNO3 showed the highest values of seed germination in three of the five varieties tested. The best responses were obtained with germination seeds O.selloi species (70% and O. micranthum (58%, followed by Ocimum sp. (26%. The results showed the presence of varying levels of latency, which was partially overcome by the application of potassium nitrate (KNO 3 0.2%.

  17. Passive Nutrition Intervention in a Military-Operated Garrison Dining Facility, Fort Devens 2

    Science.gov (United States)

    1989-01-01

    Total fitness includes: physical fitness, weight control, diet and nutrition, smoking cessation, avoidance of substance abuse, and stress management...INGREDIE𔃾T BULK Recipe 01 5 Tbs Instant Minced Onion 8 QT I Ts Sweet Basil 2 C I Tsp Black Pepper 2 C 1 Tsp Ground Cumin 2 C 2 Tsp Garlic Powder 4 C 3 Ts

  18. Diabetes Nutrition: Including Sweets in Your Meal Plan

    Science.gov (United States)

    Diabetes nutrition: Including sweets in your meal plan Diabetes nutrition focuses on healthy foods, but sweets aren't necessarily ... your meal plan. By Mayo Clinic Staff Diabetes nutrition focuses on healthy foods. But you can eat ...

  19. Determinants of Sweet Potato Value Addition among Smallholder

    African Journals Online (AJOL)

    sweet potato harvested significantly increased farmers' decision to add value by 0.494 ... (2004), bulkiness and perishability affect post- ..... credit makes it possible for farmers to purchase .... Promotion of the Sweet Potato for the Food Industry.

  20. Proximate analysis of Sweet Potato Toasted Granules

    African Journals Online (AJOL)

    Revd Dr Olaleye

    Sweet potato varieties with dark orange flesh have more beta carotene than those with light colored flesh and their increased cultivation is being encouraged in Africa where Vitamin A deficiency is a serious health problem. Sweet potato fries are a common preparation in most African homes. Its leaves are a common side ...

  1. Patterns of sweetness preference in red wine according to consumer characterisation.

    Science.gov (United States)

    Sena-Esteves, Maria Madalena; Mota, Mariana; Malfeito-Ferreira, Manuel

    2018-04-01

    The preference for sweet taste in red wine was examined according to consumer categories of age, gender, drinking experience and personality type (Big-5 personality-test). A total of 114 subjects revealed their preferences for sweetness after tasting dry red wine spiked with equal concentrations of glucose and fructose at 2g/L, 4g/L, 8g/L, 16g/L and 32g/L, following an ascending forced choice paired comparison method (2-AFC). The overall preference for sweetness was shown within the range of 4.8 to 21.9g/L, with maximal liking at 8g/L. Three patterns of response to sweetness were observed (sweet dislikers, sweet likers and indifferent to sweet) according to the different categories of consumers. Differences (p>0.05) were not found in sweetness preference among the categories up to 16g/L sugar except for the trait extraversion at 8g/L, where low extraverts showed a higher proportion of responses preferring the sweeter sample. Most significant differences were found only under the highest tasted concentration (32g/L). Females and novices preferred sweeter samples (pconsumers, respectively. Copyright © 2017. Published by Elsevier Ltd.

  2. A teoria de Basil Bernstein: alguns aspectos fundamentais

    Directory of Open Access Journals (Sweden)

    Ana Maria Morais

    2007-12-01

    Full Text Available The article begins with a reference to the pieces of work that Basil Bernstein considered to have been the landmarks of the evolution of his thought. This is followed by a detailed description of the two models that contain the main concepts of his theory – Model of Cultural Reproduction and Transformation and Model of Pedagogic Discourse – where the theoretical meaning of these models and concepts is explained and where are given some examples of how to put them into practice at the level of pedagogic texts and contexts. The article also includes the most recent developments of Bernstein’s thought by explaining his ideas about the forms discourses can take – Vertical and Horizontal Discourses. Finally, Bernstein’s theory is approached within the framework of the empirical research, highlighting his epistemological positioning and explicating the methodological model that he suggested should be the driving force of any theory.

  3. The sweet spots in human communication.

    Science.gov (United States)

    Salem, Philip

    2011-07-01

    In baseball, the sweet spot is a special place on a bat where the batter can hit the ball with the most power. It is the place where the performances of the batter and pitcher collide with maximum effect. It is the place where the dynamic tension between opponents leads to transformation. The dynamic tension in all living systems is between similarity and difference. Chaos and complexity scholars recognized this tension as amounts of information. When the amounts of information were high, but not too high, the system moved to the edge of chaos, to the complexity regime, to strange attractors, or to chaos, depending on the model. The sweet spot is that range of relative variety, just the proper mix of similarity and difference, leading to transformation. This essay contains a model of human communication as an emergent social process with its own sweet spots. The essay also includes a description of current literature highlighting tensions between similarity and difference, and there is an exploration of the potential to move from one basin of attraction to another. The primary constraints on finding communication sweet spots are paradigmatic - adopting a process orientation, discovering the proper parameters, bracketing sequences to define initial conditions, and understanding the strengths and weaknesses of various modeling techniques.

  4. Taste bud leptin: sweet dampened at initiation site.

    Science.gov (United States)

    Travers, Susan P; Frank, Marion E

    2015-05-01

    The intriguing observation that leptin decreases sweet-evoked peripheral gustatory responses has aroused much interest (Kawai K, Sugimoto K, Nakashima K, Miura H, Ninomiya Y. 2000. Leptin as a modulator of sweet taste sensitivities in mice. Proc Natl Acad Sci U S A. 97(20):11044-11049.) due to its implied importance in controlling appetite. The effects of this anorexic hormone, however, appear more conditional than originally believed. In this issue of Chemical Senses, a careful study by Glendinning and colleagues, find no effects of leptin on sweet-evoked chorda tympani responses, whereas an equally careful study by Meredith and colleagues, find decreased release of ATP and increased release of 5-HT from taste buds in response to sweet stimuli. © The Author 2015. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  5. Maturation curves of sweet sorghum genotypes

    Directory of Open Access Journals (Sweden)

    Renan Silva e Souza

    2016-02-01

    Full Text Available ABSTRACT Sweet sorghum [Sorghum bicolor (L. Moench] stands out as a complementary crop to sugarcane Saccharum spp. for the production of ethanol, since it has juicy stems with directly fermentable sugars. Due to this fact, there is a need for the analysis of sweet sorghum properties in order to meet the agro-industry demand. This work aimed to develop and study the maturation curves of seven sweet sorghum cultivars in ten harvest dates. The results showed a significant difference between cultivars and harvest dates for all parameters analysed (p≤0.01. Regarding the sugar content, the cultivars BRS508, XBWS80147 and CMSX629 showed the highest means for the total reducing sugars (TRS and recoverable sugar (RS. In the production of ethanol per tonne of biomass (EP, the cultivars BRS508 and CMSX629 presented the best results.

  6. The Association between Sweet Taste Function, Anthropometry, and Dietary Intake in Adults.

    Science.gov (United States)

    Low, Julia Y Q; Lacy, Kathleen E; McBride, Robert; Keast, Russell S J

    2016-04-23

    Variation in ability to detect, recognize, and perceive sweetness may influence food consumption, and eventually chronic nutrition-related conditions such as overweight and obesity. The aim of this study was to investigate the associations between sweet taste function, anthropometry, and dietary intake in adults. Participants' (n = 60; mean age in years = 26, SD = ±7.8) sweet taste function for a range of sweeteners (glucose, fructose, sucrose, sucralose, erythritol, and Rebaudioside A) was assessed by measuring detection and recognition thresholds and sweetness intensity. Height, weight, and waist circumference were also measured, and participants also completed a Food Frequency Questionnaire. There was large inter-individual variation in detection, recognition and sweetness intensity measures. Pearson's correlation coefficient revealed no robust correlations between measures of sweet taste function, anthropometry, and dietary intake, with the exception of suprathreshold intensity, which was moderately correlated with total energy intake (r = 0.23-0.40). One-way analysis of variance revealed no significant differences between the most and least sensitive participants in terms of BMI, waist circumference, and dietary intake for all measures of sweet taste function and sweeteners (all p > 0.01). When stratified into BMI categories, there were no significant differences in any measure of sweet taste function between the normal weight and overweight/obese participants (all p > 0.01). Results show that that sweet taste function is not associated with anthropometry and sweetness intensity measures are the most appropriate measure when assessing links between sweet taste and food consumption.

  7. Eradication of sweet potato weevil using Co-60 gamma radiation

    International Nuclear Information System (INIS)

    Tokunaga, Taizo

    2007-01-01

    Sweet potato weevil which is a harmful insect injuring sweet potatoes was found out at Yoron Island in 1915 for the first time in Kagoshima prefecture, Japan. Here the eradication of sweet potato weevils using cobalt 60 irradiation achieved at Kikai Island is described. The mass-reared male weevils in potatoes are in pasture after sterilized by gamma irradiation. If the sexually sterile male copulates with a wild female, the egg does not incubate. By the repeated sterilization during several generations, the eradication of sweet potato weevils was accomplished. (M.H.)

  8. Polymorphisms in sweet taste genes (TAS1R2 and GLUT2), sweet liking, and dental caries prevalence in an adult Italian population.

    Science.gov (United States)

    Robino, Antonietta; Bevilacqua, Lorenzo; Pirastu, Nicola; Situlin, Roberta; Di Lenarda, Roberto; Gasparini, Paolo; Navarra, Chiara Ottavia

    2015-09-01

    The aim of the study was to assess the relationship between sweet taste genes and dental caries prevalence in a large sample of adults. In addition, the association between sweet liking and sugar intake with dental caries was investigated. Caries was measured by the decayed, missing, filled teeth (DMFT) index in 647 Caucasian subjects (285 males and 362 females, aged 18-65 years), coming from six villages in northeastern Italy. Sweet liking was assessed using a 9-point scale, and the mean of the liking given by each individual to specific sweet food and beverages was used to create a sweet liking score. Simple sugar consumption was estimated by a dietary history interview, considering both added sugars and sugar present naturally in foods. Our study confirmed that polymorphisms in TAS1R2 and GLUT2 genes are related to DMFT index. In particular, GG homozygous individuals for rs3935570 in TAS1R2 gene (p value = 0.0117) and GG homozygous individuals for rs1499821 in GLUT2 gene (p value = 0.0273) showed higher DMFT levels compared to both heterozygous and homozygous for the alternative allele. Furthermore, while the relationship sugar intake-DMFT did not achieve statistical significance (p value = 0.075), a significant association was identified between sweet liking and DMFT (p value = 0.004), independent of other variables. Our study showed that sweet taste genetic factors contribute to caries prevalence and highlighted the role of sweet liking as a predictor of caries risk. Therefore, these results may open new perspectives for individual risk identification and implementation of target preventive strategies, such as identifying high-risk patients before caries development.

  9. 7 CFR 318.13-24 - Sweet potatoes from Puerto Rico.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Sweet potatoes from Puerto Rico. 318.13-24 Section 318... Articles From Hawaii and the Territories § 318.13-24 Sweet potatoes from Puerto Rico. Sweet potatoes from Puerto Rico may be moved interstate to Atlantic Coast ports north of and including Baltimore, MD, under...

  10. Enhanced ethanol production from stalk juice of sweet sorghum by ...

    African Journals Online (AJOL)

    Sweet sorghum (sugar sorghum, Sorghum bicolor) is one kind of non-grain energy crops. As a novel green regenerated high-energy crop with high utility value, high yield of biomass, the sweet sorghum is widely used and developed in China. Stalk juice of sweet sorghum was used as the main substrate for ethanol ...

  11. The Association between Sweet Taste Function, Anthropometry, and Dietary Intake in Adults

    Directory of Open Access Journals (Sweden)

    Julia Y. Q. Low

    2016-04-01

    Full Text Available Variation in ability to detect, recognize, and perceive sweetness may influence food consumption, and eventually chronic nutrition-related conditions such as overweight and obesity. The aim of this study was to investigate the associations between sweet taste function, anthropometry, and dietary intake in adults. Participants’ (n = 60; mean age in years = 26, SD = ±7.8 sweet taste function for a range of sweeteners (glucose, fructose, sucrose, sucralose, erythritol, and Rebaudioside A was assessed by measuring detection and recognition thresholds and sweetness intensity. Height, weight, and waist circumference were also measured, and participants also completed a Food Frequency Questionnaire. There was large inter-individual variation in detection, recognition and sweetness intensity measures. Pearson’s correlation coefficient revealed no robust correlations between measures of sweet taste function, anthropometry, and dietary intake, with the exception of suprathreshold intensity, which was moderately correlated with total energy intake (r = 0.23–0.40. One-way analysis of variance revealed no significant differences between the most and least sensitive participants in terms of BMI, waist circumference, and dietary intake for all measures of sweet taste function and sweeteners (all p > 0.01. When stratified into BMI categories, there were no significant differences in any measure of sweet taste function between the normal weight and overweight/obese participants (all p > 0.01. Results show that that sweet taste function is not associated with anthropometry and sweetness intensity measures are the most appropriate measure when assessing links between sweet taste and food consumption.

  12. Lipid-Lowering Pharmaceutical Clofibrate Inhibits Human Sweet Taste

    Science.gov (United States)

    Kochem, Matthew

    2017-01-01

    T1R2-T1R3 is a heteromeric receptor that binds sugars, high potency sweeteners, and sweet taste blockers. In rodents, T1R2-T1R3 is largely responsible for transducing sweet taste perception. T1R2-T1R3 is also expressed in non-taste tissues, and a growing body of evidence suggests that it helps regulate glucose and lipid metabolism. It was previously shown that clofibric acid, a blood lipid-lowering drug, binds T1R2-T1R3 and inhibits its activity in vitro. The purpose of this study was to determine whether clofibric acid inhibits sweetness perception in humans and is, therefore, a T1R2-T1R3 antagonist in vivo. Fourteen participants rated the sweetness intensity of 4 sweeteners (sucrose, sucralose, Na cyclamate, acesulfame K) across a broad range of concentrations. Each sweetener was prepared in solution neat and in mixture with either clofibric acid or lactisole. Clofibric acid inhibited sweetness of every sweetener. Consistent with competitive binding, inhibition by clofibric acid was diminished with increasing sweetener concentration. This study provides in vivo evidence that the lipid-lowering drug clofibric acid inhibits sweetness perception and is, therefore, a T1R carbohydrate receptor inhibitor. Our results are consistent with previous in vitro findings. Given that T1R2-T1R3 may in part regulate glucose and lipid metabolism, future studies should investigate the metabolic effects of T1R inhibition. PMID:27742692

  13. Sweet Preference Associated with the Risk of Hypercholesterolemia Among Middle-Aged Women in Korea.

    Science.gov (United States)

    Shin, Yoonjin; Lee, Soojin; Kim, Yangha

    2018-04-05

    Sweet preference has been reported to be associated with various health problems. This study examined the influence of sweet taste preference on the risk of dyslipidemia in Korean middle-aged women. The study selected 3,609 middle-aged women from the Korean Genome and Epidemiology Study (KoGES) and classified them into two groups on the basis of whether or not they preferred sweet taste. Dietary intake was analyzed using a semiquantitative food frequency questionnaire. Serum lipid profiles and anthropometric variables were measured. Subjects who preferred the sweet taste had significantly higher intakes of sugar products and sweet drink than those who did not prefer the sweet taste. Subjects who preferred the sweet taste showed higher carbohydrate and fat intake and less fiber intake than those who did not prefer the sweet taste. The serum concentrations of total cholesterol and low-density lipoprotein (LDL) cholesterol were significantly higher in subjects who preferred the sweet taste than those who did not prefer. Furthermore, subjects who preferred the sweet taste showed a significantly higher odds ratio (OR) for hypercholesterolemia (OR 1.22; 95% CI (1.01-1.45)) and hyper-LDL cholesterolemia (OR 1.33; 95% CI (1.11-1.60)) than those who did not prefer the sweet taste. Our results suggested that preference for sweet taste may increase the consumption of sugar products and sweet drinks, which is partially linked to the risk of hypercholesterolemia and hyper-LDL cholesterolemia in Korean middle-aged women.

