WorldWideScience

Sample records for swamp milkweed asclepias

  1. Final Critical Habitat for the Welsh's milkweed (Asclepias welshii)

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — To provide the user with a general idea of areas where the final critical habitat for Welsh's milkweed (Asclepias welshii) occur based on the description provided in...

  2. Transesterified milkweed (Asclepias) seed oil as a biodiesel fuel

    Energy Technology Data Exchange (ETDEWEB)

    Ronald Alan Holser; Rogers Harry-O' Kurua [United States Department of Agriculture, Peoria, IL (United States). Agricultural Research Service, National Center for Utilization Research

    2006-10-15

    The methyl and ethyl esters of milkweed (Asclepias) seed oil were prepared and compared to soybean esters in laboratory tests to determine biodiesel fuel performance properties. The pour points of the methyl and ethyl milkweed esters measured -6{sup o}C and -10{sup o}C, respectively, which is consistent with the high levels of unsaturation characteristic of milkweed seed oil. The oxidative stabilities measured by OSI at 100{sup o}C were between 0.8 and 4.1 h for all samples tested. The kinematic viscosities determined at 40{sup o}C by ASTM D 445 averaged 4.9 mm{sup 2}/s for milkweed methyl esters and 4.2 mm{sup 2}/s for soybean methyl esters. Lubricity values determined by ASTM D 6079 at 60{sup o}C were comparable to the corresponding soybean esters with average ball wear scar values of 118 {mu}m for milkweed methyl esters and 200 {mu}m for milkweed ethyl esters.

  3. Beneficial Insect Attraction to Milkweeds (Asclepias speciosa, Asclepias fascicularis in Washington State, USA

    Directory of Open Access Journals (Sweden)

    David G. James

    2016-06-01

    Full Text Available Native plant and beneficial insect associations are relatively unstudied yet are important in native habitat restoration programs for improving and sustaining conservation biological control of arthropod pests in agricultural crops. Milkweeds (Asclepias spp. are currently the focus of restoration programs in the USA aimed at reversing a decline in populations of the milkweed-dependent monarch butterfly (Danaus plexippus; however, little is known of the benefits of these plants to other beneficial insects. Beneficial insects (predators, parasitoids, pollinators attracted to two milkweed species (Asclepias speciosa, Asclepias fascicularis in central Washington State, WA, USA were identified and counted on transparent sticky traps attached to blooms over five seasons. Combining all categories of beneficial insects, means of 128 and 126 insects per trap were recorded for A. speciosa and A. fascicularis, respectively. Predatory and parasitic flies dominated trap catches for A. speciosa while parasitic wasps were the most commonly trapped beneficial insects on A. fascicularis. Bees were trapped commonly on both species, especially A. speciosa with native bees trapped in significantly greater numbers than honey bees. Beneficial insect attraction to A. speciosa and A. fascicularis was substantial. Therefore, these plants are ideal candidates for habitat restoration, intended to enhance conservation biological control, and for pollinator conservation. In central Washington, milkweed restoration programs for enhancement of D. plexippus populations should also provide benefits for pest suppression and pollinator conservation.

  4. Building a model: developing genomic resources for common milkweed (Asclepias syriaca) with low coverage genome sequencing

    Science.gov (United States)

    Shannon C.K. Straub; Mark Fishbein; Tatyana Livshult; Zachary Foster; Matthew Parks; Kevin Weitemier; Richard C. Cronn; Aaron. Liston

    2011-01-01

    Milkweeds (Asclepias L.) have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L.) could be useful in...

  5. Cytotoxic principles from the formosan milkweed, Asclepias curassavica.

    Science.gov (United States)

    Roy, Michael C; Chang, Fang-Rong; Huang, Hsiao-Chu; Chiang, Michael Y-N; Wu, Yang-Chang

    2005-10-01

    A series of cardenolides and related compounds have been isolated from the aerial parts and roots of the ornamental milkweed, Asclepias curassavica. Their structures were determined by spectroscopic and chemical methods. Among them, three derivatives of calactinic acid methyl ester (13-15), 19-nor-16 alpha-acetoxy-10 beta-hydroxyasclepin (16), 20 beta,21-dihydroxypregna-4,6-dien-3-one (19), and 3,4-seco-urs-20(30)-en-3-oic acid (22) are new compounds. The relative configuration of calactinic acid methyl ester (12) has been confirmed by X-ray diffraction analysis on its derivative 13. Most of the cardenolides obtained showed pronounced cytotoxicity against four cancer cell lines (IC(50) 0.01 to 2.0 microg/mL).

  6. Demography and monitoring of Welsh's milkweed (Asclepias welshii) at Coral Pink Sand Dunes

    Science.gov (United States)

    Brent C. Palmer; L. Armstrong

    2001-01-01

    Results are presented of a 12-year monitoring program on the Coral Pink Sand Dunes and Sand Hills populations of the threatened Welsh's milkweed, Asclepias welshii N & P Holmgren. The species is an early sera1 member of the dune flora, colonizing blowouts and advancing with shifting dunes. When an area stabilizes and other vegetation encroaches, A. welshii is...

  7. Reciprocal interactions between native and introduced populations of common milkweed, Asclepias syriaca, and the specialist aphid, Aphis nerii

    NARCIS (Netherlands)

    Bukovinszky, T.; Gols, R.; Agrawal, A.A.; Roge, C.; Bezemer, T.M.; Biere, A.; Harvey, J.A.

    2014-01-01

    Following its introduction into Europe (EU), the common milkweed (Asclepias syriaca) has been free of most specialist herbivores that are present in its native North American (NA) range, except for the oleander aphid Aphis nerii. We compared EU and NA populations of A. nerii on EU and NA milkweed

  8. Common milkweed (Asclepias syriaca L. response to sulcotrione

    Directory of Open Access Journals (Sweden)

    Gajić-Umiljendić Jelena

    2017-01-01

    Full Text Available A laboratory bioassay was conducted to investigate common milkweed response to sulcotrione. Sulcotrione was applied in concentration series of 0.15-0.90 kg a.i./ha without a surfactant and with Dash® at 1 L/ha. Plants grew for 14 days, upon which period morphological (height and fresh weight and physiological parameters (content of carotenoids, chlorophyll a and chlorophyll b were measured. Visual crop injury was estimated 7 and 14 days after treatment. Sulcotrione caused leaf bleaching and reduction in pigments content in common milkweed leaves and the degree of change depended on application rates and whether it was applied with or without the surfactant. Inhibition was slightly higher in plants which were treated with a combination of herbicide and surfactant. Based on the findings in this study, common milkweed showed moderate susceptibility to the recommended field rates of sulcotrione.

  9. Phylogenetic ecology of leaf surface traits in the milkweeds (Asclepias spp.): chemistry, ecophysiology, and insect behavior.

    Science.gov (United States)

    Agrawal, Anurag A; Fishbein, Mark; Jetter, Reinhard; Salminen, Juha-Pekka; Goldstein, Jessica B; Freitag, Amy E; Sparks, Jed P

    2009-08-01

    The leaf surface is the contact point between plants and the environment and plays a crucial role in mediating biotic and abiotic interactions. Here, we took a phylogenetic approach to investigate the function, trade-offs, and evolution of leaf surface traits in the milkweeds (Asclepias). Across 47 species, we found trichome densities of up to 3000 trichomes cm(-2) and epicuticular wax crystals (glaucousness) on 10 species. Glaucous species had a characteristic wax composition dominated by very-long-chain aldehydes. The ancestor of the milkweeds was probably a glaucous species, from which there have been several independent origins of glabrous and pubescent types. Trichomes and wax crystals showed negatively correlated evolution, with both surface types showing an affinity for arid habitats. Pubescent and glaucous milkweeds had a higher maximum photosynthetic rate and lower stomatal density than glabrous species. Pubescent and glaucous leaf surfaces impeded settling behavior of monarch caterpillars and aphids compared with glabrous species, although surface types did not show consistent differentiation in secondary chemistry. We hypothesize that pubescence and glaucousness have evolved as alternative mechanisms with similar functions. The glaucous type, however, appears to be ancestral, lost repeatedly, and never regained; we propose that trichomes are a more evolutionarily titratable strategy.

  10. Building a model: developing genomic resources for common milkweed (Asclepias syriaca with low coverage genome sequencing

    Directory of Open Access Journals (Sweden)

    Weitemier Kevin

    2011-05-01

    Full Text Available Abstract Background Milkweeds (Asclepias L. have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L. could be useful in characterizing the genome of a plant without prior genomic information and for development of genomic resources as a step toward further developing A. syriaca as a model in ecology and evolution. Results A 0.5× genome of A. syriaca was produced using Illumina sequencing. A virtually complete chloroplast genome of 158,598 bp was assembled, revealing few repeats and loss of three genes: accD, clpP, and ycf1. A nearly complete rDNA cistron (18S-5.8S-26S; 7,541 bp and 5S rDNA (120 bp sequence were obtained. Assessment of polymorphism revealed that the rDNA cistron and 5S rDNA had 0.3% and 26.7% polymorphic sites, respectively. A partial mitochondrial genome sequence (130,764 bp, with identical gene content to tobacco, was also assembled. An initial characterization of repeat content indicated that Ty1/copia-like retroelements are the most common repeat type in the milkweed genome. At least one A. syriaca microread hit 88% of Catharanthus roseus (Apocynaceae unigenes (median coverage of 0.29× and 66% of single copy orthologs (COSII in asterids (median coverage of 0.14×. From this partial characterization of the A. syriaca genome, markers for population genetics (microsatellites and phylogenetics (low-copy nuclear genes studies were developed. Conclusions The results highlight the promise of next generation sequencing for development of genomic resources for any organism. Low coverage genome sequencing allows characterization of the high copy fraction of the genome and exploration of the low copy fraction of the genome, which facilitate the development of molecular tools for further study of a target species

  11. Building a model: developing genomic resources for common milkweed (Asclepias syriaca) with low coverage genome sequencing

    Science.gov (United States)

    2011-01-01

    Background Milkweeds (Asclepias L.) have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L.) could be useful in characterizing the genome of a plant without prior genomic information and for development of genomic resources as a step toward further developing A. syriaca as a model in ecology and evolution. Results A 0.5× genome of A. syriaca was produced using Illumina sequencing. A virtually complete chloroplast genome of 158,598 bp was assembled, revealing few repeats and loss of three genes: accD, clpP, and ycf1. A nearly complete rDNA cistron (18S-5.8S-26S; 7,541 bp) and 5S rDNA (120 bp) sequence were obtained. Assessment of polymorphism revealed that the rDNA cistron and 5S rDNA had 0.3% and 26.7% polymorphic sites, respectively. A partial mitochondrial genome sequence (130,764 bp), with identical gene content to tobacco, was also assembled. An initial characterization of repeat content indicated that Ty1/copia-like retroelements are the most common repeat type in the milkweed genome. At least one A. syriaca microread hit 88% of Catharanthus roseus (Apocynaceae) unigenes (median coverage of 0.29×) and 66% of single copy orthologs (COSII) in asterids (median coverage of 0.14×). From this partial characterization of the A. syriaca genome, markers for population genetics (microsatellites) and phylogenetics (low-copy nuclear genes) studies were developed. Conclusions The results highlight the promise of next generation sequencing for development of genomic resources for any organism. Low coverage genome sequencing allows characterization of the high copy fraction of the genome and exploration of the low copy fraction of the genome, which facilitate the development of molecular tools for further study of a target species and its relatives

  12. GEOMORPHOLOGICAL ECOGEOGRAPHICAL VARIABLES DEFINIG FEATURES OF ECOLOGICAL NICHE OF COMMON MILKWEED (ASCLEPIAS SYRIACA L.

    Directory of Open Access Journals (Sweden)

    O. M. Kunah

    2016-04-01

    Full Text Available The role of geomorphological ecogeographical variables have been shown, which are received by means of the digital elevation model created on the basis of remote sensing data as markers of an ecological niche of weeds on an example common milkweed (Asclepias syriaca L.. The research range chooses territory which is in settlement Vovnjanka district (the Poltava region. The range has the linear sizes of 26 kilometres in a direction from the east on the west and 15 kilometres in a direction from the north on the south, the range total area makes 390 км2. As geomorphological variables the topographical wetness index, topographic position index, mass balance index, erosion LS-factor, direct and disseminated insolation, altitude above channel network, multiresolution valley bottom flatness, multiresolution ridge top flatness index, vector ruggedness measure have been considered. It is established, that on set of the geomorphological indicators received by means of digital model of a relief, it is possible to assert, that within a separate agricultural field a wide variety of microconditions which is caused by relief features is formed. Possibly, the variation of thermal and water modes, moisture redistribution, and also productivity mechanical processings of soil and efforts under the control of number of weeds make a background in which limits there is possible a moving of weed plants, including common milkweed.

  13. Impairment of leaf photosynthesis after insect herbivory or mechanical injury on common milkweed, Asclepias syriaca.

    Science.gov (United States)

    Delaney, K J; Haile, F J; Peterson, R K D; Higley, L G

    2008-10-01

    Insect herbivory has variable consequences on plant physiology, growth, and reproduction. In some plants, herbivory reduces photosynthetic rate (Pn) activity on remaining tissue of injured leaves. We sought to better understand the influence of leaf injury on Pn of common milkweed, Asclepias syriaca (Asclepiadaceae), leaves. Initially, we tested whether Pn reductions occurred after insect herbivory or mechanical injury. We also (1) examined the duration of photosynthetic recovery, (2) compared mechanical injury with insect herbivory, (3) studied the relationship between leaf Pn with leaf injury intensity, and (4) considered uninjured leaf compensatory Pn responses neighboring an injured leaf. Leaf Pn was significantly reduced on mechanically injured or insect-fed leaves in all reported experiments except one, so some factor(s) (cardiac glycoside induction, reproductive investment, and water stress) likely interacts with leaf injury to influence whether Pn impairment occurs. Milkweed tussock moth larval herbivory, Euchaetes egle L. (Arctiidae), impaired leaf Pn more severely than mechanical injury in one experiment. Duration of Pn impairment lasted > 5 d to indicate high leaf Pn sensitivity to injury, but Pn recovery occurred within 13 d in one experiment. The degree of Pn reduction was more severe from E. egle herbivory than similar levels of mechanical tissue removal. Negative linear relationships characterized leaf Pn with percentage tissue loss from single E. egle-fed leaves and mechanically injured leaves and suggested that the signal to trigger leaf Pn impairment on remaining tissue of an injured leaf was amplified by additional tissue loss. Finally, neighboring uninjured leaves to an E. egle-fed leaf had a small (approximately 10%) degree of compensatory Pn to partly offset tissue loss and injured leaf Pn impairment.

  14. Differential pollinator effectiveness and importance in a milkweed (Asclepias, Apocynaceae) hybrid zone.

    Science.gov (United States)

    Stoepler, Teresa M; Edge, Andrea; Steel, Anna; O'Quinn, Robin L; Fishbein, Mark

    2012-03-01

    Exceptions to the ideal of complete reproductive isolation between species are commonly encountered in diverse plant, animal, and fungal groups, but often the causative ecological processes are poorly understood. In flowering plants, the outcome of hybridization depends in part on the effectiveness of pollinators in interspecific pollen transport. In the Asclepias exaltata and A. syriaca (Apocynaceae) hybrid zone in Shenandoah National Park, Virginia, extensive introgression has been documented. The objectives of this study were to (1) determine the extent of pollinator overlap among A. exaltata, A. syriaca, and their hybrids and (2) identify the insect taxa responsible for hybridization and introgression. We observed focal plants of parental species and hybrids to measure visitation rate, visit duration, and per-visit pollinia removal and deposition, and we calculated pollinator effectiveness and importance. Visitation rates varied significantly between the 2 yr of the study. Overall, Apis mellifera, Bombus sp., and Epargyreus clarus were the most important pollinators. However, Bombus sp. was the only visitor that was observed to both remove and insert pollinia for both parent species as well as hybrids. We conclude that Bombus may be a key agent of hybridization and introgression in these sympatric milkweed populations, and hybrids are neither preferred nor selected against by pollinators. Thus, we have identified a potential mechanism for how hybrids act as bridges to gene flow between A. exaltata and A. syriaca. These results provide insights into the breakdown of prezygotic isolating mechanisms.

  15. Temporal patterns of foliar ozone symptoms on tall milkweed (Asclepias exaltata L.) in Great Smoky Mountains National Park

    Energy Technology Data Exchange (ETDEWEB)

    Chappelka, A.H. [School of Forestry and Wildlife Sciences, Auburn University, Auburn, AL 36849 (United States)], E-mail: chappah@auburn.edu; Somers, G.L. [School of Forestry and Wildlife Sciences, Auburn University, Auburn, AL 36849 (United States); Renfro, J.R. [USDI National Park Service, Resource Management and Science Division, Great Smoky Mountains National Park, Gatlinburg, TN 37738 (United States)

    2007-10-15

    Incidence and severity of ozone-induced foliar symptoms on tall milkweed (Asclepias exaltata L.) along selected trails in Great Smoky Mountains National Park (GRSM) were determined by two surveys/season conducted from 1992 through 1996. Overall incidence was 73%, and was 84%, 44%, 90%, 58%, and 82% for 1992-1996, respectively for the same clusters. Average incidence was 61% and 84% for the 1st and 2nd surveys, respectively. Seasonal comparisons showed two distinct injury groupings regarding incidence and severity of injury: 1992, 1994 and 1996 (high injury); 1993 and 1995 (low injury). No discernible patterns were observed between symptomatic and asymptomatic plants regarding height, herbivory or flowering. Regression analyses indicated no differentiation in foliar symptoms regarding topographic position, aspect, slope or elevation over the 5-year study period. Our findings indicate other micro-site or genetic factors may control ozone sensitivity of tall milkweed in GRSM. - Ground-level ozone has the potential to cause deleterious effects to tall milkweed growing in Great Smoky Mountains National Park.

  16. Seasonal development of ozone-induced foliar injury on tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Lara [Department of Biology, 572 Rivers Street, Appalachian State University, Boone, NC 28608 (United States)]. E-mail: lsouza@utk.edu; Neufeld, Howard S. [Department of Biology, 572 Rivers Street, Appalachian State University, Boone, NC 28608 (United States); Chappelka, Arthur H. [School of Forestry and Wildlife Sciences, 108 M White-Smith Hall, Auburn University, Auburn, AL 36849 (United States); Burkey, Kent O. [US Department of Agriculture, Agricultural Research Service, Plant Science Research Unit and Department of Crop Science, North Carolina State University, 3908 Inwood Road, Raleigh, NC 26703 (United States); Davison, Alan W. [School of Biology, Ridley Building, University of Newcastle, Newcastle Upon Tyne, NE1 7RU (United Kingdom)

    2006-05-15

    The goals of this study were to document the development of ozone-induced foliar injury, on a leaf-by-leaf basis, and to develop ozone exposure relationships for leaf cohorts and individual tall milkweeds (Asclepias exaltata L.) in Great Smoky Mountains National Park. Plants were classified as either ozone-sensitive or insensitive based on the amount of foliar injury. Sensitive plants developed injury earlier in the season and to a greater extent than insensitive plants. Older leaf cohorts were more likely to belong to high injury classes by the end of each of the two growing seasons. In addition, leaf loss was more likely for older cohorts (2000) and lower leaf positions (2001) than younger cohorts and upper leaves, respectively. Most leaves abscised without prior ozone-like stippling or chlorosis. Failure to take this into account can result in underestimation of the effects of ozone on these plants. - Leaf loss was not necessarily accompanied by symptoms of foliar ozone injury.

  17. Seasonal and diurnal gas exchange differences in ozone-sensitive common milkweed (Asclepias syriaca L.) in relation to ozone uptake

    Energy Technology Data Exchange (ETDEWEB)

    Bergweiler, Chris [Department of Plant, Soil, and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)], E-mail: bergweiler@nre.umass.edu; Manning, William J. [Department of Plant, Soil, and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States); Chevone, Boris I. [Department of Plant Pathology, Physiology, and Weed Science, Virginia Polytechnic Institute and State University, Blacksburg, VA 24061 (United States)

    2008-03-15

    Stomatal conductance and net photosynthesis of common milkweed (Asclepias syriaca L.) plants in two different soil moisture regimes were directly quantified and subsequently modeled over an entire growing season. Direct measurements captured the dynamic response of stomatal conductance to changing environmental conditions throughout the day, as well as declining gas exchange and carbon assimilation throughout the growth period beyond an early summer maximum. This phenomenon was observed in plants grown both with and without supplemental soil moisture, the latter of which should theoretically mitigate against harmful physiological effects caused by exposure to ozone. Seasonally declining rates of stomatal conductance were found to be substantial and incorporated into models, making them less susceptible to the overestimations of effective exposure that are an inherent source of error in ozone exposure indices. The species-specific evidence presented here supports the integration of dynamic physiological processes into flux-based modeling approaches for the prediction of ozone injury in vegetation. - Temporal variation in physiological processes underlying diurnal and seasonal ozone uptake are described for a key ozone bioindicator species of North America.

  18. Plant-determined variation in the cardenolide content, thin-layer chromatography profiles, and emetic potency of monarch butterflies,Danaus plexippus reared on the milkweed,Asclepias eriocarpa in California.

    Science.gov (United States)

    Brower, L P; Seiber, J N; Nelson, C J; Lynch, S P; Tuskes, P M

    1982-03-01

    This paper is the first in a series on cardenolide fingerprinting of the monarch butterfly. New methodologies are presented which allow both qualitative and quantitative descriptions of the constituent cardenolides which these insects derive in the wild from specificAsclepias foodplants. Analyses of thin-layer Chromatographic profiles ofAsclepias eriocarpa cardenolides in 85 individual plant-butterfly pairs collected at six widely separate localities in California indicate a relatively invariant pattern of 16-20 distinct cardenolides which we here define as theAsclepias eriocarpa cardenolide fingerprint profile. Cardenolide concentrations vary widely in the plant samples, but monarchs appear able to regulate total storage by increasing their concentrations relative to their larval host plant when reared on plants containing low concentrations, and vice versa. Forced-feeding of blue jays with powdered butterfly and plant material and with one of the constituent plant cardenolides, labriformin, established that theA. eriocarpa cardenolides are extremely emetic, and that monarchs which have fed on this plant contain an average of 16 emetic-dose fifty (ED50) units. The relatively nonpolar labriformin and labriformidin in the plant are not stored by the monarch but are metabolized in vivo to desglucosyrioside which the butterfly does store. This is chemically analogous to the way in which monarchs and grasshoppers metabolize another series of milkweed cardenolides, those found inA. curassavica. It appears that the sugar moiety through functionality at C-3' determines which cardenolides are metabolized and which are stored. The monarch also appears able to store several lowR f cardenolides fromA. eriocarpa without altering them. Differences in the sequestering process in monarchs and milkweed bugs (Oncopeltus) may be less than emphasized in the literature. The monarch is seen as a central organism involved in a coevolutionary triad simultaneously affecting and affected

  19. Learning in two butterfly species when using flowers of the tropical milkweed Asclepias curassavica: No benefits for pollination.

    Science.gov (United States)

    Ramos, Bruna de Cássia Menezes; Rodríguez-Gironés, Miguel Angel; Rodrigues, Daniela

    2017-08-08

    The ability of insect visitors to learn to manipulate complex flowers has important consequences for foraging efficiency and plant fitness. We investigated learning by two butterfly species, Danaus erippus and Heliconius erato, as they foraged on the complex flowers of Asclepias curassavica, as well as the consequences for pollination. To examine learning with respect to flower manipulation, butterflies were individually tested during four consecutive days under insectary conditions. At the end of each test, we recorded the number of pollinaria attached to the body of each butterfly and scored visited flowers for numbers of removed and inserted pollinia. We also conducted a field study to survey D. erippus and H. erato visiting flowers of A. curassavica, as well as to record numbers of pollinaria attached to the butterflies' bodies, and surveyed A. curassavica plants in the field to inspect flowers for pollinium removal and insertion. Learning improves the ability of both butterfly species to avoid the nonrewarding flower parts and to locate nectar more efficiently. There were no experience effects, for either species, on the numbers of removed and inserted pollinia. Heliconius erato removed and inserted more pollinia than D. erippus. For both butterfly species, pollinium removal was higher than pollinium insertion. This study is the first to show that Danaus and Heliconius butterflies can learn to manipulate complex flowers, but this learning ability does not confer benefits to pollination in A. curassavica. © 2017 Botanical Society of America.

  20. Ecogeographical determinants of the ecological niche of the common milkweed (Asclepias syriaca on the basis of indices of remote sensing of land images

    Directory of Open Access Journals (Sweden)

    O. M. Kunah

    2016-03-01

    Full Text Available The patterns of variation in vegetative indices received by means of data of remote land sensing are described as being dependant on geomorphological predictors and the sizes of agricultural fields in an experimental polygon within Poltava region. The possibilities of application of vegetative indices have been explored through ecogeographical determinants of the ecological niche of the common milkweed (Asclepias syriaca L. and other weeds. On the basis of images of the land surface taken on 23 March and 27 August 2015 by the sensor control Operational Land Imager (OLI, installed on the satellite Landsat 8, vegetative indices have been calculated (AC-Index – aerosol/coastal index, Hydrothermal Composite, NDTI – Normalized Difference Tillage Index, NDVI – Normalized Difference Vegetation Index, VI – Vegetation Index, MNDW – Modified Normalized Difference Water Index, LSWI – Land Surface Water Index, NBR – Normalized Burn Ratio, M15. The data obtained have been subjected to principal component analysis and the revealed principal components have been interpreted with the help of regression analysis, in which geomorphological variables have been applied as predictors. It was possible to explain the trends of variability of the vegetative cover, formalized in the form of the principal component, by means of indices which quantitatively characterise features of relief. The various aspects of variation of vegetative cover have been shown to be characterised by the specificity of the influence of relief factors. A prominent aspect of the variation of the vegetative cover of agroecosystems is variability within a field. The degree of a variation of conditions is proportional to the size of a field. Large fields occupy level plain positions. In turn, within small fields sources of variation are changes in ecological conditions which arise owing to unevenness of relief, which increases in proximity to gullies and ravines. We have identified

  1. Plant-determined variation in cardenolide content and thin-layer chromatography profiles of monarch butterflies,Danaus plexippus reared on milkweed plants in California : 3. Asclepias californica.

    Science.gov (United States)

    Brower, L P; Seiber, J N; Nelson, C J; Lynch, S P; Hoggard, M P; Cohen, J A

    1984-12-01

    Variation in gross cardenolide concentration of the mature leaves of 85Asclepias californica plants collected in four different areas of California is a positively skewed distribution ranging from 9 to 199 μg of cardenolide per 0.1 g dry weight with a mean of 66 μg/0.1 g. Butterflies reared individually on these plants in their native habitats contained a normal distribution of cardenolide ranging from 59 to 410 μg of cardenolide per 0.1 g dry weight with a mean of 234 μg. Cardenolide uptake by the butterflies was a logarithmic function of plant concentration. Total cardenolide per butterfly ranged from 143 to 823 μg with a mean of 441 μg and also was normally distributed. Populational variation of plant cardenolide concentrations occurs within subspecies, but the northern subspeciesA. c. greenei does not differ significantly from the southernA. c. californica. Generally higher concentrations occur in butterflies from northern populations and in females. No evidence was adduced that cardenolides in the plants adversely affected the butterflies. Low cardenolide concentrations in the leaves and the absence of cardenolides in the latex characterize bothA. californica andA. speciosa, but notA. eriocarpa. Thin-layer chromatography in two solvent systems isolated 24 cardenolide spots in the plants, of which 18 are stored by the butterflies. There was a minor difference in the cardenolide spot patterns due to geographic origin of the plants, but as in our previous studies, none in the sexes of the butterflies. UnlikeA. eriocarpa andA. speciosa, A. californica plants lack cardenolides withRf values greater than digitoxigenin. Overall, the cardenolides of bothA. californica andA. speciosa are more polar than those inA. eriocarpa. A. californica plants contain cardenolides of the calotropagenin series including calotropin, calactin, and uscharidin, and the latter is metabolically transformed by monarch larvae to calactin and calotropin. Cardenolides of this series also

  2. Cercosporoid leaf pathogens from whorled milkweed and spineless safflower in California

    NARCIS (Netherlands)

    Koike, S.K.; Baameur, A.; Groenewald, J.Z.; Crous, P.W.

    2011-01-01

    Two cercosporoid species are respectively described from Mexican whorled milkweed (Asclepias fascicularis), and spineless safflower (Carthamus tinctorius) from California. Passalora californica represents a new pathogen on Asclepias fascicularis, while Ramularia cynarae is confirmed on Carthamus

  3. Influence of ozone air pollution on plant-herbivore interactions. Part 1: Biochemical changes in ornamental milkweed (Asclepias curassavica L.; asclepiadaceae) induced by ozone.

    Science.gov (United States)

    Bolsinger, M; Lier, M E; Lansky, D M; Hughes, P R

    1991-01-01

    A series of fumigation experiments was conducted with bloodflower (Asclepias curassavica L.) in continuous-flow stirred reactors (CSTRs) to elucidate the effects of ozone on foliar concentrations of several primary and secondary plant metabolites relevant to herbivores. Plants 8 weeks of age were subjected to different ozone levels ranging from 0 to 134 nl liter(-1) for exposure periods up to 16 days. Leaves were analyzed for concentration of soluble carbohydrates, starch, free amino acids, soluble protein, total phenolics, and total cardenolides. Significant interactions between the linear effects of ozone concentration and exposure time were found for soluble carbohydrates, amino acids, cardenolides and phenolics. No significant treatment effects could be observed on foliar starch and protein concentration. The metabolic responses of plants to fumigation appeared to be altered by overall plant nutrition. It is possible that the metabolic changes observed in the host plant represent important changes in nutritional quality to insects.

  4. Competition: Butterflies eliminate milkweed bugs from a Caribbean Island.

    Science.gov (United States)

    Blakley, Nigel R; Dingle, Hugh

    1978-01-01

    By eliminating the food plant, Asclepias curassavica, monarch butterflies, Danaus plexippus, have virtually eliminated milkweed bugs, Oncopeltus spp., from the island of Barbados. The relatively open terrain of Barbados means the plants have no refuge; the butterflies survive on an alternate milkweed food plant, Calotropis procera, whose thick-walled pods make seeds unavailable to the bugs.

  5. Propagating native milkweeds for restoring monarch butterfly habitat

    Science.gov (United States)

    Thomas D. Landis; R. Kasten. Dumroese

    2015-01-01

    The number of monarch butterflies, charismatic nomads of North America, is rapidly declining. Milkweeds (Asclepias spp.), which are the sole food source for monarch caterpillars, have also experienced a decline throughout the breeding range of this butterfly. Milkweeds can be grown from seeds or vegetatively from root cuttings or rhizomes. Seed germination is often...

  6. Western Monarch and Milkweed Habitat Suitability Assessment Project- Public Share Version of Species Occurence Records Database

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This data is a compilation of milkweed (genus Asclepias) and monarch butterfly (Danaus plexippus) occurrences and specimen records across the western United States...

  7. Horizontal transfer of DNA from the mitochondrial to the plastid genome and its subsequent evolution in milkweeds (Apocynaceae)

    Science.gov (United States)

    Shannon C.K. Straub; Richard C. Cronn; Christopher Edwards; Mark Fishbein; Aaron. Liston

    2013-01-01

    Horizontal gene transfer (HGT) of DNA from the plastid to the nuclear and mitochondrial genomes of higher plants is a common phenomenon; however, plastid genomes (plastomes) are highly conserved and have generally been regarded as impervious to HGT. We sequenced the 158 kb plastome and the 690 kb mitochondrial genome of common milkweed (Asclepias syriaca [Apocynaceae...

  8. Generalised pollination systems for three invasive milkweeds in Australia.

    Science.gov (United States)

    Ward, M; Johnson, S D

    2013-05-01

    Because most plants require pollinator visits for seed production, the ability of an introduced plant species to establish pollinator relationships in a new ecosystem may have a central role in determining its success or failure as an invader. We investigated the pollination ecology of three milkweed species - Asclepias curassavica, Gomphocarpus fruticosus and G. physocarpus - in their invaded range in southeast Queensland, Australia. The complex floral morphology of milkweeds has often been interpreted as a general trend towards specialised pollination requirements. Based on this interpretation, invasion by milkweeds contradicts the expectation than plant species with specialised pollination systems are less likely to become invasive that those with more generalised pollination requirements. However, observations of flower visitors in natural populations of the three study species revealed that their pollination systems are essentially specialised at the taxonomic level of the order, but generalised at the species level. Specifically, pollinators of the two Gomphocarpus species included various species of Hymenoptera (particularly vespid wasps), while pollinators of A. curassavica were primarily Lepidoptera (particularly nymphalid butterflies). Pollinators of all three species are rewarded with copious amounts of highly concentrated nectar. It is likely that successful invasion by these three milkweed species is attributable, at least in part, to their generalised pollinator requirements. The results of this study are discussed in terms of how data from the native range may be useful in predicting pollination success of species in a new environment. © 2012 German Botanical Society and The Royal Botanical Society of the Netherlands.

  9. Climate change may alter breeding ground distributions of eastern migratory monarchs (Danaus plexippus via range expansion of Asclepias host plants.

    Directory of Open Access Journals (Sweden)

    Nathan P Lemoine

    Full Text Available Climate change can profoundly alter species' distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp. host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in

  10. Climate change may alter breeding ground distributions of eastern migratory monarchs (Danaus plexippus) via range expansion of Asclepias host plants.

    Science.gov (United States)

    Lemoine, Nathan P

    2015-01-01

    Climate change can profoundly alter species' distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus) may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp.) host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in summer months

  11. Evolution of specialization: a phylogenetic study of host range in the red milkweed beetle (Tetraopes tetraophthalmus).

    Science.gov (United States)

    Rasmann, Sergio; Agrawal, Anurag A

    2011-06-01

    Specialization is common in most lineages of insect herbivores, one of the most diverse groups of organisms on earth. To address how and why specialization is maintained over evolutionary time, we hypothesized that plant defense and other ecological attributes of potential host plants would predict the performance of a specialist root-feeding herbivore (the red milkweed beetle, Tetraopes tetraophthalmus). Using a comparative phylogenetic and functional trait approach, we assessed the determinants of insect host range across 18 species of Asclepias. Larval survivorship decreased with increasing phylogenetic distance from the true host, Asclepias syriaca, suggesting that adaptation to plant traits drives specialization. Among several root traits measured, only cardenolides (toxic defense chemicals) correlated with larval survival, and cardenolides also explained the phylogenetic distance effect in phylogenetically controlled multiple regression analyses. Additionally, milkweed species having a known association with other Tetraopes beetles were better hosts than species lacking Tetraopes herbivores, and milkweeds with specific leaf area values (a trait related to leaf function and habitat affiliation) similar to those of A. syriaca were better hosts than species having divergent values. We thus conclude that phylogenetic distance is an integrated measure of phenotypic and ecological attributes of Asclepias species, especially defensive cardenolides, which can be used to explain specialization and constraints on host shifts over evolutionary time.

  12. Monarchs (Danaus plexippus) and milkweeds (Asclepias species): The current situation and methods for propagating milkweeds

    Science.gov (United States)

    Tara Luna; R. Kasten Dumroese

    2013-01-01

    An international effort is under way to conserve populations of the monarch butterfly (Danaus plexippus L. [Lepidoptera: Nymphalidae]). Monarchs complete an impressive migration each year, flying from winter roosts on the California coast and the central mountains of Mexico to breeding areas throughout North America. Monarchs depend on habitats along their migratory...

  13. The effect of host plant phenology on reproduction of the milkweed bug, Oncopeltus fasciatus, in tropical Florida.

    Science.gov (United States)

    Miller, Elizabeth Ruth; Dingle, Hugh

    1982-01-01

    A field study of the relationship between host plant phenology and the reproductive pattern of the large milkweed bug, Oncopeltus fasciatus, was conducted in south Florida. Since O. fasciatus need seeds of either milkweed or Nerium oleander plants to reproduce, reproduction takes place on only those host plants that are producing seed pods.Two of four major host plants, Asclepias incarnata and Sarcostemma clausa fruit seasonally, producing pods in early autumn and early winter, respectively. The third milkweed host, Asclepias curassavica, produces almost no pods midsummer (although it flowers abundantly) and few pods midwinter. Nerium oleander (Apocynaceae) produces some pods all year but is only used by O. fasciatus in the summer when milkweeds are not producing pods. Correspondingly, reproduction of O. fasciatus has been observed year round, but relatively few females reproduce in midwinter, coinciding with decreased pod production and low temperatures. This pattern is consistent with the hypothesis that a photoperiodic cue of short day lengths under conditions of cool temperatures may cause adult females to enter diapause and delay reproduction in the field.A comparison of plant phenologies and rainfall between 1976, a very dry year, and 1978, a year with normal rainfall, showed that extreme dryness disrupted the seasonal fruiting of the milkweeds and consequently the reproduction of O. fasciatus.

  14. Cytotoxicity of cardenolides and cardenolide glycosides from Asclepias curassavica.

    Science.gov (United States)

    Li, Jun-Zhu; Qing, Chen; Chen, Chang-Xiang; Hao, Xiao-Jiang; Liu, Hai-Yang

    2009-04-01

    A new cardenolide, 12beta,14beta-dihydroxy-3beta,19-epoxy-3alpha-methoxy-5alpha-card-20(22)-enolide (6), and a new doubly linked cardenolide glycoside, 12beta-hydroxycalotropin (13), together with eleven known compounds, coroglaucigenin (1), 12beta-hydroxycoroglaucigenin (2), calotropagenin (3), desglucouzarin (4), 6'-O-feruloyl-desglucouzarin (5), calotropin (7), uscharidin (8), asclepin (9), 16alpha-hydroxyasclepin (10), 16alpha-acetoxycalotropin (11), and 16alpha-acetoxyasclepin (12), were isolated from the aerial part of ornamental milkweed, Asclepias curassavica and chemically elucidated through spectral analyses. All the isolates were evaluated for their cytotoxic activity against HepG2 and Raji cell lines. The results showed that asclepin (9) had the strongest cytotoxic activity with an IC(50) value of 0.02 microM against the two cancer cell lines and the new compound 13 had significant cytotoxic activity with IC(50) values of 0.69 and 1.46 microM, respectively.

  15. Plant regeneration and ploidy variation in culture derived plants of Asclepias curassavica L.

    Science.gov (United States)

    Pramanik, T K; Datta, S K

    1986-06-01

    Clonal propagation of medicinal milkweed, Asclepias curassavica L. (Asclepiadaceae) was achieved by culturing excised nodes on MS medium (Murashige and Skoog, 1962) supplemented with different hormone combinations. Both BAP and Kn were found equally effective for shoot initiation. IAA and NAA were found suitable for root induction. Combinations of Kn and NAA induced both roots and shoots after 30 days of culture. Chromosomal variation was observed in the roots of in vitro regenerated plants. Regenerants with higher chromosome number (33; 2n=22) obtained on MS medium in response to 9.2 μM Kn+10.7 μM NAA showed vigorous growth and higher propagation rates in culture than the plants possessing less than the diploid chromosome number (2n-2=20, 2n-4=18). Such variations are more likely due to genetic fitness of different aneuploids grown on a particular nutrient medium.

  16. Corneal Toxicity Following Exposure to Asclepias Tuberosa

    DEFF Research Database (Denmark)

    Mikkelsen, Lauge Hjorth; Hamoudi, Hassan; Gül, Cigdem Altuntas

    2017-01-01

    PURPOSE: To present a case of corneal toxicity following exposure to milky plant latex from Asclepias tuberosa. METHODS: A 70-year-old female presented with blurred vision and pain in her left eye after handling an Ascepias tuberosa. Clinical examination revealed a corneal stromal oedema with small...... that inhibit the Na+/ K+-ATPase in the corneal endothelium. The oedema resolved after 96 hours. After nine months the best corrected visual acuity was 20/20. CONCLUSION: Corneal toxicity has previously been reported for plants of the Asclepias family. This is a rare case describing severe corneal toxicity...... caused by exposure to latex from Asclepias tuberosa. Handling of plants of the Asclepias family should be kept as a differential diagnosis in cases of acute corneal toxicity....

  17. Milkweed (Gentianales: Apocynaceae): a farmscape resource for increasing parasitism of stink bugs (Hemiptera: Pentatomidae) and providing nectar to insect pollinators and monarch butterflies.

    Science.gov (United States)

    Tillman, P G; Carpenter, J E

    2014-04-01

    In peanut-cotton farmscapes in Georgia, the stink bugs Nezara viridula (L.) and Chinavia hilaris (Say) (Hemiptera: Pentatomidae) and the leaffooted bug, Leptoglossus phyllopus (L.) (Hemiptera: Coreidae), disperse at crop-to-crop interfaces to feed on bolls in cotton. The main objective of this study was to determine whether insecticide-free tropical milkweed (Asclepias curassavica L.), a nectar-producing plant, can increase parasitism of these bugs by Trichopoda pennipes (F.) (Diptera: Tachinidae) and provide nectar to monarch butterflies and insect pollinators in these farmscapes. Peanut-cotton plots with and without flowering milkweed plants were established in 2009 and 2010. Adult T. pennipes, monarch butterflies, honey bees, and native insect pollinators readily fed on floral nectar of milkweed. Monarch larvae feeding on milkweed vegetation successfully developed into pupae. In 2009, N. viridula was the primary host of T. pennipes in cotton, and parasitism of this pest by the parasitoid was significantly higher in milkweed cotton (61.6%) than in control cotton (13.3%). In 2010, parasitism of N. viridula, C. hilaris, and L. phyllopus by T. pennipes was significantly higher in milkweed cotton (24.0%) than in control cotton (1.1%). For both years of the study, these treatment differences were not owing to a response by the parasitoid to differences in host density, because density of hosts was not significantly different between treatments. In conclusion, incorporation of milkweed in peanut-cotton plots increased stink bug parasitism in cotton and provided nectar to insect pollinators and monarch butterflies.

  18. Characterization of papain-like isoenzymes from latex of Asclepias curassavica by molecular biology validated by proteomic approach.

    Science.gov (United States)

    Obregón, Walter D; Liggieri, Constanza S; Trejo, Sebastian A; Avilés, Francesc X; Vairo-Cavalli, Sandra E; Priolo, Nora S

    2009-01-01

    Latices from Asclepias spp are used in wound healing and the treatment of some digestive disorders. These pharmacological actions have been attributed to the presence of cysteine proteases in these milky latices. Asclepias curassavica (Asclepiadaceae), "scarlet milkweed" is a perennial subshrub native to South America. In the current paper we report a new approach directed at the selective biochemical and molecular characterization of asclepain cI (acI) and asclepain cII (acII), the enzymes responsible for the proteolytic activity of the scarlet milkweed latex. SDS-PAGE spots of both purified peptidases were digested with trypsin and Peptide Mass Fingerprints (PMFs) obtained showed no equivalent peptides. No identification was possible by MASCOT search due to the paucity of information concerning Asclepiadaceae latex cysteine proteinases available in databases. From total RNA extracted from latex samples, cDNA of both peptidases was obtained by RT-PCR using degenerate primers encoding Asclepiadaceae cysteine peptidase conserved domains. Theoretical PMFs of partial polypeptide sequences obtained by cloning (186 and 185 amino acids) were compared with empirical PMFs, confirming that the sequences of 186 and 185 amino acids correspond to acI and acII, respectively. N-terminal sequences of acI and acII, characterized by Edman sequencing, were overlapped with those coming from the cDNA to obtain the full-length sequence of both mature peptidases (212 and 211 residues respectively). Alignment and phylogenetic analysis confirmed that acI and acII belong to the subfamily C1A forming a new group of papain-like cysteine peptidases together with asclepain f from Asclepias fruticosa. We conclude that PMF could be adopted as an excellent tool to differentiate, in a fast and unequivocal way, peptidases with very similar physicochemical and functional properties, with advantages over other conventional methods (for instance enzyme kinetics) that are time consuming and afford less

  19. Arbuscular mycorrhizal fungi alter above- and below-ground chemical defense expression differentially among Asclepias species.

    Science.gov (United States)

    Vannette, Rachel L; Hunter, Mark D; Rasmann, Sergio

    2013-01-01

    Below-ground (BG) symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above- (AG) and BG herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF) on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed)-which all produce toxic cardenolides-with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in AG and BG plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and defense.

  20. Arbuscular mycorrhizal fungi alter above- and below-ground chemical defense expression differentially among Asclepias species

    Directory of Open Access Journals (Sweden)

    Rachel L Vannette

    2013-09-01

    Full Text Available Belowground symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above and belowground herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed--which all produce toxic cardenolides--with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in above- and below-ground plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and

  1. Intragenomic polymorphisms among high-copy loci: a genus-wide study of nuclear ribosomal DNA in Asclepias (Apocynaceae

    Directory of Open Access Journals (Sweden)

    Kevin Weitemier

    2015-01-01

    Full Text Available Despite knowledge that concerted evolution of high-copy loci is often imperfect, studies that investigate the extent of intragenomic polymorphisms and comparisons across a large number of species are rarely made. We present a bioinformatic pipeline for characterizing polymorphisms within an individual among copies of a high-copy locus. Results are presented for nuclear ribosomal DNA (nrDNA across the milkweed genus, Asclepias. The 18S-26S portion of the nrDNA cistron of Asclepias syriaca served as a reference for assembly of the region from 124 samples representing 90 species of Asclepias. Reads were mapped back to each individual’s consensus and at each position reads differing from the consensus were tallied using a custom perl script. Low frequency polymorphisms existed in all individuals (mean = 5.8%. Most nrDNA positions (91% were polymorphic in at least one individual, with polymorphic sites being less frequent in subunit regions and loops. Highly polymorphic sites existed in each individual, with highest abundance in the “noncoding” ITS regions. Phylogenetic signal was present in the distribution of intragenomic polymorphisms across the genus. Intragenomic polymorphisms in nrDNA are common in Asclepias, being found at higher frequency than any other study to date. The high and variable frequency of polymorphisms across species highlights concerns that phylogenetic applications of nrDNA may be error-prone. The new analytical approach provided here is applicable to other taxa and other high-copy regions characterized by low coverage genome sequencing (genome skimming.

  2. Milkweed butterfly resistance to plant toxins is linked to sequestration, not coping with a toxic diet.

    Science.gov (United States)

    Petschenka, Georg; Agrawal, Anurag A

    2015-11-07

    Insect resistance to plant toxins is widely assumed to have evolved in response to using defended plants as a dietary resource. We tested this hypothesis in the milkweed butterflies (Danaini) which have progressively evolved higher levels of resistance to cardenolide toxins based on amino acid substitutions of their cellular sodium-potassium pump (Na(+)/K(+)-ATPase). Using chemical, physiological and caterpillar growth assays on diverse milkweeds (Asclepias spp.) and isolated cardenolides, we show that resistant Na(+)/K(+)-ATPases are not necessary to cope with dietary cardenolides. By contrast, sequestration of cardenolides in the body (as a defence against predators) is associated with the three levels of Na(+)/K(+)-ATPase resistance. To estimate the potential physiological burden of cardenolide sequestration without Na(+)/K(+)-ATPase adaptations, we applied haemolymph of sequestering species on isolated Na(+)/K(+)-ATPase of sequestering and non-sequestering species. Haemolymph cardenolides dramatically impair non-adapted Na(+)/K(+)-ATPase, but had systematically reduced effects on Na(+)/K(+)-ATPase of sequestering species. Our data indicate that major adaptations to plant toxins may be evolutionarily linked to sequestration, and may not necessarily be a means to eat toxic plants. Na(+)/K(+)-ATPase adaptations thus were a potential mechanism through which predators spurred the coevolutionary arms race between plants and insects. © 2015 The Author(s).

  3. Viewing Health: Asclepia in their Natural Settings

    OpenAIRE

    Baker, Patricia A

    2017-01-01

    In this paper, it is argued that there existed a Greco-Roman perception that the views of the surrounding landscapes from Greek healing sanctuaries contributed towards the heath of the pilgrim who visited the sites. Although much has been written about the religious aspects of the healing event in Asclepia, the physical environment of the sanctuaries has yet to be examined. It is, nonetheless significant, allowing us a further understanding of the pilgrims' experience in these places that ext...

  4. Horizontal transfer of DNA from the mitochondrial to the plastid genome and its subsequent evolution in milkweeds (apocynaceae).

    Science.gov (United States)

    Straub, Shannon C K; Cronn, Richard C; Edwards, Christopher; Fishbein, Mark; Liston, Aaron

    2013-01-01

    Horizontal gene transfer (HGT) of DNA from the plastid to the nuclear and mitochondrial genomes of higher plants is a common phenomenon; however, plastid genomes (plastomes) are highly conserved and have generally been regarded as impervious to HGT. We sequenced the 158 kb plastome and the 690 kb mitochondrial genome of common milkweed (Asclepias syriaca [Apocynaceae]) and found evidence of intracellular HGT for a 2.4-kb segment of mitochondrial DNA to the rps2-rpoC2 intergenic spacer of the plastome. The transferred region contains an rpl2 pseudogene and is flanked by plastid sequence in the mitochondrial genome, including an rpoC2 pseudogene, which likely provided the mechanism for HGT back to the plastome through double-strand break repair involving homologous recombination. The plastome insertion is restricted to tribe Asclepiadeae of subfamily Asclepiadoideae, whereas the mitochondrial rpoC2 pseudogene is present throughout the subfamily, which confirms that the plastid to mitochondrial HGT event preceded the HGT to the plastome. Although the plastome insertion has been maintained in all lineages of Asclepiadoideae, it shows minimal evidence of transcription in A. syriaca and is likely nonfunctional. Furthermore, we found recent gene conversion of the mitochondrial rpoC2 pseudogene in Asclepias by the plastid gene, which reflects continued interaction of these genomes.

  5. Oviposition stimulants for the monarch butterfly: flavonol glycosides from Asclepias curassavica.

    Science.gov (United States)

    Haribal, M; Renwick, J A

    1996-01-01

    The monarch butterfly, Danaus plexippus oviposits on milkweed plants, primarily within the Asclepiadaceae. Oviposition stimulants responsible for host plant recognition were isolated from Asclepias curassavica. Six flavonoid glycosides-quercetin 3-O-(2",6"-alpha-L-dirhamnopyranosyl)-beta-D-galactopyranoside, quercetin 3-O-beta-D-glucopyranosyl-(1-->6)-beta-D-galactopyranoside, quercetin 3-O-(2"-O-alpha-L-rhamnopyranosyl)-beta-D-galactopyranoside, quercetin 3-O-alpha-L-rhamnopyranosyl-(1-->6)-beta-D-glucopyranoside, quercetin 3-O-beta-D-galactopyranoside, quercetin 3-O-beta-D-glucopyranoside, and an unidentified flavonoid mixture were isolated and characterized from this plant. An additional glycoside, possibly quercetin 3-O-(2",6"-alpha-L-dirhamnopyranosyl)-beta-D-glucopyranoside, which could not be separated from the first triglycoside, was also found in some batches of plant extract. The two dirhamnosyl glycosides, the glucosylgalactose and the rutinoside were found to be active as oviposition stimulants at 0.5 g leaf equivalents.

  6. Honey bees are the dominant diurnal pollinator of native milkweed in a large urban park.

    Science.gov (United States)

    MacIvor, James Scott; Roberto, Adriano N; Sodhi, Darwin S; Onuferko, Thomas M; Cadotte, Marc W

    2017-10-01

    In eastern North America, the field milkweed, Asclepias syriaca L. (Asclepiadaceae), is used in planting schemes to promote biodiversity conservation for numerous insects including the endangered monarch butterfly, Danaus plexippus (Linnaeus) (Nymphalidae). Less is known about its pollinators, and especially in urban habitats where it is planted often despite being under increasing pressure from invasive plant species, such as the related milkweed, the dog-strangling vine (DSV), Vincetoxicum rossicum (Kleopow) Barbar. (Asclepiadaceae). During the A. syriaca flowering period in July 2016, we surveyed bees in open habitats along a DSV invasion gradient and inspected 433 individuals of 25 bee species in 12 genera for pollinia: these were affixed to bees that visited A. syriaca for nectar and contain pollen packets that are vectored (e.g., transferred) between flowers. Of all bees sampled, pollinia were found only on the nonindigenous honeybee, Apis mellifera (43% of all bees identified), as well as one individual bumblebee, Bombus impatiens Cresson. Pollinia were recorded from 45.2% of all honeybees collected. We found no relationship between biomass of DSV and biomass of A. syriaca per site. There was a significant positive correlation between A. syriaca biomass and the number of pollinia, and the proportion vectored. No relationship with DSV biomass was detected for the number of pollinia collected by bees but the proportion of vectored pollinia declined with increasing DSV biomass. Although we find no evidence of DSV flowers attracting potential pollinators away from A. syriaca and other flowering plants, the impacts on native plant-pollinator mutualisms relate to its ability to outcompete native plants. As wild bees do not appear to visit DSV flowers, it could be altering the landscape to one which honeybees are more tolerant than native wild bees.

  7. Density-dependent reduction and induction of milkweed cardenolides by a sucking insect herbivore.

    Science.gov (United States)

    Martel, John W; Malcolm, Stephen B

    2004-03-01

    The effect of aphid population size on host-plant chemical defense expression and the effect of plant defense on aphid population dynamics were investigated in a milkweed-specialist herbivore system. Density effects of the aposematic oleander aphid, Aphis nerii, on cardenolide expression were measured in two milkweed species, Asclepias curassavica and A. incarnata. These plants vary in constitutive chemical investment with high mean cardenolide concentration in A. curassavica and low to zero in A. incarnata. The second objective was to determine whether cardenolide expression in these two host plants impacts mean A. nerii colony biomass (mg) and density. Cardenolide concentration (microgram/g) of A. curassavica in both aphid-treated leaves and opposite, herbivore-free leaves decreased initially in comparison with aphid-free controls, and then increased significantly with A. nerii density. Thus, A. curassavica responds to aphid herbivory initially with density-dependent phytochemical reduction, followed by induction of cardenolides to concentrations above aphid-free controls. In addition, mean cardenolide concentration of aphid-treated leaves was significantly higher than that of opposite, herbivore-free leaves. Therefore, A. curassavica induction is strongest in herbivore-damage tissue. Conversely, A. incarnata exhibited no such chemical response to aphid herbivory. Furthermore, neither host plant responded chemically to herbivore feeding duration time (days) or to the interaction between herbivore initial density and feeding duration time. There were also no significant differences in mean colony biomass or population density of A. nerii reared on high cardenolide (A. curassavica) and low cardenolide (A. incarnata) hosts.

  8. When bigger is not better: intraspecific competition for pollination increases with population size in invasive milkweeds.