  14. Develop of a Sweet Cookie with toasted sesame and ground

    Directory of Open Access Journals (Sweden)

    Dr.C. Aldo Hernández-Monzón

    2015-11-01

    Full Text Available The sweet cookies nutritionally are rich source of energy and they have great acceptance to world level and the sesame (Sésamum indicum it is of the family of the oleaginous ones that possesses a high quantity of protein and fat where 80% belongs to the fatty polinsaturadas fundamentally linoleic acid, it has high content of calcium and the presence iron, magnesium and zinc, what makes it a functional food. This work had as objective to develop a sweet cookie with addition of toastedsesame and ground with good characteristic sensorial and nutritional. The addition of the toasted sesame and ground it was carried out in dose of 10, 15 and 20% to the formulation of a sweet cookie. The sweet cookies were evaluated by seven trained judges to determine the most appropriate dose according to the general impression of obtained quality. The accepted formulation it was determined humidity, proteins, fat, ashy, calcium, iron, and zinc and texture analysis. The best formulation wasthat of 15% sesame for the obtaining of a product with an acceptability of excellent, a percentage of humidity and typical fat of sweet cookies and high content of proteins and calcium as well as appreciable iron content and zinc. The obtained sweet cookie was characterized sensorial to possess a scent and flavor defined to sesame, good crujencia and harmony among its components, very pleasant hardness and the weight and thickness similar to that of other sweet cookies.

  15. Mineral constituents of medicinally important herbs mentha arvensis and ocimum basilicum

    International Nuclear Information System (INIS)

    Sahito, S.; Kazi, G.H.; Kazi, T.; Hafeez-u-Raman Shaikh; Memon, A.N.

    2003-01-01

    The role of elements particularly trace elements in health and disease are now well established. In this paper we investigate the presence of various elements in very common herbs Mentha arvensis (Mint, vern. Podina) and ocimum basilicum(vern Niazboo or Tulsi). Economically the both herbs have great importance as the source of volatile aromatic oils, medicines. Medicinal drugs like menthol is derived from Mentha arvensis, which is useful in cough and diarrhea. The samples of both plants were collected from surrounding of Hyderabad and vouchers specimens were prepared following the standard Herbarium techniques. The dried parts of each plant were digested with nitric acid and hydrogen peroxide and analysed by atomic absorption spectrophotometer technique using air acetylene flame to estimate various metals present in both herbs. (author)

  16. Mineral constituents of medicinally important herbs mentha arvensis and ocimum basilicum

    Energy Technology Data Exchange (ETDEWEB)

    Sahito, S; Kazi, G H; Kazi, T [University of Sindh, Jamshoro (Pakistan). Centre of Excellence in Analytical Chemistry; Shar, G Q [Liaquat Univ. of Health and Sciences, Jamshoro (Pakistan); Shaikh, Hafeez-u-Raman [University of Sindh, Jamshoro (Pakistan). Inst. of Biochemistry; Memon, A N [University of Sindh, Jamshoro (Pakistan). Dept. of Botany

    2003-06-01

    The role of elements particularly trace elements in health and disease are now well established. In this paper we investigate the presence of various elements in very common herbs Mentha arvensis (Mint, vern. Podina) and ocimum basilicum(vern Niazboo or Tulsi). Economically the both herbs have great importance as the source of volatile aromatic oils, medicines. Medicinal drugs like menthol is derived from Mentha arvensis, which is useful in cough and diarrhea. The samples of both plants were collected from surrounding of Hyderabad and vouchers specimens were prepared following the standard Herbarium techniques. The dried parts of each plant were digested with nitric acid and hydrogen peroxide and analysed by atomic absorption spectrophotometer technique using air acetylene flame to estimate various metals present in both herbs. (author)

  17. Triggered tremor sweet spots in Alaska

    Science.gov (United States)

    Gomberg, Joan; Prejean, Stephanie

    2013-01-01

    To better understand what controls fault slip along plate boundaries, we have exploited the abundance of seismic and geodetic data available from the richly varied tectonic environments composing Alaska. A search for tremor triggered by 11 large earthquakes throughout all of seismically monitored Alaska reveals two tremor “sweet spots”—regions where large-amplitude seismic waves repeatedly triggered tremor between 2006 and 2012. The two sweet spots locate in very different tectonic environments—one just trenchward and between the Aleutian islands of Unalaska and Akutan and the other in central mainland Alaska. The Unalaska/Akutan spot corroborates previous evidence that the region is ripe for tremor, perhaps because it is located where plate-interface frictional properties transition between stick-slip and stably sliding in both the dip direction and laterally. The mainland sweet spot coincides with a region of complex and uncertain plate interactions, and where no slow slip events or major crustal faults have been noted previously. Analyses showed that larger triggering wave amplitudes, and perhaps lower frequencies (tremor. However, neither the maximum amplitude in the time domain or in a particular frequency band, nor the geometric relationship of the wavefield to the tremor source faults alone ensures a high probability of triggering. Triggered tremor at the two sweet spots also does not occur during slow slip events visually detectable in GPS data, although slow slip below the detection threshold may have facilitated tremor triggering.

  18. Brachial artery repair using the basilic vein as a reliable conduit in a 3-year-old child

    Directory of Open Access Journals (Sweden)

    Hyunyoung G. Kim

    2017-04-01

    Full Text Available A supracondylar fracture of the humerus is the most common upper extremity fracture in children with concurrent neurovascular complications. However, bypass grafting in the management of a pediatric open elbow dislocation with an arterial injury has rarely been reported in the literature. Hence, an adequate conduit for a vessel graft interposition remains questionable when a primary anastomosis is limited in an arterial reconstruction. The purpose of this study is to present a brachial artery reconstruction in a 3-year-old patient with an open supracondylar fracture of the humerus. In the clinical and surgical examination of the patient, an open wound in the left antecubital fossa presented with accompanying brachial artery injury. To repair the artery, a reverse end-to-end anastomosis was conducted using basilic vein graft from the ipsilateral arm under general anesthesia. The patient had palpable radial pulses in the postoperative clinical examination and was discharged without complications. The great saphenous vein (GSV has proven to be the most common and the best conduit for arterial reconstruction of the upper extremity in the adult patients. However, the GSV graft is known to have the propensity for becoming aneurysmal in pediatric patients. Some studies have demonstrated the basilic vein as a suitable conduit in pediatric patients, in that it has durable patency, fewer branches, size compatibility for anastomosis, and proximity to the brachial artery. Our case confirms the safety of using this autogenous vein from within the zone of injury for arterial reconstruction, after a supracondylar humeral fracture. The management of pediatric elbow fractures accompanying vascular injuries can be technically demanding due to relatively small, delicate structures and concurrent neurovascular network. Nonetheless, a vascular injury should be treated with high level of suspicion and immediate intervention to avoid any limb ischemia or loss. In

  19. The sweet potato IbMYB1 gene as a potential visible marker for sweet potato intragenic vector system.

    Science.gov (United States)

    Kim, Cha Young; Ahn, Young Ock; Kim, Sun Ha; Kim, Yun-Hee; Lee, Haeng-Soon; Catanach, Andrew S; Jacobs, Jeanne M E; Conner, Anthony J; Kwak, Sang-Soo

    2010-07-01

    MYB transcription factors play important roles in transcriptional regulation of many secondary metabolites including anthocyanins. We cloned the R2R3-MYB type IbMYB1 complementary DNAs from the purple-fleshed sweet potato (Ipomoea batatas L. cv Sinzami) and investigated the expression patterns of IbMYB1 gene with IbMYB1a and IbMYB1b splice variants in leaf and root tissues of various sweet potato cultivars by reverse transcription-polymerase chain reaction. The transcripts of IbMYB1 were predominantly expressed in the purple-fleshed storage roots and they were also detectable in the leaf tissues accumulating anthocyanin pigments. In addition, transcript levels of IbMYB1 gene were up-regulated by treatment with methyl jasmonate or salicylic acid in leaf and root tissues of cv. White Star. To set up the intragenic vector system in sweet potato, we first evaluated the utilization of the IbMYB1 gene as a visible selectable marker. The IbMYB1a was transiently expressed in tobacco leaves under the control of a constitutive cauliflower mosaic virus 35S promoter, a root-specific and sucrose-inducible sporamin promoter, and an oxidative stress-inducible sweet potato anionic peroxidase2 promoter. We also showed that overexpression of IbMYB1a induced massive anthocyanin pigmentation in tobacco leaves and up-regulated the transcript levels of the structural genes in anthocyanin biosynthetic pathway. Furthermore, high-performance liquid chromatography analysis revealed that the expression of IbMYB1a led to production of cyanidin as a major core molecule of anthocyanidins in tobacco leaves. These results suggest that the IbMYB1 gene can be applicable to a visible marker for sweet potato transformation with intragenic vectors, as well as the production of anthocyanin as important nutritive value in other plant species.

  20. ( Coturnix coturnix japonica ) fed processed sweet potato ( Ipomea ...

    African Journals Online (AJOL)

    A six–week feeding trial was carried out to investigate the effect of processing of sweet potato tuber on growth parameters and carcass values of Japanese quails. Five isonitrogenous (25%CP) diets were compounded. The control diet (A) had zero sweet potato tuber meal. The other four diets (B, C, D and E) contained ...

  1. Complementation of sweet corn mutants: a method for grouping ...

    Indian Academy of Sciences (India)

    for sweet corn are now expanding and the demands are increasing due to ... tropical/tropical regions of India is amongst one of the factors ... Maize endosperm mutant genes that affect quality of sweet corn can ... Thus, the concept of comple-.

  2. A Comparative Study of the Inhibitory Effect of the Extracts of Ocimum sanctum, Aegle marmelos, and Solanum trilobatum on the Corrosion of Mild Steel in Hydrochloric Acid Medium

    Directory of Open Access Journals (Sweden)

    M. Shyamala

    2011-01-01

    Full Text Available A comparative study of the inhibitory effect of plant extracts, Ocimum sanctum, Aegle marmelos, and Solanum trilobatum, on the corrosion of mild steel in 1N HCl medium was investigated using weightloss method, electrochemical methods, and hydrogen permeation method. Polarization method indicates plant extracts behave as mixed-type inhibitor. The impedance method reveals that charge-transfer process mainly controls the corrosion of mild steel. On comparison, maximum inhibition efficiency was found in Ocimum sanctum with 99.6% inhibition efficiency at 6.0% v/v concentration of the extract. The plant extracts obey Langmuir adsorption isotherm. The SEM morphology of the adsorbed protective film on the mild steel surface has confirmed the high performance of inhibitive effect of the plant extracts. From hydrogen permeation method, all the plant extracts were able to reduce the permeation current. The reason for the reduced permeation currents in presence of the inhibitors may be attributed to the slow discharge step followed by fast electrolytic desorption step. Results obtained in all three methods were very much in good agreement in the order Ocimum sanctum > Aegle marmelos > Solanum trilobatum.

  3. Effects of main traits of sweet sorghum irradiated by carbon ions

    International Nuclear Information System (INIS)

    Li Wenjian; He Jingyu; Liu Qingfang; Yu Lixia; Dong Xicun

    2009-01-01

    To investigate the influence of carbon ion irradiation on important agronomic characters of sweet sorghum, dry seeds of Sweet Sorghum BJ0601 and BJ0602 were irradiated by 100 MeV/u 12 C +6 ion beam to different doses at Heavy Ion Accelerator National Laboratory in Lanzhou (HIANLL). When matured, the main traits of sweet sorghum were measured. The correlation coefficient of five main agronomic characters, i.e. number of node, plant height, stalk diameter, sugar content and stem weight per plant, were analyzed using the SPSS 13.0 software. The results indicated that the obvious influence of sweet sorghum irradiated by carbon ion beam was observed. In addition, the correlation of main traits was studied. This study may provide rudimental data to select novel variety of sweet sorghum suited for fuel ethanol production. In addition, the average of sugar content of early mutant BJ0601-1 is higher than BJ0601 in M2, and the sugar content of sweet sorghum may be improved by carbon ion beam irradiation. (authors)

  4. Component Analysis of Sweet BV and Clinical Trial on Antibody Titer and Allergic Reactions

    Directory of Open Access Journals (Sweden)

    Ki Rok, Kwon

    2006-06-01

    Full Text Available Objectives : The aim of this study was to observe prevention of allergic reactions of Sweet Bee Venom (removing enzyme components from Bee Venom. Methods : Content analysis of Sweet Bee Venom and Bee Venom was rendered using HPLC method and characterization of Anti-Sweet Bee Venom in Rabbit Serum. Clinical observation was conducted for inducement of allergic responses to Sweet BV. Results : 1. Analyzing melittin content using HPLC, Sweet BV contained 34.9% more melittin than Bee venom pharmacopuncture at same concentration. 2. Observing chromatogram of HPLC, removal of the enzyme was successfully rendered on Sweet BV. 3. The anti-serum of Sweet BV showed high titers against melittin and bee venom and relatively low titer against phospholipase A2. 4. After conducting approximately 3,000 cases of Sweet BV administration, not a single case of generalized anaphylatic reaction occurred in clinical observation. 5. Mild compared to the bee venom pharmacopuncture, Sweet BV showed some acute hypersensitive reactions of edema, itchiness, and aching locally. 6. Sweet BV was administered on six patients with previous history of suffering from generalized acute hypersensitive reactions with the bee venom. None of the patients showed allergic reactions with Sweet BV, suggesting it can effectively prevent anaphylatic shock which may occur after the bee venom pharmacopuncture procedure. Conclusion : Summarizing above results, Sweet Bee Venom appears to be an effective measurement against allergic reactions from the bee venom pharmacopuncture especially against anaphylatic shock.