    Science.gov (United States)

    Ward, Megan; Johnson, Steven D; Zalucki, Myron P

    2013-04-01

    One of the essential requirements for an introduced plant species to become invasive is an ability to reproduce outside the native range, particularly when initial populations are small. If a reproductive Allee effect is operating, plants in small populations will have reduced reproductive success relative to plants in larger populations. Alternatively, if plants in small populations experience less competition for pollination than those in large populations, they may actually have higher levels of reproductive success than plants in large populations. To resolve this uncertainty, we investigated how the per capita fecundity of plants was affected by population size in three invasive milkweed species. Field surveys of seed production in natural populations of different sizes but similar densities were conducted for three pollinator-dependent invasive species, namely Asclepias curassavica, Gomphocarpus fruticosus and G. physocarpus. Additionally, supplemental hand-pollinations were performed in small and large populations in order to determine whether reproductive output was limited by pollinator activity in these populations. Reproductive Allee effects were not detected in any of the study species. Instead, plants in small populations exhibited remarkably high levels of reproductive output compared to those in large populations. Increased fruit production following supplemental hand-pollinations suggested that the lower reproductive output of naturally pollinated plants in large populations is a consequence of pollen limitation rather than limitation due to abiotic resources. This is consistent with increased intraspecific competition for pollination amongst plants in large populations. It is likely that the invasion of these milkweed species in Australia has been enhanced because plants in small founding populations experience less intraspecific competition for pollinators than those in large populations, and thus have the ability to produce copious amounts of

  9. Induced defences alter the strength and direction of natural selection on reproductive traits in common milkweed.

    Science.gov (United States)

    Thompson, K A; Cory, K A; Johnson, M T J

    2017-06-01

    Evolutionary biologists have long sought to understand the ecological processes that generate plant reproductive diversity. Recent evidence indicates that constitutive antiherbivore defences can alter natural selection on reproductive traits, but it is unclear whether induced defences will have the same effect and whether reduced foliar damage in defended plants is the cause of this pattern. In a factorial field experiment using common milkweed, Asclepias syriaca L., we induced plant defences using jasmonic acid (JA) and imposed foliar damage using scissors. We found that JA-induced plants experienced selection for more inflorescences that were smaller in size (fewer flowers), whereas control plants only experienced a trend towards selection for larger inflorescences (more flowers); all effects were independent of foliar damage. Our results demonstrate that induced defences can alter both the strength and direction of selection on reproductive traits, and suggest that antiherbivore defences may promote the evolution of plant reproductive diversity. © 2017 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2017 European Society For Evolutionary Biology.

  10. Maumee Bay State Park, Ohio. Shoreline Erosion Beach Restoration Study. Final Feasibility Report and Final Environmental Impact Statement. Interim to Western Lake Erie Shore Study. Volume 2. Appendices. Revised.

    Science.gov (United States)

    1983-12-01

    river bulrush (Scirpus fluviatilis), blue vervain ( Verbena hastata ), and purple Loostrife (Lythrum salicaria). 4* Robust marsh colonized primarily...loostrife (Lythrum salicaria), swamp milkweed (Asclepias incarnata), bur reed (Sparganium sp.), jewelweed (Impatiens sp.), blue vervain ( Verbena hastata ...apparently once agricultural land) colonized with purple loostrife (Lythrum salicaria), cattail (Typha up.), blue vervain ( Verbena hastata ), swamp

  11. Long-term trends in midwestern milkweed abundances and their relevance to monarch butterfly declines

    Science.gov (United States)

    Zaya, David N.; Pearse, Ian; Spyreas, Gregory

    2017-01-01

    Declines in monarch butterfly populations have prompted investigation into the sensitivity of their milkweed host plants to land-use change. Documented declines in milkweed abundance in croplands have spurred efforts to promote milkweeds in other habitats. Nevertheless, our current understanding of milkweed populations is poor. We used a long-term plant survey from Illinois to evaluate whether trends in milkweed abundance have caused monarch decline and to highlight the habitat-management practices that promote milkweeds. Milkweed abundance in natural areas has not declined precipitously, although when croplands are considered, changes in agricultural weed management have led to a 68% loss of milkweed available for monarchs across the region. Midsuccessional plant communities with few invasive species provide optimal milkweed habitat. The augmentation of natural areas and the management of existing grasslands, such as less frequent mowing and woody- and exotic-species control, may replace some of the milkweed that has been lost from croplands.

  12. The Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This introduction to the natural history of the Great Dismal Swamp is presented at a time when 50,000 acres of the Swamp are being converted from private holdings to...

  13. Structures, chemotaxonomic significance, cytotoxic and Na(+),K(+)-ATPase inhibitory activities of new cardenolides from Asclepias curassavica.

    Science.gov (United States)

    Zhang, Rong-Rong; Tian, Hai-Yan; Tan, Ya-Fang; Chung, Tse-Yu; Sun, Xiao-Hui; Xia, Xue; Ye, Wen-Cai; Middleton, David A; Fedosova, Natalya; Esmann, Mikael; Tzen, Jason T C; Jiang, Ren-Wang

    2014-11-28

    Five new cardenolide lactates (1–5) and one new dioxane double linked cardenolide glycoside (17) along with 15 known compounds (6–16 and 18–21) were isolated from the ornamental milkweed Asclepias curassavica. Their structures were elucidated by extensive spectroscopic methods (IR, UV, MS, 1D- and 2D-NMR). The molecular structures and absolute configurations of 1–3 and 17 were further confirmed by single-crystal X-ray diffraction analysis. Simultaneous isolation of dioxane double linked cardenolide glycosides (17–21) and cardenolide lactates (1–5) provided unique chemotaxonomic markers for this genus. Compounds 1–21 were evaluated for the inhibitory activities against DU145 prostate cancer cells. The dioxane double linked cardenolide glycosides showed the most potent cytotoxic effect followed by normal cardenolides and cardenolide lactates, while the C21 steroids were non-cytotoxic. Enzymatic assay established a correlation between the cytotoxic effects in DU145 cancer cells and the Ki for the inhibition of Na(+),K(+)-ATPase. Molecular docking analysis revealed relatively strong H-bond interactions between the bottom of the binding cavity and compounds 18 or 20, and explained why the dioxane double linked cardenolide glycosides possessed higher inhibitory potency on Na(+),K(+)-ATPase than the cardenolide lactate.

  14. Steroidal glycosides from the roots of Asclepias curassavica.

    Science.gov (United States)

    Warashina, Tsutomu; Noro, Tadataka

    2008-03-01

    Twenty-six new acylated-oxypregnane glycosides were obtained along with three known cardenolide glycosides from the roots of Asclepias curassavica (Asclepiadaceae). The new compounds were confirmed to contain 12-O-benzoylsarcostin, 12-O-benzoyldeacylmetaplexigenin, kidjolanin, and 12-O-benzoyltayloron, and one new acylated-oxypregnane, 12-O-(E)-cinnamoyltayloron, as their aglycones, using both spectroscopic and chemical methods.

  15. Southern deepwater swamps

    Science.gov (United States)

    William H. Conner; Marilyn A. Buford

    1998-01-01

    The authors define, classify, and analyze the economic significance of southern deepwater swamps. They discuss the physical environment, vegetational communities, animal communities, management issues, and research needs for this complex resource.

  16. Dismal Swamp Wildlife

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Conceived and constructed by nature the Great Swamp is the most gigantic filtration plant ever built; and more. To protect the health of the wildlife, for which-...

  17. Dismal Swamp Staff Gages

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Well design - Dismal Swamp Shallow observation wells - these are the early wells put in during 1975, 1976. They are black ABS plastic, 2-inch diameter, open at the...

  18. Detailed Project Report for Section 205 Flood Control Project. Dry Run Creek, Fayette County, Oelwein, Iowa with Environmental Assessment.

    Science.gov (United States)

    1987-06-01

    stinging nettle ( Urtica dioica ), ragweed (Ambrosia sp.), common and swamp milkweed (Asclepias syriaca and Asclepias incarnata), and goldenrod (Solidago...the 5- and 10-year flood events, a backwater effect is created by the twin box culvert under the C&NW Railroad tracks near Second Avenue SW. This...backwater effect extends upstream to a commercial business parking lot located between First Avenue NW. and North Frederick Avenue. Modification of this

  19. CALOTROPIN, A CYTOTOXIC PRINCIPLE ISOLATED FROM ASCLEPIAS CURASSAVICA L.

    Science.gov (United States)

    KUPCHAN, S M; KNOX, J R; KELSEY, J E; SAENZRENAULD, J A

    1964-12-25

    An alcoholic extract of Asclepias curassavica L., a plant widely used in folk medicine for treating cancer and warts, shows cytotoxic activity when tested in vitro against cells derived from human carcinoma of the nasopharynx. Systematic fractionation of the extract has led to isolation and characterization of calotropin as a cytotoxic principle. Calotropin is similar in structure to two cardiac glycosides recently shown to be responsible for the cytotoxicity of Apocynum cannabinum L.

  20. Ocular Toxicity Secondary to Asclepias physocarpa: The Balloon Plant

    Directory of Open Access Journals (Sweden)

    Susana Pina

    2014-01-01

    Full Text Available We report a case of a 65-year-old woman with symptoms of blurred vision and ocular irritation a few hours after accidental contact of the right eye with Asclepias physocarpa milky latex. Observation showed a diffuse conjunctival hyperemia and stromal corneal edema with Descemet’s membrane folds. Recovery was fast and apparently complete in less than one month. However, specular microscopy at 6-months follow-up showed an abnormal endothelial morphology as sequelae, suggesting this condition is not as innocuous as it has been suggested.

  1. Poor sequestration of toxic host plant cardenolides and their rapid loss in the milkweed butterfly Danaus chrysippus (Lepidoptera: Nymphalidae: Danainae: Danaini).

    Science.gov (United States)

    Mebs, Dietrich; Wunder, Cora; Toennes, Stefan W

    2017-06-01

    Butterflies of the genus Danaus are known to sequester toxic cardenolides from milkweed host plants (Apocynaceae). In particular, Danaus plexippus efficiently sequesters and stores these compounds, whereas D. chrysippus, is considered to poorly sequester cardenolides. To estimate its sequestration capability compared with that of D. plexippus, larvae of both species were jointly reared on Asclepias curassavica and the major cardenolides of the host plant, calotropin and calactin, were analyzed in adults sampled at different time intervals after eclosion. Both cardenolides were detected in body and wings of D. plexippus. Whereas the calotropin-concentration remained constant over a period of 24 days, that of calactin steadily decreased. In the body, but not in the wings of D. chrysippus, calactin only was detected in low amounts, which was then almost completely lost during the following 8 days after eclosion, suggesting that in contrast to D. plexippus, cardenolides seem to be less important for that butterfly's defence against predators. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L

    National Research Council Canada - National Science Library

    Liggieri, Constanza; Obregón, Walter; Trejo, Sebastián; Priolo, Nora

    2009-01-01

    ... and secondary metabolites. A new papain-like endopeptidase (asclepain cII) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae...

  3. Antifungal action of latex saps from Lactuca sativa L. and Asclepias curassavica L.

    Science.gov (United States)

    Moulin-Traffort, J; Giordani, R; Régli, P

    1990-01-01

    Asclepias curassavica and Lactuca sativa latex saps inhibit the growth of Candida albicans because they degrade a great number of yeasts. This was confirmed by scanning and transmission electron microscopy observations. After a contact of 4 h and 6 h yeasts are deformed and emptied of their cytoplasmic content. Moreover, it appears that these saps, particularly Asclepias, also act on the cell wall: the substances presumed to be responsible for these effects were probably terpens and cardenolids but also enzymes, in particular glucanases.

  4. Climate niches of milkweeds with plesiomorphic traits (Secamonoideae; Apocynaceae) and the milkweed sister group link ancient African climates and floral evolution.

    Science.gov (United States)

    Livshultz, Tatyana; Mead, Jerry V; Goyder, David J; Brannin, Michelle

    2011-12-01

    Climate change that increases mortality of plants and pollinators can create mate-finding Allee effects and thus act as a strong selective force on floral morphology. Milkweeds (Secamonoideae and Asclepiadoideae; Apocynaceae) are typically small plants of seasonally dry habitats, with pollinia and high pollen-transfer efficiency. Their sister group (tribe Baisseeae and Dewevrella) is mostly comprised of giant lianas of African rainforests, with pollen in monads. Comparison of the two groups motivated a new hypothesis: milkweeds evolved in the context of African aridification and the shifting of rainforest to dry forest. Pollinia and high pollen-transfer efficiency may have been adaptations that alleviated mate-finding Allee effects generated by high mortality during droughts. We formally tested whether milkweeds have a drier climate niche by comparing milkweeds with plesiomorphic traits (Secamonoideae) and the milkweed sister group in continental Africa. We georeferenced specimens of the milkweed sister group and Secamonoideae in continental Africa, extracted 19 climatic variables from the Worldclim model, conducted factor analysis to identify correlated suites of variables, and compared the frequency distributions of the two lineages relative to each factor. The distributions of Secamonoideae and the milkweed sister group differed significantly relative to four factors, each correlated with a distinct suite of climate parameters: (1) air temperature (Secamonoideae: cooler), (2) total and (3) summer precipitation (Secamonoideae: drier), and (4) temperature seasonality and isothermality (Secamonoideae: more seasonal and less isothermal). Secamonoideae in continental Africa inhabit drier, cooler sites than do the milkweed sister group, consistent with a shift from rainforests to dry forests in a cooling climate.

  5. Swamp Works- Multiple Projects

    Science.gov (United States)

    Carelli, Jonathan M.; Schuler, Jason M.; Chandler, Meredith L.

    2013-01-01

    My Surface Systems internship over the summer 2013 session covered a broad range of projects that utilized multiple fields of engineering and technology. This internship included a project to create a command center for a 120 ton regolith bin, for the design and assembly of a blast shield to add further protection for the Surface Systems engineers, for the design and assembly of a portable four monitor hyper wall strip that could extend as large as needed, research and programming a nano drill that could be utilized on a next generation robot or rover, and social media tasks including the making of videos, posting to social networking websites and creation of a new outreach program to help spread the word about the Swamp Works laboratory.

  6. Field responses of Prunus serotina and Asclepias syriaca to ozone around southern Lake Michigan

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, J.P. [U.S. Geological Survey and Institute for Environmental Studies, University of Wisconsin, Madison, WI 53706 (United States)]. E-mail: jpbennet@wisc.edu; Jepsen, E.A. [Bureau of Air Management, Wisconsin Department of Natural Resources, Madison, WI 53707 (United States); Roth, J.A. [Bureau of Air Management, Wisconsin Department of Natural Resources, Madison, WI 53707 (United States)

    2006-07-15

    Higher ozone concentrations east of southern Lake Michigan compared to west of the lake were used to test hypotheses about injury and growth effects on two plant species. We measured approximately 1000 black cherry trees and over 3000 milkweed stems from 1999 to 2001 for this purpose. Black cherry branch elongation and milkweed growth and pod formation were significantly higher west of Lake Michigan while ozone injury was greater east of Lake Michigan. Using classification and regression tree (CART) analyses we determined that departures from normal precipitation, soil nitrogen and ozone exposure/peak hourly concentrations were the most important variables affecting cherry branch elongation, and milkweed stem height and pod formation. The effects of ozone were not consistently comparable with the effects of soil nutrients, weather, insect or disease injury, and depended on species. Ozone SUM06 exposures greater than 13 ppm-h decreased cherry branch elongation 18%; peak 1-h exposures greater than 93 ppb reduced milkweed stem height 13%; and peak 1-h concentrations greater than 98 ppb reduced pod formation 11% in milkweed. - Decreased cherry branch elongation, milkweed stem height and pod production, and foliar injury on both species occurred at sites around southern Lake Michigan at ozone exposures of 13 SUM06 ppm-h and 93-98 ppb peak hourly.

  7. Six new C21 steroidal glycosides from Asclepias curassavica L.

    Science.gov (United States)

    Li, Jun-Zhu; Liu, Hai-Yang; Lin, Yi-Ju; Hao, Xiao-Jiang; Ni, Wei; Chen, Chang-Xiang

    2008-07-01

    Six new C(21) steroidal glycosides, named curassavosides A-F (3-8), were obtained from the aerial parts of Asclepias curassavica (Asclepiadaceae), along with two known oxypregnanes, 12-O-benzoyldeacylmetaplexigenin (1) and 12-O-benzoylsarcostin (2). By spectroscopic methods, the structures of the six new compounds were determined as 12-O-benzoyldeacylmetaplexigenin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (3), 12-O-benzoylsarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (4), sarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (5), sarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-digitoxopyranoside (6), 12-O-benzoyldeacylmetaplexigenin 3-O-beta-D-glucopyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-d-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (7), and 12-O-benzoylsarcostin 3-O-beta-D-glucopyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-d-canaropyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (8), respectively. All compounds (1-8) were tested for in vitro cytotoxicity; only compound 3 showed weak inhibitory activity against Raji and AGZY cell lines.

  8. Western Monarch and Milkweed Habitat Suitability Modeling Project- MaxEnt Model Outputs

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Products include relative habitat suitability models of five milkweed species thought to be important to western monarchs that enough data points to allow for...

  9. New cardenolide and acylated lignan glycosides from the aerial parts of Asclepias curassavica.

    Science.gov (United States)

    Warashina, Tsutomu; Shikata, Kimiko; Miyase, Toshio; Fujii, Satoshi; Noro, Tadataka

    2008-08-01

    Three new cardenolide glycosides and six new acylated lignan glycosides were obtained along with nineteen known compounds from the aerial parts of Asclepias curassavica L. (Asclepiadaceae). The structure of each compound was determined based on interpretations of NMR and MS measurements and chemical evidence.

  10. Morphoanatomical characters for the recognition of two species of asclepias in the province of Santa Fe, Argentina

    OpenAIRE

    Mc Cargo, Jorge C.; Gattuso, Martha; Cortadi, Adriana A.

    2010-01-01

    We disclose a morpho-anatomical study of Asclepias curassavica L. and Asclepias mellodora St.-Hil., collected in the Province of Santa Fe, Argentina. Whole plants of both species are commercialized for external and internal use due to its attributed therapeutic properties. For each entity we provide synonyms, folk names, morphological description, common and uncommon anatomical characteristics of roots, stems and leaves. These features were analyzed by optical and scanning electro...

  11. Thrombin like activity of Asclepias curassavica L. latex: action of cysteine proteases.

    Science.gov (United States)

    Shivaprasad, H V; Rajesh, R; Nanda, B L; Dharmappa, K K; Vishwanath, B S

    2009-05-04

    To validate the scientific basis of plant latex to stop bleeding on fresh cuts. Cysteine protease(s) from Asclepias curassavica (Asclepiadaceae) plant latex was assessed for pro-coagulant and thrombin like activities. A waxy material from the latex of Asclepias curassavica latex was removed by freezing and thawing. The resulted latex enzyme fraction was assayed for proteolytic activity using denatured casein as substrate. Its coagulant activity and thrombin like activity were determined using citrated plasma and pure fibrinogen, respectively. Inhibition studies were performed using specific protease inhibitors to know the type of protease. The latex enzyme fraction exhibited strong proteolytic activity when compared to trypsin and exerted pro-coagulant action by reducing plasma clotting time from 195 to 58 s whereas trypsin reduced clotting time marginally from 195 to 155 s. The pro-coagulant activity of this enzyme fraction was exerted by selectively hydrolyzing A alpha and B beta subunits of fibrinogen to form fibrin clot when pure fibrinogen was used as substrate as assessed by fibrinogen-agarose plate method and fibrinogen polymerization assay. Trypsin failed to induce any fibrin clot under similar conditions. The electrophoretic pattern of latex enzyme fraction-induced fibrin clot was very much similar to that of thrombin-induced fibrin clot and mimic thrombin like action. The proteolytic activity including thrombin like activity of Asclepias curassavica latex enzyme fraction was completely inhibited by iodoaceticacid (IAA). Cysteine proteases from Asclepias curassavica latex exhibited strong pro-coagulant action and were found to be specific in its action (Thrombin like). This could be the basis for the use of plant latex in pharmacological applications that justify their use as folk medicine.

  12. Remote Sensing of Wetland Types: Peat Swamps

    NARCIS (Netherlands)

    Hoekman, D.H.

    2017-01-01

    Deposits of peat underneath peat swamp forests are among the world’s largest reservoirs of carbon. Although tropical peatlands occupy only about 0.3 % of the global land surface, they could contain as much as 20 % of the global soil carbon stock, representing 63–148 Gt of carbon.

    Peat swamp

  13. Diagnose of the ingestion of Asclepias mellodora St. Hil. by sheep through microhistological analysis of their digestive contents

    Directory of Open Access Journals (Sweden)

    María Silvia Cid

    2011-02-01

    Full Text Available Asclepias mellodora St. Hil. is a native acute toxic species frequent in the grasslands of the Buenos Aires province, Argentina, whose toxicity had not been assessed until now. This study evaluates the minimal lethal dose of this species for sheep, and the possibility of microscopically recognizing its fragments in gastrointestinal contents as a complementary diagnostic tool in necropsies. Three Frisona sheep (average LW=55±4.5 kg were dosed via an esophageal tube with each one of the following doses of asclepias: 8.0, 5.0, 2.0 and 0.8 g DM.kg LW-1. Sheep poisoned with the three higher doses died between 10 and 85 h after intoxication, but those receiving the lower dose did not. During necropsies we: 1 determined the dry weight of the contents of rumen+reticulum, omasum+abomasum, and large intestine, 2 estimated the percentages of asclepias fragments by microanalysis correcting for digestion effects on fragment recognition, and 3 calculated the total mass of asclepias in the digestive tract of each animal. For the three higher doses, the mass of asclepias identified in the total ingesta was 12.3±3.4% of the amount supplied, possibly because of the strong diarrhea its ingestion produced. The percentages of asclepias in rumen+reticulum did not differ from the average quantified for the entire tract. The results of this study indicate that the minimal lethal doses of asclepias for sheep is between 2.0 and 0.8g DM·kg LW-1, and that the microhistological analysis of the rumen+reticulum, the easiest region to sample, can be used to confirm the ingestion of this toxic species, although the estimated percentage will be not a good estimator of the ingested percentage.

  14. Secondary Defense Chemicals in Milkweed Reduce Parasite Infection in Monarch Butterflies, Danaus plexippus.

    Science.gov (United States)

    Gowler, Camden D; Leon, Kristoffer E; Hunter, Mark D; de Roode, Jacobus C

    2015-06-01

    In tri-trophic systems, herbivores may benefit from their host plants in fighting parasitic infections. Plants can provide parasite resistance in two contrasting ways: either directly, by interfering with the parasite, or indirectly, by increasing herbivore immunity or health. In monarch butterflies, the larval diet of milkweed strongly influences the fitness of a common protozoan parasite. Toxic secondary plant chemicals known as cardenolides correlate strongly with parasite resistance of the host, with greater cardenolide concentrations in the larval diet leading to lower parasite growth. However, milkweed cardenolides may covary with other indices of plant quality including nutrients, and a direct experimental link between cardenolides and parasite performance has not been established. To determine if the anti-parasitic activity of milkweeds is indeed due to secondary chemicals, as opposed to nutrition, we supplemented the diet of infected and uninfected monarch larvae with milkweed latex, which contains cardenolides but no nutrients. Across three experiments, increased dietary cardenolide concentrations reduced parasite growth in infected monarchs, which consequently had longer lifespans. However, uninfected monarchs showed no differences in lifespan across treatments, confirming that cardenolide-containing latex does not increase general health. Our results suggest that cardenolides are a driving force behind plant-derived resistance in this system.

  15. The Aquatic Coleoptera of the Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — A brief review of the aquatic habitats and an annotated list of the aquatic Cleoptera of the Dismal Swamp is presented. Six families with a total of 53 species are...

  16. The Great Dismal Swamp A Brief Interpretation

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — All through man's experience with the Dismal swamp, People old as well as young, women as well as men have been drawn to it, repelled by it and completely fascinated...

  17. Phytomass Budgets for the Dismal Swamp Ecosystem

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Great Dismal Swamp is a heterogeneous ecosystem as a result of various human disturbances. We studied the phytomass distribution in four community types in the...

  18. Kennedy Space Center: Swamp Works

    Science.gov (United States)

    DeFilippo, Anthony Robert

    2013-01-01

    When I began my internship with the Granular Mechanics and Regolith Operations laboratory (GMRO), also known as Swamp Works, I was given the unique opportunity to shadow many teams working on various projects, and decide what projects I wanted to take part in. Before I go into details of my experiences at Swamp Works, I would like to take a moment to explain what I discovered Swamp Works to be. Swamp Works is a family of hardworking, dedicated, and driven people from various backgrounds and skill sets. These people all work to advance technologies and make science fiction science fact through means of rapid prototyping. They support and encourage failure as an option when learning new things, as long as lesson learned from said failure. In fact, their motto states "Fail, Fast, Forward." What this means is, not if but when one fails he or she must do so quickly and spring forward from the failure so that his or her progress is not delayed. With this acceptance, it provided me the confidence to dive into a multitude of projects working in various fields and with a wide range of skill sets. The first project I joined was Badger. My motivation for taking on this project was the opportunity I would have to obtain valuable experience working with 3D modeling and 3D printing technologies. Badger was a digging apparatus to be used in a highly dusty environment in a material known as Regolith. Regolith is a scientific term for the dirt or top soil found on planetary bodies. Regolith contains a large quantity of sediments less than lOppm and as a result poses a challenge of keeping it out of any cracks and crevices. Furthermore, regolith can create high levels of electrostatic energy, which can prove damaging to sensitive electrical hardware. With these characteristics in mind, I decided to take on the task of designing and manufacturing a dust proof cover for the sensitive electrical hardware. When I began this project, I did not have the slightest idea as to how to use 3D

  19. Assessment of atmospheric pollution level using Asclepias procera leaves as biomonitor

    Energy Technology Data Exchange (ETDEWEB)

    Daud, M.; Khalid, N.; Ahmad, S. [Pakistan Inst. of Nuclear Science and Technology, Islamabad (Pakistan). Nuclear Chemistry Div.; Iqbal, J. [University of the Punjab, Lahore (Pakistan). Inst. of Chemistry

    2007-07-01

    The potential of Asclepias procera plant leaves as biomonitor for air pollution monitoring has been explored by analyzing 36 elements in the leaf samples employing Instrumental Neutron Activation Analysis (INAA) and Atomic Absorption Spectrometric (AAS) techniques. The leaf samples were collected in summer and winter seasons from urban areas of Islamabad with different anthropogenic activities as well as from a rural area as a reference site. The soil samples of the respective sites were also analyzed. The reliability of the methods used was established by analyzing the certified reference materials under identical experimental conditions and comparing the results obtained with the certified values, which are in quite good agreement with each other. Pollution Load Index (PLI) of the determined elements was computed and is discussed accordingly. The uptake of metals from soil to roots, stem and leaves has also been investigated by analyzing these parts of the same plant. The results suggest that the leaves of Asclepias procera plant have a good potential to indicate the air pollution levels both in the vicinity of industrial as well as near roadside areas. (orig.)

  20. Developmental And Environmental History Of The Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Pollen analysis of several cores from the Dismal Swamp in southeastern Virginia have indicated that the swamp is a relatively young feature, having begun to develop...

  1. The role of Bahi swamp wetlands in enhancing household food ...

    African Journals Online (AJOL)

    The study was conducted to assess the role of Bahi swamp resources in enhancing household food security and income of adjacent communities. Specifically, the study assessed the socioeconomic activities in the swamp with a potential contribution to local livelihoods, the contribution of the swamp in enhancing ...

  2. Studies on mangrove swamps of Goa 1. Heterotrophic bacterial flora from mangrove swamps

    Digital Repository Service at National Institute of Oceanography (India)

    Matondkar, S.G.P.; Mathani, S.; Mavinkurve, S.

    Heterotrophic bacterial flora from the mangrove swamps of Goa consisted of physiologically active organisms exhibiting cellulolytic, pectinolytic, amylolytic, proteolytic and H2S forming activities, throughout the year. Coryneform and Bacillus were...

  3. Which native milkweeds are acceptable host plants for larval monarch butterflies (Danaus plexippus) within the Midwestern U.S.

    Science.gov (United States)

    Over the past two decades, the population of monarch butterflies east of the Rocky Mountains has experienced a significant decline. Habitat restoration within the summer breeding range is crucial to boost population numbers. Monarch butterfly larvae use milkweeds as their only host plant. However, l...

  4. Toxicity of 5% rotenone to nonindigenous Asian swamp eels

    Science.gov (United States)

    Schofield, P.J.; Nico, L.G.

    2007-01-01

    Our primary goal was to determine whether rotenone would be a useful control against introduced populations of Asian swamp eels (family Synbranchidae, genus Monopterus). We report the results of a laboratory experiment comparing the efficacy of various rotenone concentrations (1, 2, 4, and 8 mg of 5% liquid rotenone/L of water) in killing nonindigenous swamp eels of various sizes (1-350 g) from the three known Florida populations. Although most small swamp eels were killed at concentrations of 2 and 4 mg/L. 100% mortality of adult swamp eels was achieved only at 8 mg/L. We conclude that the effective use of rotenone to control established Florida swamp eel populations would be difficult, based on the relatively high concentration of rotenone needed to kill swamp eels; the complexity of the swamp eel's habitat; and our observations of the species' habitat use and behavior, including its widespread distribution and life history characteristics (e.g., burrowing and overland movement) that enhance its invasion and survival in multiple environments. Nevertheless, control of swamp eels may be achieved in certain situations. A combination of rotenone and electroshocking may be an effective way to eradicate swamp eels from small water bodies and to control populations in larger habitats. However, we are cautious in this recommendation and provide details related to the technical aspects of this type of strategy and caveats related to the toxicity of the chemical.

  5. Marsh and Water Management Plan Great Dismal Swamp National Wildlife Refuge 1990

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Many people perceive swamps as having standing water year-round. However, this is not the case in the Dismal Swamp, and, in fact, most swamp vegetation could not...

  6. Detection and plant monitoring programs: lessons from an intensive survey of Asclepias meadii with five observers.

    Directory of Open Access Journals (Sweden)

    Helen M Alexander

    Full Text Available Monitoring programs, where numbers of individuals are followed through time, are central to conservation. Although incomplete detection is expected with wildlife surveys, this topic is rarely considered with plants. However, if plants are missed in surveys, raw count data can lead to biased estimates of population abundance and vital rates. To illustrate, we had five independent observers survey patches of the rare plant Asclepias meadii at two prairie sites. We analyzed data with two mark-recapture approaches. Using the program CAPTURE, the estimated number of patches equaled the detected number for a burned site, but exceeded detected numbers by 28% for an unburned site. Analyses of detected patches using Huggins models revealed important effects of observer, patch state (flowering/nonflowering, and patch size (number of stems on probabilities of detection. Although some results were expected (i.e. greater detection of flowering than nonflowering patches, the importance of our approach is the ability to quantify the magnitude of detection problems. We also evaluated the degree to which increased observer numbers improved detection: smaller groups (3-4 observers generally found 90 - 99% of the patches found by all five people, but pairs of observers or single observers had high error and detection depended on which individuals were involved. We conclude that an intensive study at the start of a long-term monitoring study provides essential information about probabilities of detection and what factors cause plants to be missed. This information can guide development of monitoring programs.

  7. Structure of Asclepias syriaca L. population against phytocenotic and habitat conditions in Widuchowa (West Pomerania

    Directory of Open Access Journals (Sweden)

    Bacieczko Wanda

    2015-12-01

    Full Text Available Asclepias syriaca L. is on the invasive species list in Poland. Its sites are scattered, with the exception of cultivation sites; they are also not well identified in the country and that is why they have not been presented in the ATPOL (Distribution Atlas of Vascular Plants in Poland yet. In this study, spatial structure of A. syriaca population against phytocenotic and soil conditions in Widuchowa (West Pomeraniawere examined. Number of specimens, their density per 1 m2, and mean crowding were determined. In addition, the population spatial structure type was identified through observations and by calculation of the dispersion coefficient. On the basis of the conducted research, it was found that the investigated population comprised 1 500 specimens and occupied the area of 38 m2. It exhibited regular spatial distribution type (dispersion coefficient<1 and was characterized by high value of mean shoot density, which amounted to 29 spec./1 m2 (max. 35 spec./1 m2. On the basis of the conducted chemical analysis of the soil from the A. syriaca habitat, the substrate was classified as alkaline soil (pH=7.3-7.6, of low total nitrogen (0.07-0.15%, as well as low total carbon content (0.8-1.45%.

  8. Evaluation of hydrocarbon plants suitable for cultivation in Florida. [Euphorbia tirucalli, E. lathyris, and Asclepias curassavica

    Energy Technology Data Exchange (ETDEWEB)

    Dehgan, B.; Wang, S.C.

    1983-01-01

    Most of the hydrocarbon plants reported in the literature are not suitable for cultivation under Florida conditions. Preliminary results of field and greenhouse trials have indicated two species; Euphorbia tirucalli, which is suitable only for south Florida and Asclepias curassavica which has shown promise for the entire state. The hydrocarbon content of E. tirucalli increases with age of the plants (8.19-11.90%), whereas, that of A. curassavica is influenced positively by fertilization (3.62%) and negatively by supplemental irrigation (2.75%). A comparison between the results of field trials with A. curassavica in Florida and E. lathyris in California shows similar biomass yields under unirrigated conditions, despite 3.6 to 7.8 times greater nitrogen application for E. lathyris. Because of environmental conditions in Florida, E. lathyris is not capable of good growth. It is suggested that future research on hydrocarbon plants should concentrate on selection of individuals or species with vigorous, upright growth habits, low fertilizer-irrigation requirements and high hydrocarbon contents. 18 references.

  9. Purification and biochemical characterization of asclepain c I from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Arribére, M Cecilia; Trejo, Sebastián A; Canals, Francesc; Avilés, Francesc X; Priolo, Nora S

    2004-08-01

    In this work we report the isolation, purification and characterization of a new protease from latex of Asclepias curassavica L. Crude extract (CE) was obtained by gathering latex on 0.1 M citric-phosphate buffer with EDTA and cysteine with subsequent ultracentrifugation. Proteolytic assays were made on casein or azocasein as substrates. Caseinolytic activity was completely inhibited by E-64. Stability at different temperatures, optimum pH and ionic strength were evaluated by measuring the residual caseinolytic activity at different times after the incubation. CE showed the highest caseinolytic activity at pH 8.5 in the presence of 12 mM cysteine. CE was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by SDS-PAGE, were isolated. The major purified protease (asclepain cI) showed a molecular mass of 23.2 kDa by mass spectrometry and a pI higher than 9.3. The N-terminal sequence showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-aminoacid-p-nitrophenyl esters, the enzyme showed higher preference for the glutamine derivative. Determinations of kinetic parameter (km and Kcat) were performed with PFLNA.

  10. Gulf-Wide Information System, Environmental Sensitivity Index Swamps, Geographic NAD83, LDWF (2001) [esi_swamp_LDWF_2001

    Data.gov (United States)

    Louisiana Geographic Information Center — This data set contains Environmental Sensitivity Index (ESI) swamps data of coastal Louisiana. The ESI is a classification and ranking system, which characterizes...

  11. Synthesis of Polyformate Esters of Vegetable Oils: Milkweed, Pennycress, and Soy

    Directory of Open Access Journals (Sweden)

    Rogers E. Harry-O’kuru

    2016-01-01

    Full Text Available In a previous study of the characteristics of acyl derivatives of polyhydroxy milkweed oil (PHMWO, it was observed that the densities and viscosities of the respective derivatives decreased with increased chain length of the substituent acyl group. Thus from the polyhydroxy starting material, attenuation in viscosity of the derivatives relative to PHMWO was found in the order: PHMWO ≫ PAcMWE ≫ PBuMWE ≫ PPMWE (2332 : 1733 : 926.2 : 489.4 cSt, resp., at 40°C, where PAcMWE, PBuMWE, and PPMWE were the polyacetyl, polybutyroyl, and polypentanoyl ester derivatives, respectively. In an analogous manner, the densities also decreased as the chain length increased although not as precipitously compared to the viscosity drop. By inference, derivatives of vegetable oils with short chain length substituents on the triglyceride would be attractive in lubricant applications in view of their higher densities and possibly higher viscosity indices. Pursuant to this, we have explored the syntheses of formyl esters of three vegetable oils in order to examine the optimal density, viscosity, and related physical characteristics in relation to their suitability as lubricant candidates. In the absence of ready availability of formic anhydride, we opted to employ the epoxidized vegetable oils as substrates for formyl ester generation using glacial formic acid. The epoxy ring-opening process was smooth but was apparently followed by a simultaneous condensation reaction of the putative α-hydroxy formyl intermediate to yield vicinal diformyl esters from the oxirane. All three polyformyl esters milkweed, soy, and pennycress derivatives exhibited low coefficient of friction and a correspondingly much lower wear scar in the 4-ball antiwear test compared to the longer chain acyl analogues earlier studied.

  12. Indirect organogenesis in milkweed ( Calotropis procera from mature zygotic embryo explants

    Directory of Open Access Journals (Sweden)

    Hojatollah Abbasi

    2018-01-01

    Full Text Available Milkweed ( Calotropis procera is a valuable medicinal plant which grows in many regions of Iran. Its significant medicinal properties have made it an important crop which is cultivated commercially. This plant is propagated from seeds as well as root and shoot cuttings. Due to problems in the usage of these reproduction methods, new propagation methods such as tissue culturing should be developed. This study was aimed at obtaining appropriate concentrations of plant hormones for indirect organogenesis of milkweed. The experiment was arranged in a completely randomized design (CRD with 3 replications. The effects of various concentrations of (2,4-dichlorophenoxyacetic acid 2,4-D (0.1, 0.5, 1, 2 and 3 mg/l were studied in terms of callus induction and shoot regeneration on an MS based medium supplemented with BA (benzyl amino purine and NAA (naphthalene acetic acid at the same concentration. Mature embryos were used as explants and morphological traits such as embryo size, callus size, number and size of shoots and roots were recorded. The results showed that 2,4-D significantly increased the size of cultured embryos (P < 0.05. The largest embryo volume was observed in cultures treated with 3 mg/l 2,4-D. The highest callusing was recorded in 2 mg/l 2,4-D. The effects of BA and NAA concentrations on shoot regeneration were significant and the highest values were observed for a combination of 1 mg/l BA and 2 mg/l NAA. 1 mg/l IBA (Indole 3-butyric acid was able to induce the highest number of better quality roots and shoots.

  13. Analysis of Technical Efficiency among Swamp Rice Farmers in ...

    African Journals Online (AJOL)

    This study was conducted to evaluate the Technical efficiency among swamp rice farmers in Niger State, Nigeria. A multi-stage sampling technique was used to select 159 swamp rice farmers. The data collected were analysed using descriptive statistics, and the stochastic frontier production function. The results showed ...

  14. Swamp Rice Production in Ogun Waterside Local Government Area ...

    African Journals Online (AJOL)

    In conclusion, efficiency and output in swamp rice production in the area can be increased by reducing the amount of labour used but increasing the quantity of seeds planted and adopting improved technologies such as improved seeds, agrochemicals, and fertilizer. Keywords: Agrochemical; fertilizers; swamp ric

  15. Microhabitat Characteristics of sites used by swamp rabbits

    Science.gov (United States)

    Patrick A. Zollner; Winston P. Smith; Leonard A. Brennan

    2000-01-01

    The swamp rabbit (Sylvilagus aquaticus) is one of the least studied North American lagomorphs; a better understanding of the habitat types it uses will improve management of this species. We studied microhabitat characteristics of sites associated with specific behaviors of the swamp rabbit. During spring-summer (15 April-1 October) and fall-winter (...

  16. Economic analysis of swamp rice production in Ebonyi Southern ...

    African Journals Online (AJOL)

    The aim of the paper is to analyze the determinants and profitability of the output of swamp rice farmers in Ebonyi southern Agricultural zone of Ebonyi State. Primary data were obtained through the use of structured questionnaires. A total of eighty (80) swamp rice farmers were randomly selected from the different blocks ...

  17. UGT74AN1, a Permissive Glycosyltransferase from Asclepias curassavica for the Regiospecific Steroid 3-O-Glycosylation.

    Science.gov (United States)

    Wen, Chao; Huang, Wei; Zhu, Xue-Lin; Li, Xiao-San; Zhang, Fan; Jiang, Ren-Wang

    2018-01-24

    A permissive steroid glycosyltransferase (UGT74AN1) from Asclepias curassavica exhibited robust capabilities for the regiospecific C3 glycosylation of cardiotonic steroids and C21 steroid precursors, and unprecedented promiscuity toward 53 structurally diverse natural and unnatural compounds to form O-, N-, and S-glycosides, along with the catalytic reversibility for a one-pot transglycosylation reaction. These findings highlight UGT74AN1 as the first regiospecific catalyst for cardiotonic steroid C3 glycosylation and exhibit significant potential for glycosylation of diverse bioactive molecules in drug discovery.

  18. Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora

    2009-02-01

    Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.

  19. The scientific value and potential of New Zealand swamp kauri

    Science.gov (United States)

    Lorrey, Andrew M.; Boswijk, Gretel; Hogg, Alan; Palmer, Jonathan G.; Turney, Christian S. M.; Fowler, Anthony M.; Ogden, John; Woolley, John-Mark

    2018-03-01

    New Zealand swamp kauri (Agathis australis) are relic trees that have been buried and preserved in anoxic bog environments of northern New Zealand for centuries through to hundreds of millennia. Kauri are massive in proportion to other native New Zealand trees and they can attain ages greater than 1000 years. The export market for swamp (subfossil) kauri has recently been driven by demand for a high-value workable timber, but there are concerns about the sustainability of the remaining resource, a situation exacerbated in recent years by the rapid extraction of wood. Economic exploitation of swamp kauri presents several unique opportunities for Quaternary science, however the scientific value of this wood is not well understood by the wider research community and public. Here, we summarise the history of scientific research on swamp kauri, and explore the considerable potential of this unique resource. Swamp kauri tree-ring chronologies are temporally unique, and secondary analyses (such as radiocarbon and isotopic analyses) have value for improving our understanding of Earth's recent geologic history and pre-instrumental climate history. Swamp kauri deposits that span the last interglacial-glacial cycle show potential to yield "ultra-long" multi-millennia tree-ring chronologies, and composite records spanning large parts of MIS3 (and most of the Holocene) may be possible. High-precision radiocarbon dating of swamp kauri chronologies can improve the resolution of the global radiocarbon calibration curve, while testing age modelling and chronologic alignment of other independent long-term high-resolution proxy records. Swamp kauri also has the potential to facilitate absolute dating and verification of cosmogenic events found in long Northern Hemisphere tree-ring chronologies. Future efforts to conserve these identified values requires scientists to work closely with swamp kauri industry operators, resource consent authorities, and export regulators to mitigate

  20. The buck in the milkweed: evidence of male-male interference among pollinaria on pollinators.

    Science.gov (United States)

    Cocucci, Andrea A; Marino, Salvador; Baranzelli, Matías; Wiemer, Ana P; Sérsic, Alicia

    2014-07-01

    Direct physical confrontation among conspecifics for access to mates is a form of sexual selection well known among animals, but not thought to take place in plants. Consequently, no structures are known that can be considered as weapons that evolved under such confrontation. Pollinaria of milkweeds may physically compete for access to attachment points on the pollinators' body, and occasionally pollinaria may link onto pre-existing pollinaria on a pollinator resulting in concatenation. We hypothesized that concatenation may result in interference between proximal and distal pollinaria, and that features of nonconcatenating pollinaria might be attributed to prevention of concatenation. We tested this by analyzing pollen donation efficiency, experimental manipulation of the phenotype and the phylogenetic patterns of co-occurrence of traits. It is shown that concatenation was able to diminish the reproductive performance of proximal pollinaria, that horns on pollinaria prevented concatenation, and that horn acquisition was correlated with a loss of concatenation. The experimental removal of horns in species that did not concatenate caused reversion to concatenation. The present work could be the first evidence of male physical struggles and of the acquisition of weapons related to these struggles, that are analogous to those known in animals. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.

  1. Evidence against a germ plasm in the milkweed bug Oncopeltus fasciatus, a hemimetabolous insect

    Directory of Open Access Journals (Sweden)

    Ben Ewen-Campen

    2013-04-01

    Primordial germ cell (PGC formation in holometabolous insects like Drosophila melanogaster relies on maternally synthesised germ cell determinants that are asymmetrically localised to the oocyte posterior cortex. Embryonic nuclei that inherit this “germ plasm” acquire PGC fate. In contrast, historical studies of basally branching insects (Hemimetabola suggest that a maternal requirement for germ line genes in PGC specification may be a derived character confined principally to Holometabola. However, there have been remarkably few investigations of germ line gene expression and function in hemimetabolous insects. Here we characterise PGC formation in the milkweed bug Oncopeltus fasciatus, a member of the sister group to Holometabola, thus providing an important evolutionary comparison to members of this clade. We examine the transcript distribution of orthologues of 19 Drosophila germ cell and/or germ plasm marker genes, and show that none of them localise asymmetrically within Oncopeltus oocytes or early embryos. Using multiple molecular and cytological criteria, we provide evidence that PGCs form after cellularisation at the site of gastrulation. Functional studies of vasa and tudor reveal that these genes are not required for germ cell formation, but that vasa is required in adult males for spermatogenesis. Taken together, our results provide evidence that Oncopeltus germ cells may form in the absence of germ plasm, consistent with the hypothesis that germ plasm is a derived strategy of germ cell specification in insects.

  2. The fungal flora of the mangrove swamps of Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Matondkar, S.G.P.; Mahtani, S.; Mavinkurve, S.

    Mangrove swamps of Goa (India) showed the presence of fungi belonging to 14 different genera, predominant ones being Monilia, Mucor, Syncephalastrum, Aspergillus and Trichothecium. Most of the isolates were found to be physiologically active...

  3. The Great Dismal Swamp National Wildlife Refuge Contaminants Monitoring Plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Alternatives for an environmental contaminants monitoring plan have been developed for the Great Dismal Swamp National Wildlife Refuge (Refuge). This study...

  4. Panther Swamp National Wildlife Refuge : Hunting Plan and Controversy.

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This collections covers Panther Swamp National Wildlife Refuge's hunting plan and memos (specifically Mike Espy) between the refuge on the local community. The local...

  5. Bond Swamp National Wildlife Refuge: Comprehensive Conservation Plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This Comprehensive Conservation Plan (CCP) was written to guide management on Bond Swamp NWR for the next 15 years. This plan outlines the Refuge vision and purpose...

  6. Forest Management Plan Great Dismal Swamp National Wildlife Refuge 1987

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objectives of the timber management program at Great Dismal Swamp National Wildlife Refuge are: 1) protecting and preserving the unique and outstanding ecosystem...

  7. Hydrology Study at Great Swamp National Wildlife Refuge 1984

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This study evaluates the effects of changing land use on the water environment of the Great Swamp National Wildlife Refuge. Past, present and future land use maps...

  8. Ecotone Dynamics And Boundary Determination In The Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Data on hydrogeology, soils, and vegetation collected on four transects across the 48-km wetland-to-upland transition zone of the Great Dismal Swamp of Virginia/...

  9. The Natural And Cultural History Of The Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Great Dismal Swamp is a forested wetland located on the Middle Atlantic Coastal Plain in Southeastern Virginia and northeastern North Carolina. Estimates of the...

  10. Spiders of the Great Dismal Swamp: Lake Drummond 1977

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report outlines the results of a study of spiders that was conducted along the shores of Lake Drummond, in the Great Dismal Swamp. The purpose of the study was...

  11. Field Research on the Great Dismal Swamp Shrew 1988

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This is a progress report outlining the results of a study done on the evaluation of the distribution of the Dismal Swamp southeastern shrew in the refuge and areas...

  12. Animal Control Plan Great Swamp National Wildlife Refuge 1974

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Waterfowl production objectives for the Great Swamp National Wildlife Refuge are to create habitat supporting the production of 16,000 ducks and 500 geese annually....

  13. Panther Swamp National Wildlife Refuge Public Use Development Plan - 1985

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This plan for Panther Swamp NWR involves setting station public use goals, project a positive attitude, welcome and orient visitors, develop key resources awareness,...

  14. Late Pleistocene and Holocene History at Mubwindi Swamp, Southwest Uganda

    Science.gov (United States)

    Marchant, Robert; Taylor, David; Hamilton, Alan

    1997-05-01

    Deposits beneath Mubwindi Swamp provide a partial record of vegetation history since at least 43,000 yr ago. We studied pollen from two cores and obtained nine radiocarbon ages from one of these cores and three radiocarbon ages from the other. Pollen deposited before and soon after the last glacial maximum represents vegetation very different from the modern vegetation of the Mubwindi Swamp catchment. Although species now associated with higher altitudes were dominant some elements of moist lower montane forest persisted, possibly because of favorable soils or topography. The pollen data provides evidence for a late glacial montane forest refuge near Mubwindi Swamp. Moist lower montane forest became much more widespread soon after the glacial maximum. The only irrefutably Holocene sediments from Mubwindi Swamp date to the past 2500 yr. During this time a combination of climatic and human-induced changes in vegetation can be seen in the pollen records.

  15. Narrative Report : Great Swamp National Wildlife Refuges : January - December 1971

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1971 calendar year. The report begins by summarizing...

  16. Great Swamp Wilderness Character Monitoring Back-end Database

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This is the back-end data file for the Great Swamp Wilderness Character Monitoring Application. User interface and lookup databases are required for use (see...

  17. Safety Plan Great Dismal Swamp National Wildlife Refuge Suffolk, Virginia

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Great Dismal Swamp National Wildlife Refuge Safety Plan discusses policies for the safety of the station employees, volunteers, and public. This plan seeks to...

  18. Dismal Swamp National Wildlife Refuge Management Study Transmittal

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This study will investigate temporal and spatial variations in the concentrations of methane, nitrous oxide, hydrocarbons, and sulfur compounds in the Dismal Swamp....

  19. Mammals Of The Dismal Swamp: A Historical Account

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — For the first time, individual species of mammals of the Dismal Swamp area were considered in detail when K. A. Wilson studied the role of mink, otter, and raccoon...

  20. Annual Narrative 1967 Great Swamp National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1967 calendar year. The report begins by summarizing...

  1. Phosphate relationships in acid-sulphate soils of Mbiabet swamp ...

    African Journals Online (AJOL)

    Treatments consisted of potassium dihydrogen phosphate added to the swamp mud, cat-clay, and mud-clay in equal doses of 122 kg/ha P205, fitted into Latin square of 36 x 5 m swamp, except for the control plots. Limestone (CaC03) was applied to both fertilized and unfertilized plots at the rate of 50 kg/ha to reduce

  2. Regeneration potential of Taxodium distichum swamps and climate change

    Science.gov (United States)

    Middleton, B.A.

    2009-01-01

    Seed bank densities respond to factors across local to landscape scales, and therefore, knowledge of these responses may be necessary in forecasting the effects of climate change on the regeneration of species. This study relates the seed bank densities of species of Taxodium distichum swamps to local water regime and regional climate factors at five latitudes across the Mississippi River Alluvial Valley from southern Illinois to Louisiana. In an outdoor nursery setting, the seed banks of twenty-five swamps were exposed to non-flooded (freely drained) or flooded treatments, and the number and species of seeds germinating were recorded from each swamp during one growing season. Based on ANOVA analysis, the majority of dominant species had a higher rate of germination in non-flooded versus flooded treatments. Similarly, an NMS comparison, which considered the local water regime and regional climate of the swamps, found that the species of seeds germinating, almost completely shifted under non-flooded versus flooded treatments. For example, in wetter northern swamps, seeds of Taxodium distichum germinated in non-flooded conditions, but did not germinate from the same seed banks in flooded conditions. In wetter southern swamps, seeds of Eleocharis cellulosa germinated in flooded conditions, but did not germinate in non-flooded conditions. The strong relationship of seed germination and density relationships with local water regime and regional climate variables suggests that the forecasting of climate change effects on swamps and other wetlands needs to consider a variety of interrelated variables to make adequate projections of the regeneration responses of species to climate change. Because regeneration is an important aspect of species maintenance and restoration, climate drying could influence the species distribution of these swamps in the future. ?? 2008 Springer Science+Business Media B.V.

  3. Benefits of Riverine Water Discharge into the Lorian Swamp, Kenya

    Directory of Open Access Journals (Sweden)

    Zipporah Musyimi

    2012-12-01

    Full Text Available Use and retention of river water in African highlands deprive communities in arid lowlands of their benefits. This paper reviews information on water use in the Ewaso Ng’iro catchment, Kenya, to evaluate the effects of upstream abstraction on the Lorian Swamp, a wetland used by pastoralists downstream. We first assess the abstractions and demands for water upstream and the river water supplies at the upper and the lower end of the Lorian Swamp. Further analysis of 12 years of monthly SPOT-VEGETATION satellite imagery reveals higher NDVI (Normalized Differential Vegetation Index values in the swamp than nearby rainfed areas, with the difference in NDVI between the two positively related to river water discharged into the swamp. The paper next reviews the benefits derived from water entering the swamp and the vulnerability to abstractions for three categories of water: (i the surface water used for drinking and sanitation; (ii the surface water that supports forage production; and (iii the water that recharges the Merti Aquifer. Our results suggest that benefits from surface water for domestic use and forage production are vulnerable to abstractions upstream whereas the benefits from the aquifer, with significant fossil water, are likely to be affected in the long run, but not the short term.

  4. Stepwise evolution of resistance to toxic cardenolides via genetic substitutions in the Na+/K+ -ATPase of milkweed butterflies (lepidoptera: Danaini).

    Science.gov (United States)

    Petschenka, Georg; Fandrich, Steffi; Sander, Nils; Wagschal, Vera; Boppré, Michael; Dobler, Susanne

    2013-09-01

    Despite the monarch butterfly (Danaus plexippus) being famous for its adaptations to the defensive traits of its milkweed host plants, little is known about the macroevolution of these traits. Unlike most other animal species, monarchs are largely insensitive to cardenolides, because their target site, the sodium pump (Na(+)/K(+) -ATPase), has evolved amino acid substitutions that reduce cardenolide binding (so-called target site insensitivity, TSI). Because many, but not all, species of milkweed butterflies (Danaini) are associated with cardenolide-containing host plants, we analyzed 16 species, representing all phylogenetic lineages of milkweed butterflies, for the occurrence of TSI by sequence analyses of the Na(+)/K(+) -ATPase gene and by enzymatic assays with extracted Na(+)/K(+) -ATPase. Here we report that sensitivity to cardenolides was reduced in a stepwise manner during the macroevolution of milkweed butterflies. Strikingly, not all Danaini typically consuming cardenolides showed TSI, but rather TSI was more strongly associated with sequestration of toxic cardenolides. Thus, the interplay between bottom-up selection by plant compounds and top-down selection by natural enemies can explain the evolutionary sequence of adaptations to these toxins. © 2013 The Author(s). Evolution © 2013 The Society for the Study of Evolution.

  5. Status Survey for the Dismal Swamp- Green Stink Bug (Chlorochroa dismalia) in Virginia

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Dismal Swamp green stink bug (Chlorochroa dismalia), also known as the Dismal Swamp chlorochroan bug, is one of 52 members of the Family Pentatomidae (Order...

  6. Penaeid prawn population and fry resource in a mangrove swamp of Goa, India

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.; Nair, S.R.S.

    Penaeid prawns abundantly occur in the mangrove swamp during the premonsoon season. They are constituted by the commercial species, Penaeus merguiensis, Metapenaeus dobsoni and M. monoceros. Recruitment of the swamp takes place when the individuals...