  5. Dicty_cDB: Contig-U15609-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available H641784 ) CHO_OF4972xp21r1.ab1 CHO_OF4 Nicotiana tabacum ge... 54 0.002 2 ( DY336731 ) OB_SEa04L12.r OB_SEa Ocimum basil...nt WO2007093776. 38 0.029 3 ( DQ508732 ) Perkinsus marinus delta9-elongating activity prot... 38 0.029 3 ( D...Y036171 ) CAIY2568.fwd CAIY Artemisia annua leaf Artemisia ... 42 0.33 2 ( AW6512...9 2 ( EY042621 ) CAIY6316.fwd CAIY Artemisia annua leaf Artemisia ... 42 0.39 2 ( EH069644 ) PMDAD81TO Perki...nsus marinus small insert cDNA lib... 38 0.41 2 ( EY042620 ) CAIY6316.rev CAIY Artemisia annua leaf Artemi

  6. ESR-based Identification of Radiation-Induced Free Radicals in Gamma-Irradiated Basil and Clove Using Different Sample Pre-Treatments

    International Nuclear Information System (INIS)

    Kwak, J.Y.; Ahn, J.J.; Kashif Akram; Kwon, J.H.

    2012-01-01

    An improved detection of radiation-induced paramagnetic faults was developed to identify the irradiation status of basil and clove. The effectiveness of different sample pretreatments, including freeze-drying (FD), oven-drying (OD), alcoholic-extraction (AE), and water-washing and alcoholic-extraction (WAE), were examined. All non-irradiated samples showed a single central signal (g 0 = 2.006), whereas radicals representing two additional side peaks (g 1 = 2.023 and g 2 = 1.986) with a mutual distance of 6 mT were detected in the irradiated samples. AE and WAE produced the best results for irradiated clove in terms of intensities of radiation-specific ESR signals and their ratios to the central signal. However, FD provided the highest intensities of radiation-specific ESR signals for basil, whereas their ratios to the major signal were better in the cases of AE and WAE. Signal noise, particularly due to Mn 2+ signals, was observed, whereas it decreased in AE and WAE pretreatments. Based on our results, AE and WAE can improve the detection conditions for radiation-specific ESR signals in irradiated samples. (author)

  7. Protein concentrations of sweet soysauces from Rhizopus oryzae and R. oligosporus fermentation without moromi fermentation

    Directory of Open Access Journals (Sweden)

    NOOR SOESANTI HANDAJANI

    2007-07-01

    Full Text Available Soy sauce was produce from soybean that fermented with koji/tempeh fungi and thenfermented under salt solution or moromi fermentation. The objectives of this experiment was to compare of protein (total and soluble content of sweet soy sauce that produced from soybean fermented with Rhizopus oryzae and R. oligosporus without moromi fermentation to the sweet soysauce with moromi fermentation one. The total and soluble proteins of sweet soy sauces that produce from soybean without moromi fermentation were higher that sweet soy sauces that produce with moromi fermentation. Soluble protein of sweet soy sauce that produced from soybean fermented with R. oligosporus without moromi fermentation was 8.2% and meet to the highest quality of sweet soy sweet sauce based on Indonesia Industrial Standard. Soluble protein of sweet soy sauce that produced from soybean fermented with R. oryzae without moromi fermentation was 4.1% and meet to the medium quality of sweet soy sweet sauce based on Indonesia Industrial Standard.

  8. SWEET CORN FARMING: THE EFFECT OF PRODUCTION FACTOR, EFFICIENCY AND RETURN TO SCALE

    Directory of Open Access Journals (Sweden)

    Dwijatenaya I.B.M.A.

    2017-10-01

    Full Text Available This research aims to determine the effect of production factors on the sweet corn production, the efficiency of sweet corn farming, and the return to scale of sweet corn production. The sampling technique was taken by proportionate stratified random sampling method with the sample number of 57 people while the analyzer used was the program of Frointer 4.1c. The results show that the production factors of the land farm, seed, and fertilizer have a positive and significant effect on sweet corn production. On the other hand, labor production factors have a positive but not significant effect on sweet corn production. It also found that technical efficiency, price efficiency, and economic efficiency of sweet corn farming in Muara Wis Sub-district of Kutai Kartanegara Regency are not efficient yet. The return to scale of sweet corn yield has an increasing return to scale condition.

  9. Australian print news media coverage of sweet, non-alcoholic drinks sends mixed health messages.

    Science.gov (United States)

    Bonfiglioli, Catriona; Hattersley, Libby; King, Lesley

    2011-08-01

    This study aimed to analyse the contribution of Australian print news coverage to the public profile of sweet, non-alcoholic beverages. News media portrayal of health contributes to individuals' decision-making. The focus on sugar-sweetened beverages reflects their contribution to excessive energy intake. One year's coverage of sweet, non-alcoholic beverages by major Australian newspapers was analysed using content and frame analysis. Research questions addressed which sweet drinks are most prominently covered, what makes sweet drinks newsworthy and how are the health aspects of sweet drinks framed? Fruit juice was the most widely covered sweet drink, closely followed by carbonated, sugar-sweetened soft drinks. Overall coverage was positively oriented towards sweet drinks, with fruit juice primarily portrayed as having health benefits. Some coverage mentioned risks of sweet drinks, such as obesity, tooth decay, metabolic syndrome and heart attack. Sweet drinks often enjoy positive coverage, with their health benefits and harms central to their ability to attract journalists' attention. However, the mix of coverage may be contributing to consumer confusion about whether it is safe and/or healthy to consume sweet non-alcoholic drinks. Framing of sweet drinks as healthy may undermine efforts to encourage individuals to avoid excess consumption of energy-dense drinks which offer few or minimal health benefits. © 2011 The Authors. ANZJPH © 2011 Public Health Association of Australia.

  10. Effects on humans elicited by inhaling the fragrance of essential oils: sensory test, multi-channel thermometric study and forehead surface potential wave measurement on basil and peppermint.

    Science.gov (United States)

    Satoh, Tomoko; Sugawara, Yoshiaki

    2003-01-01

    The effects on humans inhaling the fragrance of essential oils were examined in terms of a sensory test, a multi-channel skin thermometer study and a portable forehead surface electroencephalographic (IBVA-EEG) measurement. The essential oils examined in this study were those of basil and peppermint, because our previous sensory test had indicated an opposite effect of these essential oils when mental work was undertaken; the inhalation of basil produced a more favorable impression after work than before work, whereas peppermint produced an unfavorable impression under these circumstances. For subjects administered basil or peppermint before and after mental work using an inhalator, a series of multi-channel skin thermometer studies and IBVA-EEG measurements were conducted. Using such paired odorants, our results showed that when compared between before and after mental work assigned to subjects: (1) the inhalation of basil, in which a favorable impression was predominant on the whole in terms of the sensory evaluation spectrum, was shown to be associated upward tendency in finger-tip skin temperature; (2) whereas these situations were opposite in the case of peppermint, in which the reversed (unfavorable) feature in sensory profiling was accompanied by a decrease in the magnitude of beta waves and a decrease in the finger-tip skin temperature both based on Welch's method, even at p < 0.01, implying a decreasing propensity of the aroused state and of the arousal response. The elucidation of such sensory and physiological endpoints of paired odorants would be of primary importance for human chemoreception science, because these are only rarely recorded during the same experiments, and this paradigm is highly informative about non-verbal responses to odorants.

  11. Essential Oil Composition and Antimicrobial Activity of Methyl cinnamate-Linalool Chemovariant of Ocimum basilicum L. from India

    Directory of Open Access Journals (Sweden)

    Rajendra Chandra Padalia

    2017-03-01

    Full Text Available The essential oils obtained from hydrodistillation of Ocimum basilicum L. harvested at four different growth stages during spring-summer and rain-autumn cropping seasons , were characterized using GC and GC-MS. The e ssential oil yield was found to vary from 0.28–0.32% and 0.40–0.52% during spring-summer and rain-autumn cropping season, respectively with its maximal at full bloom stage. Altogether , forty constituents, comprising 94.9–98.3% were identified represented by ( E -methyl cinnamate (36.6 – 66.4%, linalool (11.2 – 43.8%, and (Z -methyl cinnamate (5.4-7.6% as main constituents. Results showed that growth stages strongly influenced the chemical composition of the essential oil in two cropping seasons, particularly concerning to the content of ( E -methyl cinnamate and linalool. Seed setting stage was optimized for harvesting ( E -methyl cinnamate rich oil (66.4% in rain-winter cropping season. The antimicrobial potential of the essential oil was tested againist eight pathogenic bacteria and three fungal strains. Antimicrobial assay showed that the essential oil possessed good antibacterial activity against Streptococcus mutans, Staphylococcus epidermidis, Escherichia coli , and antifungal activity against Candida kefyr and Candida albicans. Ocimum basilicum , essential oil, ( E - methyl cinnamate, linalool, antibacterial activity, antifungal activity

  12. Anti-inflammatory and antiedematogenic activity of the Ocimum basilicum essential oil and its main compound estragole: In vivo mouse models.

    Science.gov (United States)

    Rodrigues, Lindaiane Bezerra; Oliveira Brito Pereira Bezerra Martins, Anita; Cesário, Francisco Rafael Alves Santana; Ferreira E Castro, Fyama; de Albuquerque, Thaís Rodrigues; Martins Fernandes, Maria Neyze; Fernandes da Silva, Bruno Anderson; Quintans Júnior, Lucindo José; da Costa, José Galberto Martins; Melo Coutinho, Henrique Douglas; Barbosa, Roseli; Alencar de Menezes, Irwin Rose

    2016-09-25

    The genus Ocimum are used in cooking, however, their essential oils are utilized in traditional medicine as aromatherapy. The present study was carried out to investigate the chemical composition and systemic anti-inflammatory activity of the Ocimum basilicum essential oil (EOOB) and its major component estragole, as well as its possible mechanisms of action. The Ocimum basilicum essential oil was obtained by hydrodistillation and analyzed by GC-MS. The anti-inflammatory action was verified using acute and chronic in vivo tests as paw edema, peritonitis, and vascular permeability and granulomatous inflammation model. The anti-inflammatory mechanism of action was analyzed by the participation of histamine and arachidonic acid pathways. The chemical profile analysis identified fourteen components present in the essential oil, within them: estragole (60.96%). The in vivo test results show that treatment with EOOB (100 and 50 mg/kg) and estragole (60 and 30 mg/kg) significantly reduced paw edema induced by carrageenan and dextran. The smallest doses of EOOB (50 mg/kg) and estragole (30 mg/kg) showed efficacy in the reduction of paw edema induced by histamine and arachidonic acid, vascular permeability inhibition and leukocyte emigration in the peritoneal fluid. Theses doses were capable of reducing the chronic inflammatory process. The results observed between the EOOB and estragole demonstrate efficacy in anti-inflammatory activity, however, the essential oil is more efficacious in the acute and chronic anti-inflammatory action. This study confirms the therapeutic potential of this plant and reinforces the validity of its use in popular medicine. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  13. Wool-waste as organic nutrient source for container-grown plants

    Energy Technology Data Exchange (ETDEWEB)

    Zheljazkov, Valtcho D. [Mississippi State University, North Mississippi Research and Extension Center, Verona, MS 38879 (United States)], E-mail: vj40@pss.msstate.edu; Stratton, Glenn W [Department of Plant and Animal Sciences and Department of Environmental Sciences, Nova Scotia Agricultural College, Truro, NS, B2N 5E3 (Canada); Pincock, James [Department of Chemistry, Dalhousie University, Halifax, NS, B3H 4J3 (Canada); Butler, Stephanie [Department of Plant and Animal Sciences and Department of Environmental Sciences, Nova Scotia Agricultural College, Truro, NS, B2N 5E3 (Canada); Jeliazkova, Ekaterina A [Mississippi State University, Department of Plant and Soil Sciences, Mississippi State, MS 39762 (United States); Nedkov, Nedko K [Research Institute for Roses and Aromatic Crops, 49 Osvobojdenie Blv., Kazanluk (Bulgaria); Gerard, Patrick D [Department of Applied Economics and Statistics, Clemson University, Clemson, SC 29634 (United States)

    2009-07-15

    A container experiment was conducted to test the hypothesis that uncomposted wool wastes could be used as nutrient source and growth medium constituent for container-grown plants. The treatments were: (1) rate of wool-waste application (0 or unamended control, 20, 40, 80, and 120 g of wool per 8-in. pot), (2) growth medium constituents [(2.1) wool plus perlite, (2.2) wool plus peat, and (2.3) wool plus peat plus perlite], and (3) plant species (basil and Swiss chard). A single addition of 20, 40, 80, or 120 g of wool-waste to Swiss chard (Beta vulgaris L.) and basil (Ocimum basilicum L.) in pots with growth medium provided four harvests of Swiss chard and five harvests of basil. Total basil yield from the five harvests was 1.6-5 times greater than the total yield from the unamended control, while total Swiss chard yield from the four harvests was 2-5 times greater relative to the respective unamended control. The addition of wool-waste to the growth medium increased Swiss chard and basil tissue N, and NO{sub 3}-N and NH{sub 4}-N in growth medium relative to the unamended control. Scanning electron microscopy (SEM) and energy dispersive X-ray (EDX) microanalysis of wool fibers sampled at the end of the experiments indicated various levels of decomposition, with some fibers retaining their original surface structure. Furthermore, most of the wool fibers' surfaces contained significant concentrations of S and much less N, P, or K. SEM/EDX revealed that some plant roots grow directly on wool-waste fibers suggesting either (1) root directional growth towards sites with greater nutrient concentration and/or (2) a possible role for roots or root exudates in wool decomposition. Results from this study suggest that uncomposted wool wastes can be used as soil amendment, growth medium constituent, and nutrient source for container-grown plants.

  14. Synergistic Effects of Agronet Covers and Companion Cropping on Reducing Whitefly Infestation and Improving Yield of Open Field-Grown Tomatoes

    Directory of Open Access Journals (Sweden)

    Stella Mutisya

    2016-09-01

    Full Text Available Tomatoes (Lycopersicon esculentum Mill are one of the biggest vegetable crops in the world, supplying a wide range of vitamins, minerals and fibre in human diets. In the tropics, tomatoes are predominantly grown under sub-optimal conditions by subsistence farmers, with exposure to biotic and abiotic stresses in the open field. Whitefly (Bemisia tabaci Gennadius is one of the major pests of the tomato, potentially causing up to 100% yield loss. To control whitefly, most growers indiscriminately use synthetic insecticides which negatively impact the environment, humans, and other natural pest management systems, while also increasing cost of production. This study sought to investigate the effectiveness of agronet covers and companion planting with aromatic basil (Ocimum basilicum L. as an alternative management strategy for whitefly in tomatoes and to evaluate the use of these treatments ontomato growth and yield. Two trials were conducted at the Horticulture Research and Training Field, Egerton University, Njoro, Kenya. Treatments comprised a combination of two factors, (1 growing environment (agronet and no agronet and (2 companion planting with a row of basil surrounding tomato plants, a row of basil in between adjacent rows of tomato, no companion planting. Agronet covers and companion cropping with a row of basil planted between adjacent tomato rows significantly lowered B. tabaci infestation in tomatoes by 68.7%. Better tomato yields were also recorded in treatments where the two treatments were used in combination. Higher yield (13.75 t/ha was obtained from tomatoes grown under agronet cover with a basil row planted in between adjacent rows of the tomato crop compared to 5.9 t/ha in the control. Non-marketable yield was also lowered to5.9 t/ha compared to 9.8 t/ha in the control following the use of the two treatments in combination. The results of this study demonstrate the potential viability of using companion cropping and agronet

  15. Wool-waste as organic nutrient source for container-grown plants

    International Nuclear Information System (INIS)

    Zheljazkov, Valtcho D.; Stratton, Glenn W.; Pincock, James; Butler, Stephanie; Jeliazkova, Ekaterina A.; Nedkov, Nedko K.; Gerard, Patrick D.