  7. COMPLEX STUDY OF THE LACUSTRIAN ECOSYSTEMS OF MOHOŞ SWAMP

    Directory of Open Access Journals (Sweden)

    Daniel Constantin DIACONU

    2010-06-01

    Full Text Available Mohoş Swamp is an oligotroph swamp, formed in a volcanic crater on the site of a former lake, which permanently changes. Using a series of modern methods such as ultrasound bathymetry, we want to set up a reference base so that in the future one can be able to determine the rhythm and direction of the development of this complex ecosystem, both in terms of morph metrics and chemical hydrology parameters point of view. Bathymetry and geomorfological study represents the most important stage because it makes it possible to establish the concrete characteristics of the investigated lakes as well as their placement.

  8. Characteristics of mangrove swamps managed for mosquito control in eastern Florida, USA

    Science.gov (United States)

    Middleton, B.; Devlin, D.; Proffitt, E.; McKee, K.; Cretini, K.F.

    2008-01-01

    Manipulations of the vegetation and hydrology of wetlands for mosquito control are common worldwide, but these modifications may affect vital ecosystem processes. To control mosquitoes in mangrove swamps in eastern Florida, managers have used rotational impoundment management (RIM) as an alternative to the worldwide practice of mosquito ditching. Levees surround RIM swamps, and water is pumped into the impoundment during the summer, a season when natural swamps have low water levels. In the New World, these mosquito-managed swamps resemble the mixed basin type of mangrove swamp (based on PCA analysis). An assessment was made of RIM, natural (control), and breached-RIM (restored) swamps in eastern Florida to compare their structural complexities, soil development, and resistance to invasion. Regarding structural complexity, dominant species composition differed between these swamps; the red mangrove Rhizophora mangle occurred at a higher relative density in RIM and breached-RIM swamps, and the black mangrove Avicennia germinans had a higher relative density in natural swamps. Tree density and canopy cover were higher and tree height lower in RIM swamps than in natural and breached-RIM swamps. Soil organic matter in RIM swamps was twice that in natural or breached-RIM swamps. RIM swamps had a lower resistance to invasion by the Brazilian pepper tree Schinus terebinthifolius, which is likely attributable to the lower porewater salinity in RIM swamps. These characteristics may reflect differences in important ecosystem processes (primary production, trophic structure, nutrient cycling, decomposition). Comparative assessments of managed wetlands are vital for land managers, so that they can make informed decisions compatible with conservation objectives. ?? Inter-Research 2008.

  9. The White Cedar of the Dismal Swamp 1923

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This is a report that discusses the various uses, yields and properties of the White Cedar in the Great Dismal Swamp area in the early 1920s. It also discusses the...

  10. Invertebrate Encrustations On The Mangrove Swamp Oyster And ...

    African Journals Online (AJOL)

    The mangrove swamp oyster Crassostrea tulipa demonstrates a symbiotic relationship with the barnacle. Balnus sp and other encrusting invertebrates. It is inferred that the latter militate against predatory drilling on the oyster by Thais califera as well as prevent algal infestation and the consequent bioerosion by herbivorous ...

  11. Swamp Rice Production in Ogun Waterside Local Government Area ...

    African Journals Online (AJOL)

    All the variable inputs were inefficiently utilized and about 85% of the variations in rice output could be explained by factors included in the regression model. In conclusion, efficiency and output in swamp rice production in the area can be increased by reducing the amount of labour used but increasing the quantity of seeds ...

  12. Distribution of periphytic algae in wetlands (Palm swamps, Cerrado), Brazil.

    Science.gov (United States)

    Dunck, B; Nogueira, I S; Felisberto, S A

    2013-05-01

    The distribution of periphytic algae communities depends on various factors such as type of substrate, level of disturbance, nutrient availability and light. According to the prediction that impacts of anthropogenic activity provide changes in environmental characteristics, making impacted Palm swamps related to environmental changes such as deforestation and higher loads of nutrients via allochthonous, the hypothesis tested was: impacted Palm swamps have higher richness, density, biomass and biovolume of epiphytic algae. We evaluated the distribution and structure of epiphytic algae communities in 23 Palm swamps of Goiás State under different environmental impacts. The community structure attributes here analyzed were composition, richness, density, biomass and biovolume. This study revealed the importance of the environment on the distribution and structuration of algal communities, relating the higher values of richness, biomass and biovolume with impacted environments. Acidic waters and high concentration of silica were important factors in this study. Altogether 200 taxa were identified, and the zygnemaphycea was the group most representative in richness and biovolume, whereas the diatoms, in density of studied epiphyton. Impacted Palm swamps in agricultural area presented two indicator species, Gomphonema lagenula Kützing and Oedogonium sp, both related to mesotrophic to eutrophic conditions for total nitrogen concentrations of these environments.

  13. Aluminum and iron contents in phosphate treated swamp rice farm ...

    African Journals Online (AJOL)

    In 2006 aluminum and iron contents were determined in phosphate treated swamp rice farm of Mbiabet, Akwa Ibom State. The objectives were to determine the aluminum and iron contents, the effect of drying, phosphate and lime application in an acid sulphate soil grown to rice in Nigeria. The soil samples used were ...

  14. Swamp tours in Louisiana post Hurricane Katrina and Hurricane Rita

    Science.gov (United States)

    Dawn J. Schaffer; Craig A. Miller

    2007-01-01

    Hurricanes Katrina and Rita made landfall in southern Louisiana during August and September 2005. Prior to these storms, swamp tours were a growing sector of nature-based tourism that entertained visitors while teaching about local flora, fauna, and culture. This study determined post-hurricane operating status of tours, damage sustained, and repairs made. Differences...

  15. Production Efficiency of Swamp Rice Production in Cross River ...

    African Journals Online (AJOL)

    397.00k with N9.80K made on every naira invested in improved variety of swamp rice produced in the study area. Rice farming business is a profitable business, with attractive net return on investment. Therefore, unemployed youths in Cross River ...

  16. Are there evidences of a complex mimicry system among Asclepias curassavica (Apocynaceae), Epidendrum fulgens (Orchidaceae), and Lantana camara (Verbenaceae) in Southern Brazil?

    OpenAIRE

    Fuhro, Daniela; Araújo, Aldo Mellender de; Irgang, Bruno Edgar

    2010-01-01

    The goal of this paper was to test the presence of mimicry in Asclepias curassavica L., Epidendrum fulgens Brong., and Lantana camara L. The study was carried out at the Parque Estadual de Itapeva, RS, southern Brazil, from 2004 to 2006. Flowering period of each of the three species was followed up; focal observations of butterflies visiting flowers, from fixed point and during random walks were carried out. We also estimated the frequency of pollinaria removal in the orchid, as well as its m...

  17. The exploitation of swamp plants for dewatering liquid sewage sludge

    Directory of Open Access Journals (Sweden)

    Jiří Šálek

    2006-01-01

    Full Text Available The operators of little rural wastewater treatment plants have been interested in economic exploitation of sewage sludge in local conditions. The chance is searching simply and natural ways of processing and exploitation stabilized sewage sludge in agriculture. Manure substrate have been obtained by composting waterless sewage sludge including rest plant biomass after closing 6–8 years period of filling liquid sewage sludge to the basin. Main attention was focused on exploitation of swamp plants for dewatering liquid sewage sludge and determination of influence sewage sludge on plants, intensity and course of evapotranspiration and design and setting of drying beds. On the base of determined ability of swamp plants evapotranspiration were edited suggestion solutions of design and operation sludge bed facilities in the conditions of small rural wastewater treatment plant.

  18. Forest Dynamics of Peat Swamp Forest in Sebangau, Central Kalimantan

    Directory of Open Access Journals (Sweden)

    EDI MIRMANTO

    2009-10-01

    Full Text Available Forest dynamics were studied from 1999 to 2001 for individuals > 15 cm in girth of 24 most common species in six 0.25-ha plots. The plots were set up in natural peat swamp forest in the upper catchments of Sebangau, Central Kalimantan. Aim of the study is to understand the dynamics and vegetation changes of forest studied during period of study. The peat swamp forest in the study site might be categorized as moderately forest dynamic in term of rate of growth, mortality and recruitment. Annual relative growth rate and mortality rate was comparable to previous study but recruitment rate relatively higher. There was significant effect of diameter class on annual growth rate, but not to mortality rate. Even not too strong two environment factors (peat depth and distance to river were significant correlated with rate of mortality and recruitment. During two-year period study there was no significant changes in vegetation structure.

  19. Mating system and the critical migration rate for swamping selection.

    Science.gov (United States)

    Hu, Xin-Sheng

    2011-06-01

    Crow et al. (1990) and Barton (1992) have examined the critical migration rate for swamping selection in the nuclear system. Here, I use the same methodology to examine the critical migration rate in the cytonuclear system for hermaphrodite plants with a mixed mating system. Two selection schemes for a nuclear gene (heterozygote disadvantage and directional selection) and the directional selection scheme for organelle genes are considered. Results show that under random mating, the previous results are applicable to plant species by appropriate re-parameterization of the migration rate for nuclear and paternal organelle genes. A simple complementary relationship exists between seed and pollen flow in contributing to the critical migration rate. Under the mixed mating system, the critical migration rate of seeds and pollen for nuclear and paternal organelle genes can be changed due to the effects of selection and the cytonuclear linkage disequilibrium generated by migration and inbreeding. A negative but not complementary relationship exists between seed and pollen flow in contributing to the critical migration rate, varying with the mating system. Partial selfing can also adjust the critical seed flow for the maternal organelle gene, with a small critical migration rate for species of a high selfing rate. Both concordance and discordance among cytonuclear genes can occur under certain conditions during the process of swamping selection. This theory predicts the presence of various contributions of seed versus pollen flow to genetic swamping for plants with diverse mating systems.

  20. Wastewater treatment by a natural wetland: the Nakivubo Swamp Uganda: processes and implications

    NARCIS (Netherlands)

    Kansiime, F.; Nalubega, N.

    1999-01-01

    The Nakivubo swamp is located in Uganda, near its capital Kampala, and has been receiving wastewater from Kampala for over 30 years. This swamp consists of a floating root mat co-dominated by the sedges Cyperus papyrus and Miscanthidium violaceum. Tbe partially treated wastewater mostly flows

  1. Operational restoration of the Pen Branch bottomland hardwood and swamp wetlands - the research setting

    Science.gov (United States)

    Eric A. Nelson; Neil C. Dulohery; Randall K. Kolka; William H. McKee

    2000-01-01

    The Savannah River swamp, a 3020 ha forested wetland on the floodplain of the Savannah River, USA is located on the Department of Energy's Savannah River site (SRS) near Aiken, SC. Historically, the swamp consisted of approximately 50% bald cypress-water tupelo (Taxodium distichum-Nyssa aquatica) stands, 40% mixed bottomland hardwood stands, and...

  2. Influence of Soil Type and Drainage on Growth of Swamp Chestnut Oak (Quercus Michauxii Nutt.) Seedlings

    Science.gov (United States)

    Donald D. Hook

    1969-01-01

    Swamp chestnut oak (Quercus michauxii Nutt.) seedlings were grown for 2 years in five soil types in drained and undrained pots. First-year height growth was related to soil type and pot drainage, but second-year height growth was related only to soil type. Results suggest that swamp chestnut oak is site-sensitive. But slow growth, a maximum of 2...

  3. Wastewater treatment by a natural wetland: the Nakivubo swamp, Uganda : processes and implications

    NARCIS (Netherlands)

    Kansiime, F.; Nalubega, M.

    1999-01-01

    An investigation to assess the capacity of the Nakivubo swamp, Kampala-Uganda (which has been receiving partially treated sewage from the city for more than 30 years now), to remove nutrients and pathogens was carried out. The aim of the study was to evaluate the potential of this swamp to

  4. Vegetation analyses of Sebangau peat swamp forest, Central Kalimantan

    Directory of Open Access Journals (Sweden)

    EDI MIRMANTO

    2010-04-01

    Full Text Available Mirmanto E (2010 Vegetation analyses of Sebangau peat swamp forest, Central Kalimantan. Biodiversitas 11: 82-88. The vegetation analysis study has been made in Sebangau peat-swamp forest, Central Kalimantan. Eight permanent plots of 50-m x 50-m were set-up distribute from close to the river with shallow peat-layer up to the inland with relatively deep peat-layer. Enumeration of trees (GBH > 15 cm was conducted in all of 8 plots. Overall there are 133 species (taxa were recorded within 8 plots belong to 34 families where Dipterocarpaceae, Clusiaceae, Myrtaceae and Sapotaceae were the most dominant family. Out of all species recorded, Combretocarpus rotundatus, Palaquium leiocarpum, Stemonurus scorpioides and Tristania whittiana were the most dominant species. Two community’s types namely Combretocarpus rotundatus-Shorea balangeran community and Palaquium leiocarpum-Eugenia densinervium community were recognized and they distributed in slightly different habitat condition. The sequence of these two communities’ shows significantly related to both distances to river and peat-depth. In addition there was indication the presence of habitat preference among tree species.

  5. A carbon balance model for the great dismal swamp ecosystem.

    Science.gov (United States)

    Sleeter, Rachel; Sleeter, Benjamin M; Williams, Brianna; Hogan, Dianna; Hawbaker, Todd; Zhu, Zhiliang

    2017-12-01

    Carbon storage potential has become an important consideration for land management and planning in the United States. The ability to assess ecosystem carbon balance can help land managers understand the benefits and tradeoffs between different management strategies. This paper demonstrates an application of the Land Use and Carbon Scenario Simulator (LUCAS) model developed for local-scale land management at the Great Dismal Swamp National Wildlife Refuge. We estimate the net ecosystem carbon balance by considering past ecosystem disturbances resulting from storm damage, fire, and land management actions including hydrologic inundation, vegetation clearing, and replanting. We modeled the annual ecosystem carbon stock and flow rates for the 30-year historic time period of 1985-2015, using age-structured forest growth curves and known data for disturbance events and management activities. The 30-year total net ecosystem production was estimated to be a net sink of 0.97 Tg C. When a hurricane and six historic fire events were considered in the simulation, the Great Dismal Swamp became a net source of 0.89 Tg C. The cumulative above and below-ground carbon loss estimated from the South One and Lateral West fire events totaled 1.70 Tg C, while management activities removed an additional 0.01 Tg C. The carbon loss in below-ground biomass alone totaled 1.38 Tg C, with the balance (0.31 Tg C) coming from above-ground biomass and detritus. Natural disturbances substantially impact net ecosystem carbon balance in the Great Dismal Swamp. Through alternative management actions such as re-wetting, below-ground biomass loss may have been avoided, resulting in the added carbon storage capacity of 1.38 Tg. Based on two model assumptions used to simulate the peat system, (a burn scar totaling 70 cm in depth, and the soil carbon accumulation rate of 0.36 t C/ha -1 /year -1 for Atlantic white cedar), the total soil carbon loss from the South One and Lateral West fires

  6. A carbon balance model for the great dismal swamp ecosystem

    Directory of Open Access Journals (Sweden)

    Rachel Sleeter

    2017-01-01

    Full Text Available Abstract Background Carbon storage potential has become an important consideration for land management and planning in the United States. The ability to assess ecosystem carbon balance can help land managers understand the benefits and tradeoffs between different management strategies. This paper demonstrates an application of the Land Use and Carbon Scenario Simulator (LUCAS model developed for local-scale land management at the Great Dismal Swamp National Wildlife Refuge. We estimate the net ecosystem carbon balance by considering past ecosystem disturbances resulting from storm damage, fire, and land management actions including hydrologic inundation, vegetation clearing, and replanting. Results We modeled the annual ecosystem carbon stock and flow rates for the 30-year historic time period of 1985–2015, using age-structured forest growth curves and known data for disturbance events and management activities. The 30-year total net ecosystem production was estimated to be a net sink of 0.97 Tg C. When a hurricane and six historic fire events were considered in the simulation, the Great Dismal Swamp became a net source of 0.89 Tg C. The cumulative above and below-ground carbon loss estimated from the South One and Lateral West fire events totaled 1.70 Tg C, while management activities removed an additional 0.01 Tg C. The carbon loss in below-ground biomass alone totaled 1.38 Tg C, with the balance (0.31 Tg C coming from above-ground biomass and detritus. Conclusions Natural disturbances substantially impact net ecosystem carbon balance in the Great Dismal Swamp. Through alternative management actions such as re-wetting, below-ground biomass loss may have been avoided, resulting in the added carbon storage capacity of 1.38 Tg. Based on two model assumptions used to simulate the peat system, (a burn scar totaling 70 cm in depth, and the soil carbon accumulation rate of 0.36 t C/ha−1/year−1 for Atlantic white cedar, the total

  7. A carbon balance model for the great dismal swamp ecosystem

    Science.gov (United States)

    Sleeter, Rachel; Sleeter, Benjamin M.; Williams, Brianna; Hogan, Dianna; Hawbaker, Todd J.; Zhu, Zhiliang

    2017-01-01

    BackgroundCarbon storage potential has become an important consideration for land management and planning in the United States. The ability to assess ecosystem carbon balance can help land managers understand the benefits and tradeoffs between different management strategies. This paper demonstrates an application of the Land Use and Carbon Scenario Simulator (LUCAS) model developed for local-scale land management at the Great Dismal Swamp National Wildlife Refuge. We estimate the net ecosystem carbon balance by considering past ecosystem disturbances resulting from storm damage, fire, and land management actions including hydrologic inundation, vegetation clearing, and replanting.ResultsWe modeled the annual ecosystem carbon stock and flow rates for the 30-year historic time period of 1985–2015, using age-structured forest growth curves and known data for disturbance events and management activities. The 30-year total net ecosystem production was estimated to be a net sink of 0.97 Tg C. When a hurricane and six historic fire events were considered in the simulation, the Great Dismal Swamp became a net source of 0.89 Tg C. The cumulative above and below-ground carbon loss estimated from the South One and Lateral West fire events totaled 1.70 Tg C, while management activities removed an additional 0.01 Tg C. The carbon loss in below-ground biomass alone totaled 1.38 Tg C, with the balance (0.31 Tg C) coming from above-ground biomass and detritus.ConclusionsNatural disturbances substantially impact net ecosystem carbon balance in the Great Dismal Swamp. Through alternative management actions such as re-wetting, below-ground biomass loss may have been avoided, resulting in the added carbon storage capacity of 1.38 Tg. Based on two model assumptions used to simulate the peat system, (a burn scar totaling 70 cm in depth, and the soil carbon accumulation rate of 0.36 t C/ha−1/year−1 for Atlantic white cedar), the total soil carbon loss from the

  8. THE DISTRIBUTION AND BIODIVERSITY OF FISHES IN LEBAK PAMPANGAN SWAMP SOUTH SUMATRA PROVINCE

    Directory of Open Access Journals (Sweden)

    Dina Muthmainah

    2013-12-01

    Full Text Available This research was conducted to evaluate the fish distribution and biodiversity within three types of swamp ecosystem with different water sources in Pampangan Sub-district during July to December 2011. The field observation were conducted in three different types of swamp. Ecological data and samples were collected from three sampling points in each swamp type. Parameters including local distribution, diversity index, similarity index, evenness and species richness, were analyzed. The results show a number of 9,723 fishes corresponding to 46 species were collected, the fish categorized into 16 families belonging to five orders. Eight species were found in all type of swamps i.e. Mystus nemurus, Channa striata, Cyclocheilchthys apogon, Cyclocheilichthys armatus, Pristolepis fasciata, Puntius lineatus, Osteochillus hasselti, and Trichogaster pectoralis. A diversity index of fishes in Pampangan Swamp ranged from 2.31 to 2.85, indicating moderate values. The evenness index was high more than 50%. The highest similarity was found between type 1 and type 3 of (0.43. The highest diversity index (2.85 found in type 2 of swamp indicates the swamp in more stable condition.

  9. Food Swamps Predict Obesity Rates Better Than Food Deserts in the United States.

    Science.gov (United States)

    Cooksey-Stowers, Kristen; Schwartz, Marlene B; Brownell, Kelly D

    2017-11-14

    This paper investigates the effect of food environments, characterized as food swamps, on adult obesity rates. Food swamps have been described as areas with a high-density of establishments selling high-calorie fast food and junk food, relative to healthier food options. This study examines multiple ways of categorizing food environments as food swamps and food deserts, including alternate versions of the Retail Food Environment Index. We merged food outlet, sociodemographic and obesity data from the United States Department of Agriculture (USDA) Food Environment Atlas, the American Community Survey, and a commercial street reference dataset. We employed an instrumental variables (IV) strategy to correct for the endogeneity of food environments (i.e., that individuals self-select into neighborhoods and may consider food availability in their decision). Our results suggest that the presence of a food swamp is a stronger predictor of obesity rates than the absence of full-service grocery stores. We found, even after controlling for food desert effects, food swamps have a positive, statistically significant effect on adult obesity rates. All three food swamp measures indicated the same positive association, but reflected different magnitudes of the food swamp effect on rates of adult obesity (p values ranged from 0.00 to 0.16). Our adjustment for reverse causality, using an IV approach, revealed a stronger effect of food swamps than would have been obtained by naïve ordinary least squares (OLS) estimates. The food swamp effect was stronger in counties with greater income inequality (p food outlets and incentivizing healthy food retailers to locate in underserved neighborhoods warrant consideration as strategies to increase health equity.

  10. Food Swamps Predict Obesity Rates Better Than Food Deserts in the United States

    Directory of Open Access Journals (Sweden)

    Kristen Cooksey-Stowers

    2017-11-01

    Full Text Available This paper investigates the effect of food environments, characterized as food swamps, on adult obesity rates. Food swamps have been described as areas with a high-density of establishments selling high-calorie fast food and junk food, relative to healthier food options. This study examines multiple ways of categorizing food environments as food swamps and food deserts, including alternate versions of the Retail Food Environment Index. We merged food outlet, sociodemographic and obesity data from the United States Department of Agriculture (USDA Food Environment Atlas, the American Community Survey, and a commercial street reference dataset. We employed an instrumental variables (IV strategy to correct for the endogeneity of food environments (i.e., that individuals self-select into neighborhoods and may consider food availability in their decision. Our results suggest that the presence of a food swamp is a stronger predictor of obesity rates than the absence of full-service grocery stores. We found, even after controlling for food desert effects, food swamps have a positive, statistically significant effect on adult obesity rates. All three food swamp measures indicated the same positive association, but reflected different magnitudes of the food swamp effect on rates of adult obesity (p values ranged from 0.00 to 0.16. Our adjustment for reverse causality, using an IV approach, revealed a stronger effect of food swamps than would have been obtained by naïve ordinary least squares (OLS estimates. The food swamp effect was stronger in counties with greater income inequality (p < 0.05 and where residents are less mobile (p < 0.01. Based on these findings, local government policies such as zoning laws simultaneously restricting access to unhealthy food outlets and incentivizing healthy food retailers to locate in underserved neighborhoods warrant consideration as strategies to increase health equity.

  11. Food Swamps Predict Obesity Rates Better Than Food Deserts in the United States

    Science.gov (United States)

    Cooksey-Stowers, Kristen; Schwartz, Marlene B.; Brownell, Kelly D.

    2017-01-01

    This paper investigates the effect of food environments, characterized as food swamps, on adult obesity rates. Food swamps have been described as areas with a high-density of establishments selling high-calorie fast food and junk food, relative to healthier food options. This study examines multiple ways of categorizing food environments as food swamps and food deserts, including alternate versions of the Retail Food Environment Index. We merged food outlet, sociodemographic and obesity data from the United States Department of Agriculture (USDA) Food Environment Atlas, the American Community Survey, and a commercial street reference dataset. We employed an instrumental variables (IV) strategy to correct for the endogeneity of food environments (i.e., that individuals self-select into neighborhoods and may consider food availability in their decision). Our results suggest that the presence of a food swamp is a stronger predictor of obesity rates than the absence of full-service grocery stores. We found, even after controlling for food desert effects, food swamps have a positive, statistically significant effect on adult obesity rates. All three food swamp measures indicated the same positive association, but reflected different magnitudes of the food swamp effect on rates of adult obesity (p values ranged from 0.00 to 0.16). Our adjustment for reverse causality, using an IV approach, revealed a stronger effect of food swamps than would have been obtained by naïve ordinary least squares (OLS) estimates. The food swamp effect was stronger in counties with greater income inequality (p food outlets and incentivizing healthy food retailers to locate in underserved neighborhoods warrant consideration as strategies to increase health equity. PMID:29135909

  12. SWAMP+: multiple subsequence alignment using associative massive parallelism

    Energy Technology Data Exchange (ETDEWEB)

    Steinfadt, Shannon Irene [Los Alamos National Laboratory; Baker, Johnnie W [KENT STATE UNIV.

    2010-10-18

    A new parallel algorithm SWAMP+ incorporates the Smith-Waterman sequence alignment on an associative parallel model known as ASC. It is a highly sensitive parallel approach that expands traditional pairwise sequence alignment. This is the first parallel algorithm to provide multiple non-overlapping, non-intersecting subsequence alignments with the accuracy of Smith-Waterman. The efficient algorithm provides multiple alignments similar to BLAST while creating a better workflow for the end users. The parallel portions of the code run in O(m+n) time using m processors. When m = n, the algorithmic analysis becomes O(n) with a coefficient of two, yielding a linear speedup. Implementation of the algorithm on the SIMD ClearSpeed CSX620 confirms this theoretical linear speedup with real timings.

  13. Weeds optimally grow in peat swamp after burning

    Directory of Open Access Journals (Sweden)

    P.D. Susanti

    2014-07-01

    Full Text Available After clearing land by burning the peat, then the weeds and undergrowth will flourish. Even sometimes, the weeds are eventually burned again. Weed is known as a destroyer plant that has to be controlled. Through proper treatment, the existing weeds in peatlands can be potentiallly exploited. The purpose of this study was to determine the calorific value of briquettes as one of peatland weeds utilization. The results showed that the calorific value ranged from 2,492 cal/g to 5,230 cal/g. The lowest calorific value was on ‘teki kecil’ grass (Scirpus grossus Lf, while the highest calorific value was observed for ‘bantalaki grass’ (Hymenachne amplexicaulis Nees. The high calorific value of the peat weeds are potential for biomass briquettes raw materials. The utilization and use of peat weed briquettes as a raw materials expected can reduce land degradation due to peat swamp burning

  14. Pharmacological investigation on asclepin--a new cardenolide from Asclepias curassavica. Part II. Comparative studies on the inotropic and toxic effects of asclepin, g-strophantin, digoxin and digitoxin).

    Science.gov (United States)

    Patnaik, G K; Köhler, E

    1978-01-01

    The cardiac effects of asclepin, a new glycoside from the plant Asclepias curassavica, were studies in vitro (isolated atrium and heart of guineapig) and in vivo (anaesthetized cat) and were compared with g-strophanthin, digoxin, digitoxin, or digitoxigenin, resp. Asclepin showed a marked positive inotropic effect as evidenced by the increase in the force of contraction, measured by (dp/dt)max and (formula: see text). It was found to be more active than the other glycosides.

  15. 75 FR 41879 - Great Swamp National Wildlife Refuge, Morris County, NJ

    Science.gov (United States)

    2010-07-19

    ... refuge, contact William Koch, Refuge Manager, at Great Swamp NWR, 241 Pleasant Plains Road, Basking Ridge... listed endangered Indiana bats are known to occur on the refuge. Reptile and amphibian species of...

  16. A Contribution towards a Vascular Flora of the Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This flora is an enumeration of the vascular plants growing without cultivation in the Great Dismal Swamp. It is hoped that this work will be of value to the rapidly...

  17. Final Environmental Impact Statement For The Great Dismal Swamp National Wildlife Refuge Master Plan

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Great Dismal Swamp Refuge Master Plan guides the long-range development of the Refuge by identifying and integrating appropriate habitats, management strategies,...

  18. Swainson’s Warbler And the Cowbird In The Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Swainson's Warbler, Limnothlypis swainsonii , is a fairly common breeding bird in the Dismal Swamp of Virginia and North Carolina where it is near the northern limit...

  19. A Report Concerning the Soils of a Portion of the Okefenokee Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document contains description of vegetation and organic and mineral soil of the Okefenokee Swamp. This report covers the investigations made on a tract of the...

  20. Environmental Impact Statement Master Plan Great Dismal Swamp National Wildlife Refuge 1986

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The following report describes the proposed master plan for long range management and development of Great Dismal Swamp National Wildlife Refuge and compares the...

  1. Water Control System In The Great Dismal Swamp National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Reference is made to your letter of 21 September 1977, requesting a description of the water control system in the Great Dismal Swamp National Wildlife Refuge....

  2. Developmental History and Ecology of the Dismal Swamp with Recommendations for Public Ownership and Management 1974

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The report discusses the development and history of the Dismal Swamp and proposes the designation of a Research Natural Area. Management and research needs are...

  3. Peat deposits Of Dismal Swamp Pocosins, Camdem, Currituck, Gates, Pasquotank, And Perquimans Counties, North Carolina

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Peat is present in the Dismal Swamp of northeastern North Carolina and southeastern Virginia. In North Carolina the peat is in 4 separate deposits located west,...

  4. Great Swamp National Wildlife Refuge: Annual narrative report: Calendar year 1991

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1991 calendar year. The report begins with a summary...

  5. Great Swamp National Wildlife Refuge: Annual narrative report: Calendar year 1988

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1988 calendar year. The report begins with a summary...

  6. Notes On The Amphibians And Reptiles Of The Great Dismal Swamp Of Virginia And North Carolina

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Great Dismal Swamp encompasses approximately 200,000 acres in southeastern Virginia and northeastern North Carolina. As with this paper, most of the published...

  7. Aerial Orthophotography, Interpretation and Forest Type Mapping on Great Dismal Swamp NWR.

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Sewall forest typing services for the Northern portion of Great Dismal Swamp NWR in northeastern North Carolina. This includes complete new aerial photography and...

  8. Great Swamp National Wildlife Refuge: Annual narrative report: Calendar year 1989

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1989 calendar year. The report begins with a summary...

  9. Great Dismal Swamp National Wildlife Refuge FY 1994 Prescribed Fire Proposal Plan Remnant Marsh

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This plan considers fire on Great Dismal Swamp National Wildlife Refuge as a tool for management and as a potential problem to be dealt with. This document discusses...

  10. Great Swamp National Wildlife Refuge: Annual narrative report: Calendar year 1992

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1992 calendar year. The report begins with a summary...

  11. Great Swamp National Wildlife Refuge: Annual narrative report: Calendar year 1990

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1990 calendar year. The report begins with a summary...

  12. Great Dismal Swamp National Wildlife Refuge : Annual narrative report: Calendar year 1986

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Dismal Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1986 calendar year. The report begins with a...

  13. Assessment of mercury contamination in bats at the Great Dismal Swamp National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — While bats at the Great Dismal Swamp National Wildlife Refuge (GDSNWR) have relatively low mean blood and fur Hg concentrations compared to point source...

  14. A survey of contaminants in the Great Dismal Swamp National Wildlife Refuge, Virginia

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — A contaminant survey was conducted in the Great Dismal Swamp National Wildlife Refuge to determine the extent of contamination entering the Refuge from sources near...

  15. Great Dismal Swamp National Wildlife Refuge: Annual narrative report: Calendar year 1992

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Dismal Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1992 calendar year. The report begins with a...

  16. Synopsis Of Planning Needs And Issues Great Dismal Swamp National Wildlife Refuge Master Plan January, 1982

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Great Dismal Swamp Master Plan guides the long-range development of the Refuge by identifying and integrating appropriate habitats, management strategies,...

  17. 75 FR 8107 - Bond Swamp National Wildlife Refuge, Bibb and Twiggs Counties, GA

    Science.gov (United States)

    2010-02-23

    ... for hunting, fishing, wildlife observation/photography, environmental education/interpretation... opportunities for hunting, fishing, wildlife observation, wildlife photography, and environmental education and... impact (FONSI) for the environmental assessment for Bond Swamp National Wildlife Refuge (NWR). In the...

  18. Influence Of Species, Season, And Soil On Foliar Macronutrients In The Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Leaf macronutrient variation was studied in four plant communities in the Dismal Swamp of Virginia. Soils and species composition differed markedly between sites....

  19. Great Dismal Swamp National Wildlife Refuge: Annual narrative report: Calendar year 1990

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Dismal Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1990 calendar year. The report begins with a...

  20. Great Dismal Swamp National Wildlife Refuge : Annual narrative report: Calendar year 1987

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Dismal Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1987 calendar year. The report begins with a...

  1. Annual Water Management Program Great Dismal Swamp National Wildlife Refuge 1993

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The management objectives discussed in this report are: 1) To improve and better interpret the hydrologic and vegetative databases for the Great Dismal swamp, 2) To...

  2. Great Dismal Swamp National Wildlife Refuge: Annual narrative report: Calendar year 1989

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Dismal Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1989 calendar year. The report begins with a...

  3. Annual Water Management Program Great Dismal Swamp National Wildlife Refuge 1991

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The management objectives discussed in this report are: 1) To improve and better interpret the hydrologic and vegetative databases for the Great Dismal swamp, 2) To...

  4. Public Use Plan Great Dismal Swamp National Wildlife Refuge October 1990

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The Great Dismal Swamp Refuge Master Plan guides the long-range development of the Refuge by identifying and integrating appropriate habitats, management strategies,...

  5. Great Dismal Swamp National Wildlife Refuge: Annual narrative report: Calendar year 1998

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This annual narrative report for Great Dismal Swamp National Wildlife Refuge outlines Refuge accomplishments during the 1998 calendar year. The report begins with a...

  6. A Water Budget and Water Quality Study of the Dismal Swamp Thesis Proposal

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The main objective of this project is to determine the change in water quality throughout a section of the Dismal Swamp and to calculate the water budget for the...

  7. Wastewater treatment by a natural wetland: the Nakivubo swamp, Uganda : processes and implications

    OpenAIRE

    Kansiime, F.; Nalubega, M.

    1999-01-01

    An investigation to assess the capacity of the Nakivubo swamp, Kampala-Uganda (which has been receiving partially treated sewage from the city for more than 30 years now), to remove nutrients and pathogens was carried out. The aim of the study was to evaluate the potential of this swamp to remove nutrients and pathogens from wastewater in a sustainable way, with emphasis on describing and quantifying their pathways, transformations and budgets.

    From field studies, water balan...

  8. The Ecology of Rawa Aopa, a Peat-swamp in Sulawesi, Indonesia

    OpenAIRE

    Zwahlen, Robert

    2017-01-01

    Rawa Aopa is a large swamp in South-East Sulawesi, Indonesia — the only major peat-swamp in this mainly mountainous island. Its vegetation and fauna are still quite poorly known. The existing information is summarized here. With the creation of new villages as part of Indonesia's transmigration programme, the human population in this area has increased very rapidly. Pressure on natural resources — especially soils and forests — is increasing, and primary forests are dwindling rapidly. This in...

  9. Isolation of heat-tolerant myoglobin from Asian swamp eel Monopterus albus.

    Science.gov (United States)

    Chotichayapong, Chatrachatchaya; Wiengsamut, Kittipong; Chanthai, Saksit; Sattayasai, Nison; Tamiya, Toru; Kanzawa, Nobuyuki; Tsuchiya, Takahide

    2012-10-01

    Myoglobin from Asian swamp eel Monopterus albus was purified from fish muscle using salt fractionation followed by column chromatography and molecular filtration. The purified Mb of 0.68 mg/g wet weight of muscle was determined for its molecular mass by MALDI-TOF-MS to be 15,525.18 Da. Using isoelectric focusing technique, the purified Mb showed two derivatives with pI of 6.40 and 7.12. Six peptide fragments of this protein identified by LC-MS/MS were homologous to Mbs of sea raven Hemitripterus americanus, yellowfin tuna Thunnus albacores, blue marlin Makaira nigicans, common carp Cyprinus carpio, and goldfish Carassius auratus. According to the Mb denaturation, the swamp eel Mb had thermal stability higher than walking catfish Clarias batrachus Mb and striped catfish Pangasius hypophthalmus Mb, between 30 and 60 (°)C. For the thermal stability of Mb, the swamp eel Mb showed a biphasic behavior due to the O(2) dissociation and the heme orientation disorder, with the lowest increase in both Kd(f) and Kd(s). The thermal sensitivity of swamp eel Mb was lower than those of the other Mbs for both of fast and slow reaction stages. These results suggest that the swamp eel Mb globin structure is thermally stable, which is consistent with heat-tolerant behavior of the swamp eel particularly in drought habitat.

  10. Performance measures for a Mississippi River reintroduction into the forested wetlands of Maurepas Swamp

    Science.gov (United States)

    Krauss, Ken W.; Shaffer, Gary P.; Keim, Richard F.; Chambers, Jim L.; Wood, William B.; Hartley, Stephen B.

    2017-06-09

    The use of freshwater diversions (river reintroductions) from the Mississippi River as a restoration tool to rehabilitate Louisiana coastal wetlands has been promoted widely since the first such diversion at Caernarvon became operational in the early 1990s. To date, aside from the Bonnet Carré Spillway (which is designed and operated for flood control), there are only four operational Mississippi River freshwater diversions (two gated structures and two siphons) in coastal Louisiana, and they all target salinity intrusion, shellfish management, and (or) the enhancement of the integrity of marsh habitat. River reintroductions carry small sediment loads for various design reasons, but they can be effective in delivering fresh­water to combat saltwater intrusion and increase the delivery of nutrients and suspended fine-grained sediments to receiving wetlands. River reintroductions may be an ideal restoration tool for targeting coastal swamp forest habitat; much of the area of swamp forest habitat in coastal Louisiana is undergo­ing saltwater intrusion, high rates of submergence, and lack of riverine flow leading to reduced concentrations of important nutrients and suspended sediments, which sustain growth and regeneration, help to aerate swamp soils, and remove toxic compounds from the rhizosphere.The State of Louisiana Coastal Protection and Restora­tion Authority (CPRA) has made it a priority to establish a small freshwater river diversion into a coastal swamp forest located between Baton Rouge and New Orleans, Louisiana, to reintroduce Mississippi River water to Maurepas Swamp. While a full understanding of how a coastal swamp forest will respond to new freshwater loading through a Mississippi River reintroduction is unknown, this report provides guidance based on the available literature for establishing performance measures that can be used for evaluating the effectiveness of a Mississippi River reintroduction into the forested wetlands of Maurepas Swamp

  11. Nonomuraea rhodomycinica sp. nov., isolated from peat swamp forest soil.

    Science.gov (United States)

    Sripreechasak, Paranee; Phongsopitanun, Wongsakorn; Supong, Khomsan; Pittayakhajonwut, Pattama; Kudo, Takuji; Ohkuma, Moriya; Tanasupawat, Somboon

    2017-06-01

    The taxonomic position of an actinomycete, strain NR4-ASC07T, isolated from a soil sample collected from Sirindhorn peat swamp forest, Narathiwat Province, Thailand, was clarified using a polyphasic approach. On the basis of morphological and chemotaxonomic characteristics, it was classified among the members of the genus Nonomuraea. It produced tightly closed spiral spore chains on aerial mycelium as well as forming a pseudosporangium. Whole-cell hydrolysates contained meso-diaminopimelic acid, glucose, ribose, madurose and mannose. The polar lipids were diphosphatidylglycerol, phosphatidylethanolamine, hydroxyphosphatidylethanolamine, lyso-phosphatidylethanolamine, phosphatidylinositol, phosphatidylinositol mannosides, unknown ninhydrin-positive phosphoglycolipids and unknown glycolipid. Menaquiones were MK-9(H4), MK-9(H0), MK-9(H2), MK-10(H4) and MK-9(H6). Predominant cellular fatty acids were iso-C16 : 0, C17 : 0 10-methyl, C16 : 0, C17 : 1ω8c, C16 : 0 2-OH and iso-C15 : 0. The phylogenetic tree reconstructed on the basis of 16S rRNA gene sequences showed that the strain fell within the clade containing Nonomuraea muscovyensis FMN03T, Nonomuraea roseoviolacea subsp. roseoviolaceaNBRC 14098T and Nonomuraea roseoviolacea subsp. carminataNBRC 15903T. The DNA-DNA relatedness and phenotypic data supported that strain NR4-ASC07T was clearly distinguished from the closely related species and represents a novel species of the genus Nonomuraea for which the name Nonomuraea rhodomycinica sp. nov. is proposed. The type strain is NR4-ASC07T (=NBRC 112327T=TISTR 2465T).

  12. Genetic characteristic of swamp buffalo (Bubalus bubalis) from Pampangan, South Sumatra based on blood protein profile

    Science.gov (United States)

    Windusari, Yuanita; Hanum, Laila; Wahyudi, Rizki

    2017-11-01

    Swamp buffalo (Bubalus bubalis) is an endemic species and one of the genetic wealth of South Sumatra with a distribution area in the district of Pampangan (OganIlir and OganOganIlir). Suspected inbreeding causes decreased phenotypic properties. Inbreeding among various swamp buffalo is certainly not only lower the qualities but also genotypes and phenotypes. It is of interest to determine kinship variants swamp buffaloes from Pampangan through the analysis of a blood protein profile. Blood protein profile of four variants swamps buffalo was studied by using five electrophoresis system i.e. pre-albumin (Palb), albumin (Alb), ceruloplasmin (Cp), transferrin (Tf) and transferrin post (Ptf). In this paper, it is obtained that there was no significant differences among the four variants of the buffaloes were used as a sample. Prealbumin has two alleles (Palb1 and Palb2), albumin has three alleles (Alba, AlbB, AlbC), ceruloplasmin has one allele (BPA), post-transferrin has one allele (PTFA) with an allele frequency 1.0000 at any time transferrin has two alleles (TFA and TFB) with the allele frequency of 0.7500 and 1.0000. Characteristics prealbumin (Palb), albumin (Alb), ceruloplasmin (Cp), and post-transferrin (P-tf) is monomorphic, while transferrin is polymorphic average heterozygosity values all loci (H) 0.1286. Based on average heterozygosity, the swamp buffalo (Bubalusbubalis) from Pampangan has low genetic variation and closest genetic relationship.

  13. Using a dynamic hydrology model to predict mosquito abundances in flood and swamp water.

    Science.gov (United States)

    Shaman, Jeffrey; Stieglitz, Marc; Stark, Colin; Le Blancq, Sylvie; Cane, Mark

    2002-01-01

    We modeled surface wetness at high resolution, using a dynamic hydrology model, to predict flood and swamp water mosquito abundances. Historical meteorologic data, as well as topographic, soil, and vegetation data, were used to model surface wetness and identify potential fresh and swamp water breeding habitats in two northern New Jersey watersheds. Surface wetness was positively associated with the subsequent abundance of the dominant floodwater mosquito species, Aedes vexans, and the swamp water species, Anopheles walkeri. The subsequent abundance of Culex pipiens, a species that breeds in polluted, eutrophic waters, was negatively correlated with local modeled surface wetness. These associations permit real-time monitoring and forecasting of these floodwater and nonfloodwater species at high spatial and temporal resolution. These predictions will enable public health agencies to institute control measures before the mosquitoes emerge as adults, when their role as transmitters of disease comes into play.

  14. The Effects of Corrosive Chemicals on Corrosion Rate of Steel Reinforcement Bars: I. Swamp Water

    Directory of Open Access Journals (Sweden)

    Sulistyoweni Widanarko

    2010-10-01

    Full Text Available Most of infrastructures using steel concrete to reinforce the strength of concrete. Steel concrete is so vulnerable to chemical compounds that can cause corrosion. It can happen due to the presence of chemical compounds in acid environment in low pH level. These chemical compounds are SO42-, Cl-, NO3-. There are many swamp area in Indonesia. The acid contents and the concentration of ion sulphate, chlorides, and nitrate are higher in the swamp water than in the ground water .The objective of this research was to find out the influence of corrosive chemicals in the swamp water to the steel concrete corrosion rate. There were two treatment used: (1 emerging ST 37 and ST 60 within 60 days in the 'polluted' swamp water, (2 moving the ST 37 up and down periodically in the ' polluted' swamp water. Three variation of 'polluted' swamp water were made by increasing the concentration of corrosive chemical up to 1X, 5X and 10X respectively. The corrosion rate was measured by using an Immersion Method. The result of Immersion test showed that chloride had the greatest influence to corrosion rate of ST 37 and ST 60 and followed by sulphate and Nitrate. Corrosion rate value for ST 37 is 24.29 mpy and for ST 60 is 22.76 mpy. By moving the sample up and down, the corrosion rate of ST 37 increase up to 37.59 mpy, and chloride still having the greatest influence, followed by sulphate and nitrate.

  15. Nutrition and feeding of swamp buffalo: feed resources and rumen approach

    Directory of Open Access Journals (Sweden)

    P. Rowlins

    2010-02-01

    Full Text Available Seasonal feed resources are of prime importance for swamp buffaloes to support the efficient production under the prevailing small-holder farming systems. Manipulations of rumen microorganisms, fermentation and subsequent absorption by the animals are essential. Current research work on locally available feed resources such as urea-treated rice straw, cassava hay etc. revealed significant improvement in rumen ecology with higher cellulolytic bacteria and fungal zoospores and subsequent fermentation endproducts. However, investigation of rumen microorganisms diversity of swamp buffalo and their roles in fermentation using molecular technique especially the use of PCR – DGGE/ Real Time- PCR warrant future research undertakings.

  16. Long-term disturbance dynamics and resilience of tropical peat swamp forests.

    Science.gov (United States)

    Cole, Lydia E S; Bhagwat, Shonil A; Willis, Katherine J

    2015-01-01

    1. The coastal peat swamp forests of Sarawak, Malaysian Borneo, are undergoing rapid conversion, predominantly into oil palm plantations. This wetland ecosystem is assumed to have experienced insignificant disturbance in the past, persisting under a single ecologically-stable regime. However, there is limited knowledge of the past disturbance regime, long-term functioning and fundamentally the resilience of this ecosystem to changing natural and anthropogenic perturbations through time. 2. In this study, long-term ecological data sets from three degraded peatlands in Sarawak were collected to shed light on peat swamp forest dynamics. Fossil pollen and charcoal were counted in each sedimentary sequence to reconstruct vegetation and investigate responses to past environmental disturbance, both natural and anthropogenic. 3. Results demonstrate that peat swamp forest taxa have dominated these vegetation profiles throughout the last c. 2000-year period despite the presence of various drivers of disturbance. Evidence for episodes of climatic variability, predominantly linked to ENSO events, and wildfires is present throughout. However, in the last c. 500 years, burning and indicators of human disturbance have elevated beyond past levels at these sites, concurrent with a reduction in peat swamp forest pollen. 4. Two key insights have been gained through this palaeoecological analysis: (i) peat swamp forest vegetation has demonstrated resilience to disturbance caused by burning and climatic variability in Sarawak in the late Holocene, however (ii) coincident with increased fire combined with human impact c. 500 years ago, these communities started to decline. 5.Synthesis. Sarawak's coastal peat swamps have demonstrated resilience to past natural disturbances, with forest vegetation persisting through episodes of fire and climatic variability. However, palaeoecological data presented here suggest that recent, anthropogenic disturbances are of a greater magnitude, causing

  17. Oil spill impact on the finfish of Azhiwari swamp, Joinkrama in the ...

    African Journals Online (AJOL)

    The impact of an oil spill on surface water, sediment and finfish assemblage characteristics in a freshwater swamp forest was assessed by dividing the wetland into four zones on the basis of spilled oil cover on the water surface – High Impact Zone (HIZ >60%), Medium Impact Zone (MIZ 30 – 60%), Low Impact Zone - (LIZ 5 ...

  18. Effect of gas flaring on plants in a tropical fresh water swamp forest ...

    African Journals Online (AJOL)

    An oil field in a fresh water swamp forest was visited during the wet and dry seasons to assess the impact of gas flaring on vegetation in the area. Gas flaring attracts yam beetles (Heteroligus spp.) and grasshopper (Zonocerus variegates) to the area, and these attack crops. Generally, the nearer plantain (Musa sp.) and oil ...

  19. Floristic composition and diversity of three swamp forests in northwest Guyana

    NARCIS (Netherlands)

    Andel, T.R. van

    2003-01-01

    This paper reviews the floristic composition, vegetation structure, and diversity of three types of swamp forest that cover a considerable part of Guyana’s North-West District. Trees, shrubs, lianas, herbs, and hemi-epiphytes were inventoried in three hectare plots: one in Mora forest, one in

  20. Management of Bottomland Hardwoods and Deepwater Swamps for Threatened and Endangered Species.

    Science.gov (United States)

    1999-12-01

    Zone Species II III IV V VI Acer negundo (boxelder) X X X X Acer rubrum (red maple) X X X X Alnus serrulata (common alder) X X X Amorpha...virginiana (persimmon) X X X X Euonymus americanus (strawberry bush) X X Fagus grandifolia (American beech) X X Forestiera acuminata (swamp privet) X

  1. Diversity and Antagonistic Activity of Actinomycete Strains From Myristica Swamp Soils Against Human Pathogens

    Directory of Open Access Journals (Sweden)

    Varghese Rlnoy

    2014-05-01

    Full Text Available Under the present investigation Actinomycetes were isolated from the soils of Myristica swamps of southern Western Ghats and the antagonistic activity against different human bacterial pathogens was evaluated. Results of the present study revealed that Actinomycetes population in the soils of Myristica swamp was spatially and seasonally varied. Actinomycetes load was varied from 24×104 to 71×103, from 129×103 to 40×103 and from 31×104 to 84×103 in post monsoon, monsoon and pre monsoon respectively. A total of 23 Actinomycetes strains belonging to six genera were isolated from swamp soils. Identification of the isolates showed that most of the isolates belonged to the genus Streptomyces (11, followed by Nocardia (6, Micromonospora (3, Pseudonocardia (1, Streptosporangium (1, and Nocardiopsis (1. Antagonistic studies revealed that 91.3% of Actinomycete isolates were active against one or more tested pathogens, of that 56.52% exhibited activity against Gram negative and 86.95% showed activity against Gram positive bacteria. 39.13% isolates were active against all the bacterial pathogens selected and its inhibition zone diameter was also high. 69.5% of Actinomycetes were exhibited antibacterial activity against Listeria followed by Bacillus cereus (65.21%, Staphylococcus (60.86%, Vibrio cholera (52.17%, Salmonella (52.17% and E. coli (39.13%. The results indicate that the Myristica swamp soils of Southern Western Ghats might be a remarkable reserve of Actinomycetes with potential antagonistic activity.

  2. Potential roles of fish, birds, and water in swamp privet (Forestiera acuminata) seed dispersal

    Science.gov (United States)

    Susan B. Adams; Paul B. Hamel; Kristina Connor; Bryce Burke; Emile S. Gardiner; David Wise

    2007-01-01

    Forestiera acuminata (swamp privet) is a common wetland shrub/small tree native to the southeastern United States. We examined several possible dispersal avenues for the plant. We tested germination of seeds exposed to various treatments, including passage through Ictalurus punctatus (Channel Catfi sh) guts, and conducted other...

  3. Skin disease affecting the conservation of the western swamp tortoise (Pseudemydura umbrina)

    Science.gov (United States)

    Ladyman, J M; Kuchling, G; Burford, D; Boardman, W; Raidal, S R

    1998-11-01

    To review the present position of the western swamp tortoise (Pseudemydura umbrina) as an endangered species and significant health issues affecting efforts to save it from extinction. A retrospective analysis of the husbandry, hospital and pathology records of the western swamp tortoise captive breeding program at Perth Zoo. In 1987 a captive breeding project was developed to prevent the extinction of the western swamp tortoise but an outbreak of a necrotising dermatitis in 1989 threatened the survival of the captive bred hatchlings. Less severe outbreaks occurred in 1990 and 1993, with isolated cases in between. Of 283 tortoises that were born in captivity or came into captivity from the wild, 37 (13.1%) were affected, comprising 37% of all males, 26% of all females and 13% of animals of unknown gender. Of the affected animals, 70% were less than 2 years of age and 29% were older. Males were 1.6 times more likely to be infected than females but this difference was not statistically significant (P = 0.27). Culture of the lesions consistently yielded unidentified Pseudomonas sp. Improved husbandry, such as strict maintenance of water quality and temperature conditions similar to that of the animal's natural habitat, and monitoring the health of individual tortoises have successfully controlled skin disease in the captive breeding of the western swamp tortoise.

  4. Decline of the Maurepas Swamp, Pontchartrain Basin, Louisiana, and Approaches to Restoration

    Directory of Open Access Journals (Sweden)

    Gary P. Shaffer

    2016-03-01

    Full Text Available The Maurepas swamp is the second largest contiguous coastal forest in Louisiana but it is highly degraded due to subsidence, near permanent flooding, nutrient starvation, nutria herbivory, and saltwater intrusion. Observed tree mortality rates at study sites in the Maurepas swamp are very high (up to 100% tree mortality in 11 years and basal area decreased with average salinities of <1 ppt. Habitat classification, vegetation productivity and mortality, and surface elevation changes show a clear trajectory from stagnant, nearly permanently flooded forests with broken canopy to degraded forests with sparse baldcypress and dominated by herbaceous species and open water to open water habitat for most of the Maurepas swamp without introduction of fresh water to combat saltwater intrusion and stimulate productivity and accretion. Healthy forests in the Maurepas are receiving fresh water containing nutrients and sediments from urban areas, high quality river water, or secondarily treated municipal effluent. Currently, two proposed diversions into the swamp are via Hope Canal (57 m3·s−1 and Blind River (142 m3·s−1. These diversions would greatly benefit their immediate area but they are too small to influence the entire Maurepas sub-basin, especially in terms of accretion. A large diversion (>1422 m3·s−1 is needed to deliver the adequate sediments to achieve high accretion rates and stimulate organic soil formation.

  5. Survey of economic trees in fresh water swamp of Calabar | Okon ...

    African Journals Online (AJOL)

    A survey of economic trees namely Elaeis guineensis (oil-palm) and Colocasia esculenta (taro) in fresh water swamp, Calabar was conducted. The survey area located in the vicinity of Cross River University of Technology (CRUTECH), Calabar premises covered an area of 0.5km x 0.2km was divided into five plots (A – E).

  6. Primary production in an impounded baldcypress swamp (Taxodium distichum) at the northern limit of the range

    Science.gov (United States)

    Middleton, B.A.; McKee, K.L.