    2009-01-01

    A container experiment was conducted to test the hypothesis that uncomposted wool wastes could be used as nutrient source and growth medium constituent for container-grown plants. The treatments were: (1) rate of wool-waste application (0 or unamended control, 20, 40, 80, and 120 g of wool per 8-in. pot), (2) growth medium constituents [(2.1) wool plus perlite, (2.2) wool plus peat, and (2.3) wool plus peat plus perlite], and (3) plant species (basil and Swiss chard). A single addition of 20, 40, 80, or 120 g of wool-waste to Swiss chard (Beta vulgaris L.) and basil (Ocimum basilicum L.) in pots with growth medium provided four harvests of Swiss chard and five harvests of basil. Total basil yield from the five harvests was 1.6-5 times greater than the total yield from the unamended control, while total Swiss chard yield from the four harvests was 2-5 times greater relative to the respective unamended control. The addition of wool-waste to the growth medium increased Swiss chard and basil tissue N, and NO 3 -N and NH 4 -N in growth medium relative to the unamended control. Scanning electron microscopy (SEM) and energy dispersive X-ray (EDX) microanalysis of wool fibers sampled at the end of the experiments indicated various levels of decomposition, with some fibers retaining their original surface structure. Furthermore, most of the wool fibers' surfaces contained significant concentrations of S and much less N, P, or K. SEM/EDX revealed that some plant roots grow directly on wool-waste fibers suggesting either (1) root directional growth towards sites with greater nutrient concentration and/or (2) a possible role for roots or root exudates in wool decomposition. Results from this study suggest that uncomposted wool wastes can be used as soil amendment, growth medium constituent, and nutrient source for container-grown plants.

  16. Experimental study on bread yeast cultured in sweet sorghum juice

    International Nuclear Information System (INIS)

    Wang Jufang; Dong Xicun; Li Wenjian; Xiao Guoqing; Ma Liang; Gao Feng

    2008-01-01

    As a substitute for food supplies, sweet sorghum juice with high grade has demonstrated out- standing advantage in fermentation. To obtain the optimized fermentation conditions, the growth, the bio- mass of bread yeast cultured in sweet sorghum juice and total residual sugar were investigated in the paper. The fermentation was performed and optimized in a 10-100 1 bio-reactor. The results show that the application of sweet sorghum juice in bread yeast production is very potential. (authors)

  17. Synthetic Hexaploids Derived from Wild Species Related to Sweet Potato

    OpenAIRE

    SHIOTANI, Itaru; KAWASE, Tsuneo; 塩谷, 格; 川瀬, 恒男

    1987-01-01

    The utilization of germplasm of the wild species in sweet-potato breeding has been conducted for the last three decades. Such attempts brought some remarkable achievments in improving root yield, starch content and resistance to the nematodes of sweet potato. Some wild plants in polyploid series may have many genes potentially important for further improvement of the agronomic traits. However, the genomic relationship between the wild relatives and hexaploid sweet potato (2n=6x=90) has been u...

  18. Field Evaluation Of Four Sweet Potato Cultivars For Yield And Sweet ...

    African Journals Online (AJOL)

    Four sweet potato cultivars (TIS 87/0087, TIS 8441, TIS 2532 OP. 1. 13 and Ex Igbariam) were evaluated for yield and damage of C. puncticollis during the period June to October in 1999 and 2000, respectively. The trials were conducted in a randomized complete block design and replicated three times. Plants were ...

  19. Technoeconomic evaluation of urban plant factories: The case of basil (Ocimum basilicum).

    Science.gov (United States)

    Liaros, Stelios; Botsis, Konstantinos; Xydis, George

    2016-06-01

    Greece is currently in a turmoil, experiencing the effects of more than half a decade of economic crisis. Public health and welfare, jobs and wages, labor market concerning employment as long as employability of the work force, inequality, life satisfaction and housing, tourism and environment, economic and energy poverty are heavily impacted by Greece's disadvantageous economic situation. Real estate market could not have gotten away from the financial commotion, being currently in a halt after years of rapid decline. Fired from the present situation of Greece's real estate market, the present study is concerned with the investigation of alternative ways to support the local real estate market. With respect to sustainable development's ethics, the development, implementation, installation and operation of small, inexpensive plant factories within the urban environment is evaluated. Installations such are those, will encourage the penetration of a new market for the untapped buildings' resource, advancing new investing opportunities, promoting economic growth and productivity while creating a new labor market. The study will rely on the basic principles of Life Cycle Costing Assessment and develop a methodology upon which different scenarios will be evaluated against the "Do Nothing" scenario. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. Sweet taste liking is associated with subjective response to amphetamine in women but not men.

    Science.gov (United States)

    Weafer, Jessica; Lyon, Nicholas; Hedeker, Donald; de Wit, Harriet

    2017-11-01

    Preference for sweet taste rewards has been linked to the propensity for drug use in both animals and humans. Here, we tested the association between sweet taste liking and sensitivity to amphetamine reward in healthy adults. We hypothesized that sweet likers would report greater euphoria and stimulation following D-amphetamine (20 mg) compared to sweet dislikers. Men (n = 36) and women (n = 34) completed a sweet taste test in which they rated their liking of various concentrations of sucrose and filtered water (0.05, 0.10, 0.21, 0.42, and 0.83 M). Participants who preferred the highest concentration were classified as "sweet likers." All others were classified as "sweet dislikers." They then completed four sessions in which they received D-amphetamine (20 mg) and placebo in alternating order, providing self-report measures of euphoria and stimulation on the Addiction Research Center Inventory (ARCI) at regular intervals. We conducted linear mixed effects models to examine relationships between sweet liking and drug-induced euphoria and stimulation. Sweet likers reported significantly greater amphetamine-induced euphoria than did sweet dislikers among women. By contrast, sweet liking was not associated with amphetamine response in men. No associations with stimulation were observed. The association between sweet preference and amphetamine response in women is consistent with animal studies linking sweet taste preference and drug reward and also fits with observations that individuals who use drugs show a preference for sweet tastes. Whether the sex difference is related to circulating hormones, or other variables, remains to be determined.

  1. A New Formula to Estimate the Length of Right Upper Extremity Vein from Elbow Crease to Carina Calculated by Peripherally Inserted Central Catheter Insertion through Right Basilic Vein Puncture

    International Nuclear Information System (INIS)

    Cho, Hyun Hwan; Jeon, Eui Yong; Lee, Hyun Jung; Lee, Hyun; Koh, Sung Hye; Choi, Sun Young; Lee, Kwan Seop; Yoon, Dae Young; Im, Hyoung June

    2012-01-01

    To measure the length of the upper extremity vein between the elbow crease and the carina (elbow crease to carina length, ECL), to facilitate the appropriate positioning of the tip of the peripherally inserted central catheter (PICC). A total of 124 patients (64 men and 60 women; mean age 65.2 ± 15.4 years; range, 21-90 years) inserted with PICC through the right basilic vein under fluoroscopy were included in this retrospective study. The ECL was determined as follows: ECL = (distance from elbow crease to puncture site) + (the catheter length of PICC) - (distance from carina to catheter tip on post-procedural chest radiograph). We analyzed the relationship between ECL and patient height. The mean ECL through right basilic vein was 42.07 ±4.03 cm (27.5 to 52.2 cm). ECL was found to be significantly correlated with patient height: ECL (cm) = 0.24 X patient height (cm) + 3.75. The formula developed in our study would be helpful for predicting the optimal catheter length during a blind bedside procedure of PICC via the right basilic vein.

  2. Idiopathic hypertrophic cranial pachymeningitis associated with Sweet's Syndrome

    International Nuclear Information System (INIS)

    Cano, Antonio; Ribes, Ramon; Riva, Andres de la; Rubio, Fernando Lopez; Sanchez, Carmen; Sancho, Jose L.

    2002-01-01

    A case of hypertrophic cranial pachymeningitis associated with Sweet's Syndrome is presented. Both entities have been described in association with several other chronic systemic inflammatory diseases and autoimmune conditions. To our knowledge the coexistence between Sweet's Syndrome and hypertrophic cranial pachymeningitis has not been reported up to date. We suggest a possible autoimmune or dysimmune mechanism in the pathogenesis of these two entities

  3. Assimilation, partitioning, and nonstructural carbohydrates in sweet compared with grain sorghum

    International Nuclear Information System (INIS)

    Vietor, D.M.; Miller, F.R.

    1990-01-01

    Nonstructural carbohydrate concentrations in stems are greater for sweet than grain sorghums [Sorghum bicolor (L.) Moench]. Knowledge of plant characteristics associated with high nonstructural carbohydrates in sweet sorghum will air efforts to increase nonstructural carbohydrates in grain sorghum stems. This study tested the hypothesis that variation of CO 2 assimilation rate, leaf area, branching at upper nodes, and partitioning of 14 C-labeled assimilate to main stems are associated with variation of stem nonstructural carbohydrates. A sweet (Atlas X Rio) and a grain (ATx623 X RTx5388) hybrid, stages near and after physiological maturity, and defoliation and gibberellic acid (GA 3 ) treatments provided sources of variation for study. Concentrations of nonstructural carbohydrates in lower and upper stems of the sweet hybrid were 1.4 and 2.7 times higher, respectively, than for the grain hybrid, after physiological maturity. Variation in branching, including 14 C-assimilate partitioning to branches, was not consistently associated with hybrid differences in stem nonstructural carbohydrates. Increased recovery (twofold) of 14 C-assimilate in roots and labeled leaves corresponded with lower percentages of 14 C-assimilate and lower concentrations of nonstructural carbohydrates in stems of the grain hybrid. Leaf areas and leaf CO 2 exchange rate were twice as great for the sweet hybrid. Although defoliation of the sweet hybrid minimized leaf area differences between hybrids, the sweet hybrid accumulated twice as much nonstructural carbohydrates in branches after physiological maturity. Greater potentials for CO 2 assimilation and for 14 C-assimilate accumulation in mature stem tissue were associated with higher levels of stem nonstructural carbohydrates in the sweet compared with the grain hybrid

  4. Study on genotypic variation for ethanol production from sweet sorghum juice

    Energy Technology Data Exchange (ETDEWEB)

    Ratnavathi, C.V.; Suresh, K.; Kumar, B.S. Vijay; Pallavi, M.; Komala, V.V.; Seetharama, N. [Directorate of Sorghum Research, Rajendranagar, Hyderabad 500030, Andhra Pradesh (India)

    2010-07-15

    Sugarcane molasses is the main source for ethanol production in India. Sweet sorghum with its juicy stem containing sugars equivalent to that of sugarcane is a very good alternative for bio-ethanol production to meet the energy needs of the country. Sweet sorghum is drought resistant, water logging resistant and saline-alkaline tolerant. Growing sweet sorghum for ethanol production is relatively easy and economical and ethanol produced from sweet sorghum is eco-friendly. In view of this, it is important to identify superior genotypes for ethanol production in terms of percent juice brix, juice extractability, total fermentable sugars, ethanol yield and fermentation efficiency. This paper presents the study on the variability observed for the production of ethanol by various sweet sorghum genotypes in a laboratory fermentor. Five Sweet Sorghum (Sorghum bicolor L. Moench) genotypes were evaluated for ethanol production from stalk juice (Keller, SSV 84, Wray, NSSH 104 and BJ 248). Sweet sorghum juice differs from cane juice mainly in its higher content of starch and aconitic acid. Data were collected for biomass yield; stalk sugar yield and ethanol production in five genotypes. Maximum ethanol production of 9.0%w/v ethanol was obtained with Keller variety (20% sugar concentration was used), and decreased for other genotypes. A distiller's strain of Saccharomyces cerevisiae (gifted by Seagram Distilleries Ltd.) was employed for fermentation. The fermentation efficiency (FE) was 94.7% for this strain. High biomass of yeast was obtained with BJ 248 variety. When the similar experiments were conducted with unsterile sweet sorghum juice (15% sugar concentration) 6.47%w/v ethanol was produced. (author)

  5. Effects of planting method on agronomic characteristics, yield and yield components of sweet and super sweet corn (Zea mays L. varieties under saline conditions

    Directory of Open Access Journals (Sweden)

    F. Faridi

    2016-05-01

    Full Text Available In order to evaluate the effects of planting pattern on morphological, Phonological, yield and yield components of sweet and super sweet corn (Zea mays L. varieties under saline conditions, a field experiment was conducted as split plots based on a randomized complete block design with four replications. Planting pattern in 3 levels included one row in ridge, two row in ridge and furrow planting, as a main plot and varieties in 4 levels sweet corn with 2 types (KSc 403 su, Merit and super sweet with two types (Basin, obsession as sub plots. The results showed that planting pattern had significant differences on plant height, ear height, leaf length, leaf width, number of kernel per row, number of rows per ear and 1000-kernel weight. but had no significant effects on the length of tassel, number of leaf/plant, number of leaf per plant above ear, stem diameter, time of anthesis, time of silking, anthesis silking interval ASI, grain yield, biological yield and harvest index. Different varieties had significant effects on the total characteristics studied except number of leaf above ear and stem diameter. Most of the conservable grain yield and harvest index was in Obsession variety (10 kg and 39%, respectively and the least was seen in Basin (4 kg and 20%, respectively. The result showed that use of furrow planting pattern for sweet and super sweet corn in saline conditions can effects result in higher yield.