    2005-01-01

    The ability of baldcypress (Taxodium distichum)swamps to maintain themselves near the northern limit of their range depends on their levels of production, which is not only are response to climate but also to local environmental factors(e.g., impoundment). We asked if primary production was reduced under impounded conditions and if species' responses to impoundment were individualistic or more generalized. To examine long-term production trends in a permanently impounded baldcypress swamp, a 6-year study of leaf litterfall was conducted in Buttonland Swamp, Illinois, which had been impounded for 10 years before the beginning of the study. Buttonland Swamp is at the northern boundary of the baldcypress swamp region along the Cache River, Illinois, in the Mississippi River Alluvial Valley of the United States. When the litter production of impounded sites was compared to those with natural hydrology in the same region, impounded sites had about half of the total litterfall of natural sites. Overall, leaf litterfall rates declined during the study(201 vs. 113 gm-2 yr-1), but the pattern was negatively correlated with water depth, which explained 97% of the variation in the data. Along the transect with the lowest mean minimum water depth(<0.5 cm), leaf litterfall decreased linearly over 6 years from 377 to 154gm-2 yr-1. Total leaf litterfall rates were lower at the other three depths(5, 43, and 49 cm mean minimum water depths)and remained below 200 gm-2 yr -1 throughout the study. Acer saccharinum, Nyssa aquatica, and Salix nigra were most responsible for the decline in total leaf litterfall. Amounts of leaf litterfall of T. distichum and Liquidambar styraciflua also generally decreased, while that of Cephalanthus occidentalis increased overtime. Because species' responses to environmental factors such as impoundment are individualistic, models should be based on the responses of individual species, rather than on communities. Our study further suggests that the

  7. Transforming Swamp Buffaloes to Producers of Milk and Meat Through Crossbreeding and Backcrossing

    Directory of Open Access Journals (Sweden)

    L C Cruz

    2009-09-01

    Full Text Available There are two major types of water buffaloes in the world, the riverine type and the swamp type. The total number of Swamp buffalo is 37.6 M and represents 21.8% of the world’s buffalo population. The swamp buffaloes have played a major role in draft animal-dependent farming system. But intensified rice production became more pronounced in irrigated areas and this has led to increased utilization of small farm machineries, displacing significantly the draft buffaloes for land tillage. To some extent, the introduction of tractors for land preparation and transport for corn, sugarcane and other crops in production areas has similar effect. Utilization of the existing population of swamp buffaloes to meet the growing domestic demand for milk and meat, against the background of increasing farm mechanization, is a good reason to transform the huge number of draft animals into producers of milk and meat. According to the UNDP/FAO-assisted project in the Philippines carried from 1982 to 1998, that crossing swamp buffalo and riverine buffaloes, despite the differences in chromosome numbers, is producing crossbreds with high growth rate potentials and milk production abilities several folds over the swamp buffalo parents. The known fact that swamp and riverine buffaloes have different chromosome number, the diploid chromosome number of the swamp buffalo is 48 and that of the river buffalo is 50. When crossbreeding between the 2 buffalo types occur, males and females of the F1 generation are heterozygous for the fusion and are apparently fertile with chromosome 2n = 49. Three-way crossbred hybrids were obtained by (native buffalo x Murrah x Nili Ravi or (native buffalo x Nili Ravi x Murrah. They had two chromosome categories viz. 2n=49 and 2n=50, respectively. Crossbreeding Swamp with Riverine Breed is done for quality beef. Most of the NT produced TenderBuff is farm-bred or purchased from other suppliers as swamp buffalo yearlings and growth out for a

  8. Logged peat swamp forest supports greater macrofungal biodiversity than large-scale oil palm plantations and smallholdings.

    Science.gov (United States)

    Shuhada, Siti Noor; Salim, Sabiha; Nobilly, Frisco; Zubaid, Akbar; Azhar, Badrul

    2017-09-01

    Intensive land expansion of commercial oil palm agricultural lands results in reducing the size of peat swamp forests, particularly in Southeast Asia. The effect of this land conversion on macrofungal biodiversity is, however, understudied. We quantified macrofungal biodiversity by identifying mushroom sporocarps throughout four different habitats; logged peat swamp forest, large-scale oil palm plantation, monoculture, and polyculture smallholdings. We recorded a total of 757 clusters of macrofungi belonging to 127 morphospecies and found that substrates for growing macrofungi were abundant in peat swamp forest; hence, morphospecies richness and macrofungal clusters were significantly greater in logged peat swamp forest than converted oil palm agriculture lands. Environmental factors that influence macrofungi in logged peat swamp forests such as air temperature, humidity, wind speed, soil pH, and soil moisture were different from those in oil palm plantations and smallholdings. We conclude that peat swamp forests are irreplaceable with respect to macrofungal biodiversity. They host much greater macrofungal biodiversity than any of the oil palm agricultural lands. It is imperative that further expansion of oil palm plantation into remaining peat swamp forests should be prohibited in palm oil producing countries. These results imply that macrofungal distribution reflects changes in microclimate between habitats and reduced macrofungal biodiversity may adversely affect decomposition in human-modified landscapes.

  9. Mapping swamp timothy (Cripsis schenoides) seed productivity using spectral values and vegetation indices in managed wetlands

    Energy Technology Data Exchange (ETDEWEB)

    Rahilly, P.J.A.; Li, D.; Guo, Q.; Zhu, J.; Ortega, R.; Quinn, N.W.T.; Harmon, T.C.

    2010-01-15

    This work examines the potential to predict the seed productivity of a key wetland plant species using spectral reflectance values and spectral vegetation indices. Specifically, the seed productivity of swamp timothy (Cripsis schenoides) was investigated in two wetland ponds, managed for waterfowl habitat, in California's San Joaquin Valley. Spectral reflectance values were obtained and associated spectral vegetation indices (SVI) calculated from two sets of high resolution aerial images (May 11, 2006 and June 9, 2006) and were compared to the collected vegetation data. Vegetation data were collected and analyzed from 156 plots for total aboveground biomass, total aboveground swamp timothy biomass, and total swamp timothy seed biomass. The SVI investigated included the Simple Ratio (SR), Normalized Difference Vegetation Index (NDVI), Soil Adjusted Vegetation Index (SAVI), Transformed Soil Adjusted Vegetation Index (TSAVI), Modified Soil Adjusted Vegetation Index (MSAVI), and Global Environment Monitoring Index (GEMI). We evaluated the correlation of the various SVI with in situ vegetation measurements for linear, quadratic, exponential and power functions. In all cases, the June image provided better predictive capacity relative to May, a result that underscores the importance of timing imagery to coincide with more favorable vegetation maturity. The north pond with the June image using SR and the exponential function (R{sup 2}=0.603) proved to be the best predictor of swamp timothy seed productivity. The June image for the south pond was less predictive, with TSAVI and the exponential function providing the best correlation (R{sup 2}=0.448). This result was attributed to insufficient vegetal cover in the south pond (or a higher percentage of bare soil) due to poor drainage conditions which resulted in a delay in swamp timothy germination. The results of this work suggest that spectral reflectance can be used to estimate seed productivity in managed seasonal

  10. Great Dismal Swamp National Wildlife Refuge FY 1994 Prescribed Fire Proposal Plan Fringe Marsh-Highway 158

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This plan considers fire on Great Dismal Swamp National Wildlife Refuge as a tool for management and as a potential problem to be dealt with. This document discusses...

  11. Effects of historical and active nursery operations on the Great Swamp National Wildlife Refuge, Morris County, New Jersey

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This report presents preliminary reconnaissance data on sediment and fish samples collected within the Great Swamp National Wildlife Refuge (GSNWR) Tract 141A - the...

  12. Dismal Swamp In Legend And History: George Washington Owned Large Tracts in Region Which He Described as a "Glorious Paradise"

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Ever since it was first explored, Dismal Swamp has remained a mystery place. Its last Indian disappeared around the 179o's, but in its depths it is almost as wild...

  13. A Compositional Study Of The Phytoplankton Of Lake Drummond And The Rivers And Canals That Drain The Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — A six-week study of the phytoplankton in Lake Drummond and the canals and river which drain the Dismal Swamp resulted in the identification of 110 species. These...

  14. [Amphibians and reptiles in the swamps dominated by the palm Raphia taedigera (Arecaceae) in northeastern Costa Rica].

    Science.gov (United States)

    Bonilla-Murillo, Fabian; Beneyto, Davinia; Sasa, Mahmood

    2013-09-01

    The herpetofauna that inhabits Caribbean Costa Rica has received considerable attention in the last two decades. This assemblage includes a total of 141 species of reptiles and 95 amphibians mostly distributed in tropical wet and moist lowland forests. While most information available came from primary and secondary forest sites, little is known about the amphibians and reptiles that inhabit more open habitats, such as wetlands and swamps. For instances, swaps dominated by the yolillo palm Raphia taedigera extend through much of the northeastern Caribbean coast of Costa Rica and eastern Nicaragua, but information about the herpetological community that uses such environments remains practically unknown. This situation reflects the little research conducted in such inhospitable environments. Here, we report the results of an intensive survey conducted to assess the herpetological community that inhabit R. taedigera palm-swamps. A total of 14 species of amphibians and 17 of reptiles have been recorded from these swamps. Amphibians and reptiles that inhabit yolillo swamps have wide distributions along much of Middle America and are considered common species throughout their range. In general, yolillo swamps are poor environments for herpetofauna: richness of reptiles and amphibians is almost two times higher in the adjacent forest than in the palm dominated swamps. Furthermore, most species observed in this swamps can be considered habitat generalists that are well adapted to the extreme conditions imposed by the changes in hydroperiods, reduce understory cover, low tree diversity and simple forest architecture of these environments. Despite similarities in the herpetofauna, it is clear that not all forest species use yolillo habitat, a characteristic that is discussed in terms of physical stress driven by the prolonged hydroperiod and reduced leaflitter in the ground, as these features drive habitat structure and herpetofaunal complexity. Our list of species using

  15. Imported Asian swamp eels (Synbranchidae: Monopterus) in North American live food markets: Potential vectors of non-native parasites

    Science.gov (United States)

    Nico, Leo G.; Sharp, Paul; Collins, Timothy M.

    2011-01-01

    Since the 1990s, possibly earlier, large numbers of Asian swamp eels (Synbranchidae: Monopterus spp.), some wild-caught, have been imported live from various countries in Asia and sold in ethnic food markets in cities throughout the USA and parts of Canada. Such markets are the likely introduction pathway of some, perhaps most, of the five known wild populations of Asian swamp eels present in the continental United States. This paper presents results of a pilot study intended to gather baseline data on the occurrence and abundance of internal macroparasites infecting swamp eels imported from Asia to North American retail food markets. These data are important in assessing the potential role that imported swamp eels may play as possible vectors of non-native parasites. Examination of the gastrointestinal tracts and associated tissues of 19 adult-sized swamp eels—identified as M. albus "Clade C"—imported from Vietnam and present in a U.S. retail food market revealed that 18 (95%) contained macroparasites. The 394 individual parasites recovered included a mix of nematodes, acanthocephalans, cestodes, digeneans, and pentastomes. The findings raise concern because of the likelihood that some parasites infecting market swamp eels imported from Asia are themselves Asian taxa, some possibly new to North America. The ecological risk is exacerbated because swamp eels sold in food markets are occasionally retained live by customers and a few reportedly released into the wild. For comparative purposes, M. albus "Clade C" swamp eels from a non-native population in Florida (USA) were also examined and most (84%) were found to be infected with internal macroparasites. The current level of analysis does not allow us to confirm whether these are non-native parasites.

  16. AN OVERVIEW OF CESIUM-137 CONTAMINATION IN A SOUTHEASTERN SWAMP ENVIRONMENT

    Energy Technology Data Exchange (ETDEWEB)

    Fledderman, P; Tim Jannik, T; Michael Paller, M

    2006-10-09

    In the early 1960s, an area of privately owned swamp adjacent to the Savannah River Site (SRS) was contaminated by site operations. Studies conducted in 1974 estimated that approximately 925 GBq of {sup 137}Cs and 37 GBq of {sup 60}Co were deposited in the swamp. Subsequently, a series of surveys was initiated to characterize the contaminated environment. These surveys--composed of 52 monitoring locations--allow for continued monitoring at a consistent set of locations. Initial survey results indicated maximum {sup 137}Cs concentrations of 19.5 Bq g{sup -1} in soil and 8.7 Bq g{sup -1} in vegetation. By the 2004-2005 surveys, maximum concentrations had declined to 1-2 Bq g{sup -1} in soil and 0.4 Bq g{sup -1} in vegetation.

  17. AN OVERVIEW OF CESIUM-137 CONTAMINATION IN A SOUTHEASTERN SWAMP ENVIRONMENT

    Energy Technology Data Exchange (ETDEWEB)

    Fledderman, P; Tim Jannik, T; Michael Paller, M

    2007-04-04

    In the early 1960s, an area of privately owned swamp adjacent to the Savannah River Site (SRS) was contaminated by site operations. Studies conducted in 1974 estimated that approximately 925 GBq of {sup 137}Cs and 37 GBq of {sup 60}Co were deposited in the swamp. Subsequently, a series of surveys was initiated to characterize the contaminated environment. These surveys--composed of 52 monitoring locations--allow for continued monitoring at a consistent set of locations. Initial survey results indicated maximum {sup 137}Cs concentrations of 19.5 Bq g{sup -1} in soil and 8.7 Bq g{sup -1} in vegetation. By the 2004-2005 surveys, maximum concentrations had declined to 1-2 Bq g{sup -1} in soil and 0.4 Bq g{sup -1} in vegetation.

  18. Microwave-assisted enhancement of milkweed (Calotropis procera L.) leaves as an eco-friendly source of natural colorants for textile.

    Science.gov (United States)

    Hussaan, Muhammad; Iqbal, Naeem; Adeel, Shahid; Azeem, Muhammad; Tariq Javed, M; Raza, Ali

    2017-02-01

    Application of natural colorants to textile fabrics has gained worldwide public acceptance due to the hazardous nature of synthetic dyes. Present study investigated the microwave's mediated extraction of natural colorants from leaves of milkweed (Calotropis procera L.) as well as their application to cotton fabrics assisted with biochemical mordants. Dye extraction from C. procera leaves was carried out in various mediums (alkali and aqueous), and the extracted dye as well as cotton fabrics was irradiated with microwaves for 2, 4, 6, 8, or 10 min. Effect of various temperature regimes and sodium chloride (NaCl) concentrations was also evaluated on the color strength of dyed cotton fabrics. The results revealed that extraction of natural colorants was enhanced when microwave radiations were applied for 4 min by using alkali as an extraction medium as compared to aqueous one. Optimum dyeing of cotton fabrics was achieved by using NaCl at a temperature of 55 °C. Among the chemical mordants, iron was effective for better color strength when used as pre- and post-mordant. Among the studied bio-mordants, extract of Acacia nilotica bark significantly improved the color strength and fastness properties as pre-mordant and Curcuma longa tuber as post-mordant. It was concluded that extract of C. procera leaves was a potential source of natural colorants and a high level of dye was obtained upon irradiation of alkali-solubilized extract for 4 min. Application of NaCl at concentration of 3 g/100 mL and temperature treatment of 55 °C significantly improved the color strength of dyed cotton fabrics.

  19. Restoration and Management of a Degraded Baldcypress Swamp and Freshwater Marsh in Coastal Louisiana

    OpenAIRE

    Rachael G. Hunter; John W. Day; Gary P. Shaffer; Robert R. Lane; Andrew J. Englande; Robert Reimers; Demetra Kandalepas; William B. Wood; Jason N. Day; Eva Hillmann

    2016-01-01

    The Central Wetlands Unit (CWU), covering 12,000 hectares in St. Bernard and Orleans Parishes, Louisiana, was once a healthy baldcypress–water tupelo swamp and fresh and low salinity marsh before construction of levees isolated the region from Mississippi River floodwaters. Construction of the Mississippi River Gulf Outlet (MRGO), which funneled saltwater inland from the Gulf of Mexico, resulted in a drastic ecosystem change and caused mortality of almost all trees and low salinity marsh, but...

  20. Aquatic organisms as amber inclusions and examples from a modern swamp forest

    OpenAIRE

    Schmidt, Alexander R.; Dilcher, David L.

    2007-01-01

    To find aquatic organisms in tree resin may seem to be highly unlikely, but the fossil record provides numerous amber-preserved limnetic arthropods (e.g., water beetles, water striders, and crustaceans) and microorganisms (e.g., bacteria, algae, ciliates, testate amoebae, and rotifers). Here we explain the frequently discussed process of embedding aquatic organisms in tree resin based on field studies in a Florida swamp forest. Different aquatic arthropods and all major groups of limnetic mic...

  1. Proteomic analysis of three gonad types of swamp eel reveals genes differentially expressed during sex reversal

    OpenAIRE

    Yue Sheng; Wei Zhao; Ying Song; Zhigang Li; Majing Luo; Quan Lei; Hanhua Cheng; Rongjia Zhou

    2015-01-01

    A variety of mechanisms are engaged in sex determination in vertebrates. The teleost fish swamp eel undergoes sex reversal naturally and is an ideal model for vertebrate sexual development. However, the importance of proteome-wide scanning for gonad reversal was not previously determined. We report a 2-D electrophoresis analysis of three gonad types of proteomes during sex reversal. MS/MS analysis revealed a group of differentially expressed proteins during ovary to ovotestis to testis transf...

  2. Latitudinal variation in carbon storage can help predict changes in swamps affected by global warming

    Science.gov (United States)

    Middleton, Beth A.; McKee, Karen

    2004-01-01

    Plants may offer our best hope of removing greenhouse gases (gases that contribute to global warming) emitted to the atmosphere from the burning of fossil fuels. At the same time, global warming could change environments so that natural plant communities will either need to shift into cooler climate zones, or become extirpated (Prasad and Iverson, 1999; Crumpacker and others, 2001; Davis and Shaw, 2001). It is impossible to know the future, but studies combining field observation of production and modeling can help us make predictions about what may happen to these wetland communities in the future. Widespread wetland types such as baldcypress (Taxodium distichum) swamps in the southeastern portion of the United States could be especially good at carbon sequestration (amount of CO2 stored by forests) from the atmosphere. They have high levels of production and sometimes store undecomposed dead plant material in wet conditions with low oxygen, thus keeping gases stored that would otherwise be released into the atmosphere (fig. 1). To study the ability of baldcypress swamps to store carbon, our project has taken two approaches. The first analysis looked at published data to develop an idea (hypothesis) of how production levels change across a temperature gradient in the baldcypress region (published data study). The second study tested this idea by comparing production levels across a latitudinal range by using swamps in similar field conditions (ongoing carbon storage study). These studies will help us make predictions about the future ability of baldcypress swamps to store carbon in soil and plant biomass, as well as the ability of these forests to shift northward with global warming.

  3. Nariva Swamp Ramsar Site, Trinidad and Tobago (West Indies) Wetland Habitat Restoration Initiative

    Science.gov (United States)

    Montserrat Carbonell; Nadra Nathai-Gyan

    2005-01-01

    Trinidad and Tobago, a twin island nation, is the most southerly of the Caribbean islands and lies just 11 km off the coast of Venezuela, near the Orinoco delta. Trinidad, the larger of the two islands, is approximately 5,000 km² and the Nariva Swamp is located on its eastern coast (fig. 1). In 1993, this site was designated as a wetland of international...

  4. Repeated drought alters resistance of seed bank regeneration in baldcypress swamps of North America

    Science.gov (United States)

    Lei, Ting; Middleton, Beth A.

    2018-01-01

    Recurring drying and wetting events are likely to increase in frequency and intensity in predicted future droughts in the central USA and alter the regeneration potential of species. We explored the resistance of seed banks to successive droughts in 53 sites across the nine locations in baldcypress swamps in the southeastern USA. Along the Mississippi River Alluvial Valley and northern Gulf of Mexico, we investigated the capacity of seed banks to retain viable seeds after successive periods of drying and wetting in a greenhouse study. Mean differences in species richness and seed density were compared to examine the interactions of successive droughts, geographical location and water regime. The results showed that both species richness and total density of germinating seedlings decreased over repeated drought trials. These responses were more pronounced in geographical areas with higher annual mean temperature. In seed banks across the southeastern swamp region, most species were exhausted after Trial 2 or 3, except for semiaquatic species in Illinois and Tennessee, and aquatic species in Texas. Distinct geographical trends in seed bank resistance to drought demonstrate that climate-induced drying of baldcypress swamps could influence the regeneration of species differently across their ranges. Despite the health of adult individuals, lack of regeneration may push ecosystems into a relict status. Seed bank depletion by germination without replenishment may be a major conservation threat in a future with recurring droughts far less severe than megadrought. Nevertheless, the protection of moist refugia might aid conservation.

  5. The Evolution of a Freshwater Wetland in a Semi-arid Environment, Loboi Swamp, Kenya

    Science.gov (United States)

    Ashley, G. M.; Driese, S. G.; Mworia, J. M.; Muasya, A. M.; Hover, V. C.; Owen, R. B.; Goman, M. F.

    2002-12-01

    Loboi Swamp is situated near the equator on the western fault-bounded margin of an asymmetric half-graben within the East African Rift valley. The freshwater wetland is ~ 3km2 and developed during mid to late Holocene on the low relief floodplain of the axial Loboi River. The swamp is groundwater-fed by several springs and seeps associated with the border fault system. Spring waters are ~35°C, with pH ~6.4-6.9 and the water compositions suggest that the sources are shallow, and dominated by meteoric water with little contributed by deep re-circulating fluids. The climate is semi-arid. P is ~700 mm/yr on the valley bottom and 1200mm/yr in the adjacent highlands; ET is estimated to be ~2500 mm/yr. Variation in precipitation occurs on a range of time scales: semi-annual monsoonal rains in Nov. and April; El Nino and La Nina periods every 5-7 years; and long term variations in climate are also likely, such as, orbitally-forced Precession cycles (~20ka). The modern swamp is dominated by Typha domingensis Pers. (~80%) and Cyperus papyrus L. (20%), a crocodile habitat. The stratigraphy revealed in a soil pit and 8 piston cores (1.5-4 m long) records the formation, evolution and maybe the beginning of the demise of the wetland. Basal sediments are floodplain (sandy silts) that fine upward to f. silt and clay and are capped with organic-rich sediment (peat). Subparallel siderite concretion horizons in the silts indicate that Fe-reducing conditions developed as the basal sediments were flooded by the developing wetland. The peat is thickest (1.5 m) in the spring-proximal area near the fault and thins to 0.30m in the spring-distal areas. The appearance and expansion of peat indicates moister climate, however preliminary pollen analyses reveals that Cyperaceae and Tpyha are less abundant now than earlier suggesting a change from moister to drier conditions after the development of the swamp. Surface and porewater compositions in the swamp are modified by processes of

  6. Food swamps and food deserts in Baltimore City, MD, USA: associations with dietary behaviours among urban adolescent girls.

    Science.gov (United States)

    Hager, Erin R; Cockerham, Alexandra; O'Reilly, Nicole; Harrington, Donna; Harding, James; Hurley, Kristen M; Black, Maureen M

    2017-10-01

    To determine whether living in a food swamp (≥4 corner stores within 0·40 km (0·25 miles) of home) or a food desert (generally, no supermarket or access to healthy foods) is associated with consumption of snacks/desserts or fruits/vegetables, and if neighbourhood-level socio-economic status (SES) confounds relationships. Cross-sectional. Assessments included diet (Youth/Adolescent FFQ, skewed dietary variables normalized) and measured height/weight (BMI-for-age percentiles/Z-scores calculated). A geographic information system geocoded home addresses and mapped food deserts/food swamps. Associations examined using multiple linear regression (MLR) models adjusting for age and BMI-for-age Z-score. Baltimore City, MD, USA. Early adolescent girls (6th/7th grade, n 634; mean age 12·1 years; 90·7 % African American; 52·4 % overweight/obese), recruited from twenty-two urban, low-income schools. Girls' consumption of fruit, vegetables and snacks/desserts: 1·2, 1·7 and 3·4 servings/d, respectively. Girls' food environment: 10·4 % food desert only, 19·1 % food swamp only, 16·1 % both food desert/swamp and 54·4 % neither food desert/swamp. Average median neighbourhood-level household income: $US 35 298. In MLR models, girls living in both food deserts/swamps consumed additional servings of snacks/desserts v. girls living in neither (β=0·13, P=0·029; 3·8 v. 3·2 servings/d). Specifically, girls living in food swamps consumed more snacks/desserts than girls who did not (β=0·16, P=0·003; 3·7 v. 3·1 servings/d), with no confounding effect of neighbourhood-level SES. No associations were identified with food deserts or consumption of fruits/vegetables. Early adolescent girls living in food swamps consumed more snacks/desserts than girls not living in food swamps. Dietary interventions should consider the built environment/food access when addressing adolescent dietary behaviours.

  7. Operational restoration of the Pen Branch bottomland hardwood and swamp wetlands - the research setting

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, E.A.

    2000-01-05

    The Savannah River Swamp is a 3020 Ha forested wetland on the floodplain of the Savannah River and is located on the Department of Energy's Savannah River Site (SRS) near Aiken, SC. Historically the swamp consisted of approximately 50 percent bald cypress-water tupelo stands, 40 percent mixed bottomland hardwood stands, and 10 percent shrub, marsh, and open water. Creek corridors were typical of Southeastern bottomland hardwood forests. The hydrology was controlled by flooding of the Savannah River and by flow from four creeks that drain into the swamp prior to flow into the Savannah River. Upstream dams have caused some alteration of the water levels and timing of flooding within the floodplain. Major impacts to the swamp hydrology occurred with the completion of the production reactors and one coal-fired powerhouse at the SRS in the early 1950's. Water was pumped from the Savannah River, through secondary heat exchangers of the reactors, and discharged into three of the tributary streams that flow into the swamp. Flow in one of the tributaries, Pen Branch, was typically 0.3 m3 s-1 (10-20) cfs prior to reactor pumping and 11.0 m3 s-1 (400 cfs) during pumping. This continued from 1954 to 1988 at various levels. The sustained increases in water volume resulted in overflow of the original stream banks and the creation of additional floodplains. Accompanying this was considerable erosion of the original stream corridor and deposition of a deep silt layer on the newly formed delta. Heated water was discharged directly into Pen Branch and water temperature in the stream often exceeded 65 degrees C. The nearly continuous flooding of the swamp, the thermal load of the water, and the heavy silting resulted in complete mortality of the original vegetation in large areas of the floodplain. In the years since pumping was reduced, early succession has begun in some affected areas. Most of this has been herbs, grasses, and shrubs. Areas that have seedlings are

  8. Research on Integrated Mapping——A Case Study of Integrated Land Use with Swamp Mapping

    Science.gov (United States)

    Zhang, S.; Yan, F.; Chang, L.

    2015-12-01

    Unified real estate registration system shows the attention, determination and effort to of CPC Central Committee and State Council on real estate registration in China. However, under current situation, China's real estate registration work made less progress. One of the reasons is that it's hard to express the property right of real estate on one map under the multi-sector management system. Under current multi-sector management system in China, different departments usually just survey and mapping the land type under its jurisdiction. For example, wetland investigation only mapping all kinds of wetland resources but not mapping other resource types. As a result, it cause he problem of coincidence or leak in integration of different results from different departments. As resources of the earth's surface, the total area of forest, grassland, wetland and so on should be equal to the total area of the earth's surface area. However, under the current system, the area of all kinds of resources is not equal to the sum of the earth's surface. Therefore, it is of great importance to express all the resources on one map. On one hand, this is conducive to find out the real area and distribution of resources and avoid the problem of coincidence or leak in integration; On the other hand, it is helpful to study the dynamic change of different resources. Therefore, we first proposed the "integrated mapping" as a solution, and take integrated land use with swamp mapping in Northeast China as an example to investigate the feasibility and difficulty. Study showed that: integrated land use with swamp mapping can be achieved through combining land use survey standards with swamps survey standards and "second mapping" program. Based on the experience of integrated land use with swamp mapping, we point out its reference function on integrated mapping and unified real estate registration system. We concluded that: (1) Comprehending and integrating different survey standard of

  9. De Novo Transcriptome Assembly of the Chinese Swamp Buffalo by RNA Sequencing and SSR Marker Discovery.

    Directory of Open Access Journals (Sweden)

    Tingxian Deng

    Full Text Available The Chinese swamp buffalo (Bubalis bubalis is vital to the lives of small farmers and has tremendous economic importance. However, a lack of genomic information has hampered research on augmenting marker assisted breeding programs in this species. Thus, a high-throughput transcriptomic sequencing of B. bubalis was conducted to generate transcriptomic sequence dataset for gene discovery and molecular marker development. Illumina paired-end sequencing generated a total of 54,109,173 raw reads. After trimming, de novo assembly was performed, which yielded 86,017 unigenes, with an average length of 972.41 bp, an N50 of 1,505 bp, and an average GC content of 49.92%. A total of 62,337 unigenes were successfully annotated. Among the annotated unigenes, 27,025 (43.35% and 23,232 (37.27% unigenes showed significant similarity to known proteins in NCBI non-redundant protein and Swiss-Prot databases (E-value < 1.0E-5, respectively. Of these annotated unigenes, 14,439 and 15,813 unigenes were assigned to the Gene Ontology (GO categories and EuKaryotic Ortholog Group (KOG cluster, respectively. In addition, a total of 14,167 unigenes were assigned to 331 Kyoto Encyclopedia of Genes and Genomes (KEGG pathways. Furthermore, 17,401 simple sequence repeats (SSRs were identified as potential molecular markers. One hundred and fifteen primer pairs were randomly selected for amplification to detect polymorphisms. The results revealed that 110 primer pairs (95.65% yielded PCR amplicons and 69 primer pairs (60.00% presented polymorphisms in 35 individual buffaloes. A phylogenetic analysis showed that the five swamp buffalo populations were clustered together, whereas two river buffalo breeds clustered separately. In the present study, the Illumina RNA-seq technology was utilized to perform transcriptome analysis and SSR marker discovery in the swamp buffalo without using a reference genome. Our findings will enrich the current SSR markers resources and help spearhead

  10. Effect of Combined Probiotics (Saccharomyces Cerevisae + Candida Utilis) and Herbs on Carcass Characteristics of Swamp Buffalo

    OpenAIRE

    Mahyuddin, P; Widiawati, Y

    2010-01-01

    A feedlot trial was conducted to study the effect of probiotics + herbs on carcass characteristics. Thirty male swamp buffaloes aged 2–2.5 years with the average body weight of 297 kg were used in this trial. They were fattened for 75 days to reach a slaughter weight of around 350–400 kg. They were divided into two groups of 15 animals in each group, and were placed in a shaded paddock. The groups were the control and the treated animals. The treated animals were given a supplementation conta...

  11. Historic simulation of net ecosystem carbon balance for the Great Dismal Swamp

    Science.gov (United States)

    Sleeter, Rachel

    2017-01-01

    Estimating ecosystem carbon (C) balance relative to natural disturbances and land management strengthens our understanding of the benefits and tradeoffs of carbon sequestration. We conducted a historic model simulation of net ecosystem C balance in the Great Dismal Swamp, VA. for the 30-year time period of 1985-2015. The historic simulation of annual carbon flux was calculated with the Land Use and Carbon Scenario Simulator (LUCAS) model. The LUCAS model utilizes a state-and-transition simulation model coupled with a carbon stock-flow accounting model to estimate net ecosystem C balance, and long term sequestration rates under various ecological conditions and management strategies. The historic model simulation uses age-structured forest growth curves for four forest species, C stock and flow rates for 8 pools and 14 fluxes, and known data for disturbance and management. The annualized results of C biomass are provided in this data release in the following categories: Growth, Heterotrophic Respiration (Rh), Net Ecosystem Production (NEP), Net Biome Production (NBP), Below-ground Biomass (BGB) Stock, Above-ground Biomass (AGB) Stock, AGB Carbon Loss from Fire, BGB Carbon Loss from Fire, Deadwood Carbon Loss from Management, and Total Carbon Loss. The table also includes the area (annually) of each forest type in hectares: Atlantic white cedar Area (hectares); Cypress-gum Area (hectares); Maple-gum Area (hectares); Pond pine Area (hectares). Net ecosystem production for the Great Dismal Swamp (~ 54,000 ha), from 1985 to 2015 was estimated to be a net sink of 0.97 Tg C. When the hurricane and six historic fire events were modeled, the Great Dismal Swamp became a net source of 0.89 Tg C. The cumulative above and belowground C loss estimated from the South One in 2008 and Lateral West fire in 2011 totaled 1.70 Tg C, while management activities removed an additional 0.01 Tg C. The C loss in below-ground biomass alone totaled 1.38 Tg C, with the balance (0.31 Tg C

  12. Automatic categorization of land-water cover types of the Green Swamp, Florida, using Skylab multispectral scanner (S-192) data

    Science.gov (United States)

    Coker, A. E.; Higer, A. L.; Rogers, R. H.; Shah, N. J.; Reed, L. E.; Walker, S.

    1975-01-01

    The techniques used and the results achieved in the successful application of Skylab Multispectral Scanner (EREP S-192) high-density digital tape data for the automatic categorizing and mapping of land-water cover types in the Green Swamp of Florida were summarized. Data was provided from Skylab pass number 10 on 13 June 1973. Significant results achieved included the automatic mapping of a nine-category and a three-category land-water cover map of the Green Swamp. The land-water cover map was used to make interpretations of a hydrologic condition in the Green Swamp. This type of use marks a significant breakthrough in the processing and utilization of EREP S-192 data.

  13. Genetic Variation of mtDNA Cytochrome Oxidase Subunit I (COI in Local Swamp Buffaloes in Indonesia

    Directory of Open Access Journals (Sweden)

    F. Saputra

    2013-12-01

    Full Text Available The objective of this research was to identify genetic variation of mitochondria DNA especially in cytochrome oxidase subunit I (COI among population of Indonesian buffaloes. Samples of swamp buffaloes were collected from Aceh (n= 3, North Sumatra (n= 3, Riau (n= 3, Banten (n= 3, Central Java (n= 3, West Nusa Tenggara (n= 3 and South Sulawesi (n= 3, and riverine buffalo from North Sumatra (n= 1 out of group for comparison. Sequence of COI was analyzed using MEGA 5.10 software with neighbor-joining method kimura 2-parameter model to reconstruct phylogeny tree. The result showed that three haplotypes for swamp buffalo and one haplotype for riverine buffalo in Indonesia resulted from 41 polymorphic sites. This finding showed that the COI gene could be considered as a marker to distinguish among swamp buffaloes in Indonesia.

  14. Residu Gula Glikokonjugat pada Lambung Depan Kerbau Rawa (Bubalus bubalis Kalimantan Selatan (SUGAR RESIDU OF GLYCOCONJUGATES IN FORESTOMACH OF SOUTH KALIMANTAN SWAMP BUFFALO (BUBALUS BUBALIS

    Directory of Open Access Journals (Sweden)

    Anni Nurliani

    2014-08-01

    Full Text Available The ability of swamp buffaloes to adapt with swamp environment was suggested to be supported bytheir digestive system efficiency. The research was done to obtain scientific explanation about digestiveefficiency of swamp buffalo by identification on kinds and distribution of glycoconjugates in swamp buffaloforestomach. Six male swamp buffaloes aged more than 2.5 year old and had body weight between 300-400kg were used in this study. Samples were obtained from Regency of Banjar slaughter house, SouthKalimantan. Every parts of the forestomach included rumen, reticulum, and omasum was taken andprocessed for microscopic observation with hematoxyline eosin (HE and alcian blue-periodic acid schiff(AB-PAS stainings. Sugar residues of glycoconjugates were localized with lectin histochemistry wheatgerm agglutinin (WGA, ulex europaeus agglutinin (UEA, ricinus communis agglutinin (RCA, concanavalinagglutinin (Con A, and soybean agglutinin (SBA. Every part of swamp buffalo forestomach had kinds ofspecific glycoconjugates with special distribution pattern which were different with other ruminant, andwere suitable for their functions in that part. The existence of D mannose/D glucose glycoconjugates thatwas dominant in forestomach estimated that had important role in supporting fermentative digestionfunction in swamp buffalo, through its function as receptor bacteria attachment. This is suggested as aspecial characteristic in digestive system of swamp buffalo which causes high digestive efficiency inswamp buffalo.

  15. Peat swamp forest types and their regeneration in Giam Siak Kecil-Bukit Batu Biosphere Reserve, Riau, East Sumatra, Indonesia

    Directory of Open Access Journals (Sweden)

    H. Gunawan

    2012-04-01

    Full Text Available Although the ecology of tropical peat swamp forests is only now becoming understood, they are already under severe threat of conversion and degradation. Based on studies of the peat swamp forest of the Giam Siak Kecil–Bukit Batu Biosphere Reserve carried out between 2009 and 2010, this paper discusses forest types and regeneration processes in terms of promoting biodiversity conservation and sustainable management of the remaining peat swamp forest. Permanent plots covering a total area of three hectares were established in natural and disturbed forest areas. Within these plots, 135 tree species belonging to 34 families were identified. Mixed peat swamp forest and bintangur forest, which have different dominant species, were identified as the main forest types. The greatest species richness was in logged-over forest, with 82 species and a density of 2,492 stems ha-1. The success of regeneration varied between typical main species in the logged-over forest and in forest disturbed by wind and fire. All of the forest stands had high densities of trees with diameters at breast height (DBH of 3–10 cm, which are a potential source of recruitment to ensure the sustained regeneration of the forest remaining in the Biosphere Reserve. Regeneration is very important for improving the condition of disturbed peat swamp forest areas in the reserve, but natural regeneration will not be sufficient to restore the forest vegetation and conserve the associated biodiversity. Some form of human-assisted accelerated regeneration will be needed, such as enrichment planting of typical canopy species that have problems with establishment. It is important for the remaining natural peat swamp forests to be conserved because of their unique forest-type formations which have distinct dominant species, floristic composition, diversity and local environment characteristics. Improved management of secondary forest must be achieved through rehabilitation, halted forest

  16. Aquatic organisms as amber inclusions and examples from a modern swamp forest

    Science.gov (United States)

    Schmidt, Alexander R.; Dilcher, David L.

    2007-01-01

    To find aquatic organisms in tree resin may seem to be highly unlikely, but the fossil record provides numerous amber-preserved limnetic arthropods (e.g., water beetles, water striders, and crustaceans) and microorganisms (e.g., bacteria, algae, ciliates, testate amoebae, and rotifers). Here we explain the frequently discussed process of embedding aquatic organisms in tree resin based on field studies in a Florida swamp forest. Different aquatic arthropods and all major groups of limnetic microorganisms were found embedded in resin that had contact with swamp water. The taphonomy of aquatic organisms differs from that of terrestrial plants and animals that get stuck on resin surfaces and are enclosed by successive resin outflows. Large and highly motile arthropods are predestined for embedding. The number of microbial inclusions is increased when tiny drops of water with aquatic organisms become enclosed in resin while it is flowing in an aquatic environment. Bacteria and fungi may grow inside the resin as long as it has not solidified and therefore become secondarily accumulated. In contact with air, even resin that had initially been flowing into water may solidify and potentially form amber. PMID:17940051

  17. Pharmacokinetics of amoxicillin trihydrate in Thai swamp buffaloes (Bubalus bubalis): a pilot study.

    Science.gov (United States)

    Ruennarong, N; Wongpanit, K; Sakulthaew, C; Giorgi, M; Klangkaew, N; Poapolathep, A; Poapolathep, S

    2017-04-01

    This study aimed to investigate the pharmacokinetic characteristics of amoxicillin (AMX) in Thai swamp buffaloes, Bubalus bubalis, following single intramuscular administration at two dosages of 10 and 20 mg/kg body weight (b.w.). Blood samples were collected at assigned times up to 48 h. The plasma concentrations of AMX were measured by liquid chromatography-tandem mass spectrometry (LC-MS/MS). The concentrations of AMX in the plasma were determined up to 24 h after i.m. administration at both dosages. The Cmax values of AMX were 3.39 ± 0.18 μg/mL and 6.16 ± 0.18 μg/mL at doses of 10 and 20 mg/kg, respectively. The AUClast values increased in a dose-dependent fashion. The half-life values were 5.56 ± 0.40 h and 4.37 ± 0.23 h at doses of 10 and 20 mg/kg b.w, respectively. Based on the pharmacokinetic data and PK-PD index (T > MIC), i.m. administration of AMX at a dose of 20 mg/kg b.w might be appropriate for the treatment of susceptible Mannheimia haemolytica infection in Thai swamp buffaloes. © 2016 John Wiley & Sons Ltd.

  18. Food swamps by area socioeconomic deprivation in New Zealand: a national study.

    Science.gov (United States)

    Sushil, Zaynel; Vandevijvere, Stefanie; Exeter, Daniel J; Swinburn, Boyd

    2017-11-01

    A nationwide spatial analysis of community retail food environments in relation to area socioeconomic deprivation was conducted in New Zealand. Addresses from about 20,000 registered food outlets were retrieved from all 66 Councils. Outlets were classified, geocoded and (spatially) validated. The analysis included 4087 convenience, 4316 fast food/takeaway and 1271 supermarket and fruit/vegetable outlets and excluded outlets not considered 'healthy' or 'unhealthy'. The population-weighted density of different outlet types in Census areas and the proximity to different outlet types from Meshblock centres were calculated and associations with area socioeconomic deprivation assessed. Spatial scan statistics was used to identify food swamp areas with a significantly higher relative density of unhealthy outlets than other areas. A significantly positive association was observed between area deprivation and density of all retailers. A significantly negative association was observed between area deprivation and proximity to all retailers. Nationwide, 722 Census areas were identified as food swamps. Access to food retailers is significantly higher in more deprived areas than in less deprived areas. Restricting unhealthy outlets in areas with a high relative density of those outlets is recommended.

  19. STRUCTURE OF NATURAL REGENERATION IN RELATION TO SOIL PROPERTIES AND DISTURBANCE IN TWO SWAMP FORESTS

    Directory of Open Access Journals (Sweden)

    Marly Antonielle Ávila

    2016-03-01

    Full Text Available Veredas (palm swamps is a type of vegetation associated with watercourses, characterized by the presence of Mauritia flexuosa palm trees. These systems are not well understood and suffer from high anthropogenic pressure. The aims of this study were to describe the natural regeneration of two swamp forests in vereda systems with different anthropogenic impacts and investigate if the variation in these plant communities are associated to edaphic conditions. The study was performed in preserved and impacted sites located in the Environmental Protection Area of the Pandeiros River in northern Minas Gerais. At each site, one hundred 25 m2 plots were established for surveying regenerating shrubs and trees (≥1 cm diameter at the base of the stem and < 3 cm diameter at breast height. Vegetation structure was evaluated by phytosociological parameters, similarity index, and size distribution of individuals. Regenerating strata was correlated with chemical and physical soil analyses. The vegetation at the preserved site was characterized by a higher number of individuals and a lower diversity but contained species that were typical of flooded areas. The results also showed differences in soil nutrient availability between sites that influenced the distribution of species at the two study sites.

  20. Effects of Lasia spinosa Thw. on growth rate and reproductive hormone of weaned Swamp buffalo and Murrah X Swamp buffalo calves

    Directory of Open Access Journals (Sweden)

    M. Kamonpatana

    2010-02-01

    Full Text Available The effects of Lasia spinosa Thw. on growth rate and plasma Oestradiol 17- β (E2, Progesterone (P4 and Testosterone (T were studied in 16 male and female swamp (SS buffaloes and Murrah x Swamp buffalo crossbreeds (MS calves. The treatment group was fed with a concentrate supplemented with 30 g of dry powder of L. spinosa/head/d for 7 months. It was found that L .spinosa could have effect on male and female buffalo growth rate. The growth rate of male SS treated group were 130 g/d higher than control group. In female both SS and MS buffalo, the highest growth rate (830 to 840 g/d was found after the 2nd month of treatment while a reduction in growth rate (-1,030 to - 450 g/d was found in the 3rd month. After that the growth rate of SS and MS gradually increased until the last three months to 200 and 80 g/d in average, respectively. In female MS, plasma E2 in the treated group was lower than control group during Jan to Jul. Similar result was found in SS female, level of plasma E2 in treated group was lower than in control group in the first and last three month and there was no difference of plasma E2 in May. In MS male, the level of plasma E2 of treated group was higher than control group in Jan, Mar, Apr and Jul. In SS male, the level of plasma E2 of treated group was higher than control group in every month except in Jul. In female SS, L. spinosa could decreased plasma P4 through the experiment and could not have an effect on plasma P4 in female MS and plasma T in male buffalo calves. In conclusion, the addition to the concentrate of dry powder of L. spinosa 30 g/headl/d had an effect to increase growth rate in male SS and female MS buffalo calves, decrease plasma E2 in female both SS and MS and male SS and decrease plasma P4 in female SS.

  1. First record of epizootic ulcerative syndrome from the Upper Congo catchment: An outbreak in the Bangweulu swamps, Zambia.

    Science.gov (United States)

    Huchzermeyer, C F; Huchzermeyer, K D A; Christison, K W; Macey, B M; Colly, P A; Hang'ombe, B M; Songe, M M

    2018-01-01

    We report on the first outbreak of epizootic ulcerative syndrome (EUS) amongst wild fish populations in the Bangweulu swamps, an inland delta, in the north of Zambia during 2014. The area supports a large and diverse fish fauna related to, but distinct from, that of the Zambezi River system where EUS outbreaks have occurred since 2006. A sizeable artisanal fishery, based on extensive fish weirs, is sustained by the annual flooding of the swamps, and observations of the disease outbreak by fishermen were recorded. Signs typical of infection with Aphanomyces invadans were observed in a number of species. Clinical observations, histology and molecular diagnostic methods were used to confirm infection with A. invadans in two of the most commonly and severely affected species. Several features of the wetland may have contributed to the outbreak and the annual recurrence of the disease. Modes by which the disease may have been introduced into the swamps are discussed. The outbreak is of great significance as the Bangweulu swamps drain into the Congo River in neighbouring Democratic Republic of Congo, Africa's largest drainage system with an extensive and diverse fish fauna previously unaffected by EUS. © 2017 John Wiley & Sons Ltd.

  2. On a new species of blackwater prawn, Macrobrachium oxyphilus (Crustacea: Decapoda: Caridea: Palaemonidae), from peat swamps in Peninsular Malaysia

    NARCIS (Netherlands)

    Ng, P.K.L.

    1992-01-01

    A new species of freshwater palaemonid prawn, Macrobrachium oxyphilus spec, nov., is described from highly acidic blackwaters in a peat swamp forest in Selangor, Peninsular Malaysia. The species differs from its nearest congener, M. trompii (de Man, 1898), in having proportionately smaller eyes,

  3. Variation in flood tolerance of container-grown seedlings of swamp white oak, bur oak, and white oak

    Science.gov (United States)

    Michael P. Walsh; J.W. Van Sambeek; Mark V. Coggeshall

    2008-01-01

    How much variation in flood tolerance exists among seedlings within oak species, given the flood frequency of sites from which acorns are collected, has been largely unexplored. Our studies examined initial growth and flood tolerance for seedlings of swamp white oak (Quercus bicolor Willd.), bur oak (Q. macrocarpa L.), and white...

  4. Ecological studies on a population of the water snake Grayia smythii in a rainforest swamp of the Niger Delta, Nigeria

    NARCIS (Netherlands)

    Akani, Godfrey C.; Luiselli, Luca

    2001-01-01

    The ecology of the water snake, Grayia smythii (Reptilia: Colubridae) occurring in a seasonal rainforest swamp of the Niger Delta (southern Nigeria) was investigated between December 1998 and March 2000. Females and males were similar in body sizes (SVL) and head sizes, but males had tails

  5. Satellite radar observation of tropical peat swamp forest as a tool for hydrological modelling and environmental protection

    NARCIS (Netherlands)

    Hoekman, D.H.

    2007-01-01

    1. Tropical peat swamp forests may contain as much as 20% of the global soil carbon stock. They are threatened by large-scale deforestation and canal drainage. Oxidation and forest fire cause enormous carbon emissions. Most remaining areas are located in Indonesia. These are becoming increasingly

  6. Soil warming alters seed-bank responses across the geographic range of freshwater Taxodium distichum (Cupressaceae) swamps

    Science.gov (United States)

    Middleton, Beth A.; McKee, Karen L.

    2011-01-01

    Premise of the Study: Climate warming is predicted to have far-reaching effects on the distribution of species, but those effects may depend on the flexibility of regenerating species in responding to climate gradients. We conducted a study to determine whether the variation in the response of seed banks to temperature varied across the latitudinal range of Taxodium distichum swamps in North America.

  7. [Distribution, surface and protected area of palm-swamps in Costa Rica and Nicaragua].

    Science.gov (United States)

    Serrano-Sandí, Juan; Bonilla-Murillo, Fabian; Sasa, Mahmood

    2013-09-01

    In Central America, palm swamps are known collectively as yolillales. These wetlands are usually dominated by the raffia palm Raphia taedigera, but also by the royal palm Manicaria saccifera and -in lower extensions- by the American oil palm Elaeis oleifera. The yolillales tend to be poor in woody species and are characteristic of regions with high rainfall and extensive hydroperiods, so they remain flooded most of the year. The dominance of large raffia palm leaves in the canopy, allow these environments to be distinguishable in aerial photographs, which consequently has helped to map them along most of their distribution. However, while maps depicting yolillales are available, the extent of their surface area, perimeter and connectivity remains poorly understood. This is particularly true for yolillales in Costa Rica and Nicaragua, countries that share a good proportion of palm dominated swaps in the Rio San Juan Basin. In addition, it is not known the actual area of these environments that is under any category of protection according to the conservation systems of both countries. As a first step to catalog yolillal wetlands in Costa Rica and Nicaragua, this paper evaluates cartographic maps to delineate yolillales in the region. A subsample of yolillales mapped in this study were visited and we geo-referenced them and evaluate the extent and condition of the swamp. A total of 110 883.2ha are classified as yolillales in Nicaragua, equivalent to 22% of wetland surface area recorded for that country (excluding the Cocibolca and Xolothn Lakes). In Costa Rica, 53 931.3ha are covered by these palm dominated swamps, which represent 16.24% of the total surface area covered by wetlands. About 47% of the area covered by yolillales in Nicaragua is under some category of protection, the largest extensions protected by Cerro Silva, Laguna Tale Sulumas and Indio Maiz Nature Reserves. In Costa Rica, 55.5% of the area covered by yolillal is located within protected areas

  8. Use of a 15N tracer to determine linkages between a mangrove and an upland freshwater swamp

    Science.gov (United States)

    MacKenzie, R. A.; Cormier, N.

    2005-05-01

    Mangrove forests and adjacent upland freshwater swamps are important components of subsistence-based economies of Pacific islands. Mangroves provide valuable firewood (Rhizophora apiculata) and mangrove crabs (Scylla serrata); intact freshwater swamps are often used for agroforestry (e.g., taro cultivation). While these two systems are connected hydrologically via groundwater and surface flows, little information is available on how they may be biogeochemically or ecologically linked. For example, mangrove leaf litter was once thought to be an important food source for resident and transient nekton and invertebrates, but this value may have been overestimated. Instead, nutrients or allochthonous material (e.g., phytoplankton, detritus) delivered via groundwater or surface water from upland freshwater swamps may play a larger role in mangrove food webs. Understanding the linkages between these two ecologically and culturally important ecosystems will help us to understand the potential impacts of hydrological alterations that occur when roads or bridges are constructed through them. We conducted a 15N tracer study in the Yela watershed on the island of Kosrae, Federated States of Micronesia. K15NO3 was continually added at trace levels for 4 weeks to the Yela River in an upland freshwater swamp adjacent to a mangrove forest. Nitrate and ammonium pools, major primary producers, macroinvertebrates, and fish were sampled from stations 5 m upstream (freshwater swamp) and 138, 188, 213, and 313 m downstream (mangrove) from the tracer addition. Samples were collected once a week prior to, during, and after the 15N addition for a total of 6 weeks. Preliminary results revealed no significant enrichment (mudskipper fish (Periophthalmus sp.). However, the 15N signature of ammonium pools was enriched 10-60 ‰ by the end of the third week. These results suggest that the tracer was present in the mangrove but was either unavailable to higher organisms or was incorporated into

  9. Effect of supplementary lighting on eating behaviour by corralled swamp buffalo (Bubalus bubalis heifers in Thailand

    Directory of Open Access Journals (Sweden)

    Chanvit Vajrabukka

    2007-03-01

    Full Text Available Sixteen 14-month-old swamp buffalo (Bubalus bubalis heifers were used to study the effect of supplementary lighting on eating time, number of meals and meal duration and growth performance. Eightheifers were allocated to a natural photoperiod regime, receiving approximately 12 h of daylight, (control treatment and eight heifers were allocated to a supplementary lighting regime, receiving an additional 6 h of artificial light during the night, (light supplemented treatment using a cross-over design. Rice straw wasoffered ad libitum and commercial concentrate was also offered approximately 1.5 kg/animal/day. Supplementary lighting was provided by eight 60 W white fluorescent tubes placed approximately 2.5 m above theground under the roof. Supplementary lighting did not significantly effect eating behaviour, daily intake or live weight gain. It is concluded that the performance of corralled buffalo heifers cannot be improved by the provision of supplementary lighting.

  10. Proteomic analysis of three gonad types of swamp eel reveals genes differentially expressed during sex reversal.

    Science.gov (United States)

    Sheng, Yue; Zhao, Wei; Song, Ying; Li, Zhigang; Luo, Majing; Lei, Quan; Cheng, Hanhua; Zhou, Rongjia

    2015-05-18

    A variety of mechanisms are engaged in sex determination in vertebrates. The teleost fish swamp eel undergoes sex reversal naturally and is an ideal model for vertebrate sexual development. However, the importance of proteome-wide scanning for gonad reversal was not previously determined. We report a 2-D electrophoresis analysis of three gonad types of proteomes during sex reversal. MS/MS analysis revealed a group of differentially expressed proteins during ovary to ovotestis to testis transformation. Cbx3 is up-regulated during gonad reversal and is likely to have a role in spermatogenesis. Rab37 is down-regulated during the reversal and is mainly associated with oogenesis. Both Cbx3 and Rab37 are linked up in a protein network. These datasets in gonadal proteomes provide a new resource for further studies in gonadal development.

  11. Clonal growth strategy, diversity and structure: A spatiotemporal response to sedimentation in tropical Cyperus papyrus swamps.

    Science.gov (United States)

    Geremew, Addisie; Stiers, Iris; Sierens, Tim; Kefalew, Alemayehu; Triest, Ludwig

    2018-01-01

    Land degradation and soil erosion in the upper catchments of tropical lakes fringed by papyrus vegetation can result in a sediment load gradient from land to lakeward. Understanding the dynamics of clonal modules (ramets and genets) and growth strategies of plants on such a gradient in both space and time is critical for exploring a species adaptation and processes regulating population structure and differentiation. We assessed the spatial and temporal dynamics in clonal growth, diversity, and structure of an emergent macrophyte, Cyperus papyrus (papyrus), in response to two contrasting sedimentation regimes by combining morphological traits and genotype data using 20 microsatellite markers. A total of 636 ramets from six permanent plots (18 x 30 m) in three Ethiopian papyrus swamps, each with discrete sedimentation regimes (high vs. low) were sampled for two years. We found that ramets under the high sedimentation regime (HSR) were significantly clumped and denser than the sparse and spreading ramets under the low sedimentation regime (LSR). The HSR resulted in significantly different ramets with short culm height and girth diameter as compared to the LSR. These results indicated that C. papyrus ameliorates the effect of sedimentation by shifting clonal growth strategy from guerrilla (in LSR) to phalanx (in HSR). Clonal richness, size, dominance, and clonal subrange differed significantly between sediment regimes and studied time periods. Each swamp under HSR revealed a significantly high clonal richness (R = 0.80) as compared to the LSR (R = 0.48). Such discrepancy in clonal richness reflected the occurrence of initial and repeated seedling recruitment strategies as a response to different sedimentation regimes. Overall, our spatial and short-term temporal observations highlighted that HSR enhances clonal richness and decreases clonal subrange owing to repeated seedling recruitment and genets turnover.