  6. HOW PROPERTIES OF EDIBLE OILS ARE IMPROVED BY ESSENTIAL OILS

    Directory of Open Access Journals (Sweden)

    SONIA AMARIEI

    2016-10-01

    Full Text Available The main aim of the present paper is to find out whether the addition of essential oils determines better oxidation stability and positive change of sensory and hedonic perception of edible oils. The oxidation stability of sunflower, corn and grape seed oils was analyzed in the presence of antioxidants in essential oils of rosemary (Rosmarinus officinalis, thyme (Thymus vulgaris and basil (Ocimum basilicum during storage, under conditions of accelerated oxidative processes (4 days, at 60 °C. The total phenolic compounds of these essential oils were determined by the Folin-Ciocalteu method. The DPPH method was used to evaluate the antioxidant capacity of basil, rosemary and thyme essential oils in comparison with known synthetic antioxidant L(+-ascorbic acid. The addition of essential oils to edible oils, the amounts proposed in analyses, determines a favorable influence on their oxidation stability as well as their taste. The influence of addition of essential oils on the taste of edible oils was studied in two products consumed mainly at breakfast, bread and spinach leaves. The results recommend the use of these plant extracts as additives in edible oils rather than synthetic antioxidants.

  7. Taste perception and implicit attitude toward sweet related to body mass index and soft drink supplementation.

    Science.gov (United States)

    Sartor, Francesco; Donaldson, Lucy F; Markland, David A; Loveday, Helina; Jackson, Matthew J; Kubis, Hans-Peter

    2011-08-01

    These studies examined the differences in sweet taste perception and implicit attitude toward sweet between normal-weight and overweight/obese adults; and tested the effects of soft drink consumption on sweet taste, explicit preference and implicit attitude toward sweet in normal-weight subjects. In study 1, normal-weight (n = 22) and overweight/obese (n = 11) adults were assessed for sweet taste intensity and pleasantness. Implicit attitude toward sweet was assessed by implicit association test (IAT). In study 2, normal-weight, lightly active adults (n = 12) underwent one month soft drink supplementation (≈760 ml/day). This increased their daily carbohydrate intake by 2.1 ± 0.2g/kg body weight. Sweet taste perception, explicit preference and implicit attitudes to sweet were assessed. In both studies salty taste was also assessed as a contrasting perception. Overweight/obese subjects perceived sweet and salty tastes as less intense (-23% and -19%, respectively) and reported higher IAT scores for sweet than normal-weight controls (2.1-fold). The supplementation changed sweet intensity/pleasantness ratings and it increased explicit preference (2.3-fold) for sweet in a subgroup of initial sucrose-dislikers. In conclusion, overweight/obese individuals are more implicitly attracted to sweet. One month of soft drink supplementation changed sweet taste perception of normal-weight subjects. Crown Copyright © 2011. Published by Elsevier Ltd. All rights reserved.

  8. [Recontextualization of nursing clinical simulation based on Basil Bernstein: semiology of pedagogical practice].

    Science.gov (United States)

    dos Santos, Mateus Casanova; Leite, Maria Cecília Lorea; Heck, Rita Maria

    2010-12-01

    This is an investigative case study with descriptive and participative character, based on an educational experience with the Simulation in Nursing learning trigger. It was carried out during the second semester of the first cycle of Faculdade de Enfermagem (FEN), Universidade Federal de Pelotas (UFPel). The aim is to study the recontextualization of pedagogic practice of simulation-based theories developed by Basil Bernstein, an education sociologist, and to contribute with the improvement process of education planning, and especially the evaluation of learning trigger. The research shows that Bernstein's theory is a powerful tool semiotic pedagogical of practices which contributes to the planning and analysis of curricular educational device.

  9. Component Analysis of Sweet BV and Clinical Trial on Antibody Titer and Allergic Reactions

    OpenAIRE

    Ki Rok, Kwon; Suk Ho, Choi; Bae Chun Cha

    2006-01-01

    Objectives : The aim of this study was to observe prevention of allergic reactions of Sweet Bee Venom (removing enzyme components from Bee Venom). Methods : Content analysis of Sweet Bee Venom and Bee Venom was rendered using HPLC method and characterization of Anti-Sweet Bee Venom in Rabbit Serum. Clinical observation was conducted for inducement of allergic responses to Sweet BV. Results : 1. Analyzing melittin content using HPLC, Sweet BV contained 34.9% more melittin than Bee venom ...

  10. Bioethanol production from dried sweet sorghum stalk

    Energy Technology Data Exchange (ETDEWEB)

    Almodares, A.; Etemadifar, Z.; Ghoreishi, F.; Yosefi, F. [Biology Dept. Univ. of Isfahan, Isfahan (Iran, Islamic Republic of)], e-mail: aalmodares@yahoo.com

    2012-11-01

    Bioethanol as a renewable transportation fuel has a great potential for energy and clean environment. Among crops sweet sorghum is one of the best feedstock for ethanol production under hot and dry climatic conditions. Because it has higher tolerance to salt and drought comparing to sugarcane and corn that are currently used for bio-fuel production in the world. Generally mills are used to extract the juice from sweet sorghum stalks. Three roller mills extract around nearly 50 percent of the juice and more mills is needed to extract higher percentage of the juice. More over under cold weather the stalks become dry and juice is not extracted from the stalk, therefore reduce harvesting period. In this study stalks were harvested, leaves were stripped from the stalks and the stalks were chopped to nearly 4 mm length and sun dried. The dry stalks were grounded to 60 mesh powder by a mill. Fermentation medium consists of 15-35% (w/w) sweet sorghum powder, micronutrients and active yeast inoculum from 0.5-1% (w/w) by submerge fermentation method. The fermentation time and temperature were 48-72 hours and 30 deg, respectively. The results showed the highest amount of ethanol (14.5 % w/w sorghum) was produced with 10% sweet sorghum powder and 1% of yeast inoculum, three day fermentation at 30 deg.

  11. Economic feasibility of producing sweet sorghum as an ethanol feedstock in the southeastern United States

    International Nuclear Information System (INIS)

    Linton, Joseph A.; Miller, J. Corey; Little, Randall D.; Petrolia, Daniel R.; Coble, Keith H.

    2011-01-01

    This study examines the feasibility of producing sweet sorghum (Sorghum bicolor (L.) Moench) as an ethanol feedstock in the southeastern United States through representative counties in Mississippi. We construct enterprise budgets along with estimates of transportation costs to estimate sweet sorghum producers' breakeven costs for producing and delivering sweet sorghum biomass. This breakeven cost for the sweet sorghum producer is used to estimate breakeven costs for the ethanol producer based on wholesale ethanol price, production costs, and transportation and marketing costs. Stochastic models are developed to estimate profits for sweet sorghum and competing crops in two representative counties in Mississippi, with sweet sorghum consistently yielding losses in both counties. -- Highlights: → We examine the economic feasibility of sweet sorghum as an ethanol feedstock. → We construct enterprise budgets along with estimates of transportation costs. → We estimate breakeven costs for producing and delivering sweet sorghum biomass. → Stochastic models determine profits for sweet sorghum in two Mississippi counties.

  12. A Clinical Report of Localized Itching After Treatment with Sweet Bee Venom

    Directory of Open Access Journals (Sweden)

    Choi Seok-woo

    2010-09-01

    Full Text Available Objectives : This study is to report the percentage of localized itching which occurred, when we injected to patients with Sweet Bee Venom(Sweet BV. Methods : We investigated 374 patients who had injected with Sweet BV in our clinic from February 15. 2009 to April 30, 2010. We checked the number and percentage of patients who occured localized itching on injection area. Then we analyzed those according to times in treatment, the body parts of injection and treatment dosage. Results and Conclusion : Localized itching was lower by 1.60% in the first treatment with Sweet BV. However localized itching was 12.83% in the whole course of treatment, which showed a similar incidence of 13% in Bee Venom. Therefore it can be interpreted that Sweet BV may help suppress the immune responses such as itching in the initial treatment, but the occurrence of local immune responses of Sweet BV may be similar to that of Bee Venom in continued treatment. We suppose that we should be careful of the occurrence of local immune responses as Bee Venom at least until the fourth treatment in clinical application with Sweet BV, although localized itching did not occur in the first treatment. Also we should be careful of treatment with Sweet BV in body parts, such as wrist, hand, chest and abdominal, because the percentage of localized itching was relatively high in those parts.

  13. Síndrome de Sweet associada à policitemia vera

    OpenAIRE

    Moreira,Ângela Puccini; Souza,Flávia Feijó de; Gaspar,Neide Kalil; Quattrino,Ada Lobato; Vilar,Enoi Aparecida Guedes

    2009-01-01

    A síndrome de Sweet pode estar associada a malignidades hematológicas, principalmente, à leucemia mieloide aguda, porém existem poucos relatos demonstrando a associação com a policitemia vera. Relata-se o caso de doente do sexo masculino, de 65 anos, portador de policitemia vera,que evoluiu com aparecimento de síndrome de Sweet na sua forma paraneoplásica.

  14. The anticancer effect of Ocimum tenuiflorum leaves

    Directory of Open Access Journals (Sweden)

    Lam, S.N.

    2017-11-01

    Full Text Available Breast cancer is the leading cause of cancer deaths among females in Malaysia. Ocimum tenuiflorum L., (O. tenuiflorum commonly known as ruku in Malaysia, is usually cultivated as a garden ornamental plant because of its small purplish and some yellowish flower. The specific objective of this research is to investigate the anticancer of O. tenuiflorum against human breast cancer cell lines (MCF-7 and MDA-MB-231 and human fibroblast cell line (HS-27. In addition, another objective is to determine the mineral and heavy metal determination of O. tenuiflorum. O. tenuiflorum exhibited anticancer activity against MCF-7 (a hormone-dependent breast cancer cell line. The viability of MCF-7 cells decreased significantly after treatment with various concentrations of methanolic plant extracts (25 and 100 μg/mL, as shown via 3-(4,5-dimethylthiazol-2-yl2,5-diphenyltetrazolium bromide (MTT assay. The crude extracts show the lower IC50 (less than 100 μg/mL value against the cancer cell lines and show no effect on HS-27. The high content of calcium in the leaves of O. tenuiflorum may play a role in decreasing the risk of certain cancer. The concentrations of heavy metals (Pb and As detected in O. tenuiflorum are safe for consumption.

  15. Savoring Sweet: Sugars in Infant and Toddler Feeding.

    Science.gov (United States)

    Murray, Robert D

    2017-01-01

    During the first years of life, the sweetness of sugars has a capacity to hinder or to help in laying a strong nutritional foundation for food preferences that often extend over a lifetime. Aside from supplying 4 g/kcal of energy, sugars are non-nutritive. However, sugars have a powerful attribute, sweetness, which strongly influences human food preference. A child's first relationship with sweet taste begins even before birth and continues to evolve throughout complementary feeding. The sweetness of breastmilk encourages consumption and soothes the neonate. Conversely, inappropriate introduction of non-milk solids and beverages that are sweet at 0-4 months of age raises the newborn's risk for later obesity and may discourage the acceptance of other bitter or sour foods. Although cereals, fruits, 100% fruit juices, and some grains have naturally occurring sugars that impart sweet flavor notes, there is no clear role for added sugars between 6 and 12 months of age. Yet, 60% of infants are introduced to foods and beverages containing added sugars, threatening diet quality. Pairing foods with naturally occurring sugars, such as fruits, with foods that tend to be resisted initially, such as vegetables, can mask bitterness and promote acceptance. Utilizing the infants' extraordinary capacity for sensory-motor exploration is another strategy to expose them repeatedly to challenging tastes and flavors. The transitional year, as breast milk and infant formula are withdrawn, is a time when nutritional needs are high and diet quality often precarious. Rapid growth, along with brain and cognitive development, demand high-quality nutrition. Snacks are necessary both for energy and valuable nutrients. However, the selection of snack foods often exposes toddlers to items that offer concentrated energy with low nutrient value. Recent trends suggest a rapid fall in added sugars among infants and toddlers. Parenting practices that use small amounts of sugars to promote nutrient

  16. Functional and pasting properties of cassava and sweet potato ...

    African Journals Online (AJOL)

    The functional and pasting properties of cassava starch and sweet potato starch mixtures at different ratios were investigated. Starches from four different cassava genotypes ('Adehye', AFS048, 'Bankye Botan' and OFF146) and one local sweet potato were used for the study. The swelling volume and swelling power of ...

  17. Sweet Eating Habit: Does This Affect the Results After Sleeve Gastrectomy?

    Science.gov (United States)

    Moser, Federico; Marconetto, Mariana; Gorodner, Verónica; Viscido, Germán; Piazzoni, Noel; Maldonado, Pablo; Rodriguez, Eugenia Loretani; Obeide, Lucio

    2016-04-01

    It is commonly believed that eating habits, specially the sweet eating habit, can predict results after bariatric surgery; for this reason, it is considered one of the selection criteria when deciding the surgical technique. However, there is not enough evidence of its impact on the results after sleeve gastrectomy (SG). To evaluate the relationship between the sweet eating habit and weight loss after SG. Cross-sectional retrospective study. Group A: nonobese subjects, and group B: patients who underwent SG and had ≥6 months follow-up. Demographics, anthropometrics, percentage excess weight loss (%EWL) at 6, 12, and 24 months, and eating habits before surgery were analyzed. Sweet eating consumption was classified as follows: mild, moderate, and severe. Uni- and bivariate logistic regression analysis according to each variable was performed. Between 2006 and 2011, 157 patients underwent SG at our institution; 36% were male, age 41 years old, and initial body mass index 46 kg/m(2). Mean %EWL at 6, 12, and 24 months was 66%, 77%, and 70%, respectively. Sweet eating consumption: Mild: 59%; Moderate: 38%; and Severe: 3%. No difference was found in sweet eating patterns among groups A and B; %EWL for mild, moderate, and severe sweet eaters at 6 months was 66 ± 16, 66 ± 14, and 65 ± 10, respectively (P = non-significant [NS]). The same analysis was made at 12 months: 76 ± 20, 79 ± 18, and 78 ± 11 (P = NS). At 24 months, only mild and moderate sweet eaters were available for comparison: 69 ± 23 and 73 ± 19, respectively (P = NS). Preliminary data suggested that preoperative sweet eating habit would not predict results after SG in terms of weight loss.

  18. Acral manifestations of Sweet syndrome (neutrophilic dermatosis of the hands).

    Science.gov (United States)

    Wolf, Ronni; Tüzün, Yalçın

    Neutrophilic dermatosis of the hand (NDH) is a rare localized variant of the syndrome, originally described two decades ago by Strutton et al. The lesions of NDH and Sweet syndrome are similar, as indicated in the first report of NDH. Both diagnoses are characterized by an acute onset of fever, leukocytosis, and tender, erythematous infiltrated plaques. There are also bullae and ulceration in NDH, in contrast to Sweet syndrome, in which bullae are quite uncommon, especially at the early stages. Similar to Sweet syndrome, the majority of NDH patients are women (69%). Patients with NDH present with fever, peripheral neutrophilia, leukocytosis, and/or an elevated erythrocyte sedimentation rate or C-reactive protein level, but at a significantly lower rate than those in Sweet syndrome (33%). Similar to Sweet syndrome, NDH has been associated with the following conditions: Malignancies (particularly hematological [21%], most common of which is acute myelogenous leukemia, but many other malignancies as well), inflammatory bowel disease (19%), medication and vaccination-related eruptions, bacterial and viral infections, rheumatologic diseases, and others. The clues to the diagnosis of NDH are the same as for Sweet syndrome. Awareness of this diagnosis is important not only to avoid unnecessary medical and surgical therapy and to expediently initiate the administration of steroids for this highly responsive dermatosis, but also to conduct an appropriate workup to exclude associated diseases, especially malignancies. Copyright © 2017 Elsevier Inc. All rights reserved.

  19. Effects of incorporating nonmodified sweet potato (Ipomoea batatas) flour on wheat pasta functional characteristics.

    Science.gov (United States)

    Saleh, Mohammed; Lee, Youngseung; Obeidat, Hayat

    2017-12-28

    The effects of substituting wheat flour using fractions of blanched or nonblanched sweet potato flour on produced pasta functional characteristics were investigated. The use of sweet potato flour to replace fractions of wheat flour, regardless of blanching treatment, resulted in significant (p pasta water uptake and solid leaching out and freeze-thaw stability of produced pasta. For instance, treatment containing 40% of nonblanched sweet potato flour and held at 55C resulted in 27% point increase in WHC compared to the control. Sweet potato flour was also contributed to the decrease in treatments pasting viscosities and in cooked pasta hardness. Cooked pasta hardness was significantly (p pasta made using fractions of sweet potato were equivalent to or sometimes superior to that of the control sample. Results indicated the possible enhancement of pasta nutritional quality including firmness, cooking loss, and water uptake without impairing consumer acceptability. The use of sweet potato flour in pasta would enhance the nutritional and physicochemical properties of developed pasta and pasta products. Furthermore, since sweet potato is not cultivated most of the year; sweet potato flour pasta would be better utilized in food processing and is expected to enhance sweet potato consumption year around. © 2017 Wiley Periodicals, Inc.

  20. Sweet Spot Supersymmetry and Composite Messengers

    International Nuclear Information System (INIS)

    Ibe, Masahiro; Kitano, Ryuichiro

    2007-01-01

    Sweet spot supersymmetry is a phenomenologically and cosmologically perfect framework to realize a supersymmetric world at short distance. We discuss a class of dynamical models of supersymmetry breaking and its mediation whose low-energy effective description falls into this framework. Hadron fields in the dynamical models play a role of the messengers of the supersymmetry breaking. As is always true in the models of the sweet spot supersymmetry, the messenger scale is predicted to be 10 5 GeV ∼ mess ∼ 10 GeV. Various values of the effective number of messenger fields N mess are possible depending on the choice of the gauge group

  1. Viscoelastic properties of sweet potato complementary porridges as influenced by endogenous amylases.

    Science.gov (United States)

    Nabubuya, Agnes; Namutebi, Agnes; Byaruhanga, Yusuf; Schuller, Reidar B; Narvhus, Judith; Wicklund, Trude

    2017-11-01

    Sweet potato ( Ipomoea batatas L.) roots contain amylolytic enzymes, which hydrolyze starch thus having the potential to affect the viscosity of sweet potato porridges provided the appropriate working conditions for the enzymes are attained. In this study, the effect of sweet potato variety, postharvest handling conditions, freshly harvested and room/ambient stored roots (3 weeks), and slurry solids content on the viscoelastic properties of complementary porridges prepared using amylase enzyme activation technique were investigated. Five temperatures (55°C, 65°C, 70°C, 75°C, and 80°C) were used to activate sweet potato amylases and the optimum temperature was found to be 75°C. Stored sweet potato roots had higher soluble solids (⁰Brix) content in the pastes compared to fresh roots. In all samples, activation of amylases at 75°C caused changes in the viscoelastic parameters: phase angle (tan δ) and complex viscosity (η * ). Postharvest handling conditions and slurry solids content significantly affected the viscoelastic properties of the porridges with flours from stored roots yielding viscous (liquid-like) porridges and fresh roots producing elastic (solid-like) porridges. Increase in slurry solids content caused reduction in the phase angle values and increase in the viscosity of the sweet potato porridges. The viscosity of the porridges decreased with storage of sweet potato roots. These results provide a possibility for exploiting sweet potato endogenous amylases in the preparation of complementary porridges with both drinkable viscosities and appropriate energy and nutrient densities for children with varying energy needs.

  2. Bio-deterioration of sweet potato (ipomoea batatas lam) in storage ...

    African Journals Online (AJOL)

    Michael Horsfall

    ABSTRACT: The biodeterioration of sweet potato (Ipomoea batatas) was investigated at Port. Harcourt, south southern Nigeria. Aspergillus niger, Fusarium oxysporum, Rhizopus stolonifer,. Botryodiplodia theobroma and Penicillium sp. were found to be associated with deteriorating sweet potato tubers and used for ...

  3. Sweet eating: a definition and the development of the Dutch Sweet Eating Questionnaire

    NARCIS (Netherlands)

    van den Heuvel, Margot; Hörchner, Rogier; Wijtsma, Anneke; Bourhim, Noufissa; Willemsen, Dascha; Mathus-Vliegen, Elisabeth M. H.

    2011-01-01

    Previous studies have suggested that patients who are defined as so-called sweet eaters have more difficulties to lose weight and to maintain weight loss after both conservative treatment and restrictive bariatric surgery, such as gastric banding. There is, however, no agreement on the definition of

  4. Tapping the US sweet sorghum collection to identify biofuel germplasm

    Science.gov (United States)

    The narrow genetic base in sweet sorghum [Sorghum bicolor (L.) Moench] breeding programs is limiting the development of new varieties for biofuel production. Therefore, the identification of genetically diverse sweet sorghum germplasm in the U.S. National Plant Germplasm System (NPGS) collection is...

  5. Is there a Sweet Spot in Ethical Trade?

    DEFF Research Database (Denmark)

    Lund-Thomsen, Peter; Lindgreen, Adam

    2018-01-01

    We undertake a critical appraisal of the existence of the so- called 'sweet spot' in ethical trade at which the interests of buyers, suppliers, and workers intersect to enable benefits for commercial buyers and suppliers and improvements in the conditions of workers at the base of global production...... networks. In turn, we take the perspectives of three central actors typically involved in ethical trade: buyers/brands, suppliers in the Global South, and workers at the base of these networks. By applying all three perspectives, we theorize about the circumstances in which the sweet spot in ethical trade...... might emerge, reflecting an amended version of Gereffi et al.'s (2005) theory of value chain governance. We conclude that the possibility of identifying a sweet spot in ethical trade improves as we move from market-based transactions toward hierarchical governance in global production networks....

  6. Sweet taste in apple: the role of sorbitol, individual sugars, organic acids and volatile compounds

    Science.gov (United States)

    Aprea, Eugenio; Charles, Mathilde; Endrizzi, Isabella; Laura Corollaro, Maria; Betta, Emanuela; Biasioli, Franco; Gasperi, Flavia

    2017-03-01

    Sweetness is one of the main drivers of consumer preference, and thus is given high priority in apple breeding programmes. Due to the complexity of sweetness evaluation, soluble solid content (SSC) is commonly used as an estimation of this trait. Nevertheless, it has been demonstrated that SSC and sweet taste are poorly correlated. Though individual sugar content may vary greatly between and within apple cultivars, no previous study has tried to investigate the relationship between the amount of individual sugars, or ratios of these, and apple sweetness. In this work, we quantified the major sugars (sucrose, glucose, fructose, xylose) and sorbitol and explored their influence on perceived sweetness in apple; we also related this to malic acid content, SSC and volatile compounds. Our data confirmed that the correlation between sweetness and SSC is weak. We found that sorbitol content correlates (similarly to SSC) with perceived sweetness better than any other single sugar or total sugar content. The single sugars show no differentiable importance in determining apple sweetness. Our predictive model based on partial least squares regression shows that after sorbitol and SSC, the most important contribution to apple sweetness is provided by several volatile compounds, mainly esters and farnesene.

  7. Profitability of sweet potato production in derived savannah zone of ...

    African Journals Online (AJOL)

    This study examined profitability of sweet potato production in Odeda Local Government Area, Ogun State, Nigeria. The study was based on primary data collected from 82 sweet potato farmers through multistage sampling technique; analysed using descriptive statistics and budgetary techniques. The result revealed that ...

  8. Sweet's syndrome – a comprehensive review of an acute febrile neutrophilic dermatosis

    Directory of Open Access Journals (Sweden)

    Cohen Philip R

    2007-07-01

    Full Text Available Abstract Sweet's syndrome (the eponym for acute febrile neutrophilic dermatosis is characterized by a constellation of clinical symptoms, physical features, and pathologic findings which include fever, neutrophilia, tender erythematous skin lesions (papules, nodules, and plaques, and a diffuse infiltrate consisting predominantly of mature neutrophils that are typically located in the upper dermis. Several hundreds cases of Sweet's syndrome have been published. Sweet's syndrome presents in three clinical settings: classical (or idiopathic, malignancy-associated, and drug-induced. Classical Sweet's syndrome (CSS usually presents in women between the age of 30 to 50 years, it is often preceded by an upper respiratory tract infection and may be associated with inflammatory bowel disease and pregnancy. Approximately one-third of patients with CSS experience recurrence of the dermatosis. The malignancy-associated Sweet's syndrome (MASS can occur as a paraneoplastic syndrome in patients with an established cancer or individuals whose Sweet's syndrome-related hematologic dyscrasia or solid tumor was previously undiscovered; MASS is most commonly related to acute myelogenous leukemia. The dermatosis can precede, follow, or appear concurrent with the diagnosis of the patient's cancer. Hence, MASS can be the cutaneous harbinger of either an undiagnosed visceral malignancy in a previously cancer-free individual or an unsuspected cancer recurrence in an oncology patient. Drug-induced Sweet's syndrome (DISS most commonly occurs in patients who have been treated with granulocyte-colony stimulating factor, however, other medications may also be associated with DISS. The pathogenesis of Sweet's syndrome may be multifactorial and still remains to be definitively established. Clinical and laboratory evidence suggests that cytokines have an etiologic role. Systemic corticosteroids are the therapeutic gold standard for Sweet's syndrome. After initiation of treatment

  9. Fermentation of sweet sorghum syrup to butanol in the presence of natural nutrients and inhibitors

    Science.gov (United States)

    Sweet sorghum syrups represent a renewable raw material that can be available year-round for production of biofuels and biochemicals. Sweet sorghum sugars have been used as sources for butanol production in the past but most often the studies focused on sweet sorghum juice and not on sweet sorghum s...

  10. Main viruses in sweet cherry plantations of Central-Western Spain

    Directory of Open Access Journals (Sweden)

    Rodrigo Pérez Sánchez

    2015-02-01

    Full Text Available Sweet cherry trees (Prunus avium L. are susceptible to a range of diseases, but there have been no studies to date about the viral infection of sweet cherry trees in Spain. To determine the phytosanitary status of Spanish sweet cherry plantations, the incidence and leaf symptoms induced by Prune dwarf (PDV, Prunus necrotic ringspot (PNRSV and Apple chlorotic leaf spot (ACLSV viruses were investigated during 2009. Young leaf samples were taken from 350 sweet cherry trees, corresponding to 17 cultivars, and were analysed by double antibody sandwich enzyme-linked immunosorbent assay (DAS-ELISA. To associate the leaf symptoms with the virus, 50 mature leaves from each infected tree were visually inspected during the summer. The ELISA results revealed that 72 % of sweet cherry trees were infected by at least one of the viruses. PDV occurred in all sampled cultivars and presented the highest infection rate, followed by ACLSV and PNRSV. A high number of trees showed asymptomatic, in both single and mixed infections. The leaf symptoms associated with the viruses involved generalized chlorosis around the midvein (PDV, chlorotic and dark brown necrotic ringspots on both secondary veins and intervein regions (PNRSV, chlorotic and reddish necrotic ringspots (ACLSV and generalized interveinal chlorosis (PDV-PNRSV.

  11. Glucagon-like peptide-1 is specifically involved in sweet taste transmission.

    Science.gov (United States)

    Takai, Shingo; Yasumatsu, Keiko; Inoue, Mayuko; Iwata, Shusuke; Yoshida, Ryusuke; Shigemura, Noriatsu; Yanagawa, Yuchio; Drucker, Daniel J; Margolskee, Robert F; Ninomiya, Yuzo

    2015-06-01

    Five fundamental taste qualities (sweet, bitter, salty, sour, umami) are sensed by dedicated taste cells (TCs) that relay quality information to gustatory nerve fibers. In peripheral taste signaling pathways, ATP has been identified as a functional neurotransmitter, but it remains to be determined how specificity of different taste qualities is maintained across synapses. Recent studies demonstrated that some gut peptides are released from taste buds by prolonged application of particular taste stimuli, suggesting their potential involvement in taste information coding. In this study, we focused on the function of glucagon-like peptide-1 (GLP-1) in initial responses to taste stimulation. GLP-1 receptor (GLP-1R) null mice had reduced neural and behavioral responses specifically to sweet compounds compared to wild-type (WT) mice. Some sweet responsive TCs expressed GLP-1 and its receptors were expressed in gustatory neurons. GLP-1 was released immediately from taste bud cells in response to sweet compounds but not to other taste stimuli. Intravenous administration of GLP-1 elicited transient responses in a subset of sweet-sensitive gustatory nerve fibers but did not affect other types of fibers, and this response was suppressed by pre-administration of the GLP-1R antagonist Exendin-4(3-39). Thus GLP-1 may be involved in normal sweet taste signal transmission in mice. © FASEB.

  12. Identification of widely varying levels of resistance to meloidogyne incognita in sweet sorghum

    Science.gov (United States)

    Sweet sorghum (Sorghum bicolor) is a potential bioenergy crop that could be incorporated into annual cropping systems in the southern US, where it would likely be rotated with cotton. The desirability of including sweet sorghum in a cotton cropping system will be influenced by sweet sorghum’s host ...

  13. Reconciling Conflicting Phylogenies in the Origin of Sweet Potato and Dispersal to Polynesia.

    Science.gov (United States)

    Muñoz-Rodríguez, Pablo; Carruthers, Tom; Wood, John R I; Williams, Bethany R M; Weitemier, Kevin; Kronmiller, Brent; Ellis, David; Anglin, Noelle L; Longway, Lucas; Harris, Stephen A; Rausher, Mark D; Kelly, Steven; Liston, Aaron; Scotland, Robert W

    2018-04-23

    The sweet potato is one of the world's most widely consumed crops, yet its evolutionary history is poorly understood. In this paper, we present a comprehensive phylogenetic study of all species closely related to the sweet potato and address several questions pertaining to the sweet potato that remained unanswered. Our research combined genome skimming and target DNA capture to sequence whole chloroplasts and 605 single-copy nuclear regions from 199 specimens representing the sweet potato and all of its crop wild relatives (CWRs). We present strongly supported nuclear and chloroplast phylogenies demonstrating that the sweet potato had an autopolyploid origin and that Ipomoea trifida is its closest relative, confirming that no other extant species were involved in its origin. Phylogenetic analysis of nuclear and chloroplast genomes shows conflicting topologies regarding the monophyly of the sweet potato. The process of chloroplast capture explains these conflicting patterns, showing that I. trifida had a dual role in the origin of the sweet potato, first as its progenitor and second as the species with which the sweet potato introgressed so one of its lineages could capture an I. trifida chloroplast. In addition, we provide evidence that the sweet potato was present in Polynesia in pre-human times. This, together with several other examples of long-distance dispersal in Ipomoea, negates the need to invoke ancient human-mediated transport as an explanation for its presence in Polynesia. These results have important implications for understanding the origin and evolution of a major global food crop and question the existence of pre-Columbian contacts between Polynesia and the American continent. Copyright © 2018 Elsevier Ltd. All rights reserved.