  12. Population density of red langurs in Sabangau tropical peat-swamp forest, Central Kalimantan, Indonesia.

    Science.gov (United States)

    Ehlers Smith, David A; Ehlers Smith, Yvette C

    2013-08-01

    Because of the large-scale destruction of Borneo's rainforests on mineral soils, tropical peat-swamp forests (TPSFs) are increasingly essential for conserving remnant biodiversity, particularly in the lowlands where the majority of habitat conversion has occurred. Consequently, effective strategies for biodiversity conservation are required, which rely on accurate population density and distribution estimates as a baseline. We sought to establish the first population density estimates of the endemic red langur (Presbytis rubicunda) in Sabangau TPSF, the largest remaining contiguous lowland forest-block on Borneo. Using Distance sampling principles, we conducted line transect surveys in two of Sabangau's three principle habitat sub-classes and calculated group density at 2.52 groups km⁻² (95% CI 1.56-4.08) in the mixed-swamp forest sub-class. Based on an average recorded group size of 6.95 individuals, population density was 17.51 ind km⁻², the second highest density recorded in this species. The accessible area of the tall-interior forest, however, was too disturbed to yield density estimates representative of the entire sub-class, and P. rubicunda was absent from the low-pole forest, likely as a result of the low availability of the species' preferred foods. This absence in 30% of Sabangau's total area indicates the importance of in situ population surveys at the habitat-specific level for accurately informing conservation strategies. We highlight the conservation value of TPSFs for P. rubicunda given the high population density and large areas remaining, and recommend 1) quantifying the response of P. rubicunda to the logging and burning of its habitats; 2) surveying degraded TPSFs for viable populations, and 3) effectively delineating TPSF sub-class boundaries from remote imagery to facilitate population estimates across the wider peat landscape, given the stark contrast in densities found across the habitat sub-classes of Sabangau. © 2013 Wiley

  13. Effect of day or night grazing on behaviour of swamp buffalo heifers

    Directory of Open Access Journals (Sweden)

    Somparn, P.

    2007-03-01

    Full Text Available An experiment was conducted to examine the effect of day or night grazing on behaviour by swamp buffaloes. A grazing trial was conducted over 42 days in the late rainy season, during September to November2005 at Surin Livestock Research and Breeding Center, Surin province. The experimental period was divided into two 21-day periods. Twelve 2-year-old swamp buffalo heifers were allocated to four groups, eachcontaining three heifers, with the mean group weights being as similar as possible. Each group was allowed to graze either from 06:20 to 18:00 h (daytime treatment or from 18:20 to 06:00 h (nighttime treatment infour separate paddocks, each of 5 rai, using a cross-over design. When not at pasture the animals in each group were kept in the common corral with free access to fresh drinking water and mineral blocks. Individualanimal activity was recorded by visual observation at 1-min intervals during the period at pasture. Individual groups within each period were treated as replicates. Differences between group means weretested using MIXED procedure of SAS.The buffaloes on daytime treatment spent longer (P<0.05 grazing than those on nighttime treatment (423 vs 332 min. The number of meals differed (P<0.05 between treatments, but overall mean meal durationswere similar (73 min. Buffaloes allowed to graze during daylight had a tendency (P<0.10 toward a higher bite and step rates than those grazing during the night. With the reduction in grazing activity duringthe night on nighttime treatment, the animals ruminated for longer during the period at pasture (327 and 191 min, P<0.001. Live-weight change over periods of 20 days did not differ significantly. The difference intemporal behaviour patterns between treatments indicated that animals have to adapt foraging strategies appropriate for different situations in order to maintain feed intake and subsequently production.

  14. Clonal growth strategy, diversity and structure: A spatiotemporal response to sedimentation in tropical Cyperus papyrus swamps.

    Directory of Open Access Journals (Sweden)

    Addisie Geremew

    Full Text Available Land degradation and soil erosion in the upper catchments of tropical lakes fringed by papyrus vegetation can result in a sediment load gradient from land to lakeward. Understanding the dynamics of clonal modules (ramets and genets and growth strategies of plants on such a gradient in both space and time is critical for exploring a species adaptation and processes regulating population structure and differentiation. We assessed the spatial and temporal dynamics in clonal growth, diversity, and structure of an emergent macrophyte, Cyperus papyrus (papyrus, in response to two contrasting sedimentation regimes by combining morphological traits and genotype data using 20 microsatellite markers. A total of 636 ramets from six permanent plots (18 x 30 m in three Ethiopian papyrus swamps, each with discrete sedimentation regimes (high vs. low were sampled for two years. We found that ramets under the high sedimentation regime (HSR were significantly clumped and denser than the sparse and spreading ramets under the low sedimentation regime (LSR. The HSR resulted in significantly different ramets with short culm height and girth diameter as compared to the LSR. These results indicated that C. papyrus ameliorates the effect of sedimentation by shifting clonal growth strategy from guerrilla (in LSR to phalanx (in HSR. Clonal richness, size, dominance, and clonal subrange differed significantly between sediment regimes and studied time periods. Each swamp under HSR revealed a significantly high clonal richness (R = 0.80 as compared to the LSR (R = 0.48. Such discrepancy in clonal richness reflected the occurrence of initial and repeated seedling recruitment strategies as a response to different sedimentation regimes. Overall, our spatial and short-term temporal observations highlighted that HSR enhances clonal richness and decreases clonal subrange owing to repeated seedling recruitment and genets turnover.

  15. Hydrologic remediation for the Deepwater Horizon incident drove ancillary primary production increase in coastal swamps

    Science.gov (United States)

    Middleton, Beth A.; Johnson, Darren; Roberts, Brian J

    2015-01-01

    As coastal wetlands subside worldwide, there is an urgency to understand the hydrologic drivers and dynamics of plant production and peat accretion. One incidental test of the effects of high rates of discharge on forested wetland production occurred in response to the 2010 Deepwater Horizon incident, in which all diversions in Louisiana were operated at or near their maximum discharge level for an extended period to keep offshore oil from threatened coastal wetlands. Davis Pond Diversion was operated at six times the normal discharge levels for almost 4 months, so that Taxodium distichum swamps downstream of the diversion experienced greater inundation and lower salinity. After this remediation event in 2010, above-ground litter production increased by 2.7 times of production levels in 2007–2011. Biomass of the leaf and reproductive tissues of several species increased; wood litter was minimal and did not change during this period. Root production decreased in 2010 but subsequently returned to pre-remediation values in 2011. Both litter and root production remained high in the second growing season after hydrologic remediation. Annual tree growth (circumference increment) was not significantly altered by the remediation. The potential of freshwater pulses for regulating tidal swamp production is further supported by observations of higher T. distichum growth in lower salinity and/or pulsed environments across the U.S. Gulf Coast. Usage of freshwater pulses to manage altered estuaries deserves further consideration, particularly because the timing and duration of such pulses could influence both primary production and peat accretion.

  16. Damage suffered by swamp morning glory (Ipomoea aquatica Forsk) exposed to vanadium (V).

    Science.gov (United States)

    Chen, Ting; Li, Ting-Qiang; Yang, Jin-Yan

    2016-03-01

    To elucidate the physiological and morphological responses generated by vanadium (V) in plants, hydroponic culture experiments were performed with swamp morning glory (Ipomoea aquatica Forsk) exposed to 0 mg L(-1) to 2.50 mg L(-1) pentavalent V [V(V)] in Hoagland nutrient solutions. The concentration of chlorophyll a, chlorophyll b, and carotene peaked at a V(V) concentration of 0.05 mg L(-1) and gradually decreased at higher V(V) concentrations. Similarly, the plant biomass was stimulated at low levels of V(V) and was inhibited when V(V) concentrations exceeded 0.1 mg L(-1). Pentavalent V had negative effects on the uptake of phosphorus (P) by roots, shoots, and leaves. The biological absorption coefficients of V of the roots were higher than those of the aerial parts. Under low concentrations of V(V) exposure, the predominant species of V in the aerial parts was tetravalent V [V(IV)], whereas V(V) became more prevalent when concentrations of V(V) in the solution was higher than 0.50 mg L(-1). In the roots, however, the concentrations of V(V) were always higher than those of the V(IV), except in the control group. Organelles in the V(V)-treated leaves were distorted, and the periplasmic space became wider. These results indicate V(V) has concentration-dependent effects on the physiological properties of swamp morning glory, whereas the plant has the ability to develop self-protective function to adapt to the toxicity of V(V). © 2015 SETAC.

  17. The inorganic chemistry of peat from the Maunachira channel-swamp system, Okavango Delta, Botswana

    Energy Technology Data Exchange (ETDEWEB)

    McCarthy, T.S.; McIver, J.R.; Cairncross, B.; Ellery, W.N.; Ellery, K.

    1989-05-01

    The Okavango Delta is a large (18000 km/sup 2/), low gradient (1:3600), alluvial fan situated in the semi-arid Kalahari basin of northern Botswana. Seasonal floodwaters from tropical Angola disperse on the fan creating both perennial (6000 km/sup 2/) and seasonal (7000 to 12000 km/sup 2/) swamps. Ninety-five percent of this water is lost annually by evapotranspiration. Organic rich sediment (peat) is a major sediment of the perennial swamps. Peat formation commences during senescence of the plants, when certain nutrients are recycled while others are lost by rainwater leaching. Further changes in chemistry occur during subaqueous decay of the plants which involve both gains and losses of constituents. Decaying plants trap detrital mineral matter which becomes an integral part of the peat. The main sources and forms of inorganic matter in the peat are: allochthonous kaolinite (40%) and quartz (20%) and both allochthonous and autochthonous phytolithic silica (30%). several inorganic components (Fe, K, P, Na, Ca and Mg) which make up the remaining 10% are associated with the organic fraction. Ion exchange plays only a minor part in their uptake and it seems that these metals are taken up during bacterial activity in the peat. The weight proportion of inorganic matter (ash) decreases downstream, mainly due to a decrease in allochthonous mineral matter. Volume percentage also decreases but is low throughout, generally less than five percent. This study has revealed that the low-quantity allochthonous mineral matter is the main reason for the long-term survival of this ecosystem. Uptake of soluble ions by the peat is important in off-setting evaporative concentration of metals. 36 refs., 13 figs., 7 tabs.

  18. Ground survey of red lechwe in the Linyanti swamps and Chobe floodplains, northern Botswana

    Directory of Open Access Journals (Sweden)

    Phemelo Gadimang

    2017-05-01

    Full Text Available A ground survey of red lechwe was carried out in the Linyanti swamps and the Chobe floodplains of northern Botswana in the dry and wet seasons of 2012 and 2013, respectively. We documented numbers, sex ratio and age structure of red lechwe within the linear strips of 25 km × 300 m along the Linyanti swamps and the Chobe floodplains. Results indicated a significant difference in the numbers of red lechwe between sites and seasons. About 66 and 755 red lechwe were estimated for Chobe in the dry and wet season, respectively, with 343 and 261 of them estimated for Linyanti in the dry and wet season, respectively. In Chobe, the red lechwe densities varied widely between seasons (9 red lechwe/km2 – 101 red lechwe/km2 compared with Linyanti, where the densities did not vary much between seasons (35 red lechwe/km2 – 46 red lechwe/km2 . The lower densities of red lechwe in Chobe in the dry season when compared with the wet season suggest a possible seasonal shift in the distribution of red lechwe to the nearby Zambezi floodplains in Namibia.Conservation implications: The higher number of red lechwe in the Chobe floodplains in the wet season indicates the potential of the floodplains as a habitat for this species in that season. The dry season shift in the distribution of red lechwe in Chobe presents an opportunity for local communities in Namibia to engage in tourism, whereas the return of the red lechwe to the floodplains in the wet season ensures protection of the animals as well as boosts the tourism potential of the Chobe National Park.

  19. Hyb-Seq: combining target enrichment and genome skimming for plant phylogenomics

    Science.gov (United States)

    Kevin Weitemier; Shannon C.K. Straub; Richard C. Cronn; Mark Fishbein; Roswitha Schmickl; Angela McDonnell; Aaron. Liston

    2014-01-01

    • Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. • Methods and Results: Genome and transcriptome assemblies for milkweed ( Asclepias syriaca ) were used to design enrichment probes for 3385...

  20. Environmental Assessment of Proposed Mixed-Use Business Park on an Enchanced Use Lease at Grand Forks Air Force Base, North Dakota

    Science.gov (United States)

    2014-04-01

    season grasses that continue to dominate the majority of the base today; smooth brome (Bromus inermis), red fescue (Festuca rubra), and Kentucky...meadow foxtail FACW H Apocynum cannabinum Indian hemp FAC H Asclepias syriaca Common milkweed UPL H Bromus inermus Smooth brome grass UPL H Carex

  1. Summary Report for 2003-2004 Phase 1 Archaeological Survey of the United States Fish and Wildlife Service's Great Dismal Swamp National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — In February 2004, the United States National Park Service (USNPS) recognized the significance of the United States Fish and Wildlife Service's Great Dismal Swamp...

  2. Ecology and Physiology of a Black Bear Population in Great Dismal Swamp and Reproductive Physiology in the Captive Female Black Bear

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This study was designed to provide information on demographics and ecology of the black bear population in Great Dismal Swamp National Wildlife Refuge for the...

  3. Contaminants in white-tailed deer tissue from the Great Swamp National Wildlife Refuge Morris and Somerset Counties, New Jersey: Results of 1988 sampling and analysis

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — White-tailed deer (Odocoileus virginianus) tissues were sampled during the December, 1988, public deer hunt at the Great Swamp National Wildlife Refuge (GSNWR) to...

  4. Contaminants in fish and sediments of the Great Swamp National Wildlife Refuge, Morris County, New Jersey: A 10-year follow-up investigation

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Located in Morris County, New Jersey about 25 miles west of New York City's Time Square, the U.S. Fish & Wildlife Service's (Service) Great Swamp National...

  5. Hydrography - HYDROGRAPHY_HIGHRES_WATERBODYDISCRETE_NHD_USGS: Lakes, Ponds, Reservoirs, Swamps, and Marshes in Watersheds of Indiana (U. S. Geological Survey, 1:24,000, Polygon Shapefile)

    Data.gov (United States)

    NSGIC State | GIS Inventory — HYDROGRAPHY_HIGHRES_WATERBODYDISCRETE_NHD_USGS.SHP is a polygon shapefile that contains features of lakes, ponds, reservoirs, swamps and marshes in watersheds in and...

  6. Salinity tolerance of non-native Asian swamp eels (Teleostei: Synbranchidae) in Florida, USA: Comparison of three populations and implications for dispersal

    Science.gov (United States)

    Schofield, P.J.; Nico, L.G.

    2009-01-01

    Three populations of non-native Asian swamp eels are established in peninsular Florida (USA), and comprise two different genetic lineages. To assess potential for these fish to penetrate estuarine habitats or use coastal waters as dispersal routes, we determined their salinity tolerances. Swamp eels from the three Florida populations were tested by gradual (chronic) salinity increases; additionally, individuals from the Miami population were tested by abrupt (acute) salinity increases. Results showed significant tolerance by all populations to mesohaline waters: Mean survival time at 14 ppt was 63 days. The Homestead population, a genetically distinct lineage, exhibited greater tolerance to higher salinity than Tampa and Miami populations. Acute experiments indicated that swamp eels were capable of tolerating abrupt shifts from 0 to 16 ppt, with little mortality over 10 days. The broad salinity tolerance demonstrated by these experiments provides evidence that swamp eels are physiologically capable of infiltrating estuarine environments and using coastal waters to invade new freshwater systems. ?? 2009 US Government.

  7. TALL HERB SPRUCE FORESTS AS CLIMAX COMMUNITIES ON LOWLAND SWAMPS OF BRYANSK POLESIE

    Directory of Open Access Journals (Sweden)

    O. I. Evstigneev

    2017-09-01

    Full Text Available Nettle grey alder forests are a dominant forest type on lowland swamps in the Bryansk Polesie. They are formed as a result of repeated cuttings in the place of tall herb spruce forests. Tall herb spruce forests are very rare communities in the vegetation cover in this area due to clear cutting, melioration and peat extraction. An assessment of the succession status of tall herb spruce forests and nettle grey alder forests was carried out in this paper. The criteria of climax state and succession state of communities, developed for Eastern European forests, were used. These criteria are based on the degree of intensity of the following signs in the community: 1 the completeness of species composition of tree synusia; 2 the ontogenetic structure of tree species cenopopulation; 3 the gap-mosaic stand structure; 4 the diversity of microsites in soil cover; 5 the completeness of species composition and ecological-coenotic diversity of vascular species. We showed that tall herb spruce forest, as opposed to black alder forest, is close to communities of the climax type. This is evidenced by the following features of cenosis: firstly, all tree species in the area that covers the Bryansk Polesie and that are able to grow on lowland swamps are represented in the spruce forest (Alnus glutinosa, Betula pubescens, Fraxinus excelsior, Padus avium, Picea abies, Salix pentandra, Sorbus aucuparia, Ulmus glabra. Secondly, a steady turnover of generations is carried out in the cenopopulations of main edificators (Picea abies and Alnus glutinosa. This is evidenced by the complete and left-sided structure of their ontogenetic spectrum. Thirdly, a system of asynchronously developing gaps (parcels, which are formed on the site of old tree falls, is formed in the community. This ensures the continuous renewal of spruce and alder populations and creates conditions for the regeneration of other tree species. Fourthly, the structure of biogenic microsites has been formed

  8. LOWEST POSSIBLE FELLING TECHNIQUE FOR INCREASING UTILIZATION OF RENGHAS (Gluta renghas L. WOOD AT A PEAT SWAMP FOREST

    Directory of Open Access Journals (Sweden)

    Sona Suhartana

    2006-07-01

    Full Text Available This study was carried out in 2005 at a peat swamp forest company in Jambi. The aim of this study was to find out a technique to increase the utilization of renghas wood in a peat swamp forest by implementing the lowest possible felling technique (LPFT and  the conventional felling technique (CFT. Data collected in this study were: working time, log volume, waste volume, productivity, efficiency, stump height and felling cost. Two data categories were analyzed with respect to their possible differences by using a t-test. The study showed that the implementation of LPFT produced better results compared to that of CFT which was indicated by: (1 Felling productivity increased to 5.220 m3/hour, (2 Felling cost decreased Rp 341/m3, (3 Felling efficiency increased 3.2%, and (4 The average stump heights were 41.2 cm for LPFT and 67.5 cm for CFT.

  9. Water, sanitation and hygiene in wetlands. A case study from the Ewaso Narok Swamp, Kenya.

    Science.gov (United States)

    Anthonj, Carmen; Rechenburg, Andrea; Kistemann, Thomas

    2016-10-01

    Wetlands can be both a blessing and a curse. They are beneficial sources of safe water and nutrition and places from which humans derive their livelihoods. At the same time, wetlands are known to be sources of disease-causing microorganisms and invertebrates that can threaten human health. Safe water, sanitation and personal hygiene (WASH) are crucial preconditions for the prevention of disease transmission. And of special importance for people living in wetlands, depending on and being exposed to them. WASH should be prioritized especially in those wetlands that are subject to intensive use, that have a poor sanitation infrastructure, and which at the same time only provide limited water resources. However, despite this critical importance, WASH in wetlands is not well characterized in literature. This study therefore aimed at providing insights into the water, sanitation and hygiene conditions and behavioural determinants of households in wetlands by presenting the case of a rural wetland in East Africa. The mixed method approach included a broad set of empirical data collected during a household survey (n=400), an observational WASH assessment (n=397) and in-depth interviews (n=20) conducted from January to March 2015 in Ewaso Narok Swamp in Kenya. Different user groups of the wetland were targeted. The study in Ewaso Narok Swamp showed that wetland users' water supply and storage, sanitation and personal hygiene conditions were inadequate for large parts of the community and significantly differed between groups. Whereas the WASH conditions of people working in the service sector were rather positive, for pastoralists, they were correspondingly negative. The WASH behaviour was also perceived to be inadequate influenced by a variety of determining factors. The observational index as applied in this study indicated to be a valuable, rapid and efficient tool for assessing domestic WASH and for detecting differences between different groups in wetlands. Combined

  10. Factors affecting oxidative peat decomposition due to land use in tropical peat swamp forests in Indonesia.

    Science.gov (United States)

    Itoh, Masayuki; Okimoto, Yosuke; Hirano, Takashi; Kusin, Kitso

    2017-12-31

    The increasing frequency of fire due to drainage of tropical peatland has become a major environmental problem in Southeast Asia. To clarify the effects of changes in land use on carbon dioxide emissions, we measured oxidative peat decomposition (PD) at different stages of disturbance at three sites in Central Kalimantan, Indonesia: an undrained peat swamp forest (UF), a heavily drained peat swamp forest (DF), and a drained and burned ex-forest (DB). PD exhibited seasonality, being less in the wet season and greater in the dry season. From February 2014 to December 2015, mean PD (±SE) were 1.90±0.19, 2.30±0.33, and 1.97±0.25μmolm(-2)s(-1) at UF, DF, and DB, respectively. The groundwater level (GWL) was a major controlling factor of PD at all sites. At UF and DF, PD and GWL showed significant quadratic relationships. At DB, PD and GWL showed significant positive and negative relationships during the dry and wet seasons, respectively. Using these relationships, we estimated annual PD from GWL data for 2014 and 2015 as 698 and 745gCm(-2)yr(-1) at UF (mean GWL: -0.23 and -0.39m), 775 and 825gCm(-2)yr(-1) at DF (-0.55 and -0.59m), and 646 and 748gCm(-2)yr(-1) at DB (-0.22 and -0.62m), respectively. The annual PD was significantly higher in DF than in UF or DB, in both years. Despite the very dry conditions, the annual PD values at these sites were much lower than those reported for tropical peat at plantations (e.g., oil palm, rubber, and acacia). The differences in the relationship between PD and GWL indicate that separate estimations are required for each type of land. Moreover, our results suggest that PD can be enhanced by drainage both in forests and at burned sites. Copyright © 2017 Elsevier B.V. All rights reserved.

  11. American black bears and bee yard depredation at Okefenokee Swamp, Georgia

    Science.gov (United States)

    Clark, J.D.; Dobey, S.; Masters, D.V.; Scheick, B.K.; Pelton, M.R.; Sunquist, M.E.

    2005-01-01

    We studied American black bears (Ursus americanus), on the northwest periphery of Okefenokee Swamp in southeast Georgia, to assess landowner attitudes toward bears, estimate the extent of damage to commercial honey bee operations by bears, and evaluate methods to reduce bear depredations to apiaries. We collected 8,351 black bear radiolocations and identified 51 bee yards on our study area. Twenty-seven of 43 home ranges contained ≥1 bee yard, averaging 11.3 and 5.1 bee yards/home range of males (n = 7) and females (n = 20), respectively. From 1996 to 1998, we documented 7 instances of bears raiding bee yards within our study area and 6 instances in adjacent areas. All but 1 of the 13 raided yards were enclosed by electric fencing. In the 12 cases of damage to electrically fenced yards, however, the fences were not active because of depleted batteries. Based on compositional analysis, bear use of areas 800–1,400 m from bee yards was disproportionately greater than use 0–800 m from bee yards. Bears disproportionately used bay (red bay: Persea borbonia, loblolly bay: Gordonia lasianthus, and southern magnolia: Magnolia virginia), gum (water tupelo: Nyssa aquatic and black gum: N. sylvatica), and cypress (Taxodium spp.) and loblolly bay habitats, however, compared with slash pine (Pinus elliottii) or pine–oak (Quercus spp.), where bee yards usually were placed. The distribution of bear radiolocations likely reflected the use of those swamp and riparian areas, rather than avoidance of bee yards. Distances to streams from damaged bee yards (x̄ = 1,750 m) were less than from undamaged yards (x̄ = 4,442 m), and damaged bee yards were closer to unimproved roads (x̄ = 134 m) than were undamaged bee yards (x̄ = 802 m). Our analysis suggests that bee yard placement away from bear travel routes (such as streams and unimproved roads) can reduce bear depredation problems. Our results strongly indicate that working electric fences are effective deterrents to bear

  12. The Munchausen paradigm for deprived neighbourhoods: pulling yourself out of the swamp of deprivation

    Directory of Open Access Journals (Sweden)

    Jeannette Nijkamp

    2017-06-01

    Full Text Available The Munchausen paradigm for deprived neighbourhoods: pulling yourself out of the swamp of deprivation Since the 1980s, many initiatives have attempted to tackle the deprivation currently experienced in South Rotterdam. Efforts have been made to attract creative workers and, in a counter-reaction, other initiatives have aimed to encourage the creative talents of poorer residents to strengthen their economic position. One example of this is Freehouse, which has established projects in the Afrikaanderwijk, including a neighbourhood cooperative. Our article addresses two questions: 1 What are the effects of the Freehouse projects on the economic position of residents of the Afrikaanderwijk? and 2 Which insights do our results provide into the possible effects of local government policies that rely on citizens playing an active role? Although the economic effects of the projects were limited, our study reveals that citizens’ initiatives, such as the Afrikaander Cooperative, can help residents gain employment. In order to succeed, these initiatives should not be hindered by obstructive regulations, and they should include input from the residents who function as staff. However, in deprived neighbourhoods, many residents require support to be able to contribute to citizens’ initiatives, and cannot be expected to act like Baron Münchausen and pull themselves out of the swamp of deprivation by their own hair. Het Münchausen paradigma voor achterstandswijken: jezelf uit het moeras van achterstand trekken Sinds de jaren 80 hebben veel initiatieven geprobeerd het achterstandsniveau in Rotterdam Zuid te verminderen. Verschillende initiatieven waren gericht op het aantrekken van creatieve professionals. Als tegenreactie stimuleerden andere initiatieven de creatieve talenten van arme wijkbewoners teneinde hun economische positie te versterken. Een voorbeeld hiervan is Freehouse, dat projecten in de Afrikaanderwijk startte, waaronder de oprichting van

  13. Assessment of semen quality in Swamp Buffalo AI Bulls in Thailand

    Directory of Open Access Journals (Sweden)

    S. Koonjaenak

    2010-02-01

    Full Text Available Characteristic of Thai swamp buffalo bulls semen used for artificial insemination (AI in Thailand, aspects relevance in freezing and thawing of semen are review. Semen and sperm characteristics were evaluated included sperm count, motility (assessed subjectively and by CASA, morphology (using phase-contrast light microscopy and SEM, plasma membrane integrity (PMI (using a hypo-osmotic swelling test [HOST] and SYBR- 14/propidium iodide [PI], plasma membrane stability (PMS (using Annexin-V/PI and deoxyribonucleic acid (DNA integrity (using SCSA and flow cytometry [FCM]. The average ejaculate volume was about 3.0–4.0 mL, with good viability (PMI measured by the HOST and motility (>65% and >70%, respectively. Sperm concentration ranged from 1.1 to 1.2 billion/mL, being also affected by bull age. Whereas semen quality (including sperm output, pH and initial sperm motility did not differ between the seasons. Few spermatozoa (<15%/ ejaculate had abnormal morphology with abnormalities resembling those in other bovidae. In FT semen, PMI (using SYBR-14/PI and PMS were highest in winter. Across seasons, ~50% of post-thaw spermatozoa depicted linear motility, a proportion that decreased to ~35% during incubation (38oC for 60 minutes, without marking any seasonal difference. The sperm DNA was hardly damaged (with <3% fragmentation, expressed as DNA fragmentation index [DFI], among seasons.

  14. Restoration and Management of a Degraded Baldcypress Swamp and Freshwater Marsh in Coastal Louisiana

    Directory of Open Access Journals (Sweden)

    Rachael G. Hunter

    2016-02-01

    Full Text Available The Central Wetlands Unit (CWU, covering 12,000 hectares in St. Bernard and Orleans Parishes, Louisiana, was once a healthy baldcypress–water tupelo swamp and fresh and low salinity marsh before construction of levees isolated the region from Mississippi River floodwaters. Construction of the Mississippi River Gulf Outlet (MRGO, which funneled saltwater inland from the Gulf of Mexico, resulted in a drastic ecosystem change and caused mortality of almost all trees and low salinity marsh, but closure of the MRGO has led to decreases in soil and surface water salinity. Currently, the area is open water, brackish marsh, and remnant baldcypress stands. We measured hydrology, soils, water and sediment chemistry, vegetation composition and productivity, accretion, and soil strength to determine relative health of the wetlands. Vegetation species richness is low and above- and belowground biomass is up to 50% lower than a healthy marsh. Soil strength and bulk density are low over much of the area. A baldcypress wetland remains near a stormwater pumping station that also has received treated municipal effluent for about four decades. Based on the current health of the CWU, three restoration approaches are recommended, including: (1 mineral sediment input to increase elevation and soil strength; (2 nutrient-rich fresh water to increase productivity and buffer salinity; and (3 planting of freshwater forests, along with fresh and low salinity herbaceous vegetation.

  15. A Review of the Relative Merits of Conserving, Using, or Draining Papyrus Swamps

    Science.gov (United States)

    Maclean, Ilya M. D.; Boar, Rosalind R.; Lugo, Charles

    2011-02-01

    Wetlands are a vital resource, particularly in Africa where livelihoods are closely linked to natural capital. In recent years, extensive drainage has occurred to make way for agriculture. To gain insight into whether drainage is justified, we review the value of African wetlands dominated by Cyperus papyrus in relation to use, conservation and conversion. Evidence suggests that the value derived from low-intensity, multifunctional wetland use far exceeds the value derived from swamp reclamation and generally exceeds that of conservation. At a local level, the main driver of wetland misuse appear to be a breakdown in collaborative management regimes and the main constraint on wetland use, the value of labor and selling-times. Local drivers are linked to regional factors such as the lack of coordinated wetland policies and difficulties in ensuring that legislation is absorbed by all sectors of society. We highlight opportunities for ensuring more effective collaborative management and legislation communication, which capitalize on existing governance structures. In contrast to predictions by Hardin's Tragedy of the Commons model, we argue that effective wetland management is best achieved by preventing privatization and promoting common property management regimes. We also argue that poverty and income inequity are more important drivers of unsustainable resource use than environmental managers commonly acknowledge.

  16. ADVANCED LAND COVER MAPPING OF TROPICAL PEAT SWAMP ECOSYSTEM USING AIRBORNE DISCRETE RETURN LIDAR

    Directory of Open Access Journals (Sweden)

    Solichin Manuri

    2017-02-01

    Full Text Available The ability to better understand tropical peat ecosystems for restoration and climate change mitigation is often hampered by the lack of availability accurate and detailed data on vegetation cover and hydrologys, which is typically only derived from detailed and high-resolution imaging or field-based measurements. The aims of this study were to explore the potential advantage of airborne discrete-return lidar for mapping of forest cover in peat swamp forests. We used 2.8 pulse.m-1 lidar and the associated 1-m DTM derived from an airborne platform. The lidar dataset fully covered a 120 thousand hectare protection forest in Central Kalimantan. We extracted maximum vegetation heights in 5-m grid resolution to allow detailed mapping of the forest. We followed forest definition from FAO for forest and non-forest classification. We found that lidar was able to capture detail variation of canopy height in high-resolution, thus provide more accurate classification. A comparison with existing maps suggested that the lidar-derived vegetation map was more consistent in defining canopy structure of the vegetation, with small standard deviations of the mean height of each class.

  17. Monticellia ophisterni n. sp. (Cestoda: Monticelliidae) from the swamp-eel Ophisternon aenigmaticum (Synbranchiformes) from Mexico.

    Science.gov (United States)

    Scholz, T; de Chambrier, A; Salgado-Maldonado, G

    2001-12-01

    Monticellia ophisterni n. sp. is described from the swamp-eel Ophisternon aenigmaticum Rosen and Greenwood (Synbranchiformes: Synbranchidae) from Lake Catemaco, Veracruz, Mexico. The new species is placed into Monticellia because of the cortical position of the testes, ovary, and uterus. It differs from other Monticellia species (with the exception of Monticellia magna (Rego, Santos and Silva, 1974)) in the position of longitudinal musculature that crosses the vitelline follicles, making them paramuscular. The new species can be distinguished from M. magna--which possesses a similar number of testes (107-139), paramuscular vitelline follicles, and numerous gland cells distributed between the apex of the scolex and suckers--in the position of the genital pore (8-21% vs. 19-27%), in the presence of a weak internal longitudinal musculature, in the arrangement of the testes in the median field, and in the absence of a vaginal sphincter. This is the first proteocephalidean tapeworm reported from a synbranchid fish and the first species of Monticellia found in North America.

  18. Identification and Characterization of Reference Genes for Normalizing Expression Data from Red Swamp Crawfish Procambarus clarkii

    Directory of Open Access Journals (Sweden)

    Hucheng Jiang

    2015-09-01

    Full Text Available qRT-PCR is a widely used technique for rapid and accurate quantification of gene expression data. The use of reference genes for normalization of the expression levels is crucial for accuracy. Several studies have shown that there is no perfect reference gene that is appropriate for use in all experimental conditions, and research on suitable reference genes in red swamp crawfish (Procambarus clarkii is particularly scarce. In this study, eight commonly used crustacean reference genes were chosen from P. clarkii transcriptome data and investigated as potential candidates for normalization of qRT-PCR data. Expression of these genes under different experimental conditions was examined by qRT-PCR, and the stability of their expression was evaluated using three commonly used statistical algorithms, geNorm, NormFinder and BestKeeper. A final comprehensive ranking determined that EIF and 18S were the optimal reference genes for expression data from different tissues, while TBP and EIF were optimal for expression data from different ovarian developmental stages. To our knowledge, this is the first systematic analysis of reference genes for normalization of qRT-PCR data in P. clarkii. These results will facilitate more accurate and reliable expression studies of this and other crustacean species.

  19. Waste drilling-fluid-utilising microorganisms in a tropical mangrove swamp oilfield location

    Energy Technology Data Exchange (ETDEWEB)

    Benka-Coker, M.O.; Olumagin, A. [Benin Univ. (Nigeria). Dept. of Microbiology

    1995-12-31

    Waste drilling-fluid-utilising microorganisms were isolated from drilling-mud cuttings, soil and creek water from a mangrove swamp oilfield location in the Delta area of Nigeria using waste drilling-fluid as the substrate. Eighteen bacterial isolates obtained were identified as species of Staphylococcus, Acinetobacter, Alcaligenes, Serratia, Clostridium, Enterobacter, Klebsiella, Nocardia, Bacillus, Actinomyces, Micrococcus and Pseudomonas, while the genera of fungi isolated were Penicillium, Cladosporium and Fusarium. Even though drilling-fluid-utilising genera were in higher numbers in the soil than in the two other sources examined, the percentages of the total heterotrophic bacteria that utilised waste drilling-fluid were 6.02 in the drilling-mud cuttings, 0.83 in creek water and 0.42 in soil. The screen tests for biodegradation potential of the bacterial isolates showed that, even though all the isolates were able to degrade and utilise the waste fluid for growth, species of Alcaligenes and Micrococcus were more active degraders of the waste. The significance of the results in environmental management in oil-producing areas of Nigeria is discussed. (Author)

  20. Effect of Combined Probiotics (Saccharomyces cerevisae + Candida utilis and Herbs on Carcass Characteristics of Swamp Buffalo

    Directory of Open Access Journals (Sweden)

    P Mahyuddin

    2010-05-01

    Full Text Available A feedlot trial was conducted to study the effect of probiotics + herbs on carcass characteristics. Thirty male swamp buffaloes aged 2–2.5 years with the average body weight of 297 kg were used in this trial. They were fattened for 75 days to reach a slaughter weight of around 350–400 kg. They were divided into two groups of 15 animals in each group, and were placed in a shaded paddock. The groups were the control and the treated animals. The treated animals were given a supplementation containing combined yeasts (Saccharomyces cerevisae and Candida utilis, and herbs. All animals were fed basal diet of ammoniated rice straw and commercial concentrate with a ratio of 10: 90. There was no effect of probiotics+herbs on live weight gain, percentage of carcass, dressing, meat and by products, back fat thickness and eye muscle area. Addition of probiotics+herbs increased proportion of bone, reduced meat : bone ratio, body fat and proportion of offal. Although body fat content was reduced by the treatment, the compositions of fat were similar between the control and treated animals. (Animal Production 12(2: 69-73 (2010Key Words: buffalo, feedlot, yeast, carcass

  1. Impact of logging on a mangrove swamp in South Mexico: cost / benefit analysis

    Directory of Open Access Journals (Sweden)

    Cristian Tovilla Hernández

    2001-06-01

    Full Text Available Environmental changes caused by logging in a mangrove swamp were studied in Barra de Tecoanapa, Guerrero, Mexico. Original forest included Rhizophora mangle, Laguncularia racemosa, Avicennia germinans and halophytic vegetation, and produced wood (164.03 m3/ha and organic matter (3.9 g/m2/day. A total of 3.5 tons of wood per year were harvested from this area. Later, an average of 2 555 kg of maize per planting cycle were obtained (market value of 88 USD. Succession when the area was abandoned included strictly facultative and glycophyte halophytes (16 families, Cyperaceae and Poaceae were the best represented. After logging, temperatures increased 13 °C in the soil and 11°C in the air, whereas salinity reached 52 psu in the dry season. These modified soil color and sand content increased from 42.6 to 63.4%. Logging was deleterious to species, habitat, biogeochemical and biological cycles, organic matter production, seeds, young plants, genetic exchange conservation of soil and its fertility, coastal protection, and aesthetic value; 3 000 m2 had eroded as the river advanced towards the deforested area (the cost/benefit analysis showed a ratio of 246: 1. There was long-term economic loss for the community and only 30% of the site has recovered after five years.

  2. [Egg size variation in egrets and herons (Aves: Ardeidae) nesting in Birama's swamp, Cuba].

    Science.gov (United States)

    Denis Avila, Dennis

    2015-03-01

    Intraclutch egg size variation in birds depends on many ecological factors and on the evolutive history of each species. In wading birds, a trend to smaller eggs with laying order has been described, but comparative reports are scarce. In this study, egg size variation patterns were described for nine Egrets and Heron species nesting in Birama' Swamp, Cuba. The patterns were described using external dimensions of 3142 eggs from 1875 nests of Butorides virescens, Bubulcus ibis, Ardea alba, Nycticorax nycticorax, Nyctanassa violacea and four Egretta species, taken in the field between 1998 and 2006. Results showed that eggs were 4.9-10% of adult weight and had volume variation coefficients between 6-9%. There were no general and consistent interspecies relationship between clutch size and egg sizes. Average volumes tend to get smaller with laying order, but it is not statistically detectable in Butorides and Bubulcus. Last egg was between 0.2% and 15% smaller than the first, showing an inverse relationship with it. Intraclutch asymmetry is light in E. thula and fluctuating around null in Bubulcus. Size only predicted laying or hatching order for the last egg, in nests with more than two eggs, with 72.4% of confidence.

  3. Swamp cancer: a case of human pythiosis and review of the literature.

    Science.gov (United States)

    Hilton, R E; Tepedino, K; Glenn, C J; Merkel, K L

    2016-08-01

    Pythiosis is an infection caused by the aquatic oomycete Pythium insidiosum. Commonly known as 'swamp cancer' in veterinary pathology, pythiosis is now considered an emerging human disease associated with significant morbidity and mortality. However, because clinical information is limited, many healthcare providers, including dermatologists, are unfamiliar with this diagnosis. To increase awareness of this life-threatening infection, a case of cutaneous pythiosis is presented. We describe a middle-aged man with acute myeloid leukaemia who presented with necrotizing haemorrhagic plaques on his thighs after a weekend of freshwater boating. Histological examination of a biopsy specimen showed invasive fungal hyphae associated with dense perivascular inflammation and vessel damage. Diagnostic testing on tissue culture revealed growth of P. insidiosum. Despite multiple debridements and antifungal therapy, the patient died within 2 weeks of presentation. There are four clinical presentations reported in human pythiosis. Pythium insidiosum infection should be considered in any patient with a suggestive exposure history and fungal elements found on histological examination or in culture. Identification of the organism can be difficult, so polymerase chain reaction and serological assays can be useful in making a diagnosis. To improve clinical outcomes, early combination therapy with antifungals and surgery is needed. © 2016 British Association of Dermatologists.

  4. High methane emissions from restored Norway spruce swamps in southern Finland over one growing season

    Directory of Open Access Journals (Sweden)

    M. Koskinen

    2016-02-01

    Full Text Available Forestry-drained peatlands in the boreal region are currently undergoing restoration in order to bring these ecosystems closer to their natural (undrained state. Drainage affects the methane (CH4 dynamics of a peatland, often changing sites from CH4 sources to sinks. Successful restoration of a peatland would include restoration of not only the surface vegetation and hydrology, but also the microbial populations and thus CH4 dynamics. As a pilot study, CH4 emissions were measured on two pristine, two drained and three restored boreal spruce swamps in southern Finland for one growing season. Restoration was successful in the sense that the water table level in the restored sites was significantly higher than in the drained sites, but it was also slightly higher than in the pristine sites. The restored sites were surprisingly large sources of CH4 (mean emissions of 52.84 mg CH4 m-2 d-1, contrasting with both the pristine (1.51 mg CH4 m-2 d-1 and the drained sites (2.09 mg CH4 m-2 d-1. More research is needed to assess whether the high CH4 emissions observed in this study are representative of restored spruce mires in general.

  5. Firing Room Remote Application Software Development & Swamp Works Laboratory Robot Software Development

    Science.gov (United States)

    Garcia, Janette

    2016-01-01

    The National Aeronautics and Space Administration (NASA) is creating a way to send humans beyond low Earth orbit, and later to Mars. Kennedy Space Center (KSC) is working to make this possible by developing a Spaceport Command and Control System (SCCS) which will allow the launch of Space Launch System (SLS). This paper's focus is on the work performed by the author in her first and second part of the internship as a remote application software developer. During the first part of her internship, the author worked on the SCCS's software application layer by assisting multiple ground subsystems teams including Launch Accessories (LACC) and Environmental Control System (ECS) on the design, development, integration, and testing of remote control software applications. Then, on the second part of the internship, the author worked on the development of robot software at the Swamp Works Laboratory which is a research and technology development group which focuses on inventing new technology to help future In-Situ Resource Utilization (ISRU) missions.

  6. Tower-Based Validation and Improvement of MODIS Gross Primary Production in an Alpine Swamp Meadow on the Tibetan Plateau

    Directory of Open Access Journals (Sweden)

    Ben Niu

    2016-07-01

    Full Text Available Alpine swamp meadow on the Tibetan Plateau is among the most sensitive areas to climate change. Accurate quantification of the GPP in alpine swamp meadow can benefit our understanding of the global carbon cycle. The 8-day MODerate resolution Imaging Spectroradiometer (MODIS gross primary production (GPP products (GPP_MOD provide a pathway to estimate GPP in this remote ecosystem. However, the accuracy of the GPP_MOD estimation in this representative alpine swamp meadow is still unknown. Here five years GPP_MOD was validated using GPP derived from the eddy covariance flux measurements (GPP_EC from 2009 to 2013. Our results indicated that the GPP_EC was strongly underestimated by GPP_MOD with a daily mean less than 40% of EC measurements. To reduce this error, the ground meteorological and vegetation leaf area index (LAIG measurements were used to revise the key inputs, the maximum light use efficiency (εmax and the fractional photosynthetically active radiation (FPARM in the MOD17 algorithm. Using two approaches to determine the site-specific εmax value, we suggested that the suitable εmax was about 1.61 g C MJ−1 for this alpine swamp meadow which was considerably larger than the default 0.68 g C MJ−1 for grassland. The FPARM underestimated 22.2% of the actual FPAR (FPARG simulated from the LAIG during the whole study period. Model comparisons showed that the large inaccuracies of GPP_MOD were mainly caused by the underestimation of the εmax and followed by that of the undervalued FPAR. However, the DAO meteorology data in the MOD17 algorithm did not exert a significant affection in the MODIS GPP underestimations. Therefore, site-specific optimized parameters inputs, especially the εmax and FPARG, are necessary to improve the performance of the MOD17 algorithm in GPP estimation, in which the calibrated MOD17A2 algorithm (GPP_MODR3 could explain 91.6% of GPP_EC variance for the alpine swamp meadow.

  7. Holocene palaeoclimate and sea level fluctuation recorded from the coastal Barker Swamp, Rottnest Island, south-western Western Australia

    Science.gov (United States)

    Gouramanis, C.; Dodson, J.; Wilkins, D.; De Deckker, P.; Chase, B. M.

    2012-10-01

    The Holocene palaeoclimatic history of south-western Western Australia (SWWA) has received little attention compared to south-eastern Australia, and this has resulted in conflicting views over the impact of climate variability in the region. We present here a well-dated, high-resolution record from two overlapping sediment cores obtained from the centre of Barker Swamp, Rottnest Island, offshore Perth. The records span the last 8.7 ka, with the main lacustrine phase occurring after 7.4 ka. This site preserves both pollen and several ostracod taxa. The pollen record suggests a long-term shift from the early-mid Holocene to the late Holocene to drier conditions with less shrubland and more low-ground cover and less fire activity. A salinity transfer function was developed from ostracod faunal assemblage data and trace metal ratios (Mg/Ca, Sr/Ca and Na/Ca) and stable isotopes (δ18O and δ13C) analysed on selected ostracod valves. These provide a detailed history of evaporation/precipitation (E/P) differences that clearly shows that the SWWA region was subjected to significant climatic shifts over the last 7.4 ka, with a broad shift towards increased aridity after 5 ka. The swamp ranged from fresh to saline as recorded in the ostracod valve chemistry and the independently-derived salinity transfer function. The ostracod record also indicates that a sea-level highstand occurred between ca. 4.5 and 4.3 ka, with probable step-wise increases at 6.75, 6.2, and 5.6 ka, with the last vestiges of salt water intrusion at ca. 1 ka. After about 2.3 ka, the fresh, groundwater lens that underlies the western portion of the island intersected the swamp depression, influencing the hydrology of the swamp. The broad climatic changes recorded in Barker Swamp are also compared with data from southern South Africa, and it is suggested that the Southern Annular Mode appears to have been the dominant driver in the climate of these regions and that the Indian Ocean Dipole is of little

  8. Characterizing the Status (Disturbed, Hybrid or Novel) of Swamp Forest Fragments in a Caribbean Ramsar Wetland: The Impact of Anthropogenic Degradation and Invasive Plant Species

    Science.gov (United States)

    Prospere, Kurt; McLaren, Kurt P.; Wilson, Byron

    2016-10-01

    The last remaining Amazonian-type swamp forest fragments in Black River Lower Morass, Jamaica, have been subjected to a myriad of anthropogenic disturbances, compounded by the establishment and spread of several invasive plant species. We established 44 permanent sample plots (covering 3.92 ha) across 10 of these swamp forest fragments and sampled all non-woody plants and all trees ≥2 cm DBH found in the plots. These data were used to (1) identify thresholds of hybridity and novelty, (2) derive several diversity and structural descriptors used to characterize the swamp forest fragments and (3) identify possible indicators of anthropogenic degradation. These were incorporated into a framework and used to determine the status of the swamp forest fragments so that appropriate management and conservation measures can be implemented. We recorded 43 woody plant species (9 endemic, 28 native and 4 non-native) and 21 non-tree species. The composition and structure of all the patches differed significantly due to the impact of the herbaceous invasive plant Alpinia allughas, the presence and diversity of other non-native plants, and differing intensities of anthropogenic disturbance (e.g., burning, cutting and harvesting of non-timber forest products). We ranked forest patches along a continuum representing deviations from a historical proxy (least disturbed) swamp forest to those with dramatically altered structural and floristic attributes (=novel swamp forests). Only one fragment overrun with A. allughas was classified as novel. If effective conservation and management does not come to the BRLM, the remaining swamp forest fragments appear doomed to further degradation and will soon disappear altogether.

  9. TEMPORAL VEGETATION DYNAMICS IN PEAT SWAMP AREA USING MODIS TIME-SERIES IMAGERY: A MONITORING APPROACH OF HIGH-SENSITIVE ECOSYSTEM IN REGIONAL SCALE

    Directory of Open Access Journals (Sweden)

    Yudi Setiawan

    2016-10-01

    Full Text Available Peat swamp area is an essential ecosystem due to high vulnerability of functions and services. As the change of forest cover in peat swamp area has increased considerably, many studies on peat swamp have focused on forest conversion or forest degradation. Meanwhile, in the context of changes in the forestlands are the sum of several processes such as deforestation, reforestation/afforestation, regeneration of previously deforested areas, and the changing spatial location of the forest boundary. Remote sensing technology seems to be a powerful tool to provide information required following that concerns. A comparison imagery taken at the different dates over the same locations for assessing those changes tends to be limited by the vegetation phenology and land-management practices. Consequently, the simultaneous analysis seems to be a way to deal with the issues above, as a means for better understanding of the dynamics changes in peat swamp area. In this study, we examined the feasibility of using MODIS images during the last 14 years for detecting and monitoring the changes in peat swamp area. We identified several significant patterns that have been assigned as the specific peat swamp ecosystem. The results indicate that a different type of ecosystem and its response to the environmental changes can be portrayed well by the significant patterns. In understanding the complex situations of each pattern, several vegetation dynamics patterns were characterized by physical land characteristics, such as peat depth, land use, concessions and others. Characterizing the pathways of dynamics change in peat swamp area will allow further identification for the range of proximate and underlying factors of the forest cover change that can help to develop useful policy interventions in peatland management.

  10. Characterizing the Status (Disturbed, Hybrid or Novel) of Swamp Forest Fragments in a Caribbean Ramsar Wetland: The Impact of Anthropogenic Degradation and Invasive Plant Species.

    Science.gov (United States)

    Prospere, Kurt; McLaren, Kurt P; Wilson, Byron

    2016-10-01

    The last remaining Amazonian-type swamp forest fragments in Black River Lower Morass, Jamaica, have been subjected to a myriad of anthropogenic disturbances, compounded by the establishment and spread of several invasive plant species. We established 44 permanent sample plots (covering 3.92 ha) across 10 of these swamp forest fragments and sampled all non-woody plants and all trees ≥2 cm DBH found in the plots. These data were used to (1) identify thresholds of hybridity and novelty, (2) derive several diversity and structural descriptors used to characterize the swamp forest fragments and (3) identify possible indicators of anthropogenic degradation. These were incorporated into a framework and used to determine the status of the swamp forest fragments so that appropriate management and conservation measures can be implemented. We recorded 43 woody plant species (9 endemic, 28 native and 4 non-native) and 21 non-tree species. The composition and structure of all the patches differed significantly due to the impact of the herbaceous invasive plant Alpinia allughas, the presence and diversity of other non-native plants, and differing intensities of anthropogenic disturbance (e.g., burning, cutting and harvesting of non-timber forest products). We ranked forest patches along a continuum representing deviations from a historical proxy (least disturbed) swamp forest to those with dramatically altered structural and floristic attributes (=novel swamp forests). Only one fragment overrun with A. allughas was classified as novel. If effective conservation and management does not come to the BRLM, the remaining swamp forest fragments appear doomed to further degradation and will soon disappear altogether.

  11. The effect of peat swamp forest degradation on greenhouse gas fluxes in the Peruvian Amazon

    Science.gov (United States)

    van Lent, Jeffrey; Hergoualc'h, Kristell; Verchot, Louis; van Groeningen, Jan Willem; Oenema, Oene

    2017-04-01

    Carbon-dense peat swamp forests in Peru are recurrently harvested for M. flexuosa fruits, which is typically performed by cutting down entire palms. This research aimed to evaluate how biogeochemical cycles are affected by this type of forest degradation. Total soil respiration (Rs), heterotrophic respiration (Rh), CH4 and N2O fluxes, litterfall and environmental parameters were monitored monthly for two years in an undisturbed (UD), a moderately disturbed (MD), and a highly degraded site (HD). The experimental setup entailed measurements in hollows and hummocks with standing live or dead palms. Rh rates were higher in hummocks than in hollows (UD: 25.9±0.5 and 17.5±0.3, MD: 14.1±1.3 and 12.4±1.2, HD: 26.8±4.7 and 18.8±3.0 kg C-CO2 ha-1 d-1, respectively). Unexpectedly, CH4 fluxes did not vary significantly between hummocks and hollows, whereas N2O fluxes followed the same trend as Rh. GHG fluxes from hummocks with a standing live or a standing dead palm were similar. However, degradation did reduce the relative hummock area (relative areas: 18, 10 and 4% for UD, MD, and HD, respectively). As a result, the overall weighted average Rh in the MD site (12.4±1.6 kg C-CO2 ha-1 d-1) was lower than the UD one (18.4±1.0 kg C-CO2 ha-1 d-1), while litter input was higher (12.2±0.3 and 9.3±0.4 kg d.w. ha-1 d-1in the MD and UD, respectively). The HD site exhibited Rh (17.5±1.2 kg C-CO2 ha-1 d-1) and litter input (9.4±0.2 kg d.w. ha-1 d-1) rates similar to those of the UD site. CH4 fluxes were 0.75±0.10, 0.62±0.08, 0.89±0.05 kg C-CH4 ha-1 d-1 and N2O fluxes 1.7±0.2, 1.2±0.1, 2.0±0.3 g N-N2O ha-1 d-1 in the UD, MD and HD site, respectively. These findings suggest that differentiating hummocks and hollows in GHG flux assessments and accounting for changes in relative hummock areas are essential for evaluating degradation impacts on peat C and N cycling in Amazonian peat swamp forests. These results contribute to building knowledge on emission factors for

  12. Burrowing activity in channel levees: impact of the invasive red swamp crayfish Procambarus clarkii

    Science.gov (United States)

    Solari, L.; Bendoni, M.; Consumi, L.; Haubrock, P.; Inghilesi, A.; Mazza, G.; Torrini, M.; Tricarico, E.

    2016-12-01

    The effect of animal burrowing, as an example of bioturbation on the stability of river levees has been recently raised to the scientific community as a consequence of the levee collapses of Secchia and Foenna rivers in Italy (Camici et al., 2010, 2014; Orlandini et al., 2015). Indeed, these authors showed that the presence of animal burrows is crucial in promoting the collapse of the bank. The American red swamp Crayfish Procambarus clarkii is an invasive species in Europe, mostly introduced for commercial purposes related to livestock. It is rapidly spreading throughout the Italian peninsula due to its plasticity, dispersal capability and high reproduction rate (Souty-Grosset et al., 2016). As well as the negative effects on local biodiversity, it damages the levees of the irrigation channel leading to disastrous collapses, relevant repairing and maintenance costs. In this work, we present an experimental activity where specimens of P. clarkii were monitored while burrowing into a small-scale physical model of an earthen levee, coupled with the mathematical modelling of the variations induced by the burrows on the seepage flow patterns through the levee.Preliminary results show the burrowing structure was quite irregular. Generally, crayfish start burrowing under the water level, developing tunnels (diameter ranging 4-7cm) both horizontally and heading upward, also above the water level. Some tunnels showed one or more circular chambers. The highest burrowing activity was observed during the experiments carried out in summer, when the species has a peak of maximum activity due to the higher temperature. Mathematical modelling shows that, for given boundary conditions and experimental duration, the presence of burrows in the levee raises the phreatic line. Critical conditions for levee integrity may be associated either to the internal erosion and stability of the system of tunnels and to the emergence of the phreatic line of the landside of the levee slope. These

  13. In-depth transcriptome analysis of the red swamp crayfish Procambarus clarkii.

    Directory of Open Access Journals (Sweden)

    Huaishun Shen

    Full Text Available The red swamp crayfish Procambarus clarkii is a highly adaptable, tolerant, and fecund freshwater crayfish that inhabits a wide range of aquatic environments. It is an important crustacean model organism that is used in many research fields, including animal behavior, environmental stress and toxicity, and studies of viral infection. Despite its widespread use, knowledge of the crayfish genome is very limited and insufficient for meaningful research. This is the use of next-generation sequencing techniques to analyze the crayfish transcriptome. A total of 324.97 million raw reads of 100 base pairs were generated, and a total of 88,463 transcripts were assembled de novo using Trinity software, producing 55,278 non-redundant transcripts. Comparison of digital gene expression between four different tissues revealed differentially expressed genes, in which more overexpressed genes were found in the hepatopancreas than in other tissues, and more underexpressed genes were found in the testis and the ovary than in other tissues. Gene ontology (GO and KEGG enrichment analysis of differentially expressed genes revealed that metabolite- and immune-related pathway genes were enriched in the hepatopancreas, and DNA replication-related pathway genes were enriched in the ovary and the testis, which is consistent with the important role of the hepatopancreas in metabolism, immunity, and the stress response, and with that of the ovary and the testis in reproduction. It was also found that 14 vitellogenin transcripts were highly expressed specifically in the hepatopancreas, and 6 transcripts were highly expressed specifically in the ovary, but no vitellogenin transcripts were highly expressed in both the hepatopancreas and the ovary. These results provide new insight into the role of vitellogenin in crustaceans. In addition, 243,764 SNP sites and 43,205 microsatellite sequences were identified in the sequencing data. We believe that our results provide an

  14. Identification and characterization of two arasin-like peptides in red swamp crayfish Procambarus clarkii.

    Science.gov (United States)

    Chai, Lian-Qin; Li, Wan-Wan; Wang, Xian-Wei

    2017-11-01

    Antimicrobial peptides (AMPs) are small effectors in host defense by directly targeting microorganisms or by indirectly modulating immune responses. In the present study, two arasin like AMPs, named as Pc-arasin1 and Pc-arasin2, were identified in red swamp crayfish Procambarus clarkii with sequence similarity to the arasins found in Hyas araneus. Both Pc-arasins consisted of signal peptide, N-terminal proline-rich region and C-terminal region containing four conserved cysteine residues. The similarity of two Pc-arasins was 44.44%, and Pc-arasin2 contained several additional residues in the N-terminus. Multiple alignment of arasin family suggested the conservation of the C-terminus and the variation of the N-terminus of Pc-arasins. Both AMPs were found hemocytes-specific, and the expression could be induced the challenge of bacteria, espeacially by the pathogenic bacterium Aeromonas hydrophila. Knockdown of each Pc-arasin expression by double strand RNA would suppress the host immunity against A. hydrophila, and the commercially synthetic Pc-arasins could rescue the knockdown consequence. Both synthetic peptide showed broad antimicrobial activity towards 3 Gram-positive bacterium and 3 Gram-negative bacterium, and the minimal inhibitory concentrations varied from 6.25 μM to 50 μM. These results presented new data about the sequence, expression and function of arasin family, and emphasized the role of this family in host immune response against bacterial pathogens. The characterization of Pc-arasins also provided potential of therapeutic agent development for disease control in aquaculture based on these two newly identified AMPs. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Nocardia rayongensis sp. nov., isolated from Thai peat swamp forest soil.

    Science.gov (United States)

    Tanasupawat, Somboon; Phongsopitanun, Wongsakorn; Suwanborirux, Khanit; Ohkuma, Moriya; Kudo, Takuji

    2016-05-01

    An actinomycete strain, RY45-3T, isolated from a peat swamp forest soil in Rayong Province, Thailand, was characterized using a polyphasic approach. The strain belonged to the genus Nocardia on the basis of morphological, physiological, biochemical and chemotaxonomic properties. Cell-wall peptidoglycan contained meso-diaminopimelic acid. The N-acyl group of muramic acid in the cell wall was glycolyl type. The diagnostic sugars in whole-cell hydrolysates were galactose and arabinose. MK-8 (H4ω-cycl) was the major menaquinone. The major fatty acids were C16 : 0 and C18 : 1ω9c. The major polar lipids were diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylinositol and phosphatidylinositol mannosides. The genomic DNA G+C content was 71 mol%. On the basis of 16S rRNA gene sequence similarity analysis, strain RY45-3T was closely related to Nocardia jiangxiensis JCM 12861T (98.9 %), Nocardia nova JCM 6044T (98.8 %) and Nocardia pseudobrasiliensis JCM 9894T (98.6 %). The strain showed low levels of DNA-DNA relatedness with N. jiangxiensis JCM 12861T, N. nova JCM 6044T and N. pseudobrasiliensis JCM 9894T (range from 3.6 to 55.3 %). On the basis of the phenotypic characteristics and the results mentioned, this strain could be differentiated from closely related type strains and represents a novel species of the genus Nocardia, for which the name Nocardia rayongensis sp. nov. (type strain RY45-3T = JCM 19832T = TISTR 2213T = PCU 334T) is proposed.

  16. Deforestation projections for carbon-rich peat swamp forests of Central Kalimantan, Indonesia.

    Science.gov (United States)

    Fuller, Douglas O; Hardiono, Martin; Meijaard, Erik

    2011-09-01

    We evaluated three spatially explicit land use and cover change (LUCC) models to project deforestation from 2005-2020 in the carbon-rich peat swamp forests (PSF) of Central Kalimantan, Indonesia. Such models are increasingly used to evaluate the impact of deforestation on carbon fluxes between the biosphere and the atmosphere. We considered both business-as-usual (BAU) and a forest protection scenario to evaluate each model's accuracy, sensitivity, and total projected deforestation and landscape-level fragmentation patterns. The three models, Dinamica EGO (DE), GEOMOD and the Land Change Modeler (LCM), projected similar total deforestation amounts by 2020 with a mean of 1.01 million ha (Mha) and standard deviation of 0.17 Mha. The inclusion of a 0.54 Mha strict protected area in the LCM simulations reduced projected loss to 0.77 Mha over 15 years. Calibrated parameterizations of the models using nearly identical input drivers produced very different landscape properties, as measured by the number of forest patches, mean patch area, contagion, and Euclidean nearest neighbor determined using Fragstats software. The average BAU outputs of the models suggests that Central Kalimantan may lose slightly less than half (45.1%) of its 2005 PSF by 2020 if measures are not taken to reduce deforestation there. The relatively small reduction of 0.24 Mha in deforestation found in the 0.54 Mha protection scenario suggests that these models can identify potential leakage effects in which deforestation is forced to occur elsewhere in response to a policy intervention.

  17. How could a freshwater swamp produce a chemical signature characteristic of a saltmarsh?

    Science.gov (United States)

    McCloskey, Terrence; Smith, Christopher G.; Liu, Kam-biu; Marot, Marci E.; Haller, Christian

    2018-01-01

    Reduction–oxidation (redox) reaction conditions, which are of great importance for the soil chemistry of coastal marshes, can be temporally dynamic. We present a transect of cores from northwest Florida wherein radical postdepositional changes in the redox regime has created atypical geochemical profiles at the bottom of the sedimentary column. The stratigraphy is consistent along the transect, consisting of, from the bottom upward, carbonate bedrock, a gray clay, an organic mud section, a dense clay layer, and an upper organic mud unit representing the current saltwater marsh. However, the geochemical signature of the lower organic mud unit suggests pervasive redox reactions, although the interval has been identified as representing a freshwater marsh, an unlikely environment for such conditions. Analyses indicate that this discrepancy results from postdepositional diagenesis driven by millennial-scale environmental parameters. Rising sea level that led to the deposition of the capping clay layer, created anaerobic conditions in the freshwater swamp interval, and isolated it hydrologically from the rest of the sediment column. The subsequent infiltration of marine water into this organic material led to sulfate reduction, the buildup of H2S and FeS, and anoxic conditions. Continued sulfidation eventually resulted in euxinic conditions, as evidenced by elevated levels of Fe, S, and especially Mo, the diagnostic marker of euxinia. Because this chemical transformation occurred long after the original deposition the geochemical signature does not reflect soil chemistry at the time of deposition and cannot be used to infer syn-depositional environmental conditions, emphasizing the importance of recognizing diagenetic processes in paleoenvironmental studies.

  18. Differences in impacts of Hurricane Sandy on freshwater swamps on the Delmarva Peninsula, Mid−Atlantic Coast, USA

    Science.gov (United States)

    Middleton, Beth A.

    2016-01-01

    Hurricane wind and surge may have different influences on the subsequent composition of forests. During Hurricane Sandy, while damaging winds were highest near landfall in New Jersey, inundation occurred along the entire eastern seaboard from Georgia to Maine. In this study, a comparison of damage from salinity intrusion vs. wind/surge was recorded in swamps of the Delmarva Peninsula along the Pocomoke (MD) and Nanticoke (DE) Rivers, south of the most intense wind damage. Hickory Point Cypress Swamp (Hickory) was closest to the Chesapeake Bay and may have been subjected to a salinity surge as evidenced by elevated salinity levels at a gage upstream of this swamp (storm salinity = 13.1 ppt at Nassawango Creek, Snow Hill, Maryland). After Hurricane Sandy, 8% of the standing trees died at Hickory including Acer rubrum, Amelanchier laevis, Ilex spp., and Taxodium distichum. In Plot 2 of Hickory, 25% of the standing trees were dead, and soil salinity levels were the highest recorded in the study. The most important variables related to structural tree damage were soil salinity and proximity to the Atlantic coast as based on Stepwise Regression and NMDS procedures. Wind damage was mostly restricted to broken branches although tipped−up trees were found at Hickory, Whiton and Porter (species: Liquidamabar styraciflua, Pinus taeda, Populus deltoides, Quercus pagoda and Ilex spp.). These trees fell mostly in an east or east−southeast direction (88o−107o) in keeping with the wind direction of Hurricane Sandy on the Delmarva Peninsula. Coastal restoration and management can be informed by the specific differences in hurricane damage to vegetation by salt versus wind.

  19. Pseudocapillaria (Ichthyocapillaria) ophisterni sp. n. (Nematoda : Capillariidae) from the swamp-eel Ophisternon aenigmaticum (Pisces) in Mexico.

    Science.gov (United States)

    Moravec, F; Salgado-Maldonado, G; Jiménez-García, I

    2000-04-01

    A new nematode species, Pseudocapillaria ophisterni sp. n., is described from the intestine and rarely from the stomach of the swamp-eel, Ophisternon aenigmaticum Rosen et Greenwood, from Catemaco Lake, Veracruz, Mexico. In having both caudal lobes in the male interconnected by a distinct dorsal membrane, it belongs to the subgenus Ichthyocapillaria. It differs from the three species in this subgenus mainly in possessing either a distinctly longer spicule or a smaller length of oesophagus relative to body length. It also differs in host type and geographical distribution. P. ophisterni is the first capillariid species reported from synbranchiform fishes.

  20. Nitrogen Dynamics Along a Headwater Stream Draining a Fen, Swamp, and Marsh in a Fractured Dolomite Watershed

    Science.gov (United States)

    Duval, T. P.; Waddington, J. M.

    2009-05-01

    Stream-wetland interaction has been shown to have a significant effect on nutrient cycling and downstream water quality. Additionally, connection to regional groundwater systems can dilute or enrich stream water with a number of dissolved constituents. This study demonstrates the resultant downstream change in dissolved nitrogen species as a hardwater stream emerges from a calcareous aquifer and traverses a calcareous fen, a cedar swamp, and a cattail marsh over two growing seasons, a very dry 2006 and a very wet 2007. Upon emergence at a number of groundwater seeps, the water contained appreciable nitrate levels averaging 2.72±0.42 mg NO3-N L-1, minimal organic nitrogen, and ammonium below detectable levels. Through the gently sloping calcareous fen, with a stream residence time of ~ 5 hours, NO3-N concentration decreases of 0.35 mg L-1 were observed. Concomitantly, stream recharge into the dolomite bedrock depressed stream discharge values significantly, further removing nitrate from the stream system. This resulted in the fen-bedrock system acting as an estimated net sink of 432 kg of NO3-N in the early summer of 2007, for example. In contrast, the hydrological-biogeochemical systems became decoupled through the swamp during the same period, where concentrations increased from 2.58±0.34 mg L-1 entering the swamp to 2.65±0.58 mg L-1 exiting, but streamflow decreased in general by 5 L s- 1. This resulted in the swamp, with its large depression storage, acting as a small net sink of nitrate (75 kg through the early summer), which would not be detected simply from concentration changes. The concentration-discharge relation realigned through the marsh, where significant groundwater entered the wetland, increasing both concentration and discharge, yielding a small export of 93 kg over the same time period. A series of tracer injections in each wetland type will be presented to compare the streamflow- concentration patterns with the measured nutrient spiralling

  1. Recent benthic foraminifera assemblages from mangrove swamp and channels of Abu Dhabi (UAE)

    Science.gov (United States)

    Fiorini, Flavia; Lokier, Stephen W.; Odeh, Weaam A. S. Al; Paul, Andreas; Song, Jianfeng; Freeman, Mark; Michel, Françoise

    2017-04-01

    Zonation of Recent mangrove environments can be defined using benthic foraminifera, however, little is known about foraminifera from mangrove environments of the Persian/Arabian Gulf. The objective of this study is to produce a detailed micropaleontological and sedimentological analysis to identify foraminiferal associations from mangrove swamps and channels located on the eastern side of Abu Dhabi Island (UAE). Detailed sediment sampling collection in mangal environments of Eastern Abu Dhabi was carried out to assess the distribution of benthic foraminifera in different sedimentary facies in the mangal and in the surrounding natural environments of the upper and lower intertidal area (mud flats and channels). A 100 m transect across a natural channel in a mangal on the eastern side of Abu Dhabi Island was sampled in detail for sedimentological and foraminiferal analysis. Forty-seven samples were collected at 2 meter intervals along the transect in a number of different sedimentary facies including; fine sediment in areas exposed during low tide and close to mangrove trees (Avicennia marina), fine sediment rich in leaf material, coarse sediment in channels, and coarse sediments with a shell lag. At each sampling location environmental parameters were recorded, including water depth, salinity, temperature and pH. Samples collected for foraminiferal analysis were stained in rose Bengal in order to identify living specimens. Samples collected on the mud flat at the margin of the channel show a living foraminiferal assemblage characterised by abundant foraminifera belonging to the genera Ammonia, Elphidium, Cribroelphidium, Triloculina, Quinqueloculina, Sigmoilinita, Spiroloculina, Peneroplis and Spirolina. Samples collected in the lower (wet) intertidal area close to Avicennia marina roots, presented a low-diversity assemblage mostly comprising small-sized opportunistic foraminifera of the genera Ammonia and Cribroelphidium along with rare Triloculina and

  2. POTENCY OF BIOCONTROL AGENTS ISOLATED FROM COMPOST AND PEAT SOIL OF TROPICAL PEAT SWAMP FOREST IN KALAMPANGAN ZONE, CENTRAL KALIMANTAN

    Directory of Open Access Journals (Sweden)

    Yuliar Yuliar

    2011-12-01

    Full Text Available Rhizoctonia solani is a soil pathogen that causes diseases in wide range of hosts of agricultural, horticultural and flower crops. Biological control is the most promising way for the diseases management and it is environment friendly too. The objective of this study was to isolate and screen the potency of soil bacteria as biological control from various local compost and peat soil of tropical peat swamp forest in Kalampangan Zone, Central Kalimantan. Forty seven isolates from peat soil and compost were screened for biocontrol agent of Rhizoctonia solani . R. Solani Seven out of thirteen peat soil isolates, and six out of thirty three compost isolates showed antagonistic activity against in Potato Dextrose Agar. The cultivation of the antagonistic isolates in Trypticase Soy Broth (TSB was extracted and analysed by high performance liquid chromatography (HPLC column. The HPLC analyzes indicated that the antagonistic isolates produce an antifungal iturin A. Macroscopic observation of isolates colonies showed that form of their colonies were amuboid, myceloid, curled, circular, rhizoid, irregular and filamentous. These achievement indicate peat swamp forest not only offer a potential biocontrol agents of damping off but also provide a new source for production of antibiotics.

  3. Gnathostoma spinigerum in live Asian swamp eels (Monopterus spp.) from food markets and wild populations, United States

    Science.gov (United States)

    Cole, Rebecca A.; Choudhury, Anindo; Nico, Leo G.; Griffin, Kathryn M.

    2014-01-01

    In Southeast Asia, swamp eels (Synbranchidae: Monopterus spp.) are a common source of human gnathostomiasis, a foodborne zoonosis caused by advanced third-stage larvae (AL3) of Gnathostoma spp. nematodes. Live Asian swamp eels are imported to US ethnic food markets, and wild populations exist in several states. To determine whether these eels are infected, we examined 47 eels from markets and 67 wild-caught specimens. Nematodes were identified by morphologic features and ribosomal intergenic transcribed spacer–2 gene sequencing. Thirteen (27.7%) M. cuchia eels from markets were infected with 36 live G. spinigerum AL3: 21 (58.3%) in liver; 7 (19.4%) in muscle; 5 (13.8%) in gastrointestinal tract, and 3 (8.3%) in kidneys. Three (4.5%) wild-caught M. albus eels were infected with 5 G. turgidum AL3 in muscle, and 1 G. lamothei AL3 was found in a kidney (both North American spp.). Imported live eels are a potential source of human gnathostomiasis in the United States.

  4. Epiphytic ferns in swamp forest remnants of the coastal plain of southern Brazil: latitudinal effects on the plant community

    Directory of Open Access Journals (Sweden)

    Letícia S. Machado

    Full Text Available ABSTRACT Community structure and spatial distribution of epiphytic ferns in swamp forest remnants along the coastal plain of the state of Rio Grande do Sul were analyzed. A total of 440 trees were sampled in fifty-seven 10 x 10 m plots. Each phorophyte was divided into five ecological zones (strata, where all species of epiphytic ferns were recorded. A total of 34 species representing 18 genera in six families were recorded. Polypodiaceae was the most represented family with 17 species, and Microgramma vacciniifolia had the highest epiphytic importance value. Characteristic holoepiphyte was the predominant ecological category, representing 70 % of the species. Ordination analysis showed a gradual change in floristic composition between ecological zones with richness differing significantly between strata. We observed that with increasing latitude there was a decrease in mean temperature and total rainfall, but an increase in frosts. These climatic and phytogeography changes result in a reduction in species richness and a change in the structure of epiphytic fern communities in a north-to-south direction. The importance of swamp forest remnants of the coastal plain to the diversity of epiphytic ferns is discussed.

  5. 'Leaves and eats shoots': direct terrestrial feeding can supplement invasive red swamp crayfish in times of need.

    Directory of Open Access Journals (Sweden)

    Jonathan Grey

    Full Text Available We used stable isotope analyses to characterise the feeding dynamics of a population of red swamp crayfish in Lake Naivasha, Kenya, after the crash of submerged macrophytes and associated macroinvertebrates, and during a natural draw-down of the lake water level. We expected a heavy reliance upon a diet of detrital matter to sustain the population as a consequence, and indeed, for the majority of the crayfish population caught from the lake, we saw a concomitant shift in isotopic values reflecting a dietary change. However, we also caught individual crayfish that had occupied the footprints of hippopotamus and effectively extended their range beyond the lake up to 40 m into the riparian zone. Isotopic analysis confirmed limited nocturnal observations that these individuals were consuming living terrestrial plants in the vicinity of the footprints. These are the first empirical data to demonstrate direct use of terrestrial resources by an aquatic crayfish species and further highlight the traits that make red swamp crayfish such opportunistic and successful invaders.

  6. Identifying the best season for mapping evergreen swamp and mangrove species using leaf-level spectra in an estuarine system in KwaZulu-Natal, South Africa

    CSIR Research Space (South Africa)

    Van Deventer, Heidi

    2014-10-01

    Full Text Available Swamp and mangrove forests are some of the most threatened forest types in the world. In Africa, these forests are essential in providing food, construction material and medicine to people. These forest types have not sufficiently been mapped...

  7. Integrating local ecological knowledge and management practices of an isolated semi-arid papyrus swamp (Loboi, Kenya) into a wider conservation framework.

    Science.gov (United States)

    Terer, Taita; Muasya, A Muthama; Dahdouh-Guebas, Farid; Ndiritu, George G; Triest, Ludwig

    2012-01-01

    The current study documented local utilization of Cyperus papyrus L. (papyrus), harvesting patterns, threats, and local management practices among the Endorois community living around Loboi swamp (Kenya). Papyrus is a highly productive freshwater macrophyte that is widely utilized throughout tropical Africa. However, increased human population and poverty, has led to over exploitation and conversion of papyrus wetlands to agricultural fields. Nonetheless, users of papyrus hold important local ecological knowledge (LEK) and practices. We show that Endorois practices on papyrus uses are compatible with the management priorities of the swamp and a wider conservation framework using data obtained from three focus group discussions (FGD), interviews of 34 households and 15 key informants. The study revealed that papyrus support local livelihood notably as a source of income (papyrus mats are sold), cattle fodder, roofing materials (shelter), and cooking fuel. The study further revealed important LEK relating to harvesting patterns, recovery after harvesting and traditional management practices. Correlation and principal component analyses showed that experienced old harvesters (EXPERT) avoided harvesting repeatedly at the same location (REVISIT), thereby allowing recovery of papyrus when compared to younger harvesters (r = 0.63, p papyrus coverage in the future due to the current diversion of water from the swamp, and frequent droughts, despite the instituted traditional management strategies (e.g. rotational harvesting) to curb overharvesting. The study concluded that the documentation of site-scale papyrus users' profile, LEK, and traditional practices are vital for the conservation and management of Loboi swamp. Copyright © 2011 Elsevier Ltd. All rights reserved.

  8. Yeast communities in Sphagnum phyllosphere along the temperature-moisture ecocline in the boreal forest-swamp ecosystem and description of Candida sphagnicola sp. nov.

    Science.gov (United States)

    Kachalkin, Aleksey V; Yurkov, Andrey M

    2012-06-01

    The effects of the temperature-moisture factors on the phylloplane yeast communities inhabiting Sphagnum mosses were studied along the transition from a boreal forest to a swamp biotope at the Central Forest State Biosphere Reserve (Tver region, Russia). We tested the hypothesis that microclimatic parameters affect yeast community composition and structure even on a rather small spatial scale. Using a conventional plating technique we isolated and identified by molecular methods a total of 15 species of yeasts. Total yeast counts and species richness values did not depend on environmental factors, although yeast community composition and structure did. On average, Sphagnum in the swamp biotope supported a more evenly structured yeast community. Relative abundance of ascomycetous yeasts was significantly higher on swamp moss. Rhodotorula mucilaginosa dominated in the spruce forest and Cryptococcus magnus was more abundant in the swamp. Our study confirmed the low occurrence of tremellaceous yeasts in the Sphagnum phyllosphere. Of the few isolated ascomycetous yeast and yeast-like species, some were differentiated from hitherto known species in physiological tests and phylogenetic analyses. We describe one of them as Candida sphagnicola and designate KBP Y-3887(T) (=CBS 11774(T) = VKPM Y-3566(T) = MUCL 53590(T)) as the type strain. The new species was registered in MycoBank under MB 563443.

  9. Draft Genome Sequences of Two Antimicrobial-Producing Burkholderia sp. Strains, MSh1 and MSh2, Isolated from Malaysian Tropical Peat Swamp Forest Soil

    Science.gov (United States)

    Aw, Yoong Kit; Gan, Han Ming; Yule, Catherine M.; Lee, Sui Mae

    2014-01-01

    We report the draft genome sequences of two antimicrobial-producing isolates, Burkholderia sp. strains MSh1 and MSh2, which were isolated from tropical peat swamp forest soil. Putative genes related to different antimicrobial production have been annotated in both genome sequences. PMID:25301661

  10. Comparing Avocado, Swamp Bay, and Camphortree as Hosts of Raffaelea lauricola Using a Green Fluorescent Protein (GFP)-Labeled Strain of the Pathogen.

    Science.gov (United States)

    Campbell, A S; Ploetz, R C; Rollins, J A

    2017-01-01

    Raffaelea lauricola, a fungal symbiont of the ambrosia beetle Xyleborus glabratus, causes laurel wilt in members of the Lauraceae plant family. North American species in the family, such as avocado (Persea americana) and swamp bay (P. palustris), are particularly susceptible to laurel wilt, whereas the Asian camphortree (Cinnamomum camphora) is relatively tolerant. To determine whether susceptibility is related to pathogen colonization, a green fluorescent protein-labeled strain of R. lauricola was generated and used to inoculate avocado, swamp bay, and camphortree. Trees were harvested 3, 10, and 30 days after inoculation (DAI), and disease severity was rated on a 1-to-10 scale. By 30 DAI, avocado and swamp bay developed significantly more severe disease than camphortree (mean severities of 6.8 and 5.5 versus 1.6, P avocado than camphortree (0.9% versus 0.1%, P avocado (r = 0.74), swamp bay (r = 0.82), and camphortree (r = 0.87), even severely affected trees of all species were scarcely colonized by the pathogen.

  11. Strong and stable geographic differentiation of swamp buffalo maternal and paternal lineages indicates domestication in the China/Indochina border region

    NARCIS (Netherlands)

    Zhang, Yi; Lu, Yongfang; Yindee, Marnoch; Li, Kuan-Yi; Kuo, Hsiao-Yun; Ju, Yu-Ten; Ye, Shaohui; Faruque, Md Omar; Li, Qiang; Wang, Yachun; Cuong, Vu Chi; Pham, Lan Doan; Bouahom, Bounthong; Yang, Bingzhuang; Liang, Xianwei; Cai, Zhihua; Vankan, Dianne; Manatchaiworakul, Wallaya; Kowlim, Nonglid; Duangchantrasiri, Somphot; Wajjwalku, Worawidh; Colenbrander, Ben; Zhang, Yuan; Beerli, Peter; Lenstra, Johannes A; Barker, J Stuart F

    The swamp type of the Asian water buffalo is assumed to have been domesticated by about 4000 years BP, following the introduction of rice cultivation. Previous localizations of the domestication site were based on mitochondrial DNA (mtDNA) variation within China, accounting only for the maternal

  12. Evolution of Pennsylvanian (Late Carboniferous) peat swamps of the Ruhr Basin, Germany: Comparison of palynological, coal petrographical and organic geochemical data

    Energy Technology Data Exchange (ETDEWEB)

    Jasper, K. [Institute of Geology and Geochemistry of Petroleum and Coal, Lochnerstr. 4-20, RWTH Aachen University, 52056 Aachen (Germany); Institute of Geology and Palaeontology, Lochnerstr. 4-20, RWTH Aachen University, 52056 Aachen (Germany); Hartkopf-Froeder, C. [Geological Survey North Rhine-Westphalia, de-Greiff-Strasse 195, 47803 Krefeld (Germany); Flajs, G. [Institute of Geology and Palaeontology, Lochnerstr. 4-20, RWTH Aachen University, 52056 Aachen (Germany); Littke, R. [Institute of Geology and Geochemistry of Petroleum and Coal, Lochnerstr. 4-20, RWTH Aachen University, 52056 Aachen (Germany)

    2010-09-01

    This study focuses on the reconstruction of the environment during peat swamp development. Eight coal and sedimentary organic rock bearing seam successions were examined all belonging to the Duckmantian (Pennsylvanian, Late Carboniferous). 410 samples were analysed with coal petrographical methods, 155 of these also by palynological methods. In addition, on 55 samples organic geochemical investigations were carried out with respect to n-alkanes and iso-alkanes. The established coal petrographical parameters gelification index (GI), tissue preservation index (TPI), groundwater index (GWI) and vegetation index (VI) were used to characterize different periods of peat swamp development. Furthermore, the new index WCI (= Water Cover Index) was introduced to reflect water level conditions by using the ratio between hydrophilous/hygrophilous and mesophilous plants. In this study the index is based on palynological data but can be equally applied when quantitative macrofloral counts are available. GI versus TPI values show two general trends of peat swamp evolution: low GI and TPI values as indicator for drier swamp conditions like ombrogenous mires and high GI and TPI values which show a trend to water covered environments like topogenous mires. In addition, ash yields and GWI versus VI data also emphasize a general trend from topogenous to ombrogenous mires. A decrease in water level towards the top of the seams and thus resulting in the development of domed mires is reflected by the newly introduced WCI. Hence, these parameters show recurrent peat swamp successions, characterized by mineral- and vitrinite-rich coals, typical for topogenous swamps and an evolution towards inertinite/liptinite-rich coals with low ash yield, typical for ombrogenous swamps. n-alkane ratios like the carbon preference index (CPI), pristane/n-C{sub 17}, phytane/n-C{sub 18}, pristane/phytane and the n-C{sub 17}/n-C{sub 27} relationship indicate a strong correlation of these parameters with

  13. The Analysis of Management and Timber Trade System of Gelam (Melaleuca cajuputi From Peat Swamp Forest in South Kalimantan

    Directory of Open Access Journals (Sweden)

    Yudi Firmanul Ariffin

    2015-05-01

    Full Text Available Until now the raw material of wood especially Gelam (Melaleuca cajuputi available for supporting the construction of housing and other infrastructures is increasingly large in Indonesia. On the Island of Borneo that partly consists of swamps needs Gelam very large and continuous, particularly for residential development. However, areas of peat swamp forest habitat of this plant from year to year are degradation and shrinkage. This situation is a very big influence on the population of Gelam, while the management and timber trade systems are not well regulated. This study aims to analyze the management and timber trade systems of Gelam particularly in South Kalimantan to provide input to the policy holder in the preservation of Gelam. The method was used a field survey and interviews with traders and policy holders related regulations. The results showed in South Kalimantan the potency of Gelam is only 2,9-7,1 m3/ha and decreasing yearly. Normally Gelam with a diameter <4 cm have been cut down, as well as > 30 cm. These dimensions should not be cut because of <4 cm too young and > 30 cm can be used as seed sources. Gelam derived from peat swamp forest, which mostly comes from the Batola District and some came from Kapuas District of Central Kalimantan. Distributions of Gelam were starting gatherers logging in the forest then sold to small gatherers, next to the large gatherers and distributed to all districts/cities in South Kalimantan, wood processing industries, and some of them were sent to Java. The silviculture system of Gelam was using selective cutting. Classification of wood sizes traded by the diameter divided into 3-4cm, 5-6cm, 7-8cm, 9-10cm, 11-12cm, 13-14cm, 15-19cm and > 20cm to 4m long. Its use consists of a small diameter (3-10cm for foundry building and firewood, while the large diameter (10-20cm for the construction of houses in swampy areas, and waste as well as the stems are bent and deformed used for firewood. Until now Gelam

  14. Effects of Supplementation of Eucalyptus (E. Camaldulensis) Leaf Meal on Feed Intake and Rumen Fermentation Efficiency in Swamp Buffaloes

    Science.gov (United States)

    Thao, N. T.; Wanapat, M.; Kang, S.; Cherdthong, A.

    2015-01-01

    Four rumen fistulated swamp buffaloes were randomly assigned according to a 4×4 Latin square design to investigate the effects of Eucalyptus (E. Camaldulensis) leaf meal (ELM) supplementation as a rumen enhancer on feed intake and rumen fermentation characteristics. The dietary treatments were as follows: T1 = 0 g ELM/hd/d; T2 = 40 g ELM/hd/d; T3 = 80 g ELM/hd/d; T4 = 120 g ELM/hd/d, respectively. Experimental animals were kept in individual pens and concentrate was offered at 0.3% BW while rice straw was fed ad libitum. The results revealed that voluntary feed intake and digestion coefficients of nutrients were similar among treatments. Ruminal pH, temperature and blood urea nitrogen concentrations were not affected by ELM supplementation; however, ELM supplementation resulted in lower concentration of ruminal ammonia nitrogen. Total volatile fatty acids, propionate concentration increased with the increasing level of EML (pefficiency. PMID:26104399

  15. Water-use dynamics of a peat swamp forest and a dune forest in Maputaland, South Africa

    Science.gov (United States)

    Clulow, A. D.; Everson, C. S.; Price, J. S.; Jewitt, G. P. W.; Scott-Shaw, B. C.

    2013-05-01

    Peat swamp forests are the second rarest forest type found in South Africa while dune forests have been under severe threat through mining and agriculture. Both forest types exist in the conservation area, and World Heritage site, known as the iSimangaliso Wetland Park on the East coast of South Africa. The area is prone to severe droughts (Taylor et al., 2006) and recent attempts to understand the local water balance revealed that there was insufficient information on the water use of the indigenous forests of the area. The peat swamp forest and dune forest sites studied in this research were located within close proximity to each other, yet, are characterised by different landscape positions in terms of water availability. The coastal dune forest soil profile was generally dry and sandy and the tree roots did not have access to the water table. In contrast the peat swamp forest is located in an interdunal wetland where the trees have permanent access to water. The climate at both sites is subtropical with a mean annual precipitation of 1200 mm yr-1. However, over 20 months of measurement, the first summer (October 2009 to March 2010) was drier (424 versus 735 mm) than the second summer (October 2010 to March 2011) emphasising the variability of the rainfall in the area and providing a wide range of conditions measured. The sap flow of an evergreen, overstory Syzygium cordatum and a semi-deciduous, understory Shirakiopsis elliptica were measured in the peat swamp forest using the heat ratio method. The Syzygium cordatum water use was not highly seasonal and the daily maximum water use ranged from approximately 30 L d-1 in winter to 45 L d-1 in summer whereas the Shirakiopsis elliptica water use was more seasonal at 2 L d-1 in winter and 12 L d-1 in summer. The water use of the Syzygium cordatum was not influenced by seasonal rainfall variations and was actually higher in the drier summer (October 2009 to March 2010). Three trees of different heights were monitored

  16. Water-use dynamics of a peat swamp forest and a dune forest in Maputaland, South Africa

    Directory of Open Access Journals (Sweden)

    A. D. Clulow

    2013-05-01

    Full Text Available Peat swamp forests are the second rarest forest type found in South Africa while dune forests have been under severe threat through mining and agriculture. Both forest types exist in the conservation area, and World Heritage site, known as the iSimangaliso Wetland Park on the East coast of South Africa. The area is prone to severe droughts (Taylor et al., 2006 and recent attempts to understand the local water balance revealed that there was insufficient information on the water use of the indigenous forests of the area. The peat swamp forest and dune forest sites studied in this research were located within close proximity to each other, yet, are characterised by different landscape positions in terms of water availability. The coastal dune forest soil profile was generally dry and sandy and the tree roots did not have access to the water table. In contrast the peat swamp forest is located in an interdunal wetland where the trees have permanent access to water. The climate at both sites is subtropical with a mean annual precipitation of 1200 mm yr−1. However, over 20 months of measurement, the first summer (October 2009 to March 2010 was drier (424 versus 735 mm than the second summer (October 2010 to March 2011 emphasising the variability of the rainfall in the area and providing a wide range of conditions measured. The sap flow of an evergreen, overstory Syzygium cordatum and a semi-deciduous, understory Shirakiopsis elliptica were measured in the peat swamp forest using the heat ratio method. The Syzygium cordatum water use was not highly seasonal and the daily maximum water use ranged from approximately 30 L d−1 in winter to 45 L d−1 in summer whereas the extit{Shirakiopsis elliptica} water use was more seasonal at 2 L d−1 in winter and 12 L d−1 in summer. The water use of the Syzygium cordatum was not influenced by seasonal rainfall variations and was actually higher in the drier summer (October 2009 to March 2010. Three trees of

  17. Estimating population size of the red swamp crayfish (Procambarus clarkii in fish-ponds (Brenne, Central France

    Directory of Open Access Journals (Sweden)

    Coignet A.

    2012-07-01

    Full Text Available The red swamp crayfish, Procambarus clarkii, was discovered in 2007 in the “Parc naturel régional (PNR de la Brenne” (France. Ten colonized sites have been identified in the park to date, including two new sites discovered in 2011. The present study aims at establishing a protocol suitable for estimating the population size of P. clarkii by the use of a Capture-Mark-Recapture (CMR technique in a chain of five connected fish-ponds. Results show different cohorts of individuals among seasons and fish-ponds. However, trapping effort was not efficient enough to obtain an accurate estimate of the population size of this species in a fish-pond larger than 2 − 3 ha. On the other hand, the adopted protocol appeared useful to assess, in smaller fish-ponds, the effect of intensive trapping and other control methods on P. clarkii populations.

  18. Effect of Ground Corn Cob Replacement for Cassava Chip on Feed Intake, Rumen Fermentation and Urinary Derivatives in Swamp Buffaloes

    Directory of Open Access Journals (Sweden)

    M. Wanapat

    2012-08-01

    Full Text Available Four Thai - rumen fistulated male swamp buffaloes (Bubalus bubalis, about four years old with 400±20 kg liveweight, were randomly assigned according to a 4×4 Latin square design to receive dietary treatments. The treatments were: ground corn cob (GCC replacement for cassava chip (CC in concentrate at 0% (T1; GCC replacement at 33% (T2; GCC replacement at 67% (T3; and GCC replacement at 100% (T4, respectively. During the experiment, concentrate was offered at 0.5% BW while 5% urea-treated rice straw was given at ad libitum. The result revealed that there was no effect of GCC replacement on DMI among treatments. In addition, digestibilities of DM, OM and CP were not different while aNDF linearly increased with an increasing level of GCC replacement. However, GCC replacement did not affect rumen fermentation such as ruminal pH, NH3-N and VFA concentration; except C3 proportion which was the highest at 33% replacement while the lowest was at 100% replacement. All replacements of GCC resulted in similar protozoal and bacterial populations and microbial protein synthesis (MPS. Purine derivatives (PD concentration in urine and PD to creatinine (PDC index were varied with time of urination and among treatments at 0 to 8 and 8 to 16 h post feeding and higher values were shown among the GCC replacement groups. However at 16 to 24 h-post feeding, it was untraceable. In addition, creatinine concentration was similar among all treatments at every sampling time. Based on the above results, GCC can be used as an energy source for swamp buffalo fed with rice straw. Spot sampling of urine can be used for purine derivatives determination.

  19. Insect emergence in relation to floods in wet meadows and swamps in the River Dalälven floodplain.

    Science.gov (United States)

    Vinnersten, T Z Persson; Östman, Ö; Schäfer, M L; Lundström, J O

    2014-08-01

    Annual variation in flood frequency and hydroperiod during the vegetation season has ecological impacts on the floodplain biota. Although many insect groups may have a lower emergence during a flood event, it is poorly known how annual emergence of insects in temporary wetlands is related to the variation in hydrology. Between May and September, we studied the weekly emergence of 18 insect taxa over six consecutive years, 2002-2007, in six temporary flooded wetlands (four wet meadows and two forest swamps) in the River Dalälven floodplains, Central Sweden. We used emergence traps to collect emerging insects from terrestrial and aquatic parts of wet meadows and swamp forests. In all wetlands, the insect fauna was numerically dominated by the orders Diptera, Hymenoptera, Coleoptera and Homoptera. On a weekly basis, 9 out of the 18 insect taxa had lower emergence in weeks with flood than in weeks with no flood, whereas no taxon had a higher emergence in weeks with flood. Over the seasons, we related insect emergence to seasonal flood frequency and length of hydroperiod. The emergence of most studied taxa decreased with increasing hydroperiod, which suggests that emergence after floods do not compensate for the reduced emergence during floods. Only Culicidae and the aquatic Chironomidae sub-families Tanypodinae and Chironominae showed an increase in emergence with increasing hydroperiod, whereas Staphylinidae peaked at intermediate hydroperiod. We conclude that a hydroperiod covering up to 40% of the vegetation season has a significant negative effect on the emergence of most taxa and that only a few taxa occurring in the temporary wetlands are actually favoured by a flood regime with recurrent and unpredictable floods.

  20. Locomotor behavior of wild orangutans (Pongo pygmaeus wurmbii) in disturbed peat swamp forest, Sabangau, Central Kalimantan, Indonesia.

    Science.gov (United States)

    Manduell, Kirsten L; Morrogh-Bernard, Helen C; Thorpe, Susannah K S

    2011-07-01

    This study examined the locomotor behavior of wild Bornean orangutans (P. p. wurmbii) in an area of disturbed peat swamp forest (Sabangau Catchment, Indonesia) in relation to the height in the canopy, age-sex class, behavior (feeding or traveling), and the number of supports used to bear body mass. Backward elimination log-linear modeling was employed to expose the main influences on orangutan locomotion. Our results showed that the most important distinctions with regard to locomotion were between suspensory and compressive, or, orthograde (vertical trunk) and pronograde (horizontal trunk) behavior. Whether orangutans were traveling or feeding had the most important influence on locomotion whereby compressive locomotion had a strong association with feeding, suspensory locomotion had a strong association with travel in the peripheral strata using multiple supports, whereas vertical climb/descent and oscillation showed a strong association with travel on single supports in the core stratum. In contrast to theoretical predictions on positional behavior and body size, age-sex category had a limited influence on locomotion. The study revealed that torso orthograde suspension dominates orangutan locomotion, concurring with previous studies in dipterocarp forest. But, orangutans in the Sabangau exhibited substantially higher frequencies of oscillatory locomotion than observed at other sites, suggesting this behavior confers particular benefits for traversing the highly compliant arboreal environment typical of disturbed peat swamp forest. In addition, torso pronograde suspensory locomotion was observed at much lower levels than in the Sumatran species. Together these results highlight the necessity for further examination of differences between species, which control for habitat. Copyright © 2011 Wiley-Liss, Inc.

  1. Calculation method for determination of carbon in the peatand moss litter of forest swamps by ash content of plant substrates

    Directory of Open Access Journals (Sweden)

    T. T. Efremova

    2016-12-01

    Full Text Available Studies were carried out in the lowmountain part of the Kuznetsk Alatau. The spruce stands were studied in the peaty valley of river Tunguzhul and swamp near Agaskyr Lake (valley of river Pechische, basin of river Black Iyus. The objects belong to the group of high ash content flood plain peat lands of cryogenicseries. We have done the evaluation of organic carbon response to physical-chemical properties – decomposition degree, ash content, and bulk density, connected together (r – 0.5–0.7, that in contrast to carbon, is easy determined analytically. Received results according to stepwise regression analysis characterize the strong conditionality predictors of carbon: multiple determination index R2 – 0.86. The highest partial correlation coefficient with the response belongs to the ash content in range (5–68 %. Partial correlation coefficient values of bulk density and decomposition degree is not significant. The determination index (R2 – 0.93, constant and negative coefficient of pair regression analysis are highly significant and evidence of the strong bond of carbon and organic substrate ash content. The relative error of approximation is in the range of 2–8 % and characterizes the high accuracy of prognosis. Including only one indicator (ash content in the calculation formula makes it convenient and simple in practical application for the carbon content prediction on the forest litter, modern peat soils, buried peat and peat-mineral formations with ash content of 5–68 %. We are the first to present the geochemical characteristics of forest swamps peat mine for the KuznetskAlatau intermountain basins.

  2. The complete chloroplast genome sequence of an important medicinal plant Cynanchum wilfordii (Maxim.) Hemsl. (Apocynaceae).

    Science.gov (United States)

    Park, Hyun-Seung; Kim, Kyu-Yeob; Kim, Kyunghee; Lee, Sang-Choon; Lee, Junki; Seong, Rack Seon; Shim, Young Hun; Sung, Sang Hyun; Yang, Tae-Jin

    2016-09-01

    Cynanchum wilfordii (Maxim.) Hemsl. is a traditional medicinal herb belonging to the Asclepiadoideae subfamily, whose dried roots have been used as traditional medicine in Asia. The complete chloroplast genome of C. wilfordii was generated by de novo assembly using the small amount of whole genome sequencing data. The chloroplast genome of C. wilfordii was 161 241 bp long, composed of large single copy region (91 995 bp), small single copy region (19 930 bp) and a pair of inverted repeat regions (24 658 bp). The overall GC contents of the chloroplast genome was 37.8%. A total of 114 genes were annotated, which included 80 protein-coding genes, 30 tRNA genes and 4 rRNA genes. Phylogenetic analysis with the reported chloroplast genomes revealed that C. wilfordii is most closely related to Asclepias nivea (Caribbean milkweed) and Asclepias syriaca (common milkweed) within the Asclepiadoideae subfamily.

  3. Integrating local ecological knowledge and management practices of an isolated semi-arid papyrus swamp (Loboi, Kenya) into a wider conservation framework

    OpenAIRE

    Terer, T.; Muasya, A.M.; Dahdouh-Guebas, F.; Ndiritu, G.G.; Triest, L.

    2012-01-01

    The current study documented local utilization of Cyperus papyrus L. (papyrus), harvesting patterns, threats, and local management practices among the Endorois community living around Loboi swamp (Kenya). Papyrus is a highly productive freshwater macrophyte that is widely utilized throughout tropical Africa. However, increased human population and poverty, has led to over exploitation and conversion of papyrus wetlands to agricultural fields. Nonetheless, users of papyrus hold important local...

  4. Effects of Hurricane Katrina on the forest structure of taxodium distichum swamps of the Gulf Coast, USA

    Science.gov (United States)

    Middleton, B.A.

    2009-01-01

    Hurricane Katrina pushed mixed Taxodium distichum forests toward a dominance of Taxodium distichum (baldcypress) and Nyssa aquatica (water tupelo) because these species had lower levels of susceptibility to wind damage than other woody species. This study documents the volume of dead versus live material of woody trees and shrubs of T. distichum swamps following Hurricane Katrina along the Gulf Coast of Mississippi and Louisiana. Pearl River Wildlife Management Area near Canton, Mississippi had the highest winds of the study areas, and these forests were located in the northeast quadrant of Hurricane Katrina (sustained wind 151 kph (94 mph)). Jean Lafitte National Historical Park and Preserve south of New Orleans had medium to high winds (sustained winds 111 kph (69 mph) at the New Orleans lakefront). Cat Island National Wildlife Refuge had a lower level of winds and was positioned on the western edge of the storm. The forests at Pearl River and to a lesser extent at Jean Lafitte had the highest amount of structural damage in the study. For Cat Island, Jean Lafitte, and Pearl River, the total volume of dead material (debris) was 50, 80, and 370 m3 ha-1, respectively. The ratio of dead to live volume was 0.010, 0.082, and 0.039, respectively. For both of the dominant species, T. distichum and N. aquatica, the percentage of dead to live volume was less than 1. Subdominant species including Acer rubrum, Liquidambar styraciflua, Quercus lyrata, and Quercus nigra were more damaged by the storm at both Pearl River and Jean Lafitte. Only branches were damaged by Hurricane Katrina at Cat Island. Shrubs such as Morella cerifera, Euonymous sp., and Vaccinium sp. were often killed by the storm, while other species such as Cephalanthus occidentalis, Forestiera acuminata, and Cornus florida were not killed. Despite the fact that Hurricane Katrina was a Category 3 storm and struck Pearl River and Jean Lafitte fairly directly, dominant species of the T. distichum swamps were

  5. What does the study of swamp ecological transition(s) tell us about past climatic conditions in East Africa?

    Science.gov (United States)

    Coffinet, Sarah; Huguet, Arnaud; Pedentchouk, Nikolai; Anquetil, Christelle; Kolaczek, Piotr; Kolaczek, Monika; Galka, Marius; Williamson, David; Bergonzini, Laurent; Majule, Amos; Laggoun-Défarge, Fatima; Wagner, Thomas; Derenne, Sylvie

    2016-04-01

    Peatlands represent only 3-5% of the total world land cover (Gorham, 1991) but approximately 20-30% of the total carbon storage of the world. However, they have so far been scarcely used as paleoclimate archives. The aim of this work was to reconstruct past climate and ecological changes through a high-resolution multi-proxy study of a 4 m peat core collected in the Kyambangunguru swamp (SW Tanzania). This core covers the last 4,000 years based on 14C dating of bulk organic matter and macro-remains. Microscopic observations ‒ macro-remains, micro-fossils, palynofacies and pollen ‒ and geochemical analyses ‒ organic carbon and nitrogen contents, branched glycerol dialkyl glycerol tetraethers (br GDGTs), n-alkanes and their H isotopic composition ‒ were combined to track potential ecological changes in the swamp and to relate them to climate forcings. This approach revealed an abrupt ecological transition ca. 2,300 yrs BP ago, when the ecosystem likely changed from a lake to a marsh. In addition, climate variations were investigated through the analysis of specific organic compounds, i.e. long chain n-alkanes and br GDGTs. On the one hand, the change in ecosystem functioning seems associated with an increase in mean annual air temperature of ca. 1 °C according to br GDGT-derived temperature estimates. On the other hand, the hydrogen isotopic composition of plant derived n-alkanes (δ²Hwax), which is related to the isotopic signature of precipitations and with hydrological regimes, did not show any abrupt shift at this period. In conclusion, high coherence between vegetation changes and climate modifications recorded by different proxies was observed along the core. They all indicate the transition from a lake to an acidic marsh ca. 2300 years ago. The onset of marsh formation may have been driven by hydroseral succession processes, i.e. the lake overgrowth by macrophytes, and may have been favoured by a warming climate and a long-term progressive trend

  6. Bacterial diversity in the rumen of Gayals (Bos frontalis), Swamp buffaloes (Bubalus bubalis) and Holstein cow as revealed by cloned 16S rRNA gene sequences.

    Science.gov (United States)

    Yang, Shuli; Ma, Songcheng; Chen, Jing; Mao, Huaming; He, Yiduo; Xi, Dongmei; Yang, Liangyu; He, Tianbao; Deng, Weidong

    2010-04-01

    Libraries of rumen bacterial 16S rRNA gene sequences of Gayals (Bos frontalis) and Swamp buffaloes (Bubalus bubalis) were cloned and sequenced in the present work to compare the bacterial diversity with the third published library of Holstein cow. Sequence similarity of 97% was used as the definition of operational taxonomic unit (OTU). The majority of the 470 sequences retrieved fell into the phyla of low G + C subdivision (329 sequences) and Cytophaga-Flexibacter-Bacteroides (CFB, 123 sequences) with the percentages of 70 and 26.2, respectively. The remaining clones belonged to the phyla of Proteobacter, high G + C gram positive bacteria (HGCGPB) and Spirochaetes, accounting for 3.8% totally. Only 73 clones (25 OTUs, 15.5%) could be closely related to cultured representatives. However, a larger fraction was related to uncultured representatives. Holstein cow may have more representatives of cultural bacteria and there were more uncultured clones for Gayals. The percentage of cultural representatives was 24, 13.3 and 9.5 for Holstein cow, Swamp buffaloes and Gayals, respectively. Twenty-three OTUs of the 236 ones appeared in more than one library, five of which were cultural. Selenomonas ruminantium, Ruminococcus flavefaciens and Butyrivibrio fibrisolvens were found in two different libraries, while Succiniclasticum ruminis and Pseudobutyrivibrio ruminis were found in all three libraries. Some of the animal-specific bacteria that had not been described previously in the ruminal ecosystem, e.g. Allisonella histaminiformans for Gayals and Staphylococcus sciuri for Swamp buffaloes were also recovered.

  7. Effect of Carbohydrate Source and Cottonseed Meal Level in the Concentrate on Feed Intake, Nutrient Digestibility, Rumen Fermentation and Microbial Protein Synthesis in Swamp Buffaloes

    Directory of Open Access Journals (Sweden)

    M. Wanapat

    2013-07-01

    Full Text Available The objective of this study was to investigate the effect of carbohydrate source and cottonseed meal level in the concentrate on feed intake, nutrient digestibility, rumen fermentation and microbial protein synthesis in swamp buffaloes. Four, 4-yr old rumen fistulated swamp buffaloes were randomly assigned to receive four dietary treatments according to a 2×2 factorial arrangement in a 4×4 Latin square design. Factor A was carbohydrate source; cassava chip (CC and CC+rice bran at a ratio 3:1 (CR3:1, and factor B was level of cottonseed meal (CM; 109 g CP/kg (LCM and 328 g CP/kg (HCM in isonitrogenous diets (490 g CP/kg. Buffaloes received urea-treated rice straw ad libitum and supplemented with 5 g concentrate/kg BW. It was found that carbohydrate source did not affect feed intake, nutrient intake, digested nutrients, nutrient digestibility, ammonia nitrogen concentration, fungi and bacterial populations, or microbial protein synthesis (p>0.05. Ruminal pH at 6 h after feeding and the population of protozoa at 4 h after feeding were higher when buffalo were fed with CC than in the CR3:1 treatment (p0.05. Based on this experiment, concentrate with a low level of cottonseed meal could be fed with cassava chips as an energy source in swamp buffalo receiving rice straw.

  8. Sedimentary signature of Hurricane Isaac in a Taxodium swamp on the western margin of Lake Pontchartrain, Louisiana, USA

    Directory of Open Access Journals (Sweden)

    K.-B. Liu

    2015-03-01

    Full Text Available Compositional and geochemical profiles were established for a 59-cm sediment core extracted from a small pothole pond in a Taxodium (bald cypress swamp 830 m inland from Lake Pontchartrain in south-eastern Louisiana, USA. The core consists of a top organic unit (peat to clayey peat from 0–29 cm above a bottom clay unit at 30–59 cm depth. Four distinct zones, marked by gradual changes in organic content and elemental concentrations, occur in the clay unit. These changes probably reflect two cycles of slowly changing water depths. Hurricane Isaac’s signature, a brown clay band at 3–5 cm, is identified based on the stratigraphic and compositional correspondence with the storm’s event layer, documented from nearby sites. Sedimentary and geochemical similarities between this material and clastic bands at 15–19 and 23–25 cm identify those two intervals as potentially representing earlier floods. The Cl/Br ratio presents a potentially useful method for distinguishing fluvial and marine flooding.

  9. Inferring Invasion History of Red Swamp Crayfish (Procambarus clarkii in China from Mitochondrial Control Region and Nuclear Intron Sequences

    Directory of Open Access Journals (Sweden)

    Yanhe Li

    2015-06-01

    Full Text Available Identifying the dispersal pathways of an invasive species is useful for adopting the appropriate strategies to prevent and control its spread. However, these processes are exceedingly complex. So, it is necessary to apply new technology and collect representative samples for analysis. This study used Approximate Bayesian Computation (ABC in combination with traditional genetic tools to examine extensive sample data and historical records to infer the invasion history of the red swamp crayfish, Procambarus clarkii, in China. The sequences of the mitochondrial control region and the proPOx intron in the nuclear genome of samples from 37 sites (35 in China and one each in Japan and the USA were analyzed. The results of combined scenarios testing and historical records revealed a much more complex invasion history in China than previously believed. P. clarkii was most likely originally introduced into China from Japan from an unsampled source, and the species then expanded its range primarily into the middle and lower reaches and, to a lesser extent, into the upper reaches of the Changjiang River in China. No transfer was observed from the upper reaches to the middle and lower reaches of the Changjiang River. Human-mediated jump dispersal was an important dispersal pathway for P. clarkii. The results provide a better understanding of the evolutionary scenarios involved in the rapid invasion of P. clarkii in China.