  14. Biogas utilization for drying sweet potato chips by using infrared dryer

    Science.gov (United States)

    Sriharti, Rahayuningtyas, Ari; Susanti, Novita Dwi; Sitompul, Rislima Febriani

    2017-11-01

    This study aims to utilize biogas, that produced from organic waste, as fuel for infrared dryers. The digester was dome type, which made from fiberglass, 5.5 m3 capacities, gas container made from soft PVC, 5.6 m3 capacities. The infrared dryer was household scale which have dimension 2000 mm x 2000 mm x 2000 mm, it is consist of 2 racks, which have size 1500 mm x 500 mm x 1400 mm, and consist of 44 baking pans (600 mm X 400 mm x 30 mm), the dryer has 36 kg of capacity. The parameters observed include ambient temperature, temperature inside the digester, pH value, biogas production, drying room temperature, moisture content of sweet potato and biogas consumption for drying. Infrared dryer is used to dry the sweet potato slices thickness of 2 mm with total amount 12 kg, at room temperature dryer ± 60 °C. The results showed that the average biogas production was 1.335 m3 per day, at a temperature of 26 - 35 °C and the neutral pH value was 6.99 - 7.7. 12 kg of sweet potato sliced dried for 4 hours, the initial moisture content of 79.68 % decreased to 8.98 %, the consumption of biogas used 4,952 m3. The final result of drying process of sweet potato slices of 3.5 kg, there was a shrinkage of 70.83 %. Characterization of sweet potato slices is 3 % protein, 0,6 % fat, 94 % carbohydrate and 2 % ash. These sweet potato can be used as flour for cookies and cake raw materials, the use of sweet potato flour can reach 50 - 100 %.

  15. Sweet Solutions to Reduce Procedural Pain in Neonates: A Meta-analysis.

    Science.gov (United States)

    Harrison, Denise; Larocque, Catherine; Bueno, Mariana; Stokes, Yehudis; Turner, Lucy; Hutton, Brian; Stevens, Bonnie

    2017-01-01

    Abundant evidence of sweet taste analgesia in neonates exists, yet placebo-controlled trials continue to be conducted. To review all trials evaluating sweet solutions for analgesia in neonates and to conduct cumulative meta-analyses (CMAs) on behavioral pain outcomes. (1) Data from 2 systematic reviews of sweet solutions for newborns; (2) searches ending 2015 of CINAHL, Medline, Embase, and psychINFO. Two authors screened studies for inclusion, conducted risk-of-bias ratings, and extracted behavioral outcome data for CMAs. CMA was performed using random effects meta-analysis. One hundred and sixty-eight studies were included; 148 (88%) included placebo/no-treatment arms. CMA for crying time included 29 trials (1175 infants). From the fifth trial in 2002, there was a statistically significant reduction in mean cry time for sweet solutions compared with placebo (-27 seconds, 95% confidence interval [CI] -51 to -4). By the final trial, CMA was -23 seconds in favor of sweet solutions (95% CI -29 to -18). CMA for pain scores included 50 trials (3341 infants). Results were in favor of sweet solutions from the second trial (0.5, 95% CI -1 to -0.1). Final results showed a standardized mean difference of -0.9 (95% CI -1.1 to -0.7). We were unable to use or obtain data from many studies to include in the CMA. Evidence of sweet taste analgesia in neonates has existed since the first published trials, yet placebo/no-treatment, controlled trials have continued to be conducted. Future neonatal pain studies need to select more ethically responsible control groups. Copyright © 2017 by the American Academy of Pediatrics.

  16. Sustratos orgánicos como alternativa para la producción de albahaca (Ocimum Selloi Benth)

    OpenAIRE

    Campos Mota, Lilián; Flores Sánchez, Diego

    2013-01-01

    La especie de albahaca Ocimum Selloi Benth ha sido empleada en México por sus propiedades medicinales y como condimento. Por otra parte, el uso de vermicomposta es una alternativa en la producción orgánica de las plantas medicinales; por lo tanto, esta investigación tuvo como objetivo evaluar el efecto de la vermicomposta en el crecimiento de albahaca. Como tratamientos se emplearon 4 sustratos: 1) vermicomposta de café (con base a pulpa proveniente del beneficio húmedo) más cascarilla de caf...

  17. 7 CFR 457.154 - Processing sweet corn crop insurance provisions.

    Science.gov (United States)

    2010-01-01

    ... policies: Processing Sweet Corn Crop Provisions If a conflict exists among the policy provisions, the order.... Processor. Any business enterprise regularly engaged in canning or freezing processing sweet corn for human... disease control measures or as otherwise limited by the Special Provisions; (5) Wildlife; (6) Earthquake...

  18. Aroma profile of Garnacha Tintorera-based sweet wines by chromatographic and sensorial analyses.

    Science.gov (United States)

    Noguerol-Pato, R; González-Álvarez, M; González-Barreiro, C; Cancho-Grande, B; Simal-Gándara, J

    2012-10-15

    The aroma profiles obtained of three Garnacha Tintorera-based wines were studied: a base wine, a naturally sweet wine, and a mixture of naturally sweet wine with other sweet wine obtained by fortification with spirits. The aroma fingerprint was traced by GC-MS analysis of volatile compounds and by sensorial analysis of odours and tastes. Within the volatiles compounds, sotolon (73 μg/L) and acetoin (122 μg/L) were the two main compounds found in naturally sweet wine. With regards to the odorant series, those most dominant for Garnacha Tintorera base wine were floral, fruity and spicy. Instead, the most marked odorant series affected by off-vine drying of the grapes were floral, caramelized and vegetal-wood. Finally, odorant series affected by the switch-off of alcoholic fermentation with ethanol 96% (v/v) fit for human consumption followed by oak barrel aging were caramelized and vegetal-wood. A partial least square test (PLS-2) was used to detect correlations between sets of sensory data (those obtained with mouth and nose) with the ultimate aim of improving our current understanding of the flavour of Garnacha Tintorera red wines, both base and sweet. Based on the sensory dataset analysis, the descriptors with the highest weight for separating base and sweet wines from Garnacha Tintorera were sweetness, dried fruit and caramel (for sweet wines) vs. bitterness, astringency and geranium (for base wines). Copyright © 2012 Elsevier Ltd. All rights reserved.

  19. Sweet Taste Receptor Signaling Network: Possible Implication for Cognitive Functioning

    Directory of Open Access Journals (Sweden)

    Menizibeya O. Welcome

    2015-01-01

    Full Text Available Sweet taste receptors are transmembrane protein network specialized in the transmission of information from special “sweet” molecules into the intracellular domain. These receptors can sense the taste of a range of molecules and transmit the information downstream to several acceptors, modulate cell specific functions and metabolism, and mediate cell-to-cell coupling through paracrine mechanism. Recent reports indicate that sweet taste receptors are widely distributed in the body and serves specific function relative to their localization. Due to their pleiotropic signaling properties and multisubstrate ligand affinity, sweet taste receptors are able to cooperatively bind multiple substances and mediate signaling by other receptors. Based on increasing evidence about the role of these receptors in the initiation and control of absorption and metabolism, and the pivotal role of metabolic (glucose regulation in the central nervous system functioning, we propose a possible implication of sweet taste receptor signaling in modulating cognitive functioning.

  20. Sweet taste preferences before and after an intensive medical weight loss intervention.

    Science.gov (United States)

    Asao, K; Rothberg, A E; Arcori, L; Kaur, M; Fowler, C E; Herman, W H

    2016-06-01

    Medical weight loss could change sweet taste threshold and preferences. The decrease in sweet taste preferences may, in turn, help in the maintenance of weight loss. This study examined the association between sweet taste preferences at baseline and weight change during a medical weight management programme and the impact of diet-induced weight loss on sweet taste preferences. Adult patients with body mass index ≥32 kg m -2 were recruited from a medical weight management clinic. Sweet taste preference was assessed using a forced-choice, paired-comparison tracking method before and after a very-low-calorie diet (VLCD). Twenty participants were included in the analysis: mean age was 53.1 (standard deviation [SD]: 11.4) years, and 14 were female. The mean body mass index was 41.4 (SD: 7.5) kg m -2 . The median preferred sucrose concentration before VLCD was 0.45 M. Following VLCD, mean change in weight was -13.3 (SD: 6.6) kg, and percentage weight change was -11.3% (SD: 5.9%). Based on mixed models with and without adjustment for demographic factors, diabetes status and smoking history, preferred sucrose concentration at baseline did not predict change in longer-term body weight. The change of preferred sucrose concentration following 12 weeks of VLCD was not significant ( P -value 0.95). Change in weight during and after VLCD was not associated with sweet taste preferences at baseline. After diet-induced weight loss, sweet taste preferences did not change.

  1. Technical Feasibility and Comprehensive Sustainability Assessment of Sweet Sorghum for Bioethanol Production in China

    Directory of Open Access Journals (Sweden)

    Xiaolin Yang

    2018-03-01

    Full Text Available Under dual pressures of energy and environmental security, sweet sorghum is becoming one of the most promising feedstocks for biofuel production. In the present study, the technical feasibility of sweet sorghum production was assessed in eight agricultural regions in China using the Sweet Sorghum Production Technique Maturity Model. Three top typical agricultural zones were then selected for further sustainability assessment of sweet sorghum production: Northeast China (NEC, Huang-Huai-Hai Basin (HHHB and Ganxin Region (GX. Assessment results demonstrated that NEC exhibited the best sustainable production of sweet sorghum, with a degree of technical maturity value of 0.8066, followed by HHHB and GX, with corresponding values of 0.7531 and 0.6594, respectively. Prospective economic profitability analysis indicated that bioethanol production from sweet sorghum was not feasible using current technologies in China. More efforts are needed to dramatically improve feedstock mechanization logistics while developing new bioethanol productive technology to reduce the total cost. This study provides insight and information to guide further technological development toward profitable industrialization and large-scale sweet sorghum bioethanol production.

  2. INDUCING RESISTANCE IN COTTON AGAINST COLLETOTRICHUM GOSSYPII VAR. CEPHALOSPORIOIDES WITH ESSENTIAL OILS

    Directory of Open Access Journals (Sweden)

    B. T. Santos

    2016-11-01

    Full Text Available This study aimed to evaluate the potential of essential oils of rosemary (Rosmarinus officinalis, baccharis (Baccharis trimera, lemon grass (Cymbopogon citratus, basil (Ocimum basilicum and eucalyptus (Corymbia citriodora in inducing resistance in cotton plants against C. gossypii var. cephalosporioides. The inductive effect of the essential oils was evaluated in plants growing in pots in the environment, which were treated with 1% essential oil at 47 days of age. 24 hours after elicitor treatment the plants were inoculated with a suspension of 1.5 x 105 conidia mL-1 of C. gossypii var. cephalosporioides. Five evaluations were performed disease and calculated the area under the disease progress curve. All essential oils showed potential for inducing resistance against cotton C. gossypii var. cephalosporioides.

  3. The Role of the Sweet Taste Receptor in Enteroendocrine Cells and Pancreatic β-Cells

    Directory of Open Access Journals (Sweden)

    Itaru Kojima

    2011-10-01

    Full Text Available The sweet taste receptor is expressed in taste cells located in taste buds of the tongue. This receptor senses sweet substances in the oral cavity, activates taste cells, and transmits the taste signals to adjacent neurons. The sweet taste receptor is a heterodimer of two G protein-coupled receptors, T1R2 and T1R3. Recent studies have shown that this receptor is also expressed in the extragustatory system, including the gastrointestinal tract, pancreatic β-cells, and glucose-responsive neurons in the brain. In the intestine, the sweet taste receptor regulates secretion of incretin hormones and glucose uptake from the lumen. In β-cells, activation of the sweet taste receptor leads to stimulation of insulin secretion. Collectively, the sweet taste receptor plays an important role in recognition and metabolism of energy sources in the body.

  4. Sodium fluxes in sweet pepper exposed to varying sodium concentrations

    NARCIS (Netherlands)

    Blom-Zandstra, M.; Vogelzang, S.A.; Veen, B.W.

    1998-01-01

    The sodium transport and distribution of sweet pepper (Capsicum annuum L.) under saline conditions were studied after transferring the plants to a sodium-free nutrient solution. Sodium stress up to 60 mM did not affect the growth of sweet pepper, as it appears able to counteract the unfavourable

  5. New Insight Into the Diversity of SemiSWEET Sugar Transporters and the Homologs in Prokaryotes

    Directory of Open Access Journals (Sweden)

    Baolei Jia

    2018-05-01

    Full Text Available Sugars will eventually be exported transporters (SWEETs and SemiSWEETs represent a family of sugar transporters in eukaryotes and prokaryotes, respectively. SWEETs contain seven transmembrane helices (TMHs, while SemiSWEETs contain three. The functions of SemiSWEETs are less studied. In this perspective article, we analyzed the diversity and conservation of SemiSWEETs and further proposed the possible functions. 1,922 SemiSWEET homologs were retrieved from the UniProt database, which is not proportional to the sequenced prokaryotic genomes. However, these proteins are very diverse in sequences and can be classified into 19 clusters when >50% sequence identity is required. Moreover, a gene context analysis indicated that several SemiSWEETs are located in the operons that are related to diverse carbohydrate metabolism. Several proteins with seven TMHs can be found in bacteria, and sequence alignment suggested that these proteins in bacteria may be formed by the duplication and fusion. Multiple sequence alignments showed that the amino acids for sugar translocation are still conserved and coevolved, although the sequences show diversity. Among them, the functions of a few amino acids are still not clear. These findings highlight the challenges that exist in SemiSWEETs and provide future researchers the foundation to explore these uncharted areas.