  10. Effect of Chronic Exposure to Prometryne on Oxidative Stress and Antioxidant Response in Red Swamp Crayfish (Procambarus clarkii

    Directory of Open Access Journals (Sweden)

    Alžběta Stará

    2014-01-01

    Full Text Available The aim of the study was to investigate effects of the triazine herbicide prometryne on red swamp crayfish on the basis of oxidative stress, antioxidant indices in hepatopancreas and muscle, and histopathology of hepatopancreas. Crayfish were exposed to prometryne concentrations of 0.51 μg L−1, 0.144 mg L−1, and 1.144 mg L−1 for 11 and 25 days. Indices of oxidative stress (thiobarbituric acid reactive substances (TBARS, and antioxidant parameters (superoxide dismutase (SOD, catalase (CAT, and glutathione reductase (GR in crayfish muscle and hepatopancreas were measured. Chronic exposure to prometryne did not showed the impact of oxidative damage to cells. Changes activity of the antioxidant enzymes SOD, CAT, and GR were observed in all tested concentrations to prometryne for 11 and 25 days (P<0.01 as compared with the control group. We did not see any differences in histopatological examination to hepatopancreas. Prolonged exposure of prometryne did not result in oxidative damage to cell lipids and proteins, but it led to changes in antioxidant activity in crayfish tissues. Changes in antioxidant systems were also observed in the environmental prometryne concentration of 0.51 μg L−1. The results suggest that antioxidant responses may have potential as biomarkers for monitoring residual triazine herbicides in aquatic environments.

  11. Benefits of the fire mitigation ecosystem service in The Great Dismal Swamp National Wildlife Refuge, Virginia, USA.

    Science.gov (United States)

    Parthum, Bryan; Pindilli, Emily; Hogan, Dianna

    2017-12-01

    The Great Dismal Swamp (GDS) National Wildlife Refuge delivers multiple ecosystem services, including air quality and human health via fire mitigation. Our analysis estimates benefits of this service through its potential to reduce catastrophic wildfire related impacts on the health of nearby human populations. We used a combination of high-frequency satellite data, ground sensors, and air quality indices to determine periods of public exposure to dense emissions from a wildfire within the GDS. We examined emergency department (ED) visitation in seven Virginia counties during these periods, applied measures of cumulative Relative Risk to derive the effects of wildfire smoke exposure on ED visitation rates, and estimated economic losses using regional Cost of Illness values established within the US Environmental Protection Agency BenMAP framework. Our results estimated the value of one avoided catastrophic wildfire in the refuge to be $3.69 million (2015 USD), or $306 per hectare of burn. Reducing the frequency or severity of extensive, deep burning peatland wildfire events has additional benefits not included in this estimate, including avoided costs related to fire suppression during a burn, carbon dioxide emissions, impacts to wildlife, and negative outcomes associated with recreation and regional tourism. We suggest the societal value of the public health benefits alone provides a significant incentive for refuge mangers to implement strategies that will reduce the severity of catastrophic wildfires. Published by Elsevier Ltd.

  12. Cadmium and lead residues in field-collected red swamp crayfish (Procambarus clarkii) and uptake by alligator weed, Alternanthera philoxiroides

    Energy Technology Data Exchange (ETDEWEB)

    Naqvi, S.M.; Howell, R.D.; Sholas, M. (Southern Univ., Baton Rouge, LA (United States). Dept. of Biological Sciences and Health Research Center)

    1993-01-01

    The whole-body residues of Cd and Pb in the tissues of Louisiana swamp crayfish (Procambarus clarkii) were determined by flame AAS technique. Test animals were collected from roadside ditches alongside major highways. The water and soil samples were also collected from the same sites. The mean Cd and Pb concentrations in crayfish tissues were 0.46 and 0.07, respectively. The levels of Cd and Pb in the water were 0.09 and 0.04; and in soil were 2.85 and 0.87 mg/1, respectively. The concentration of cadmium was 32 and Pb 12 times more than in the water. The bioaccumulation factors (BF) for Cd and Pb in crayfish tissues were 5.1 and 1.7, respectively. Alligator weed (Alternanthera philoxiroides) plants were exposed to 0.5 mg/1 Cd-chloride or Pb-nitrate solutions for 3 wk period, thrice. The mean Pb accumulation in roots was 1.31 mg/1, followed by stem (0.078 mg/1), but Cd only accumulated in root (0.83 mg/1). The BF for Pb and Cd in plant tissues were 14.8 and 16.6, respectively. The uptake of metals was time-dependent. These data suggest that although there is no biomagnification of Cd and Pb from alligator weed to crayfish, both metals readily accumulate in field-collected crayfish and laboratory-exposed alligator weed.

  13. Nakazawaea todaengensis f.a., sp. nov., a yeast isolated from a peat swamp forest in Thailand.

    Science.gov (United States)

    Polburee, Pirapan; Lertwattanasakul, Noppon; Limtong, Pitayakon; Groenewald, Marizeth; Limtong, Savitree

    2017-07-01

    Strain DMKU-PS11(1)T was isolated from peat in a swamp forest in Thailand. DNA sequence analysis showed that it belonged to a novel species that was most closely related to Nakazawaea laoshanensis. However, it differed from the type strain of N. laoshanensis (NRRL Y-63634T) by 2.3 % nucleotide substitutions in the D1/D2 region of the large subunit (LSU) rRNA gene, 1.0 % nucleotide substitutions in the small subunit (SSU) rRNA gene and 8.0 % nucleotide substitutions in the internal transcribed spacer (ITS) region. The phylogenetic analyses based on the combined sequences of the SSU and the D1/D2 region and that of the SSU sequences alone confirmed the placement of the novel species in the Nakazawaea clade and its close affinity with N. laoshanensis. Hence, the species Nakazawaea todaengensis f.a., sp. nov. is proposed. The type strain is DMKU-PS11(1)T (=CBS 14555T=TBRC 6559T). The MycoBank number for Nakazawaea todaengensis f.a., sp. nov. is MB 819513.

  14. Effect of Lunar Phases, Tides, and Wind Speed on the Abundance of Diptera Calliphoridae in a Mangrove Swamp.

    Science.gov (United States)

    Batista-da-Silva, J A

    2014-02-01

    Abiotic factors, such as lunar phases and tides, have a significant effect on insect development. Reproduction and immature development are usually interlinked to these abiotic factors. The tide is at its highest levels at full moon or new moon, hindering the feeding of the immature or causing their drowning. The oviposition by adult females is also compromised on these days because much of the available food is submerged. Another important abiotic factor is the wind, which displaces odoriferous particles in the air. Wind speed and direction are important elements to indicate potential sources of food for insects. I report on the effects of lunar phases, tides, and wind speed on the Calliphoridae fauna in mangrove swamps. The different species collected were identified, and the predominant species in the area were quantified. A total of 1,710 flies were collected over a 1-year period. Six Calliphoridae flies, Chloroprocta idioidea (Robineau-Desvoidy), Chrysomya megacephala (Fabricius), Chrysomya albiceps (Wiedemann), Chrysomya putoria (Wiedemann), Cochliomyia macellaria (Fabricius), and Lucilia eximia (Wiedemann) were collected. Data indicated that lunar phases have a significant effect on the abundance of C. albiceps (r = 0.39, p macellaria (r = 0.41, p < 0.00), and C. idioidea (r = 0.31, p < 0.04). The wind speed, however, did not affect these species.

  15. Antibacterial properties of extracts of Solidago canadensis and their potential use as dietary supplements in red swamp crayfish (Procambarus clarkii

    Directory of Open Access Journals (Sweden)

    Manhong YE,Lei ZHANG,Jiaqi GE,Haifeng SUN,Jingjing NI,Shengmei YANG,Wanhong WEI

    2015-12-01

    Full Text Available Canadian goldenrod (Solidago canadensis is one of the most destructive invasive weeds in South-eastern China. To evaluate its potential application as dietary supplement in red swamp crayfish (Procambarus clarkii, the antibacterial properties of aqueous and ethanol extracts of this plant against three major pathogenic bacteria in crayfish aquaculture were examined. Inhibition zone tests and determination of minimum inhibitory concentration revealed that the extracts had lower antibacterial activity than extracts from two traditional medicinal plants that possess antibacterial properties, garlic (Allium sativum and cortex phellodendri (Phellodendron chinense. However, they did exhibit greater antibacterial effects than extracts from another widely used medicinal plant, Sophora flavescens, and an aquatic weed, Alternanthera philoxeroides. Aqueous extracts of Canadian goldenrod gave greater inhibition than the ethanol extracts. Crayfish fed a diet with 2% these aqueous extracts exhibited significantly higher enzyme activity of alkaline phosphatase, catalase and phenoloxidase (P<0.05. Based on the results of this study, we conclude that aqueous extracts of Canadian goldenrod are highly promising for the development of new dietary supplement for use in crayfish aquaculture.

  16. Benefits of the fire mitigation ecosystem service in the Great Dismal Swamp National Wildlife Refuge, Virginia, USA

    Science.gov (United States)

    Parthum, Bryan M.; Pindilli, Emily; Hogan, Dianna

    2017-01-01

     The Great Dismal Swamp (GDS) National Wildlife Refuge delivers multiple ecosystem services, including air quality and human health via fire mitigation. Our analysis estimates benefits of this service through its potential to reduce catastrophic wildfire related impacts on the health of nearby human populations. We used a combination of high-frequency satellite data, ground sensors, and air quality indices to determine periods of public exposure to dense emissions from a wildfire within the GDS. We examined emergency department (ED) visitation in seven Virginia counties during these periods, applied measures of cumulative Relative Risk to derive the effects of wildfire smoke exposure on ED visitation rates, and estimated economic losses using regional Cost of Illness values established within the US Environmental Protection Agency BenMAP framework. Our results estimated the value of one avoided catastrophic wildfire in the refuge to be \\$3.69 million (2015 USD), or \\$306 per hectare of burn. Reducing the frequency or severity of extensive, deep burning peatland wildfire events has additional benefits not included in this estimate, including avoided costs related to fire suppression during a burn, carbon dioxide emissions, impacts to wildlife, and negative outcomes associated with recreation and regional tourism. We suggest the societal value of the public health benefits alone provides a significant incentive for refuge mangers to implement strategies that will reduce the severity of catastrophic wildfires.

  17. Acid base status in swamp buffaloes (Bubalus Bubalis fed rice straw and concentrate with addition of sodium

    Directory of Open Access Journals (Sweden)

    G Joseph

    2001-12-01

    Full Text Available An experiment was conducted to study the addition of NaHCO3 and Na2CO3 on acid-base status in swamp buffaloes, Three fistulated buffaloes were each introduced to dietary treatment control diett (50% rice straw + 50% concentrate, control + \\0% NaHCO3 and diet control + 10% Na2CO3 in two times Latin Square Design. The diets contained 9,7% crude protein and 53% TDN to achieve maintenance requirements of the animals. Parameters measured include (l Fed consumption, water consumption and urine volume. (2 pH in rumen fluid, saliva, bLood and urine, (3 natrium mineral content in rumen fluid, saliva, blood and urine. The results of the experiment showed higher pH in the rumen fluid, saliva, blood and urine of buffaloes due to supplementation of NaHCO3 and Na2CO3, Water consumption and urine volume was significanly increased as the effect of Na supplement. The acid-base status of buffaloes was apparently normal in all animals.

  18. Heavy metals bioaccumulation in selected tissues of red swamp crayfish: An easy tool for monitoring environmental contamination levels.

    Science.gov (United States)

    Goretti, E; Pallottini, M; Ricciarini, M I; Selvaggi, R; Cappelletti, D

    2016-07-15

    In this paper we explored the heavy metal bioaccumulation (Cd, Cu, Pb and Zn) in Procambarus clarkii, a crayfish recently suggested as a potential bioindicator for metals pollution in freshwater systems. The present study is focused on crayfishes populations caught in a heavily polluted industrial and in a reference sites (Central Italy), though the results are generalized with a thorough analysis of literature metadata. In agreement with the literature, the hepatopancreas (Hep, detoxification tissues) of the red swamp crayfish showed a higher concentration of heavy metals in comparison to the abdominal muscle (AbM, not detoxification tissues) in the sites under scrutiny. Hep/AbM concentration ratio was dependent on the specific metal investigated and on its sediment contamination level. Specifically we found that Hep/AbM ratio decreases as follows: Cd (11.7)>Cu (5.5)>Pb (3.6)>Zn (1.0) and Pb (4.34)>Cd (3.66)>Zn (1.69)>Cu (0.87) for the industrial and reference sites, respectively. The analysis of our bioaccumulation data as well as of literature metadata allowed to elaborate a specific contamination index (Toxic Contamination Index, TCI), dependent only on the bioaccumulation data of hepatopancreas and abdominal muscle. In the industrial site, TCI expressed values much higher than the unit for Cd and Cu, confirming that these metals were the main contaminants; in contrast for lower levels of heavy metals, as those observed in the reference site for Cu, Zn and Pb, the index provided values below unit. TCI is proposed as a useful and easy tool to assess the toxicity level of contaminated sites by heavy metals in the environmental management. Copyright © 2016. Published by Elsevier B.V.

  19. Food deserts or food swamps?: A mixed-methods study of local food environments in a Mexican city.

    Science.gov (United States)

    Bridle-Fitzpatrick, Susan

    2015-10-01

    Differential access to healthy foods has been hypothesized to contribute to disparities in eating behaviors and health outcomes. While food deserts have been researched extensively in developed Anglophone countries, evidence from low- and middle-income countries is still scarce. In Mexico, prevalence of obesity is among the highest worldwide. As obesity has increased nationally and become a widespread public health issue, it is becoming concentrated in the low-income population. This mixed-methods study uses a multidimensional approach to analyze food environments in a low-, middle-, and high-income community in a Mexican city. The study advances understanding of the role that food environments may play in shaping eating patterns by analyzing the density and proximity of food outlet types as well as the variety, quantity, quality, pricing, and promotion of different foods. These measures are combined with in-depth qualitative research with families in the communities, including photo elicitation, to assess perceptions of food access. The central aims of the research were to evaluate physical and economic access and exposure to healthy and unhealthy foods in communities of differing socioeconomic status as well as participants' subjective perceptions of such access and exposure. The findings suggest a need to reach beyond a narrow focus on food store types and the distance from residence to grocery stores when analyzing food access. Results show that excessive access and exposure to unhealthy foods and drinks, or "food swamps," may be a greater concern than food deserts for obesity-prevention policy in Mexico. Copyright © 2015 Elsevier Ltd. All rights reserved.

  20. Capture efficiency and size selectivity of sampling gears targeting red-swamp crayfish in several freshwater habitats

    Directory of Open Access Journals (Sweden)

    Paillisson J.-M.

    2011-05-01

    Full Text Available The ecological importance of the red-swamp crayfish (Procambarus clarkii in the functioning of freshwater aquatic ecosystems is becoming more evident. It is important to know the limitations of sampling methods targeting this species, because accurate determination of population characteristics is required for predicting the ecological success of P. clarkii and its potential impacts on invaded ecosystems. In the current study, we addressed the question of trap efficiency by comparing population structure provided by eight trap devices (varying in number and position of entrances, mesh size, trap size and construction materials in three habitats (a pond, a reed bed and a grassland in a French marsh in spring 2010. Based on a large collection of P. clarkii (n = 2091, 272 and 213 respectively in the pond, reed bed and grassland habitats, we found that semi-cylindrical traps made from 5.5 mm mesh galvanized steel wire (SCG were the most efficient in terms of catch probability (96.7–100% compared to 15.7–82.8% depending on trap types and habitats and catch-per-unit effort (CPUE: 15.3, 6.0 and 5.1 crayfish·trap-1·24 h-1 compared to 0.2–4.4, 2.9 and 1.7 crayfish·trap-1·24 h-1 by the other types of fishing gear in the pond, reed bed and grassland respectively. The SCG trap was also the most effective for sampling all size classes, especially small individuals (carapace length \\hbox{$\\leqslant 30$} ⩽ 30 mm. Sex ratio was balanced in all cases. SCG could be considered as appropriate trapping gear to likely give more realistic information about P. clarkii population characteristics than many other trap types. Further investigation is needed to assess the catching effort required for ultimately proposing a standardised sampling method in a large range of habitats.

  1. Effects of Supplementation of Eucalyptus ( Leaf Meal on Feed Intake and Rumen Fermentation Efficiency in Swamp Buffaloes

    Directory of Open Access Journals (Sweden)

    N. T. Thao

    2015-07-01

    Full Text Available Four rumen fistulated swamp buffaloes were randomly assigned according to a 4×4 Latin square design to investigate the effects of Eucalyptus (E. Camaldulensis leaf meal (ELM supplementation as a rumen enhancer on feed intake and rumen fermentation characteristics. The dietary treatments were as follows: T1 = 0 g ELM/hd/d; T2 = 40 g ELM/hd/d; T3 = 80 g ELM/hd/d; T4 = 120 g ELM/hd/d, respectively. Experimental animals were kept in individual pens and concentrate was offered at 0.3% BW while rice straw was fed ad libitum. The results revealed that voluntary feed intake and digestion coefficients of nutrients were similar among treatments. Ruminal pH, temperature and blood urea nitrogen concentrations were not affected by ELM supplementation; however, ELM supplementation resulted in lower concentration of ruminal ammonia nitrogen. Total volatile fatty acids, propionate concentration increased with the increasing level of EML (p<0.05 while the proportion of acetate was decreased (p<0.05. Methane production was linearly decreased (p<0.05 with the increasing level of ELM supplementation. Protozoa count and proteolytic bacteria population were reduced (p<0.05 while fungal zoospores and total viable bacteria, amylolytic, cellulolytic bacteria were unchanged. In addition, nitrogen utilization and microbial protein synthesis tended to increase by the dietary treatments. Based on the present findings, it is suggested that ELM could modify the rumen fermentation and is potentially used as a rumen enhancer in methane mitigation and rumen fermentation efficiency.

  2. Indigenous Knowledge of Dayaks Bakumpai in Barito Kuala District on the Management of Plant Diversity Growing at Streams and Swamps

    Directory of Open Access Journals (Sweden)

    Dharmono Dharmono

    2013-11-01

    Full Text Available Research aimed at describing profile of indigenous knowldge owned by the Dayaks Bakumpai in Batola district on managing the diversity of herbs growing at the river flow and swamp. Data on herb used by the tribe were grouped based on the etnobotanic study, covering study botany, etnofarmacology, etnoantrophology, etnolinguistik and etnoekologi. We also observed how the Dayaks Bakumpai in Batola district preserve the diversity of plant in around them, and how their efforts in bequeathing or teaching the traditional knowledge of an old breed generation to his young daam in managing diversity of herbs around them. The study was carried out at three vellages, namely Simpang Arja, Pengulu and Ulu Benteng. The results showed that 52 plant species living along the river and 67 species that live in the marsh. Based on the interview we found that (1 the profile of indigenous knowldge dayaks bakumpai district batola in making use of the diversity of plant in surrounding shown through etno-linguistic, etno-economy, etno-anthropology, etno-farmacology and etno-ecology against 44 tufted herbs of 67 of herbs found, (2 Dayaks Bakumpai in Batola district, to preserve the diversity of plant surrounding them, have done without planting, but by making use of herbs without a certain rule, making use of herbs by a certain rule, making use of herbs let plant grown in nature, and destroy plants that exist or cultivated, and (3 efforts for the inheriting the indigenous knowldge to its young generation have been done by women and quite alarming that many young ages of Dayaks Bakumpai do not know the name of herbs around them.

  3. How does conversion from peat swamp forest to oil palm plantation affect emissions of nitrous oxide from the soil? A case study in Jambi, Indonesia

    Science.gov (United States)

    Hartill, Jodie; Hergoualc'h, Kristell; Comeau, Louis-Pierre; Jo, Smith; Lou, Verchot

    2017-04-01

    Half of the peatlands across Peninsular Malaysia, Borneo and Sumatra are 'managed'. Conversion of peat swamp forest to workable oil palm plantation requires a drastic, potentially irreversible, change to the landscape, to which fertilizers are then routinely applied. A combination of these factors is now widely thought to increase soil nitrous oxide (N2O) emissions, although there is high uncertainty due to gaps in the knowledge, both regionally and nationally. Despite the widespread use of fertilizers in plantations on peats, studies observing their effects remain very limited. Therefore, there is a need for in situ studies to evaluate how environmental parameters (edaphic properties, climate, soil moisture and N availability indicators) influence soil emissions. This 18 month study was located in plots local to each other, representing the start, intermediate and end of the land conversion process; namely mixed peat swamp forest, drained and logged forest and industrial oil palm plantation. Spatial variability was taken into account by differentiating the hollows and hummocks in the mixed peat swamp forest, and the fertilized zone and the zone without fertilizer addition in the oil palm plantation. Gas samples were collected each month from static chambers at the same time as key environmental parameters were measured. Intensive sampling was performed during a 35 day period following two fertilizer applications, in which urea was applied to palms at rates of 0.5 and 1 kg urea palm-1. Soil N2O emissions (kg N ha-1 y-1 ± SE) were low overall, but they were greater in the oil palm plantation (0.8 ± 0.1) than in the mixed peat swamp forest (0.3 ± 0.0) and the drained/logged forest (0.2 ± 0.0). In the mixed peat swamp forest, monthly average fluxes of N2O (g N ha-1 d-1 ± SE) were similar in the hollows (0.6 ± 0.2) and the hummocks (0.3 ± 0.1), whereas in the oil palm plantation they were consistently higher in the zone without fertilizer (2.5 ± 0.4) than in

  4. EFFECT OF ARBUSCULAR MYCORRHIZAL COLONIZATION ON EARLY GROWTH AND NUTRIENT CONTENT OF TWO PEAT­ SWAMP FOREST TREE SPECIES SEEDLINGS, Calophyllum hosei AND Ploiarium alternifolium

    Directory of Open Access Journals (Sweden)

    Maman Turjaman

    2006-03-01

    Full Text Available Tropical peat-swamp forests are one of  the largest near-surface reserves of terrestrial organic carbon,  but rnany peat-swamp forest tree species decreased due over-exploitation, forest fire and conversion of natural forests into agricultural lands. Among those species are slow-growing Calophyllum  hoseiand Ploiarium  alternifolium, two species are good for construction of boats, furniture, house building and considerable attention from pharmacological viewpoint for human healthly. This study was aimed at understanding the effects of arbuscular mycorrhizal (AM fungi on early growth of  C. hosei and P.alternifoliumunder greenhouse condition. Seedlings of C. hosei and P.alternifoliumwere inoculated with AM fungi: Glomus clarum and Glomus aggregatum ,or uninoculated under greenhouse condition during 6 months. AM colonization,   plant growth,  survival rate and  nutrient  content  (P, Zn  and B were measured. The percentage of C. hoseiand P.alternifolium ranged from 27-32% and 18-19%,  respectively. Both inoculated seedling species had greater plant  height, diameter, leaf number, shoot and root dry weight than control  seedlings.   Nutrient  content  of  inoculated  plants  were increased with AM colonization- Survival rates of  inoculated plants were higher (100%  than those of  control plants (67%. The results suggested that inoculation of AM fungi could improve the early growth of C. hoseiand P.alternifolium grown in tropical peat-swamp forest therefore  this finding has greater potential impact if this innovative technology applied in field scales which are socially acceptable, commercially profitable and environmentally friendly.

  5. POTENCY OF RAMIN (Gonystylus bancanus Kurtz. AND OTHER COMMERCIAL SPECIES IN PEAT SWAMP FOREST MANAGED WITH TPTI SILVICULTURAL SYSTEM IN BAGAN, RIAU

    Directory of Open Access Journals (Sweden)

    Hendromono Hendromono

    2005-07-01

    Full Text Available Ramin  (Gonystylus bancanus Kurtz.  is one  of  the  tree  species in  peat-swamp  forest  that  is endangered due to excessive exploitation. The objective of this research was to assess the potency of rarnin and other commercial tree species in primary and logged over peat-swamp forests at Bagan, Riau. The tree stands were inventoried in primary forest of the 2004 and 2006 Annual Work Plan (RKTs and in  the  1997  and  2001  RKTs  managed  with  Indonesian  Selective Cutting  and  Planting  (TPTI silvicultural system.  The  result  showed  that  rarnin in  Bagan peat-swamp  forest  was not  evenly distributed. The total number of ramin  in tree stage in primary forests was fewer than that in  logged over forests.  The total number of ramin species at tree stage in primary forest was between 4.5  and 5 trees ha·' with the important value index (IVI of 10.3  to 12.0%,  whereas the one at logged over forest were between 2.5 and 15  trees ha·' with theM    indices of 7.9 to 20.4%.  Commercial species of swamp meranti (Shorea uliginosaand S. teysmaniana and balam/ suntai or (Palaqqiumspp. were dominant at tree stage both in the primary and the logged over forests. Enrichment in logged over forests is not needed since the total number of seedlings and saplings  is enough. The total number of potential core trees in logged over forests was enough for the next cutting cycle. The effort that must be done in logged over forests is to protect them from illegal logging.

  6. Mixture Toxicity of Bensulfuron-Methyl and Acetochlor to Red Swamp Crayfish (Procambarus clarkii): Behavioral, Morphological and Histological Effects.

    Science.gov (United States)

    Yu, Jixin; Xu, Elvis Genbo; Ren, Yan; Jin, Shiyu; Zhang, Tanglin; Liu, Jiashou; Li, Zhongjie

    2017-11-27

    The mixture of bensulfuron-methyl and acetochlor (MBA) has been widely applied as a rice herbicide in China, but the mixture toxicity of MBA to aquatic organisms is largely unknown. The current study aims to investigate the acute effects of MBA to juvenile red swamp crayfish, Procambarus clarkii. Firstly, a 96 h semi-static exposure was conducted to determine the Lethal Concentration 50 (LC50) values at 24, 48, 72 and 96 h, as well as to assess the behavioral and morphological effects. A second 96 h exposure was conducted at an MBA concentration of 50% of the 96 h LC50 (72.62 mg/L) to assess the histological changes in the gill, perigastric organ, muscle, heart, stomach, and midgut. The results showed that MBA exhibited low acute toxicity with the 24, 48, 72 and 96 h LC50 values of 191.25 (179.37-215.75), 166.81 (159.49-176.55), 154.30 (148.36-160.59) and 145.24 (138.94-151.27) mg/L, respectively. MBA-exposed crayfish showed body jerk, belly arch, equilibrium loss, body and appendage sway, and lethargy; and the dead crayfish showed dark gray or grayish-white body color and separated cephalothorax and abdomen. At 72.62 mg/L, MBA exposure caused significant histopathological alterations, mainly including the cuticular and epithelial degeneration of all the gills; atrophy of tubule lumina and cellular vacuolation of the perigastric organs (61.15 ± 9.90% of the tubules showed lesions); epithelial hyperplasia (48.40 ± 9.00%), myocardial fibers and epithelial cell lysis (17.30 ± 2.01%), and hemocytic infiltration of the hearts; cuticular swelling (15.82 ± 2.98%) and vacuolate connective tissue (11.30 ± 2.47%) of the stomachs; atrophied bladder cell and fragmented longitudinal muscles (95.23 ± 4.77%) of the midguts; and slight myofibers fragmentation and lysis (7.37 ± 0.53%) of the abdominal muscles. Our results indicate that MBA can cause behavioral, morphological and histopathological effects on juvenile P. clarkii at relatively high concentrations, but its acute

  7. Mixture Toxicity of Bensulfuron-Methyl and Acetochlor to Red Swamp Crayfish (Procambarus clarkii: Behavioral, Morphological and Histological Effects

    Directory of Open Access Journals (Sweden)

    Jixin Yu

    2017-11-01

    Full Text Available The mixture of bensulfuron-methyl and acetochlor (MBA has been widely applied as a rice herbicide in China, but the mixture toxicity of MBA to aquatic organisms is largely unknown. The current study aims to investigate the acute effects of MBA to juvenile red swamp crayfish, Procambarus clarkii. Firstly, a 96 h semi-static exposure was conducted to determine the Lethal Concentration 50 (LC50 values at 24, 48, 72 and 96 h, as well as to assess the behavioral and morphological effects. A second 96 h exposure was conducted at an MBA concentration of 50% of the 96 h LC50 (72.62 mg/L to assess the histological changes in the gill, perigastric organ, muscle, heart, stomach, and midgut. The results showed that MBA exhibited low acute toxicity with the 24, 48, 72 and 96 h LC50 values of 191.25 (179.37–215.75, 166.81 (159.49–176.55, 154.30 (148.36–160.59 and 145.24 (138.94–151.27 mg/L, respectively. MBA-exposed crayfish showed body jerk, belly arch, equilibrium loss, body and appendage sway, and lethargy; and the dead crayfish showed dark gray or grayish-white body color and separated cephalothorax and abdomen. At 72.62 mg/L, MBA exposure caused significant histopathological alterations, mainly including the cuticular and epithelial degeneration of all the gills; atrophy of tubule lumina and cellular vacuolation of the perigastric organs (61.15 ± 9.90% of the tubules showed lesions; epithelial hyperplasia (48.40 ± 9.00%, myocardial fibers and epithelial cell lysis (17.30 ± 2.01%, and hemocytic infiltration of the hearts; cuticular swelling (15.82 ± 2.98% and vacuolate connective tissue (11.30 ± 2.47% of the stomachs; atrophied bladder cell and fragmented longitudinal muscles (95.23 ± 4.77% of the midguts; and slight myofibers fragmentation and lysis (7.37 ± 0.53% of the abdominal muscles. Our results indicate that MBA can cause behavioral, morphological and histopathological effects on juvenile P. clarkii at relatively high concentrations

  8. Recent benthic foraminifera and sedimentary facies from mangrove swamps and channels of Abu Dhabi (United Arab Emirates)

    Science.gov (United States)

    Fiorini, Flavia; Odeh, Weaam A. S. Al; Lokier, Stephen W.; Paul, Andreas

    2016-04-01

    Zonation of Recent mangrove environments can be defined using benthic foraminifera, however, little is known about foraminifera from mangrove environments of the Arabian Gulf. The objective of this study is to produce a detailed micropaleontological and sedimentological analysis to identify foraminiferal associations in several coastline environments (mangrove swamps and channels) located on the eastern side of Abu Dhabi Island (UAE). Detailed sediment sampling collection in mangal environments of Eastern Abu Dhabi was carried out to assess the distribution of living and dead benthic foraminifera in different sedimentary facies in the mangal and in the surrounding area comprising natural environments of the upper and lower intertidal area (mud flats and channels) and areas modified by anthropogenic activities (dredged channels). The fine-grain sediments collected near mangrove (Avicenna marina) roots presented a high abundance of living and dead foraminifera tests. The assemblages in these samples show very low diversity and are almost entirely constituted of small-sized opportunistic species belonging to the genera Ammonia and Elphidium. In particular: • Samples collected on the mud flat and in ponds at the margin of the channel show a foraminiferal assemblage characterised by abundant foraminifera belonging to the genera Ammonia, Elphidium, Triloculina, Quinqueloculina, Peneroplis and Spirolina. • Samples collected in the lower (wet) intertidal area close to Avicenna marina roots, presented a low-diversity assemblage mostly comprising opportunistic foraminifera of the genera Ammonia and Elphidium along with rare miliolidae. • Samples from the upper intertidal area (dry) close to Avicenna marina roots, produced an assemblage exclusively composed of small-sized opportunistic Ammonia and Elphidium, together with abundant specimens belonging to the genera Trochammina. Throchammina specimens have not been previously recorded from Recent sedimentary samples of

  9. Nutritional ecology of wild Bornean orangutans (Pongo pygmaeus wurmbii) in a peat swamp habitat: Effects of age, sex, and season.

    Science.gov (United States)

    Vogel, Erin R; Alavi, Shauhin E; Utami-Atmoko, Sri Suci; van Noordwijk, Maria A; Bransford, Timothy D; Erb, Wendy M; Zulfa, Astri; Sulistyo, Fransiska; Farida, Wartika Rosa; Rothman, Jessica M

    2017-04-01

    The spatial and temporal variation in food abundance has strong effects on wildlife feeding and nutrition. This variation is exemplified by the peatland forests of Central Kalimantan, which are characterized by unpredictable fruiting fluctuations, relatively low levels of fruit availability, and low fruit periods (orangutans must periodically rely on non-preferred, lower-quality foods to meet their nutritional needs. We examined variation in nutrient intake among age-sex classes and seasons over a 7-year period at the Tuanan Orangutan Research Station in Central Kalimantan. We conducted 2,316 full-day focal follows on 62 habituated orangutans (Pongo pygmaeus wurmbii). We found differences in total energy and macronutrient intake across age-sex classes, controlling for metabolic body mass. Intake of both total energy and macronutrients varied with fruit availability, and preference of dietary items increased with their nutritional quality. Foraging-related variables, such as day journey length, travel time, and feeding time, also varied among age-sex classes and with fruit availability. Our results add to the growing body of literature suggesting that great variation in foraging strategies exists among species, populations, and age-sex classes and in response to periods of resource scarcity. The spatial and temporal variation in food abundance has strong effects on wildlife feeding and nutrition. Here we present the first long term study of the effects of variation in fruit availability and age/sex class on nutritional ecology of wild Bornean orangutans. We examined variation in nutrient intake of wild orangutans in living in a peat swamp habitat over a 7-year period at the Tuanan Orangutan Research Station in Central Kalimantan. We conducted 2,316 full-day focal follows on 62 habituated orangutans (Pongo pygmaeus wurmbii). We found differences in total energy and macronutrient intake across age-sex classes, controlling for metabolic body mass. Intake of both total

  10. Photodecomposition of humic acid and natural organic matter in swamp water using a TiO(2)-coated ceramic foam filter: potential for the formation of disinfection byproducts.

    Science.gov (United States)

    Mori, Masanobu; Sugita, Tsuyoshi; Mase, Akinori; Funatogawa, Takahiro; Kikuchi, Masaru; Aizawa, Kazuhiko; Kato, Shigekazu; Saito, Yoichi; Ito, Tsukasa; Itabashi, Hideyuki

    2013-01-01

    This paper reports on the photodecomposition of aqueous humic acid (HA) by a TiO(2)-coated ceramic foam filter (TCF) reactor and on the potential for the formation of disinfection byproducts (DBPs) upon chlorination of the photocatalytically treated solutions. This photocatalytic reactor can also be applied to the removal of natural organic matter (NOM) in swamp waters. The proposed photocatalytic reaction system was operated as per standardized methodologies. First, the ability of the TCF to decompose HA (a representative compound of NOM) was evaluated from the changes in the total organic carbon (TOC) and UV(254) with the reaction time. Remarkably, TOC removal and UV(254) values ranging from 44% to 61% and from 60% to 83%, respectively, were achieved. The potential for the formation of DBPs (total trihalomethane and total haloacetic acid) by chlorination of the phototreated solution was strongly dependent on the TOC removal and UV(254) values in the solution. The degree of photodecomposition of NOMs in the swamp water samples and the DBP formation potential showed similar trends as in the case of the standard solutions containing HA. The method used in this study could be effectively used to evaluate the efficiency of TCF for reducing HA and NOM, while suppressing the formation of DBP products. Copyright © 2012 Elsevier Ltd. All rights reserved.

  11. Dismal Swamp Drainage Patterns

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The natural hydrolics of the Chesapeake Drainage Basin, which has its inception at the crest of the Appalachian mountain range, the waters flowing across the surface...

  12. Comprehensive Base Realignment/Closure and Fort Belvoir Development

    Science.gov (United States)

    1991-06-01

    Zizania aquatica), pickerel weed ( Pontederia cordata ), and arrow arum I (Peltandra virginica). The brackish tidal wetlands on Fort Belvoir are confined to...Ampelopsis cordata simple-leaved ampelopsis S2 RSC swamps and river banks Anemone canadensis round-leaved anemone SIS2 RSC low grounds Asclepias rubra...Belvoir. State Federal State3!Scientific Name Common Name Rank Status Status Habitat Plants Arnpelopsis cordata simple-leaved ampelopsis S2 RSC swamps

  13. NILAI EKONOMI KARBON HUTAN RAWA GAMBUT MERANG KEPAYANG, PROVINSI SUMATERA SELATAN (Economic Value of Carbon of Merang Kepayang Peat Swamp Forest, South Sumatera Province

    Directory of Open Access Journals (Sweden)

    Nur Arifatul Ulya

    2015-03-01

    Full Text Available ABSTRAK Hutan rawa gambut menyimpan cadangan karbon baik di tanah maupun di atas tanah. Hutan Rawa Gambut Merang Kepayang (HRGMK merupakan kawasan hutan yang berada di kubah gambut terbesar di Sumatera Selatan, yaitu Kubah Gambut Merang (KGM, yang didalamnya terdapat gambut dengan ketebalan lebih dari 3 meter. Meskipun menurut aturan KGM seharusnya dikonservasi, pada kenyataannya kawasan HRGMK dihadapkan pada konversi. Konversi HRGMK diduga akan mengakibatkan terganggunya fungsi hutan rawa gambut sebagai cadangan karbon dunia sehingga akan menyebabkan terjadinya emisi karbon ke atmosfer dalam jumlah besar. Penelitian ini bertujuan untuk mengetahui nilai ekonomi kawasan HRGMK sebagai penyimpan cadangan karbon. Hasil penelitian diharapkan menjadi acuan pelestarian HRGMK sebagai stabilisator iklim dunia. Nilai ekonomi karbon HRGMK ditaksir dengan menggunakan harga bayangan. Harga karbon yang digunakan untuk menaksir nilai ekonomi karbon diperoleh dengan metode benefit transfer. Hasil penelitian menunjukkan bahwa nilai total karbon HRGMK adalah US$ 1.591.878.378,00 atau Rp. 14.002.162.211.645,00. Nilai tersebut sebagian besar berasal dari cadangan karbon di bawah tanah. ABSTRACT Peat swamp forests store aboveground and belowground carbon. Merang Kepayang Peat Swamp Forest (MKPSF is a forest area which is located in Merang Peat Dome (MPD, the largest peat dome in South Sumatra, with peat thickness more than 3 meters. Although the order should be conserved MPD, in fact MKPSF area exposed to the conversion. MKPSF conversion would presumably result in impaired function of peat swamp forest as world's carbon storage that will be caused carbon emissions into the atmosphere in large quantities. This study aimed to determine the economic value of the HRGMK as carbon storage. The results are expected to be justifications for conservation of MKPSF as climate stabilizers. The economic value of carbon HRGMK assessed using shadow pricing method. The carbon price

  14. Swamp Works: A New Approach to Develop Space Mining and Resource Extraction Technologies at the National Aeronautics Space Administration (NASA) Kennedy Space Center (KSC)

    Science.gov (United States)

    Mueller, R. P.; Sibille, L.; Leucht, K.; Smith, J. D.; Townsend, I. I.; Nick, A. J.; Schuler, J. M.

    2015-01-01

    The first steps for In Situ Resource Utilization (ISRU) on target bodies such as the Moon, Mars and Near Earth Asteroids (NEA), and even comets, involve the same sequence of steps as in the terrestrial mining of resources. First exploration including prospecting must occur, and then the resource must be acquired through excavation methods if it is of value. Subsequently a load, haul and dump sequence of events occurs, followed by processing of the resource in an ISRU plant, to produce useful commodities. While these technologies and related supporting operations are mature in terrestrial applications, they will be different in space since the environment and indigenous materials are different than on Earth. In addition, the equipment must be highly automated, since for the majority of the production cycle time, there will be no humans present to assist or intervene. This space mining equipment must withstand a harsh environment which includes vacuum, radical temperature swing cycles, highly abrasive lofted dust, electrostatic effects, van der Waals forces effects, galactic cosmic radiation, solar particle events, high thermal gradients when spanning sunlight terminators, steep slopes into craters / lava tubes and cryogenic temperatures as low as 40 K in permanently shadowed regions. In addition the equipment must be tele-operated from Earth or a local base where the crew is sheltered. If the tele-operation occurs from Earth then significant communications latency effects mandate the use of autonomous control systems in the mining equipment. While this is an extremely challenging engineering design scenario, it is also an opportunity, since the technologies developed in this endeavor could be used in the next generations of terrestrial mining equipment, in order to mine deeper, safer, more economical and with a higher degree of flexibility. New space technologies could precipitate new mining solutions here on Earth. The NASA KSC Swamp Works is an innovation

  15. Comparative acute toxicity of gallium(III), antimony(III), indium(III), cadmium(II), and copper(II) on freshwater swamp shrimp (Macrobrachium nipponense).

    Science.gov (United States)

    Yang, Jen-Lee

    2014-04-01

    Acute toxicity testing were carried out the freshwater swamp shrimp, Macrobrachium nipponense, as the model animal for the semiconductor applied metals (gallium, antimony, indium, cadmium, and copper) to evaluate if the species is an suitable experimental animal of pollution in aquatic ecosystem. The static renewal test method of acute lethal concentrations determination was used, and water temperature was maintained at 24.0 ± 0.5°C. Data of individual metal obtained from acute toxicity tests were determined using probit analysis method. The median lethal concentration (96-h LC50) of gallium, antimony, indium, cadmium, and copper for M. nipponense were estimated as 2.7742, 1.9626, 6.8938, 0.0539, and 0.0313 mg/L, respectively. Comparing the toxicity tolerance of M. nipponense with other species which exposed to these metals, it is obviously that the M. nipponense is more sensitive than that of various other aquatic animals.

  16. RELATIONSHIPS BETWEEN TOTAL TREE HEIGHT AND DIAMETER AT BREAST HEIGHT FOR TROPICAL PEAT SWAMP FOREST TREE SPECIES IN ROKAN HILIR DISTRICT, RIAU PROVINCE

    Directory of Open Access Journals (Sweden)

    Nunung Puji Nugroho

    2016-06-01

    Full Text Available Reliable information on total tree height (H is fundamental in forest resource management and forest ecological studies, including in forest biomass assessment. Adding an H variable can improve the performance of the biomass allometric equations by reducing the average deviation significantly. However, measuring H is relatively complex, less accurate, time consuming, and expensive. Thus, H is only measured for sampled trees within the plots, whilst diameter at breast height (DBH is commonly measured for each tree during the forest inventory. The missing H information is usually estimated based on a stand-specific allometric relationship between H and DBH (H-D model constructed from sampled trees. Despite extensive studies on H-D model for boreal forests and for single-species/plantation forests, few studies have focused on tropical forests. Furthermore, relationships for peat swamp forest tree species, and especially those in Indonesia, have not been widely published. Thus, the objective of this study was to develop site-specific H-D models for tropical peat swamp forests using linearized and non-linear regression functions. The results indicated that the non-linear models outperformed the linearized models based on the statistical parameters and the biological criteria. The modified logistic function (Model 7 is recommended for estimating H in the study area as it has comparable model performances to the exponential function (Model 6 and passed the point diameter-height of (0, 1.3. However, all five non-linear models performed equally well and the differences between them were trivial. Further improvements are needed to improve the accuracy, the predictive ability and the geographical applicability of the models by grouping the species, adding stand variables and (or using advanced techniques of mixed-effect modelling. In addition, model validation should be carried out prior to their application by collecting a new dataset from the forest

  17. Computation and comparison of Pd-based membrane reactor performances for water gas shift reaction and isotope swamping in view of highly tritiated water decontamination

    Energy Technology Data Exchange (ETDEWEB)

    Santucci, Alessia, E-mail: alessia.santucci@enea.it [Associazione ENEA-Euratom sulla Fusione, C.R. ENEA Frascati, Via E. Fermi 45, 00044 Frascati, RM (Italy); Rizzello, Claudio [Tesi Sas, Via Bolzano 28, Roma (Italy); Tosti, Silvano [Associazione ENEA-Euratom sulla Fusione, C.R. ENEA Frascati, Via E. Fermi 45, 00044 Frascati, RM (Italy)

    2013-10-15

    Highlights: • A dedicated detritiation process for highly tritiated water (HTW) has to be identified. • Water gas shift and isotopic swamping via Pd–Ag membrane reactor are possible processes. • A parametric analysis through two simulation codes is performed. • A comparison in terms of the decontamination factor is provided. -- Abstract: In a D–T fusion machine, due to the possible reaction between tritium and oxygen, some potential sources of highly tritiated water (HTW) can be identified. Therefore, a dedicated detritiation process has to be assessed either for economic and safety reasons. In this view, the use of a Pd-based membrane reactor performing isotopic exchange reactions can be considered since hydrogen isotopes exclusively permeate the Pd–Ag membrane and their exchange over the catalyst realizes the water detritiation. In this activity, the treatment of highly tritiated water, generated by an ITER-like machine (i.e. 2 kg of stoichiometric HTO containing up to 300 g of tritium), via a Pd-membrane reactor is studied in terms of decontamination capability. Especially, a parametric analysis of two processes (water gas shift and isotopic swamping) performed in a Pd-based membrane reactor is carried out by using two mathematical models previously developed and experimentally verified. Particularly, the effect of the reactor temperature, the membrane thickness, the reaction pressure and the protium sweep flow-rate is investigated. Moreover, a comparison in terms of the decontamination factor and the number of reactors necessary to detritiate the HTW are provided. Generally, the results reveal a higher decontamination capability of the WGS reaction respect with the IS (maximum DF values of about 120 and 1.6 in the case of WGS and IS, respectively). However some drawbacks, mainly related with the formation of tritiated species, can occur by performing the WGS.

  18. Fitossociologia de dois trechos inundáveis de Matas de Galeria no Distrito Federal, Brasil Phytosociology of two swamped portions of gallery forests in Distrito Federal, Brazil

    Directory of Open Access Journals (Sweden)

    Ernestino de Souza Gomes Guarino

    2005-09-01

    Full Text Available As Matas de Galeria do bioma Cerrado possuem peculiaridades fisionômicas e florísticas que permitem separá-las em dois subtipos: "não-inundável", quando em solos bem drenados; e "inundável", o subtipo menos estudado, em solos mal drenados. O presente trabalho objetivou caracterizar estrutural e floristicamente dois trechos inundáveis das matas dos córregos Acampamento (15°35'S; 48°10'W e Riacho Fundo (15°55'S; 48°02'W no Distrito Federal (DF. Para isso foi alocada em cada Mata uma grade de 160×50 m (0,8 ha, composta por 40 parcelas de 10×20 m (200 m². Todos os indivíduos com diâmetro a 1,30 m da altura do solo (DAP > 3,0 cm foram amostrados, incluindo aqueles mortos ainda em pé. Foram amostrados 6.078 indivíduos, sendo 3.030 no trecho do Acampamento (33 famílias, 49 gêneros e 60 espécies e 3.048 no Riacho Fundo (30 famílias, 41 gêneros, 53 espécies. A área basal e a diversidade (H' calculada para os trechos foram de 47,96 m²/ha e 2,99 nats/ind. (Acampamento, e 41,28 m²/ha e 2,84 nats/ind. (Riacho Fundo, respectivamente. Se comparados com matas anteriormente estudadas no DF os valores de diversidade são baixos, estando na mesma magnitude indicada para as Matas de Brejo (Higrófilas do sudeste brasileiro. Os índices de similaridade indicaram alta semelhança qualitativa (Sørensen 58,0% e quantitativa (Morisita 70,6% entre os trechos estudados, embora uma classificação por TWINSPAN tenha gerado dois grupos distintos, cada qual vinculado a um dos trechos. Os resultados reforçam indicações anteriores de que as Matas de Galeria do DF, ou trechos similares destas, inundáveis ou não, possuem comunidades arbóreas particulares, as quais estão relacionadas à bacia hidrográfica na qual a Mata esta inserida e ao padrão determinante da drenagem do solo.Gallery forests in the Cerrado biome possess physiognomic and floristic peculiarities that allow its division in two subtypes: "non-swamp" located in well drained

  19. The transfer of two clades of Malaysian Sphenomorphus Fitzinger (Squamata: Scincidae) into the genus Tytthoscincus Linkem, Diesmos, & Brown and the description of a new Malaysian swamp-dwelling species.

    Science.gov (United States)

    Grismer, L Lee; Muin, Mohd Abdul; Wood, Perry L Jr; Anuar, Shahrul; Linkem, Charles W

    2016-03-15

    Phylogenetic analyses based on the mitochondrial gene ND2 and its flanking tRNAs indicate the diminutive upland and insular species Sphenomorphus bukitensis, S. butleri, S. langkawiensis, S. perhentianensis, and S. temengorensis form a monophyletic group that is phylogenetically embedded within the Southeast Asian genus Tytthoscincus. The analyses also indicate that a new swamp-dwelling skink from the Bukit Panchor State Park, Pulau Pinang, Peninsular Malaysia is the sister species to the swamp-dwelling species S. sibuensis from Pulau Sibu, Johor and Singapore and that these two are also embedded in the genus Tytthoscincus. By transferring the two Peninsular Malaysian clades of Sphenomorphus into the genus Tytthoscincus, the monophyly of the latter is maintained. The new species T. panchorensis sp. nov. can be distinguished from all other species of Tytthoscincus by having a unique combination of morphological and color pattern characteristics.

  20. EVALUATION OF THE REPRODUCTIVE CHARACTERISTICS OF TWO SUBSPECIES OF AFRICAN GIANT LAND SNAILS Archachatina marginata ovum AND Archachatina marginata saturalis FED OIL PALM FRUITS IN SWAMP FOREST ZONE OF NIGERIA.

    OpenAIRE

    Ubua J. A; Ibom, L.A; Ekpo, T, E

    2012-01-01

    The study evaluated the reproductive characteristics of two African giant land snail subspecies (Archachatina marginata ovum and Archachatina marginata saturalis) fed oil palm fruits in swamp forest zone of Nigeria within a 20 week periods. Reproductive characteristics of the two African giant land snails subspecies evaluated revealed that Archachatina marginata ovum performed better (P < 0.05) than Archachatina marginata saturalis in terms of total number of eggs laid, clutch size, incubat...

  1. Floristic composition and structure of a peat swamp forest in the conservation area of the PT National Sago Prima, Selat Panjang, Riau, Indonesia

    Directory of Open Access Journals (Sweden)

    Yusi Rosalina

    2014-12-01

    Full Text Available We studied the floristic composition and structure of the logged-over peat swamp forest in the  PT National Sago Prima of PT Sampoerna Agro Tbk. group for future management of the conservation area that has been  set aside by the company.  In January - February 2012, 25 quadrats of 20 m × 20 m were laid out systematically along a transect,  thus covering a sampled area of 1-ha.  The results showed that the study site was a regenerating and developing secondary  peat swamp forests having high plant species richness. The total number of species recorded was 73 species of 38 families, consisting of 49 species (30 families of trees (DBH≥ 10 cm , 42     species (24 families of saplings (H > 1.5 m and DBH < 10 cm and 41 species (27 families of seedlings and undergrowth. Tree density was 550 individuals/ha and total tree basal area was 18.32 m2. The Shannon-Wiener’s Diversity Index for trees was high  (3.05  Two tree species with the highest Importance Values (IV were Pandanus atrocarpus (IV = 45.86 % and Blumeodendron subrotundifolium (22.46%. The tree families with the highest IV were Pandanaceae (45.86, Myrtaceae (40.37 and Dipterocarpaceae (39.20.  Forest structure dominated by trees with a diameter below 20 cm amounting to 408 trees/ha (74.05%. D and E strata with height of less than 20 m, and density of 431 trees/ha (78.36%. Jaccard Similarity index among species, showed strong association between Pandanus atrocarpus and Blumeodendron subrotundifolium and based on this association combined with high IVs, the two parameters of species characterized the forest, hence the forest  could be designated as the Pandanus atrocarpus–Blumeodendron   subrotundifolium association. Primary forest species with high economic values were still present in the forest. Eleven species can be included in the IUCN Red List, of which Shorea rugosa is in the category of Critically Endangered,  Shorea teysmanniana Endangered and

  2. ANALISIS SISTEM USAHATANI TERPADU DI LAHAN PASANG SURUT UNTUK MENDUKUNG PENGEMBANGAN AGROINDUSTRI WILAYAH (An Analysis Integrated Farming System in Tidal Swamp Land to Support Regional Agroindustrial Development

    Directory of Open Access Journals (Sweden)

    Rustan Massinai

    2013-11-01

    Full Text Available Integrated farming system was directed to the efforts to lengthen biological cycle by optimizing the use of agriculture and livestock by-products. Each chain of cycle resulted a new product that has high economic value, so this system was expected to optimize the empowerment and use of marginal land in all regions. The objective of this research was to analyze integrated farming system in tidal swamp land to support agroindustry development in Pulang Pisau Regency of Central Kalimantan Province. This research was done with survey and interview method in Pulang Pisau Regency of Central Kalimantan Province. Primary data was collected from May 2011 to December 2011. The results showed that the management of agro-based enterprises integrated farming (rice, coffee and cattle obtained by the BC Ratio = 1.09, (greater than 1, IRR = 16,7% greater than the rate bank interest rate (12% and NPV values obtained for Rp 37,349,080 is positive (+, then the utilization of integrated agro-based farming in tidal land eligible to be developed. Agro-industry development opportunities based integrated farming in tidal land in the future have a chance to be applied in other areas, it can anticipate the growing number of people who have added each year. Keywords: Integrated farming system analysis, tidal swamp land, agroindustry   ABSTRAK Sistem pertanian terpadu diarahkan pada upaya memperpanjang siklus biologis dengan mengoptimalkan pemanfaatan hasil samping pertanian dan peternakan. Setiap mata rantai siklus menghasilkan produk baru yang memiliki nilai ekonomis tinggi, sehingga dengan sistem ini diharapkan pemberdayaan dan pemanfaatan lahan marginal di seluruh daerah dapat lebih dioptimalkan. Penelitian ini bertujuan untuk menganalisis sistem usahatani terpadu (Integrated Farming System di lahan pasang surut untuk mendukung pengembangan agroindustri di Kabupaten Pulang Pisau Provinsi Kalimantan Tengah. Penelitian ini dilaksanakan dengan metode survei dan wawancara

  3. Assessing the influence of return density on estimation of lidar-based aboveground biomass in tropical peat swamp forests of Kalimantan, Indonesia

    Science.gov (United States)

    Manuri, Solichin; Andersen, Hans-Erik; McGaughey, Robert J.; Brack, Cris

    2017-04-01

    The airborne lidar system (ALS) provides a means to efficiently monitor the status of remote tropical forests and continues to be the subject of intense evaluation. However, the cost of ALS acquisition can vary significantly depending on the acquisition parameters, particularly the return density (i.e., spatial resolution) of the lidar point cloud. This study assessed the effect of lidar return density on the accuracy of lidar metrics and regression models for estimating aboveground biomass (AGB) and basal area (BA) in tropical peat swamp forests (PSF) in Kalimantan, Indonesia. A large dataset of ALS covering an area of 123,000 ha was used in this study. This study found that cumulative return proportion (CRP) variables represent a better accumulation of AGB over tree heights than height-related variables. The CRP variables in power models explained 80.9% and 90.9% of the BA and AGB variations, respectively. Further, it was found that low-density (and low-cost) lidar should be considered as a feasible option for assessing AGB and BA in vast areas of flat, lowland PSF. The performance of the models generated using reduced return densities as low as 1/9 returns per m2 also yielded strong agreement with the original high-density data. The use model-based statistical inferences enabled relatively precise estimates of the mean AGB at the landscape scale to be obtained with a fairly low-density of 1/4 returns per m2, with less than 10% standard error (SE). Further, even when very low-density lidar data was used (i.e., 1/49 returns per m2) the bias of the mean AGB estimates were still less than 10% with a SE of approximately 15%. This study also investigated the influence of different DTM resolutions for normalizing the elevation during the generation of forest-related lidar metrics using various return densities point cloud. We found that the high-resolution digital terrain model (DTM) had little effect on the accuracy of lidar metrics calculation in PSF. The accuracy of

  4. Present distribution and future spread of louisiana red swamp crayfish Procambarus clarkii (Crustacea, Decapoda, Astacida, Cambaridae in Britain : Implications for conservation of native species and habitats

    Directory of Open Access Journals (Sweden)

    Ellis A.