  6. Citrus sinensis annotation project (CAP): a comprehensive database for sweet orange genome.

    Science.gov (United States)

    Wang, Jia; Chen, Dijun; Lei, Yang; Chang, Ji-Wei; Hao, Bao-Hai; Xing, Feng; Li, Sen; Xu, Qiang; Deng, Xiu-Xin; Chen, Ling-Ling

    2014-01-01

    Citrus is one of the most important and widely grown fruit crop with global production ranking firstly among all the fruit crops in the world. Sweet orange accounts for more than half of the Citrus production both in fresh fruit and processed juice. We have sequenced the draft genome of a double-haploid sweet orange (C. sinensis cv. Valencia), and constructed the Citrus sinensis annotation project (CAP) to store and visualize the sequenced genomic and transcriptome data. CAP provides GBrowse-based organization of sweet orange genomic data, which integrates ab initio gene prediction, EST, RNA-seq and RNA-paired end tag (RNA-PET) evidence-based gene annotation. Furthermore, we provide a user-friendly web interface to show the predicted protein-protein interactions (PPIs) and metabolic pathways in sweet orange. CAP provides comprehensive information beneficial to the researchers of sweet orange and other woody plants, which is freely available at http://citrus.hzau.edu.cn/.

  7. Mixing Tamiflu with Sweet Liquids

    Centers for Disease Control (CDC) Podcasts

    If your doctor prescribes Tamiflu® capsules for your child and your child cannot swallow them, this podcast describes how to mix the contents of the capsules with a sweet thick liquid so they can be given that way.

  8. Sweet taste preference in binge-eating disorder: A preliminary investigation.

    Science.gov (United States)

    Goodman, Erica L; Breithaupt, Lauren; Watson, Hunna J; Peat, Christine M; Baker, Jessica H; Bulik, Cynthia M; Brownley, Kimberly A

    2018-01-01

    Research suggests that individuals with high liking for sweets are at increased risk for binge eating, which has been minimally investigated in individuals with binge-eating disorder (BED). Forty-one adults (85% female, 83% white) with binge eating concerns completed a sweet taste test and measures of eating disorder behaviors and food cravings. A subset of participants with BED completed an oral glucose tolerance test (OGTT; N=21) and a 24-hour dietary recall (N=26). Regression models were used to compare highest sweet preferers (HSP [N=18]) to other sweet preferers (OSP [N=23]) and were used to assess associations between sweet taste preference and outcome variables. Effect sizes (ηp 2 ) for differences between HSP and OSP ranged from small (≤0.01) to large (≥0.24); group differences were statistically nonsignificant except for 24-hour caloric intake (ηp 2 =0.16, p=0.04), protein intake (ηp 2 =0.16, p=0.04), and insulin sensitivity index (ηp 2 =0.24, p=0.04), which were higher in HSP, and postprandial insulin, which was smaller in HSP (ηp 2 =0.27, p=0.03). Continuous analyses replicated postprandial insulin response. Compared with OSP, HSP reported numerically higher binge-eating frequency (ηp 2 =0.04), over-eating frequency (ηp 2 =0.06), and carbohydrate intake (ηp 2 =0.14), and they exhibited numerically smaller postprandial glucose AUC (ηp 2 =0.16). Sweet taste preference may have implications for glucose regulation, binge-eating frequency, and nutrient intake in BED. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Study of single dose toxic test of Sweet Bee Venom in Beagle Dogs

    Directory of Open Access Journals (Sweden)

    Hye-Chul, Yoon

    2010-12-01

    Full Text Available Objectives : This study was performed to analyse single dose toxicity of Sweet Bee Venom(Sweet BV extracted from the bee venom in Beagle dogs. Methods : All experiments were conducted under the regulations of Good Laboratory Practice (GLP at Biotoxtech Company, a non-clinical study authorized institution. Male and female Beagle dogs of 5-6 months old were chosen for the pilot study of single dose toxicity of Sweet BV which was administered at the level of 9.0 ㎎/㎏ body weight which is 1300 times higher than the clinical application dosage as the high dosage, followed by 3.0 and 1.0 ㎎/㎏ as midium and low dosage, respectively. Equal amount of excipient(normal saline to the Sweet BV experiment groups was administered as the control group. Results : 1. No mortality was witnessed in all of the experiment groups. 2. Hyperemia and movement disorder were observed around the area of administration in all the experiment groups, and higher occurrence in the higher dosage treatment. 3. For weight measurement, Neither male nor female groups showed significant changes. 4. To verify abnormalities of organs and tissues, thigh muscle which treated with Sweet BV, brain, liver, lung, kidney, and spinal cords were removed and histologocal observation using H-E staining was conducted. In the histologocal observation of thigh muscle, cell infiltration, inflammation, degeneration, necrosis of muscle fiber, and fibrosis were found in both thigh tissue. And the changes depend on the dose of Sweet BV. But the other organs did not showed in any abnormality. 5. The maximum dose of Sweet BV in Beagle dogs were over 9 ㎎/㎏ in this study. Conclusions : The above findings of this study suggest that Sweet BV is a relatively safe treatment medium. Further studies on the toxicity of Sweet BV should be conducted to yield more concrete evidences.

  10. Red Light-Dose or Wavelength-Dependent Photoresponse of Antioxidants in Herb Microgreens.

    Directory of Open Access Journals (Sweden)

    Giedė Samuolienė

    Full Text Available The purpose of this study was to evaluate the role of 638-nm and 665-nm LEDs on changes of antioxidants of basil (Ocimum basilicum and parsley (Petroselinum crispum, and to assess the effect of light quality on antioxidative status. Plants were grown in peat substrate for 19 days (21/17 ±2°C, 16 h. Experiments were performed in (I a controlled-environment: B455,R638,R665,FR731(control; B455,R*638,R665,FR731; B455,R638,R*665,FR731; R638; R665 (B-blue, R- red, FR-far-red light. PPFD was set from 231 during growth, upto 300 μmol m-2 s-1 during 3-day treatment changing R638 or R665 PPFD level; in (II greenhouse (November: high-pressure sodium lamps (HPS (control-300 μmol m-2s-1; and HPS + 638 (HPS generated 90 and red LEDs-210 μmol m-2s-1. In general, under supplemental or increased red 638 nm light, amounts of tested antioxidants were greater in basil, whereas sole 665 nm or sole 638 nm is more favourable for parsley. Increased or supplemental red light significantly increased contents of phenolics, α-tocopherol, ascorbic acid and DPPH• but suppressed accumulation of lutein and β-carotene in basil, whereas an increase of β-carotene and DPPH• was observed in parsley. Hereby, the photoresponse of antioxidant compounds suggests that photoprotective mechanism is stimulated by both light-dose-dependent and wavelength-dependent reactions.

  11. Expermental Studies of quantitative evaluation using HPLC and safety of Sweet Bee Venom

    Directory of Open Access Journals (Sweden)

    Ki Rok Kwon

    2007-06-01

    Full Text Available Objectives : This study was conducted to carry out quantitative evaluation and safety of Sweet Bee Venom. Methods : Content analysis was done using HPLC, measurement of LD50 was conducted intravenous, subcutaneous, and intra-muscular injection to the ICR mice. Results : 1. According to HPLC analysis, removal of the enzymes containing phospholipase A2 was successfully rendered on Sweet Bee Venom. And analyzing melittin content, Sweet Bee Venom contained 12% more melittin than Bee Venom. 2. LD50 of ICR mice with Sweet Bee Venom was more than 20mg/kg in subcutaneous injection and intravenous injection, between 15mg/kg and 20mg/kg in muscular injection. 3. LD50 of ICR mice with Bee Venom was between 6 and 9mg/kg in subcutaneous injection and intravenous injection, and more than 9mg/kg in muscular injection. Conclusion : Above results indicate that Sweet Bee Venom was more safe than Bee Venom and the process of removing enzymes was well rendered in Sweet Bee Venom.

  12. Resource Use Efficiency in Sweet Potato Production in Kwara State ...

    African Journals Online (AJOL)

    This paper examines resource use efficiency in sweet potato production in Offa and Oyun local government areas of Kwara State of Nigeria. Primary data were collected from one hundred sweet potato farmers who were selected from the two local government areas during the 2003/2004 farming season. The data was ...

  13. Quality assessment of flour and bread from sweet potato wheat ...

    African Journals Online (AJOL)

    This study was to assess the quality of the flour and bread produced from sweet potato wheat composite flour blends. Matured and freshly harvested sweet potato (Ipomea batatas L.) was obtained from a local market in Akure, Nigeria. The tubers were thoroughly washed, peeled, washed again, drained, chipped, oven dried, ...

  14. DMPD: Sweet preferences of MGL: carbohydrate specificity and function. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 18249034 Sweet preferences of MGL: carbohydrate specificity and function. van Vliet....csml) Show Sweet preferences of MGL: carbohydrate specificity and function. PubmedID 18249034 Title Sweet p...references of MGL: carbohydrate specificity and function. Authors van Vliet SJ, S

  15. Effects of Sweet Bee Venom on cardiovascular system in the conscious telemetered Beagle Dogs

    Directory of Open Access Journals (Sweden)

    Lim Chung-San

    2010-09-01

    Full Text Available Objectives:This study was performed to analyse the effects of Sweet Bee Venom(Sweet BV on cardiovascular system in the conscious telemetered Beagle Dogs. Methods:All experiments were conducted at Biotoxtech Company, a non-clinical studies authorized institution, under the regulations of Good Laboratory Practice (GLP. Male Beagle dogs of 13-19 months old were chosen for the pilot study and surgical implantation was performed for conscious telemetered Beagle dogs. And after confirming condition of Beagle dogs was stable, Sweet BV was administered 4 times(first: 0.0 ㎎/㎏, 2nd: 0.01 ㎎/㎏, 3rd: 0.1 ㎎/㎏, and forth: 0.5 ㎎/㎏, one time/week in thigh muscle of Beagle dogs. And blood pressure, heart rate, electrocardiography and clinical responses were measured. Equal amount of normal saline to the Sweet BV experiment groups was administered to the control group. 1. In the analysis of body weight and taking amount, Beagle dogs did not show significant changes. 2. In the clinical observation, responses of pain and edema were showed depend on dosage of Sweet BV. 3. In the analysis of blood pressure, treatment with Sweet BV did not show significant changes in the dosage of 0.01 ㎎/㎏, but in the dosage of 0.1 ㎎/㎏ and 0.5 ㎎/㎏, treatment with Sweet BV increased blood pressure significantly. 4. In the analysis of heart rate, treatment of Sweet BV did not show significant changes in all dosage and period. 5. In the analysis of electrocardiography, treatment of Sweet BV was not showed significant changes in all dosage and period. Conclusion:Above findings suggest that Sweet BV is relatively safe treatment in the cardiovascular system. But in the using of over dosage, Sweet BV may the cause of increasing blood pressure. Further studies on the subject should be conducted to yield more concrete evidences.

  16. Sweet Sorghum Alternative Fuel and Feed Pilot Project

    Energy Technology Data Exchange (ETDEWEB)

    Slack, Donald C. [Univ. of Arizona, Tucson, AZ (United States). Agricultural and Biosystems Engineering Dept.; Kaltenbach, C. Colin [Univ. of Arizona, Tucson, AZ (United States)

    2013-07-30

    The University of Arizona undertook a “pilot” project to grow sweet sorghum on a field scale (rather than a plot scale), produce juice from the sweet sorghum, deliver the juice to a bio-refinery and process it to fuel-grade ethanol. We also evaluated the bagasse for suitability as a livestock feed and as a fuel. In addition to these objectives we evaluated methods of juice preservation, ligno-cellulosic conversion of the bagasse to fermentable sugars and alternative methods of juice extraction.

  17. Sweet taste exposure and the subsequent acceptance and preference for sweet taste in the diet

    NARCIS (Netherlands)

    Appleton, Km; Tuorila, H.; Bertenshaw, Ej; Graaf, De C.; Mela, Dj

    2018-01-01

    Background There are consistent, evidence-based global public health recommendations to reduce intakes of free sugars. However, the corresponding evidence for recommending reduced exposure to sweetness is less clear. Objective Our aim was to identify and review the published evidence investigating

  18. The effect of sucralose on flavor sweetness in electronic cigarettes varies between delivery devices.

    Directory of Open Access Journals (Sweden)

    Kathryn Rosbrook

    Full Text Available The appeal of sweet electronic cigarette flavors makes it important to identify the chemical compounds that contribute to their sweetness. While volatile chemicals that produce sweet aromas have been identified in e-liquids, there are no published reports of sugars or artificial sweeteners in commercial e-liquids. However, the sweetener sucralose is marketed as an e-liquid additive to commercial flavors. The primary aims of the study were to determine if sucralose is delivered in sufficient concentration in the inhaled aerosol to enhance flavor sweetness, and whether the amount delivered depends on the e-liquid delivery system. Thirty-two adult smokers rated flavor intensity, sweetness, harshness and liking/disliking for 4 commercial flavors with and without sucralose (1% using 2 e-cigarette delivery systems (cartridge and tank. Participants alternately vaped normally or with the nose pinched closed to block perception of volatile flavor components via olfaction. LC/MS was used to measure the concentration of sucralose in the e-liquid aerosols using a device that mimicked vaping. Sweetness and flavor intensity were perceived much more strongly when olfaction was permitted. The contribution of sucralose to sweetness was significant only for the cartridge system, and the chemical analysis showed that the concentration of sucralose in the aerosol was higher when the cartridge was used. Together these findings indicate that future regulation of sweet flavor additives should focus first on the volatile constituents of e-liquids with the recognition that artificial sweeteners may also contribute to flavor sweetness depending upon e-cigarette design.

  19. Gender and Relative Economic Efficiency in Sweet Potato Farms of ...

    African Journals Online (AJOL)

    This study employed the stochastic frontier cost function to measure the level of economic efficiency and its determinants in small-scale sweet potato production in Imo State, Nigeria on gender basis. A multi-stage random sampling technique was used to select 120 sweet potato farmers (64 females and 56 males) in the ...

  20. Cancer-preventive Properties of an Anthocyanin-enriched Sweet Potato in the APCMIN Mouse Model.

    Science.gov (United States)

    Asadi, Khalid; Ferguson, Lynnette R; Philpott, Martin; Karunasinghe, Nishi

    2017-09-01

    Anthocyanin-rich foods and preparations have been reported to reduce the risk of life-style related diseases, including cancer. The SL222 sweet potato, a purple-fleshed cultivar developed in New Zealand, accumulates high levels of anthocyanins in its storage root. We examined the chemopreventative properties of the SL222 sweet potato in the C57BL/6J-APC MIN/+ (APC MIN ) mouse, a genetic model of colorectal cancer. APC MIN and C57BL/6J wild-type mice (n=160) were divided into four feeding groups consuming diets containing 10% SL222 sweet potato flesh, 10% SL222 sweet potato skin, or 0.12% ARE (Anthocyanin rich-extract prepared from SL222 sweet potato at a concentration equivalent to the flesh-supplemented diet) or a control diet (AIN-76A) for 18 weeks. At 120 days of age, the mice were anaesthetised, and blood samples were collected before the mice were sacrificed. The intestines were used for adenoma enumeration. The SL222 sweet potato-supplemented diets reduced the adenoma number in the APC MIN mice. These data have significant implications for the use of this sweet potato variant in protection against colorectal cancer.