    2012-10-01

    Full Text Available The Louisiana red swamp crayfish Procambarus clarkii is highly invasive. It is now common in Europe where it is causing problems to native wildlife and structural damage to habitats. Procambarus clarkii was first recorded in Britain in 1991 and is currently found in the Hampstead Heath ponds and Regents Canal in London, as well as a small lake 15 km outside of Greater London. This paper considers how conditions in Britain affect the life cycle, breeding habits and potential range expansion of P. clarkii. Results of trapping surveys are presented in an effort to map the current distribution of P. clarkii and predict which areas it could colonise in the future. The ecological impact of potential colonisation is discussed by considering the impact P. clarkii has in mainland Europe. It is concluded that P. clarkii is likely to spread from Regents Canal into the nearby Brent, Crane, Colne, Lee and Thames catchments within 50 years. This time would be reduced significantly if further deliberate or accidental introductions by humans occur since this is deemed a far greater risk than natural expansion. P. clarkii is expected to have a negative impact on aquatic ecosystems in Britain and therefore tighter enforcement is needed to slow the spread of this species.

  5. RICE CULTIVATION ASPECTS OF DEVELOPMENT TIDAL SWAMPS AGRICULTURE SUPPORTED TO FOOD SECURITY (Case study of Danda Besar Unit, Barito Kuala district

    Directory of Open Access Journals (Sweden)

    Agus Supriyo

    2017-09-01

    Full Text Available k of reclamation. Research was carried out in July 2012. Method: "participatory rural appraisal" and interviews. Secondary data were obtained from "desk study". Data were analyzed using SWOT. Results: aspects of rice cultivating in land development tidal marsh consisting problem: (a land management (land arrangement lowland system start area upstream to downstream, low soil fertility, ground is not yet mature, (b arrangements water (macro and micro, (c participation of farmers (labor and skills are limited, and (d external support (KUD is not functioning optimally, number of extension limited to one PPL serves 659 farmers and "cover" area of land covering an area of 1,546 ha. Scenario development of tidal marsh Danda Besar can be divided into (a arrangement of land, (b setting micro water management by creating a channel quarter and channel worms and sanitation channel tertiary (c mechanization of agriculture by means of pre-harvest and post-harvest systems business services, training, technological innovation swamp land for farmer groups, and (d revitalizing function of cooperatives, increasing number of personnel PPLn and labor observers water associated with task forces village

  6. A new genus of proteocephalid tapeworm (Cestoda) from the marbled swamp eel Synbranchus marmoratus Bloch (Synbranchiformes: Synbranchidae) in the River Paraná basin, Argentina.

    Science.gov (United States)

    Arredondo, Nathalia J; Alves, Philippe Vieira; Gil de Pertierra, Alicia A

    2017-05-05

    Synbranchiella gen. n. is proposed to accommodate Synbranchiella mabelae sp. n. (Proteocephalidae: Monticelliinae) from the intestine of the marbled swamp eel Synbranchus marmoratus Bloch, in the River Colastiné, a tributary of the middle River Paraná in Argentina. The new genus is placed in the Monticelliinae because of the cortical position of the genital organs. It differs from all known monticelliine genera by the following combination of characters: (i) scolex robust, with a conical apex, without metascolex; (ii) biloculate suckers with a conspicuous septum separating unequally-sized loculi and a robust non-adherent area, lacking free posterior margin; (iii) vitelline follicles in two narrow lateral bands, extended throughout the nearly entire proglottid length; (iv) vagina always anterior to the cirrus-sac, with an inconspicuous vaginal sphincter; (v) a genital pore pre-equatorial. Scanning electron microscopy revealed three types of microtriches on the tegument surface: acicular and capiliform filitriches and gladiate spinitriches. A phylogenetic analysis of the large subunit nuclear ribosomal RNA gene (lsrDNA, D1-D3 domains) confirms that S. mabelae represents an independent lineage within a large clade comprised mainly from Neotropical taxa parasitising catfishes. This is the second proteocephalidean cestode described from a Neotropical synbranchiform fish host.

  7. Transport and Retention of Nitrogen, Phosphorus and Carbon in North America’s Largest River Swamp Basin, the Atchafalaya River Basin

    Directory of Open Access Journals (Sweden)

    Y. Jun Xu

    2013-04-01

    Full Text Available Floodplains and river corridor wetlands may be effectively managed for reducing nutrients and carbon. However, our understanding is limited to the reduction potential of these natural riverine systems. This study utilized the long-term (1978–2004 river discharge and water quality records from an upriver and a downriver location of the Atchafalaya River to quantify the inflow, outflow, and inflow–outflow mass balance of total Kjeldahl nitrogen (TKN = organic nitrogen + ammonia nitrogen, nitrate + nitrite nitrogen (NO3 + NO2, total phosphorous (TP, and total organic carbon (TOC through the largest river swamp basin in North America. The study found that, over the past 27 years, the Atchafalaya River Basin (ARB acted as a significant sink for TKN (annual retention: 24%, TP (41%, and TOC (12%, but a source for NO3 + NO2 nitrogen (6%. On an annual basis, ARB retained 48,500 t TKN, 16,900 t TP, and 167,100 t TOC from the river water. The retention rates were closely and positively related to the river discharge with highs during the winter and spring and lows in the late summer. The higher NO3 + NO2 mass outflow occurred throughout spring and summer, indicating an active role of biological processes on nitrogen as water and air temperatures in the basin rise.

  8. High Throughput Sequencing to Detect Differences in Methanotrophic Methylococcaceae and Methylocystaceae in Surface Peat, Forest Soil, and Sphagnum Moss in Cranesville Swamp Preserve, West Virginia, USA

    Science.gov (United States)

    Lau, Evan; Nolan, Edward J.; Dillard, Zachary W.; Dague, Ryan D.; Semple, Amanda L.; Wentzell, Wendi L.

    2015-01-01

    Northern temperate forest soils and Sphagnum-dominated peatlands are a major source and sink of methane. In these ecosystems, methane is mainly oxidized by aerobic methanotrophic bacteria, which are typically found in aerated forest soils, surface peat, and Sphagnum moss. We contrasted methanotrophic bacterial diversity and abundances from the (i) organic horizon of forest soil; (ii) surface peat; and (iii) submerged Sphagnum moss from Cranesville Swamp Preserve, West Virginia, using multiplex sequencing of bacterial 16S rRNA (V3 region) gene amplicons. From ~1 million reads, >50,000 unique OTUs (Operational Taxonomic Units), 29 and 34 unique sequences were detected in the Methylococcaceae and Methylocystaceae, respectively, and 24 potential methanotrophs in the Beijerinckiaceae were also identified. Methylacidiphilum-like methanotrophs were not detected. Proteobacterial methanotrophic bacteria constitute Sphagnum moss) or co-occurred in both Sphagnum moss and peat. This study provides insights into the structure of methanotrophic communities in relationship to habitat type, and suggests that peat and Sphagnum moss can influence methanotroph community structure and biogeography. PMID:27682082

  9. Population genetic structure and molecular diversity of the red swamp crayfish in China based on mtDNA COI gene sequences.

    Science.gov (United States)

    Liu, Gang; Zhou, Lizhi

    2017-11-01

    Population genetic structure and molecular diversity are closely related to adaptability, potential and evolutionary of a species, which also reflects its population history. We analyzed the molecular variability and genetic structure among 24 populations of the red swamp crayfish in China based on the COI region. The COI of 687 bp aligned across 44 haplotypes, the average AT content (68.1%) was slightly higher than the AT content (31.9%). AMOVA indicated that a high proportion of the total genetic variance was attributable to variations within populations (87.57%), whereas only 12.43% occurred among populations. The Fst values were between 0.016 and 0.585, and the Nm values were between 0.178 and 15.182 in each population. All of the AMOVA, Fst statistics and Nm values suggested low genetic differentiation, but a high level genetic diversity existed in Chinese populations of Procambarus clarkii. The phylogenetic trees showed that some geographical populations were irregularly distributed according to the river systems while others were matched well, suggesting that genetic differentiation is created largely by geographic isolation.

  10. Importance of body-water circulation for body-heat dissipation in hot-humid climates: a distinctive body-water circulation in swamp buffaloes

    Directory of Open Access Journals (Sweden)

    S. Chanpongsang

    2010-02-01

    Full Text Available Thermo-regulation in swamp buffaloes has been investigated as an adaptive system to hot-humid climates, and several distinctive physiological responses were noted. When rectal temperature increased in hot conditions, blood volume, blood flow to the skin surface and skin temperature markedly increased in buffaloes relatively to cattle. On the other hand, the correlation between blood volume and plasma concentration of arginine vasopressin (AVP was compared between buffaloes and cattle under dehydration. Although plasma AVP in cattle increased immediately for reducing urine volume against a decrease in blood volume as well as the response observed in most animal species, the increase in plasma AVP was delayed in buffaloes, even after a large decrease in blood volume. In buffaloes, a marked increase in blood volume facilitated the dissipation of excess heat from the skin surface during wallowing. In addition, the change in plasma AVP observed in buffaloes was consistent with that of other animals living in habitats with the high availability of water. These results suggest that the thermo-regulatory system in buffaloes accelerates body-water circulation internally and externally. This system may be adaptive for heat dissipation in hot-humid climates, where an abundance of water is common.

  11. ISOLASI DAN KARAKTERISASI PROTEASE DARI BAKTERI TANAH RAWA INDRALAYA, SUMATERA SELATAN [Isolation and Characterization of Proteases from Indralaya Soil Swamp Bacteria,South Sumatera

    Directory of Open Access Journals (Sweden)

    Ace Baehaki*

    2011-06-01

    Full Text Available In an effort of obtaining indigenous protease producing bacteria, screening for bacterial protease was conducted from samples collected from Indralaya soil swamp, South Sumatera. Three of 31 colonies showed high protease activity with proteolytic index >1.00. T1S1 produced enzyme with the highest activity. The crude enzyme activity after 48 hours of incubation was 0.391 IU/ml. The optimum pH of the extracelull proteases from T1S1, T3S2 and T3S3 were 8.0, 8.0, and 7.5, respectively. The optimum temperature of T1S1, T3S2 and T3S3 proteases were 40, 50, and 500C, respectively. All metal ions tested (Na+, K+, Mn2+, Zn2+ and Fe2+ inhibited proteases except Fe2+ which activatesthe T3S3 protease at 5 mM. EDTA (1 and 5 mM inhibited all proteases. Study on the effect of metals ion and spesific inhibitors indicated that all protease are metaloprotease. Molecular weights was determined using SDS-PAGE and zymogram technique. The molecular weight of T1S1 proteases was 121 kD,T3S2 proteaseswere 51, 71, and 119 kD whereas T3S3 proteaseswere 49, 70, and 116 kD.

  12. Fine-scale habitat use by orang-utans in a disturbed peat swamp forest, central Kalimantan, and implications for conservation management.

    Science.gov (United States)

    Morrogh-Bernard, Helen C; Husson, Simon J; Harsanto, Fransiskus A; Chivers, David J

    2014-01-01

    This study was conducted to see how orang-utans (Pongo pygmaeus wurmbii) were coping with fine-scale habitat disturbance in a selectively logged peat swamp forest in Central Kalimantan, Borneo. Seven habitat classes were defined, and orang-utans were found to use all of these, but were selective in their preference for certain classes over others. Overall, the tall forest classes (≥20 m) were preferred. They were preferred for feeding, irrespective of canopy connectivity, whereas classes with a connected canopy (canopy cover ≥75%), irrespective of canopy height, were preferred for resting and nesting, suggesting that tall trees are preferred for feeding and connected canopy for security and protection. The smaller forest classes (≤10 m high) were least preferred and were used mainly for travelling from patch to patch. Thus, selective logging is demonstrated here to be compatible with orang-utan survival as long as large food trees and patches of primary forest remain. Logged forest, therefore, should not automatically be designated as 'degraded'. These findings have important implications for forest management, forest classification and the designation of protected areas for orang-utan conservation.

  13. High Throughput Sequencing to Detect Differences in Methanotrophic Methylococcaceae and Methylocystaceae in Surface Peat, Forest Soil, and Sphagnum Moss in Cranesville Swamp Preserve, West Virginia, USA

    Directory of Open Access Journals (Sweden)

    Evan Lau

    2015-04-01

    Full Text Available Northern temperate forest soils and Sphagnum-dominated peatlands are a major source and sink of methane. In these ecosystems, methane is mainly oxidized by aerobic methanotrophic bacteria, which are typically found in aerated forest soils, surface peat, and Sphagnum moss. We contrasted methanotrophic bacterial diversity and abundances from the (i organic horizon of forest soil; (ii surface peat; and (iii submerged Sphagnum moss from Cranesville Swamp Preserve, West Virginia, using multiplex sequencing of bacterial 16S rRNA (V3 region gene amplicons. From ~1 million reads, >50,000 unique OTUs (Operational Taxonomic Units, 29 and 34 unique sequences were detected in the Methylococcaceae and Methylocystaceae, respectively, and 24 potential methanotrophs in the Beijerinckiaceae were also identified. Methylacidiphilum-like methanotrophs were not detected. Proteobacterial methanotrophic bacteria constitute <2% of microbiota in these environments, with the Methylocystaceae one to two orders of magnitude more abundant than the Methylococcaceae in all environments sampled. The Methylococcaceae are also less diverse in forest soil compared to the other two habitats. Nonmetric multidimensional scaling analyses indicated that the majority of methanotrophs from the Methylococcaceae and Methylocystaceae tend to occur in one habitat only (peat or Sphagnum moss or co-occurred in both Sphagnum moss and peat. This study provides insights into the structure of methanotrophic communities in relationship to habitat type, and suggests that peat and Sphagnum moss can influence methanotroph community structure and biogeography.

  14. Trace element concentrations in red swamp crayfish (Procambarus clarkii) and surface sediments in Lake Preola and Gorghi Tondi natural reserve, SW Sicily.

    Science.gov (United States)

    Bellante, A; Maccarone, V; Buscaino, G; Buffa, G; Filiciotto, F; Traina, A; Del Core, M; Mazzola, S; Sprovieri, M

    2015-07-01

    Concentrations of trace elements (Cd, Pb, As, V, Cr, Ni, Cu and Zn) were determined in superficial sediments and in muscle and hepatopancreas tissues of the red swamp crayfish Procambarus clarkii from Lake Preola and Gorghi Tondi Natural Reserve (SW Sicily). In particular, hepatopancreas showed a decidedly higher content of all analysed trace elements with respect to muscles (two- to threefold higher for Cd, Cu, As, Zn and V; four- to fivefold higher for Pb and Cr and seven times higher for Ni). However, no statistically reliable differential accumulation pattern emerged with regard to length and weight for trace elements (except for Cd for which significant positive correlations with length were recorded). Trace element concentrations found in crayfish tissues were in the range considered harmful to human health (except for Cd and Cr). Moreover, the As and Pb concentrations, either in sediment or crayfish tissues, are clearly related to intense agricultural activities, with extensive use of fertilizers and pesticides, that significantly affect the levels of these toxic metals in the study area.

  15. Short-term changes in the abundance and parity rate of Anopheles quadrimaculatus species C (Diptera: Culicidae) in a central Florida swamp.

    Science.gov (United States)

    Jensen, T; Kaiser, P E; Barnard, D R

    1993-11-01

    Updraft CDC traps baited with dry ice were used to monitor changes in the abundance and parity rate of Anopheles quadrimaculatus Say complex mosquitoes in an intermittently flooded swamp in Central Florida during an 18-d period. Mosquitoes collected each day were identified to species using DNA hybridization and isozyme electrophoretic techniques and were dissected to determine follicular maturation and parity. Of 1,178 An. quadrimaculatus mosquitoes identified to species, 4% were species A and 96% were species C. Dissections of females of both species indicated that 98% were nonblood fed and nongravid with ovariole development at Christophers' stage II. Overall parity rates were 0.19 and 0.51 for populations of species A and species C, respectively. The duration of the gonotrophic cycle for species C females was estimated to be 5 d based on the interval between peaks in the number of nulliparous females collected on days 1 and 6 and peaks in the number of parous females collected 5 d later. Significant trends were observed in the number of parous species C females collected each day, indicating that the parity rate could not be used as an unbiased estimator of survivorship.

  16. First insights into mid-Holocene environmental change in central Vanuatu inferred from a terrestrial record from Emaotfer Swamp, Efaté Island

    Science.gov (United States)

    Wirrmann, Denis; Eagar, Stephen H.; Harper, Margaret A.; Leroy, Éric; Sémah, Anne-Marie

    2011-12-01

    Here we present the first terrestrial record of mid-Holocene environmental changes in Vanuatu. This preliminary multi-proxy analysis of core Tfer 06 from Emaotfer Swamp (Efaté Island) indicates changes in environmental conditions are mainly related to variations in climate over the last 6500 cal yr BP. Drier periods are broadly correlated with an increase in sustained El Niño events recorded in the Pacific on a decadal timescale. The earliest change is the disappearance of mangroves adjacent to the site around 3200 cal yr BP, this could well be due to both local tectonic uplift with subsequent hydrostatic adjustment and the onset of a drier period. From c. 3250-2500 cal yr BP the prevailing drier conditions can be linked to more persistent El Niño conditions. Local volcanic events had limited ecological impact on the area. Freshwater diatoms indicate a hydroseral succession, species living on submerged plants being common in muds from c. 3250-1500 cal yr BP, but rare in fibrous peat deposited later. Palaeoecological indicators of human impact have not been identified throughout this work.

  17. Food selection and utilization in a danid butterfly.

    Science.gov (United States)

    Mathavan, S; Bhaskaran, R

    1975-03-01

    Larvae of the danid butterfly Danaus chrysippus, fed on the milkweeds Calotropis gigantea and Asclepias curassavica grew successfully during the 9-day feeding period and pupated. In the presence of these milkweeds, the larvae preferred to feed on C. gigantea. Their preference was more pronounced during the final 2 instars than during the initial 3 instars. They consumed 605 mg, defecated 308 mg, and converted 115 mg of C. gigantea; those receiving A. curassavica consumed 563 mg, defecated 287 mg and converted 85 mg. They assimilated either food with equal efficiency (♀♀: 46%; ♂♂: 50%). But they differed significantly in their efficiency in converting the assimilated food. The presence of a greater amount of latex in C. gigantea than in A. curassavica and/or the nutritional inadequacy of the latter food may perhaps be the reason(s) for the preference of C. gigantea by D. chrysippus larvae over A. curassavica.

  18. Swamp buffalo keeping – an out-dated farming activity? A case study in smallholder farming systems in Xishuangbanna, Yunnan Province, PR China

    Directory of Open Access Journals (Sweden)

    Anne Schiborra

    2012-01-01

    Full Text Available Expansion of rubber tree plantations and agricultural mechanization caused a decline of swamp buffalo numbers in the Naban River National Nature Reserve (NRNNR, Yunnan Province, China. We analysed current use of buffaloes for field work and the recent development of the regional buffalo population, based on interviews with 184 farmers in 2007/2008 and discussions with 62 buffalo keepers in 2009. Three types of NRNNR farms were distinguished, differing mainly in altitude, area under rubber, and involvement in livestock husbandry. While pig based farms (PB; n=37 have abandoned buffalo keeping, 11% of the rubber based farms (RB; n=71 and 100% of the livestock-corn based farms (LB; n=76 kept buffaloes in 2008. Herd size was 2.5 +/-1.80 (n=84 buffaloes in early 2008 and 2.2 +/-1.69 (n=62 in 2009. Field work on own land was the main reason for keeping buffaloes (87.3 %, but lending work buffaloes to neighbours (79.0% was also important. Other purposes were transport of goods (16.1%, buffalo trade (11.3% and meat consumption (6.4%. Buffalo care required 6.2 +/-3.00 working hours daily, while annual working time of a buffalo was 294 +/-216.6 hours. The area ploughed with buffaloes remained constant during the past 10 years despite an expansion of land cropped per farm. Although further replacement of buffaloes by tractors occurs rapidly, buffaloes still provide cheap work force and buffer risks on poor NRNNR farms. Appropriate advice is needed for improved breeding management to increase the efficiency of buffalo husbandry and provide better opportunities for buffalo meat sale in the region.

  19. Seasonal profiles of leaf ascorbic acid content and redox state in ozone-sensitive wildflowers

    Energy Technology Data Exchange (ETDEWEB)

    Burkey, Kent O. [Plant Science Research Unit, USDA-ARS and North Carolina State University, 3127 Ligon Street, Raleigh, NC 27607 (United States)]. E-mail: koburkey@unity.ncsu.edu; Neufeld, Howard S. [Appalachian State University, Boone, NC (United States); Souza, Lara [Department of Ecology and Evolutionary Biology, University of Tennessee, Knoxville, TN (United States); Chappelka, Arthur H. [Auburn University, Auburn, AL (United States); Davison, Alan W. [University of Newcastle, Newcastle, England (United Kingdom)

    2006-10-15

    Cutleaf coneflower (Rudbeckia laciniata L.), crown-beard (Verbesina occidentalis Walt.), and tall milkweed (Asclepias exaltata L.) are wildflower species native to Great Smoky Mountains National Park (U.S.A.). Natural populations of each species were analyzed for leaf ascorbic acid (AA) and dehydroascorbic acid (DHA) to assess the role of ascorbate in protecting the plants from ozone stress. Tall milkweed contained greater quantities of AA (7-10 {mu}mol g{sup -1} fresh weight) than crown-beard (2-4 {mu}mol g{sup -1} fresh weight) or cutleaf coneflower (0.5-2 {mu}mol g{sup -1} fresh weight). DHA was elevated in crown-beard and cutleaf coneflower relative to tall milkweed suggesting a diminished capacity for converting DHA into AA. Tall milkweed accumulated AA in the leaf apoplast (30-100 nmol g{sup -1} fresh weight) with individuals expressing ozone foliar injury symptoms late in the season having less apoplast AA. In contrast, AA was not present in the leaf apoplast of either crown-beard or cutleaf coneflower. Unidentified antioxidant compounds were present in the leaf apoplast of all three species. Overall, distinct differences in antioxidant metabolism were found in the wildflower species that corresponded with differences in ozone sensitivity. - Wildflower species exhibit differences in ascorbic acid content and redox status that affect ozone sensitivity.

  20. PENGEMBANGAN KONSEP AGROINDUSTRI BERBASIS SISTEM USAHATANI TERPADU DI WILAYAH PASANG SURUT BAGIAN I: (KONSEP PEMIKIRAN The Concept Development of Agroindustry Based on Integrated Farming System at Tidal Swamp Land Areas Chapter I: Conceptual Thinkin

    Directory of Open Access Journals (Sweden)

    Rustan Massinai

    2013-06-01

    Full Text Available Integrated farming system was directed in efforts to lengthen biological cycle by optimizing use of agriculture and livestock products. Each chain of cycle resulted new product that have high economic value, so this system was expected to optimize empowerment and use of marginal land in all regions. The problems encountered in agricultural systems in tidal swamp land in general, i.e; (a limitations in the form of land, human resources, technology, and capital owned by farmers, then the potential of local resources need to be managed optimally, directed, integrated and sustainable with a view to improve land productivity and living standards of farmers by way of application of integrated farming systems by integrating crop and livestock based on the potential of local areas, and (b socio-economic problems and constraints in the development of food crops was due to a swamp area. The objective of this research was to produce integrated farming system concept to support agroindustry development in tidal swamp land in Pulang Pisau regency of Central Kalimantan province. This research was conducted with a book study method, which identifies a system consisting of integrated farming and agroindustry systems. In the both identification is performed by the system includes four aspects, i,e; economic aspects, technical aspects, social aspects of cultural and environmental. Integrated farming systems concept in tidal swamp land was generated from the production of integrated farming systems should first be processed through the processing system (agroindustry in the form of home industry, or using a mechanical device. After that, it was carried out the marketing of products, systems concepts was expected to increase the added value of agricultural production (rice, coffee and cow. With the application of agroindustry systems in tidal swamp land Pulang Pisau regency of Central Kalimantan Province is expected to increase the economic income of farmers in

  1. Properties and expression of Na+/K+-ATPase α-subunit isoforms in the brain of the swamp eel, Monopterus albus, which has unusually high brain ammonia tolerance.

    Directory of Open Access Journals (Sweden)

    Xiu L Chen

    Full Text Available The swamp eel, Monopterus albus, can survive in high concentrations of ammonia (>75 mmol l(-1 and accumulate ammonia to high concentrations in its brain (4.5 µmol g(-1. Na(+/K(+-ATPase (Nka is an essential transporter in brain cells, and since NH4(+ can substitute for K(+ to activate Nka, we hypothesized that the brain of M. albus expressed multiple forms of Nka α-subunits, some of which might have high K(+ specificity. Thus, this study aimed to clone and sequence the nka α-subunits from the brain of M. albus, and to determine the effects of ammonia exposure on their mRNA expression and overall protein abundance. The effectiveness of NH4(+ to activate brain Nka from M. albus and Mus musculus was also examined by comparing their Na(+/K(+-ATPase and Na(+/NH4(+-ATPase activities over a range of K(+/NH4(+ concentrations. The full length cDNA coding sequences of three nkaα (nkaα1, nkaα3a and nkaα3b were identified in the brain of M. albus, but nkaα2 expression was undetectable. Exposure to 50 mmol l(-1 NH4Cl for 1 day or 6 days resulted in significant decreases in the mRNA expression of nkaα1, nkaα3a and nkaα3b. The overall Nka protein abundance also decreased significantly after 6 days of ammonia exposure. For M. albus, brain Na(+/NH4(+-ATPase activities were significantly lower than the Na(+/K(+-ATPase activities assayed at various NH4(+/K(+ concentrations. Furthermore, the effectiveness of NH4(+ to activate Nka from the brain of M. albus was significantly lower than that from the brain of M. musculus, which is ammonia-sensitive. Hence, the (1 lack of nkaα2 expression, (2 high K(+ specificity of K(+ binding sites of Nkaα1, Nkaα3a and Nkaα3b, and (3 down-regulation of mRNA expression of all three nkaα isoforms and the overall Nka protein abundance in response to ammonia exposure might be some of the contributing factors to the high brain ammonia tolerance in M. albus.

  2. Burkholderia paludis sp. nov., an Antibiotic-Siderophore Producing Novel Burkholderia cepacia Complex Species, Isolated from Malaysian Tropical Peat Swamp Soil.

    Science.gov (United States)

    Ong, Kuan Shion; Aw, Yoong Kit; Lee, Learn Han; Yule, Catherine M; Cheow, Yuen Lin; Lee, Sui Mae

    2016-01-01

    A novel Gram negative rod-shaped bacterium, designated strain MSh1T, was isolated from Southeast Pahang tropical peat swamp forest soil in Malaysia and characterized using a polyphasic taxonomy approach. The predominant cellular fatty acids (>10.0%) were C16:0 (31.7%), C17:0 cyclo (26.6%), and C19:0 cyclo ω8c (16.1%). The polar lipids detected were phosphatidylglycerol, phosphatidylethanolamine, and diphosphatidylglycerol. The predominant ubiquinone was Q-8. This revealed that strain MSh1T belongs to the genus Burkholderia. The type strain MSh1T can be differentiated from other Burkholderia cepacia complex (Bcc) species by phylogenetic analysis of 16S rRNA gene sequence, multilocus sequence analysis (MLSA), average nucleotide identity (ANI) and biochemical tests. DNA-DNA relatedness values between strain MSh1T and closely related type strains were below the 70% threshold value. Based on this polyphasic study of MSh1T, it can be concluded that this strain represents a novel species within the Bcc, for which the name Burkholderia paludis sp. nov. is proposed. The type strain is MSh1T (= DSM 100703T = MCCC 1K01245T). The dichloromethane extract of MSh1T exhibited antimicrobial activity against four Gram positive bacteria (Enterococcus faecalis ATCC 29212, E. faecalis ATCC 700802, Staphylococcus aureus ATCC 29213, S. aureus ATCC 700699) and a Gram negative bacteria (Escherichia coli ATCC 25922). Further purification work has led to the isolation of Compound 1, pyochelin. Pyochelin demonstrated antimicrobial activity against four S. aureus strains and three E. faecalis strains with MIC-values of 3.13 μg/ml and 6.26 μg/ml, respectively. SEM analysis showed that the cellular morphology of E. faecalis ATCC 700802 was not affected by pyochelin; suggesting that it might target the intracellular components. Pyochelin, a siderophore with antimicrobial activity might be useful in treating bacterial infections caused by S. aureus and E. faecalis, however further work has to

  3. Holocene Climate Variability in the Central North Pacific: An Organic Geochemical Record from Ka'au Crater Swamp, O'ahu, Hawai'i

    Science.gov (United States)

    Street, J. H.; Beilman, D.; Timmermann, A.; Gaidos, E.; Paytan, A.

    2010-12-01

    North Pacific climate is known to have varied during the Holocene, with significant “downstream” effects on the regional climate and hydrology of western North America. Evidence from paleoclimatic studies along the northeast Pacific margin hints at several broad-scale regime shifts since the early Holocene, with spatial expressions analogous to those observed during phase shifts of the modern ENSO and PDO, though occurring on much longer (centennial to millennial) timescales. Nonetheless, the timing, magnitude and spatial patterns of Holocene rearrangements in oceanic and atmospheric circulation in the North Pacific remain incompletely defined. The main Hawaiian Islands (19 - 22 °N, 155 - 160 °W) are uniquely situated to “sample” climate variability in the subtropical, central North Pacific. Precipitation in Hawai’i is strongly influenced by the seasonal migration of the Pacific Anticyclone and the associated trade winds, and, during the winter, the frequency and intensity of westerly moisture-bearing storms. On interannual to decadal timescales, basin-wide circulation changes related to ENSO and PDO modulate trade wind strength and the occurrence of winter storm patterns, leading to local variations in precipitation. Terrestrial paleoclimatic records from Hawai’i are rare, but of great potential value to reconstruct aspects of central North Pacific atmospheric circulation during the Holocene, including the influence of the tropical ENSO system. In this study we present initial results from a 4.5 m, ~14 kyr sedimentary sequence recovered from Ka’au Crater Swamp, located near the leeward crest of the Ko’olau range of southeastern O’ahu, in a zone of high precipitation (>330 cm/yr). We utilize carbon and nitrogen elemental abundances (TOC, TN, C/N) and isotopic compositions (δ13C, δ15N) of bulk organic matter and ratios of biomarker compounds to reconstruct changes in vegetation, organic matter sources, and biogeochemical cycling in relation to

  4. Growth-Suppressing Effect of Calotropis procera (Giant Milkweed ...

    African Journals Online (AJOL)

    v20i3.4492 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors. OTHER RESOURCES... Journal Quality · for Researchers · for Journals · for Authors · for Policy Makers · about Open Access · FAQ's ...

  5. Patterns of resource use by milkweed insects in Sinai Abstract ...

    African Journals Online (AJOL)

    Francis

    upon which monarch caterpillars survive well tend to be plants with few attendant ants and few aphids (Mooney & Agrawal 2008). Since plant defence traits form part of this suite of heritable characters, the implication is that plant defensive chemistry impacts on insect herbivores, and attack by herbivores that is selective with ...

  6. Patterns of resource use by milkweed insects in Sinai | Elbanna ...

    African Journals Online (AJOL)

    Plant morphology and defensive chemistry are related to the insect community of herbivores on Gomphocarpus sinaicus (Boiss.) (Apocynaceae) in Sinai (Egypt). There appears to be significant variation among individual plants in the components of their chemical defences. The different components of the community ...

  7. Western Monarch and Milkweed Habitat Suitability Modeling Project- Final Presentation

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — To better understand the distribution of key breeding areas for the declining western population of monarch butterflies, the USFWS, in collaboration with the Xerces...

  8. The distribution and abundance of wetland ichthyofauna,and exploitation of the fisheries in the Godineau Swamp,Trinidad -Case study

    Directory of Open Access Journals (Sweden)

    Himawatee Ramsundar

    2005-05-01

    Full Text Available The Godineau (South OropucheSwamp (3171 haon the southwestern coast of Trinidad (10 º13- 15 ’N,61 º30-32 ’Wis heavily impacted by anthropogenic activities including fishing,oil exploration, drainage manipulation and wetland clearance.To reduce the negative effects of these activities and to manage the swamp more sustainably,more quantitative information is needed on the ecology of the wetland and the activities that occur within it.This study focuses on the distribution of the fish resources and exploited fisheries as a basis for more informed management directives. Sampling was conducted during 2002,in April-May (for dry seasonand July-September (for wet season sampling.Ichthyofauna was sampled both day and night using trammel nets and a push seine.Fishing activities were assessed using a questionnaire and informal discussions with fishers.The wetland supports over 29 species of fish distributed over the freshwater,estuarine and saline zones (n=1454. Species distribution is seasonal,with evidence of the wetland being used as a spawning ground. Species richness and species diversity (Shannon-Weiner Indexfor the wetland ranged over 2-11 and 0.162-0.967,respectively, in the dry season and 2-7 and 0.036-0.903,respectively,in the wet season.Communities inhabiting the saline and estuarine zones of the wetland were dominated by a single species,Hexanematichthys bonillai .Percent Similarity Indices were 41.8%for freshwater, 72.7%for estuarine and 79.8%for estuarine-saline communities. The commercial species accounted for 18%of total catch sampled and consisted of Centropomus undecimalis, Megalops atlanticus ,Hoplosternum littorale ,Hoplias malabaricus ,Ophioscion punctatissimus and Macrodon ancyclodon .Full-time and part-time fishers,including recreational fishers,accounted for 14.3%and 85.7%, respectively of all fishers surveyed (n=56.A conservative estimate of the revenue earned directly at point of sale for fish and shellfish,is approximately

  9. Restoring monarch butterfly habitat in the Midwestern US: 'All hands on deck'

    Science.gov (United States)

    Thogmartin, Wayne E.; Lopez-Hoffman, Laura; Rohweder, Jason; Diffendorfer, James E.; Drum, Ryan G.; Semmens, Darius J.; Black, Scott; Caldwell, Iris; Cotter, Donita; Drobney, Pauline; Jackson, Laura L.; Gale, Michael; Helmers, Doug; Hilburger, Steven B.; Howard, Elizabeth; Oberhauser, Karen S.; Pleasants, John M.; Semmens, Brice X.; Taylor, Orley R.; Ward, Patrick; Weltzin, Jake F.; Wiederholt, Ruscena

    2017-01-01

    The eastern migratory population of monarch butterflies (Danaus plexippus plexippus) has declined by >80% within the last two decades. One possible cause of this decline is the loss of ≥1.3 billion stems of milkweed (Asclepias spp.), which monarchs require for reproduction. In an effort to restore monarchs to a population goal established by the US Fish and Wildlife Service and adopted by Mexico, Canada, and the US, we developed scenarios for amending the Midwestern US landscape with milkweed. Scenarios for milkweed restoration were developed for protected area grasslands, Conservation Reserve Program land, powerline, rail and roadside rights of way, urban/suburban lands, and land in agricultural production. Agricultural land was further divided into productive and marginal cropland. We elicited expert opinion as to the biological potential (in stems per acre) for lands in these individual sectors to support milkweed restoration and the likely adoption (probability) of management practices necessary for affecting restoration. Sixteen of 218 scenarios we developed for restoring milkweed to the Midwestern US were at levels (>1.3 billion new stems) necessary to reach the monarch population goal. One of these scenarios would convert all marginal agriculture to conserved status. The other 15 scenarios converted half of marginal agriculture (730 million stems), with remaining stems contributed by other societal sectors. Scenarios without substantive agricultural participation were insufficient for attaining the population goal. Agricultural lands are essential to reaching restoration targets because they occupy 77% of all potential monarch habitat. Barring fundamental changes to policy, innovative application of economic tools such as habitat exchanges may provide sufficient resources to tip the balance of the agro-ecological landscape toward a setting conducive to both robust agricultural production and reduced imperilment of the migratory monarch butterfly.

  10. Restoring monarch butterfly habitat in the Midwestern US: ‘all hands on deck’

    Science.gov (United States)

    Thogmartin, Wayne E.; López-Hoffman, Laura; Rohweder, Jason; Diffendorfer, Jay; Drum, Ryan; Semmens, Darius; Black, Scott; Caldwell, Iris; Cotter, Donita; Drobney, Pauline; Jackson, Laura L.; Gale, Michael; Helmers, Doug; Hilburger, Steve; Howard, Elizabeth; Oberhauser, Karen; Pleasants, John; Semmens, Brice; Taylor, Orley; Ward, Patrick; Weltzin, Jake F.; Wiederholt, Ruscena

    2017-07-01

    The eastern migratory population of monarch butterflies (Danaus plexippus plexippus) has declined by >80% within the last two decades. One possible cause of this decline is the loss of ≥1.3 billion stems of milkweed (Asclepias spp.), which monarchs require for reproduction. In an effort to restore monarchs to a population goal established by the US Fish and Wildlife Service and adopted by Mexico, Canada, and the US, we developed scenarios for amending the Midwestern US landscape with milkweed. Scenarios for milkweed restoration were developed for protected area grasslands, Conservation Reserve Program land, powerline, rail and roadside rights of way, urban/suburban lands, and land in agricultural production. Agricultural land was further divided into productive and marginal cropland. We elicited expert opinion as to the biological potential (in stems per acre) for lands in these individual sectors to support milkweed restoration and the likely adoption (probability) of management practices necessary for affecting restoration. Sixteen of 218 scenarios we developed for restoring milkweed to the Midwestern US were at levels (>1.3 billion new stems) necessary to reach the monarch population goal. One of these scenarios would convert all marginal agriculture to conserved status. The other 15 scenarios converted half of marginal agriculture (730 million stems), with remaining stems contributed by other societal sectors. Scenarios without substantive agricultural participation were insufficient for attaining the population goal. Agricultural lands are essential to reaching restoration targets because they occupy 77% of all potential monarch habitat. Barring fundamental changes to policy, innovative application of economic tools such as habitat exchanges may provide sufficient resources to tip the balance of the agro-ecological landscape toward a setting conducive to both robust agricultural production and reduced imperilment of the migratory monarch butterfly.

  11. Análise comparativa da anatomia foliar de Melastomataceae em ambiente de vereda e cerrado sensu stricto Comparative analysis of Melastomataceae leaf anatomy in palm swamp and cerrado sensu stricto environments

    Directory of Open Access Journals (Sweden)

    Nádia Sílvia Somavilla

    2011-12-01

    Full Text Available Este trabalho descreve a anatomia das lâminas foliares de três espécies de Melastomataceae, Lavoisiera bergii Cogn., Macairea radula (Bonpl. DC. e Trembleya parviflora (D. Don Cogn. que estão colonizando a zona alagável e aberta de fundo de vereda e de M. radula e T. parviflora que ocorrem no cerrado sensu stricto da Estação Ecológica de Águas Emendadas, Planaltina/DF. Os dados estruturais mostrados pelas três espécies indicam escleromorfia com características particulares a cada uma delas, como projeções nas células epidérmicas de L. bergii, diferentes tipos e localização de emergências formadas por esclereídes em L. bergii e M. radula, e evaginações na epiderme de T. parviflora. A caracterização anatômica das folhas de M. radula e T. parviflora não difere entre os ambientes. No entanto, as lâminas foliares dos indivíduos encontrados na vereda apresentaram plasticidade com valores significativamente (PThis study describes the anatomy of the leaf blade of three species of Melastomataceae, Lavoisiera bergii Cogn., Macairea radula (Bonpl. DC. and Trembleya parviflora (D. Don Cogn., which colonize the flooded and open areas of a lower zone of palm swamp, and the M. radula and T. parviflora, which occur in cerrado sensu stricto, of the Estação Ecológica de Águas Emendadas, Planaltina, DF. Structural data of the three species indicate sclerophylly with particular characteristics to each of them, such as projections on epidermal cells of L. bergii, different types and position of emergencies in L. bergii and M. radula and the protrusion in the epidermis of T. parviflora. Anatomical characterization of the leaves of M. radula and T. parviflora did not differ between environments. However, the leaf blades of individuals of M. radula and T. parviflora found in the palm swamp showed plasticity in relation to individuals from the cerrado sensu stricto. Significantly higher values (P < 0.05 for the thickness of the mesophyll

  12. Reflorestamento de manguezais e o valor de resgate para o seqüestro de carbono atmosférico The reforestation of mangrove swamps and its value in atmospheric carbon sequestration

    Directory of Open Access Journals (Sweden)

    Sérgio de Mattos Fonseca

    2003-12-01

    Full Text Available Os autores afirmam a relevância do reflorestamento de manguezais para projetos de seqüestro de carbono atmosférico, dentro dos princípios do chamado mecanismo de desenvolvimento limpo (MDL,definidos em diversas arenas técnicas e políticas internacionais, dentro da Convenção de Mudanças Climáticas. Descrevem um projeto de pesquisa em andamento, que inclui estudo de caso focalizado em manguezais da laguna de Itaipu (Niterói, RJ, cujo objetivo é selecionar e fazer medições preliminares de parâmetros ecológicos e socioambientais relevantes para a valoração econômica e financeira dos benefícios do reflorestamento. A seleção e as medições servirão como estudo de viabilidade para que projetos semelhantes se qualifiquem para obter apoio financeiro e alcançar sucesso técnico, gerando benefícios ambientais e sociais.The article argues that the reforestation of mangrove swamps is of relevance to projects for sequestering atmospheric carbon, within the principles of the Clean Development Mechanism (CDM currently being defined in different technical and political arenas as part of the Convention on Climate Change. The text describes a research project currently under way that includes a case study of mangrove swamps in the Itaipu Lagoon in Niterói, RJ. The project's goal is to select and take preliminary measurements of the ecological and socio-environmental parameters pertinent to the economic and financial valuation of the benefits of reforestation. These parameters will serve as part of feasibility studies that determine whether similar projects up for financing by the CDM qualify for financial support and whether they will achieve technical success that brings environmental and social benefits to the various social actors involved.

  13. Disease ecology across soil boundaries: effects of below-ground fungi on above-ground host-parasite interactions.

    Science.gov (United States)

    Tao, Leiling; Gowler, Camden D; Ahmad, Aamina; Hunter, Mark D; de Roode, Jacobus C

    2015-10-22

    Host-parasite interactions are subject to strong trait-mediated indirect effects from other species. However, it remains unexplored whether such indirect effects may occur across soil boundaries and connect spatially isolated organisms. Here, we demonstrate that, by changing plant (milkweed Asclepias sp.) traits, arbuscular mycorrhizal fungi (AMF) significantly affect interactions between a herbivore (the monarch butterfly Danaus plexippus) and its protozoan parasite (Ophryocystis elektroscirrha), which represents an interaction across four biological kingdoms. In our experiment, AMF affected parasite virulence, host resistance and host tolerance to the parasite. These effects were dependent on both the density of AMF and the identity of milkweed species: AMF indirectly increased disease in monarchs reared on some species, while alleviating disease in monarchs reared on other species. The species-specificity was driven largely by the effects of AMF on both plant primary (phosphorus) and secondary (cardenolides; toxins in milkweeds) traits. Our study demonstrates that trait-mediated indirect effects in disease ecology are extensive, such that below-ground interactions between AMF and plant roots can alter host-parasite interactions above ground. In general, soil biota may play an underappreciated role in the ecology of many terrestrial host-parasite systems. © 2015 The Author(s).

  14. Density estimates of monarch butterflies overwintering in central Mexico

    Directory of Open Access Journals (Sweden)

    Wayne E. Thogmartin

    2017-04-01

    Full Text Available Given the rapid population decline and recent petition for listing of the monarch butterfly (Danaus plexippus L. under the Endangered Species Act, an accurate estimate of the Eastern, migratory population size is needed. Because of difficulty in counting individual monarchs, the number of hectares occupied by monarchs in the overwintering area is commonly used as a proxy for population size, which is then multiplied by the density of individuals per hectare to estimate population size. There is, however, considerable variation in published estimates of overwintering density, ranging from 6.9–60.9 million ha−1. We develop a probability distribution for overwinter density of monarch butterflies from six published density estimates. The mean density among the mixture of the six published estimates was ∼27.9 million butterflies ha−1 (95% CI [2.4–80.7] million ha−1; the mixture distribution is approximately log-normal, and as such is better represented by the median (21.1 million butterflies ha−1. Based upon assumptions regarding the number of milkweed needed to support monarchs, the amount of milkweed (Asclepias spp. lost (0.86 billion stems in the northern US plus the amount of milkweed remaining (1.34 billion stems, we estimate >1.8 billion stems is needed to return monarchs to an average population size of 6 ha. Considerable uncertainty exists in this required amount of milkweed because of the considerable uncertainty occurring in overwinter density estimates. Nevertheless, the estimate is on the same order as other published estimates. The studies included in our synthesis differ substantially by year, location, method, and measures of precision. A better understanding of the factors influencing overwintering density across space and time would be valuable for increasing the precision of conservation recommendations.

  15. Density estimates of monarch butterflies overwintering in central Mexico

    Science.gov (United States)

    Thogmartin, Wayne E.; Diffendorfer, James E.; Lopez-Hoffman, Laura; Oberhauser, Karen; Pleasants, John M.; Semmens, Brice X.; Semmens, Darius J.; Taylor, Orley R.; Wiederholt, Ruscena

    2017-01-01

    Given the rapid population decline and recent petition for listing of the monarch butterfly (Danaus plexippus L.) under the Endangered Species Act, an accurate estimate of the Eastern, migratory population size is needed. Because of difficulty in counting individual monarchs, the number of hectares occupied by monarchs in the overwintering area is commonly used as a proxy for population size, which is then multiplied by the density of individuals per hectare to estimate population size. There is, however, considerable variation in published estimates of overwintering density, ranging from 6.9–60.9 million ha−1. We develop a probability distribution for overwinter density of monarch butterflies from six published density estimates. The mean density among the mixture of the six published estimates was ∼27.9 million butterflies ha−1 (95% CI [2.4–80.7] million ha−1); the mixture distribution is approximately log-normal, and as such is better represented by the median (21.1 million butterflies ha−1). Based upon assumptions regarding the number of milkweed needed to support monarchs, the amount of milkweed (Asclepias spp.) lost (0.86 billion stems) in the northern US plus the amount of milkweed remaining (1.34 billion stems), we estimate >1.8 billion stems is needed to return monarchs to an average population size of 6 ha. Considerable uncertainty exists in this required amount of milkweed because of the considerable uncertainty occurring in overwinter density estimates. Nevertheless, the estimate is on the same order as other published estimates. The studies included in our synthesis differ substantially by year, location, method, and measures of precision. A better understanding of the factors influencing overwintering density across space and time would be valuable for increasing the precision of conservation recommendations.

  16. High brain ammonia tolerance and down-regulation of Na+:K+:2Cl(- Cotransporter 1b mRNA and protein expression in the brain of the Swamp Eel, Monopterus albus, exposed to environmental ammonia or terrestrial conditions.

    Directory of Open Access Journals (Sweden)

    Yuen K Ip

    Full Text Available Na(+:K(+:2Cl(- cotransporter 1 (NKCC1 has been implicated in mediating ischemia-, trauma- or ammonia-induced astrocyte swelling/brain edema in mammals. This study aimed to determine the effects of ammonia or terrestrial exposure on ammonia concentrations in the plasma and brain, and the mRNA expression and protein abundance of nkcc/Nkcc in the brain, of the swamp eel Monopterusalbus. Ammonia exposure led to a greater increase in the ammonia concentration in the brain of M. albus than terrestrial exposure. The brain ammonia concentration of M. albus reached 4.5 µmol g(-1 and 2.7 µmol g(-1 after 6 days of exposure to 50 mmol l(-1 NH4Cl and terrestrial conditions, respectively. The full cDNA coding sequence of nkcc1b from M. albus brain comprised 3276 bp and coded for 1092 amino acids with an estimated molecular mass of 119.6 kDa. A molecular characterization indicated that it could be activated through phosphorylation and/or glycosylation by osmotic and/or oxidative stresses. Ammonia exposure for 1 day or 6 days led to significant decreases in the nkcc1b mRNA expression and Nkcc1b protein abundance in the brain of M. albus. In comparison, a significant decrease in nkcc1b mRNA expression was observed in the brain of M. albus only after 6 days of terrestrial exposure, but both 1 day and 6 days of terrestrial exposure resulted in significant decreases in the protein abundance of Nkcc1b. These results are novel because it has been established in mammals that ammonia up-regulates NKCC1 expression in astrocytes and NKCC1 plays an important role in ammonia-induced astrocyte swelling and brain edema. By contrast, our results indicate for the first time that M. albus is able to down-regulate the mRNA and protein expression of nkcc1b/Nkcc1b in the brain when confronted with ammonia toxicity, which could be one of the contributing factors to its extraordinarily high brain ammonia tolerance.

  17. Performans Kerbau Lumpur dan Strategi Pengembangannya pada Daerah dengan Ketinggian Berbeda di Kabupaten Cianjur (PERFORMANCE ANALYSIS OF SWAMP BUFFALO AT DIFFERENT ALTITUDES IN CIANJUR DISTRICT AND ITS DEVELOPMENT STRATEGIES

    Directory of Open Access Journals (Sweden)

    Komariah .

    2016-01-01

    Full Text Available The research objectives were to analyze reproduction performance and productivity of swamp buffalofrom different altitudes in Cianjur and draw up a hierarchy of productivity strategy development usinganalysis of SWOT (Strength, Weakness, Opportunity, Threats and Analytical Hierarchy Process (AHPwith four criteria: technology, costs, impact, and the response of farmers. Survey was conducted in Cianjurduring January-March 2014 by interview prepared questionnaires and direct observation of 63 buffalo farmers. Secondary data were also obtained from relevant agencies. Primary data were collected usingdirect observation of 139 reproductive female buffaloes then were further analyzed. A total of 58 buffaloesat their productive period were sampled and taken their morphometric data. Whilst 37 buffaloes weremeasured their frame size using Body Condition Score (BCS. The results showed that the reproductionperformance of buffaloes in the lowlands are not significantly different from those in the highland. The ageat first oestrus, first mating, first calving, gestation period were 25.6 months, 26.6 months, 38.7 months,11.8 months, respectively.. The oestrus period was 5.3 days, and post-partum mating interval was 54.6days. Differences in altitude and sex significantly affected (P <0.05 the morphometry assessment. Thebody weight of male buffaloes were found lower than the females both in highlands and lowlands (P<0.05.The body conditioning score of buffalo performance at highland was better compared to those in thelowland. Based on the SWOT analysis and AHP: (1 The main strategy is to improve the technology basedon the criteria of internal weakness by increasing scale holdings to seize opportunities buffalo meat selfsufficiency;(2 based on the criteria of cost and impact, the strategy was to cover threats over the professionout of the region by empowering farmers (facilitate increased productivity buffalo; (3 based on the responsecriteria, the primary

  18. Observations of Resource Use by the Threatened Diana Fritillary Butterfly (Speyeria diana in the Southern Appalachian Mountains, USA

    Directory of Open Access Journals (Sweden)

    Carrie N. Wells

    2013-01-01

    Full Text Available We present four summers (2006–2009 of field observations of the Diana fritillary, Speyeria diana (Cramer, 1777, throughout the Southern Appalachian Mountains, USA, in the eastern portion of its distribution. We describe our observations of resource use by S. diana in sites located in Georgia, Tennessee, South Carolina, North Carolina, and Virginia. Butterflies imbibed nectar from five genera (>11 species of flowering plants and also imbibed liquid from dirt roads and horse manure. The majority of butterflies (57% were observed feeding on milkweed, Asclepias spp., a high-quality nectar-producing plant which is known to be an important resource for many Lepidoptera. We documented 14 species of Viola spp., the larval host plant used by Speyeria, in our survey sites. All butterflies were marked to observe their movement. Recapture rates ranged from 17% to 56%, suggesting that dispersal of S. diana out of suitable habitat was somewhat limited.

  19. The influence of eastern North American autumnal migrant monarch butterflies (Danaus plexippus L.) on continuously breeding resident monarch populations in southern Florida.

    Science.gov (United States)

    Knight, Amy; Brower, Lincoln P

    2009-07-01

    In Florida, the eastern North American population of the monarch butterfly exhibits geographic variability in population structure and dynamics. This includes the occurrence of migrants throughout the peninsula during the autumnal migration, occasional overwintering clusters that form along the Gulf Coast, remigrants from Mexico that breed in north-central Florida during the spring, and what have been assumed to be year-round, resident breeding populations in southern Florida. The work reported here focused on two monarch populations west of Miami and addressed four questions: Are there permanent resident populations of monarchs in southern Florida? Do these breed continuously throughout the year? Do they receive northern monarchs moving south during the autumn migration? Do they receive overwintered monarchs returning via Cuba or the Yucatan during the spring remigration from the Mexican overwintering area? Monthly collections and counts of spermatophores in the bursa copulatrices of females established that a resident population of continuously breeding monarchs exists year-round in southern Florida. It was determined through cardenolide fingerprinting that most of the butterflies had bred on the local southern Florida milkweed species, Asclepias curassavica. During the autumn migration period, however, some monarchs had fed on the northern milkweed, Asclepias syriaca. It appears that instead of migrating to Mexico, these individuals travel south through peninsular Florida, break diapause, mate with and become incorporated into the resident breeding populations. None of the monarchs captured in spring had the A. syriaca cardenolide fingerprint, which is evidence against the southern Florida populations receiving overwintered remigrants from Cuba, Central America or Mexico.

  20. Significance of mangrove swamps for aquaculture

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, S.; Untawale, A.G.

    stream_size 9 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_249.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_249.pdf.txt Content-Encoding ISO-8859-1 Content-Type text.../plain; charset=ISO-8859-1 ...

  1. Return Journey: "Snakes in the Swamp"

    Science.gov (United States)

    Beynon, John

    2008-01-01

    In 1985 Falmer Press published my first book, a classroom ethnography entitled "Initial Encounters in a Secondary School," which helped establish me as an academic. However, it has long concerned me that the decade-long Victoria Road Lower School Project (as it came to be called) contained two resounding "silences": (1)…

  2. Restoring Wetlands: The Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — In the spirit of Rediscovery, Cousteau teams have been revisiting previously explored regions, investigating human impact on ecosystems and through our films and...

  3. Intoxicação experimental por Asclepias curassavica (Asclepiadaceae) em bovinos. Dados complementares

    OpenAIRE

    Tokarnia,Carlos Hubinger; Brito,Marilene F.; Cunha,Bernardo R.M.

    2001-01-01

    Em experimentos com bovinos, que receberam diariamente doses subletais repetidas (2,5 e 5,0 g/kg/dia durante 12 dias) até alcançar a dose letal e/ou ultrapassá-la, A. curassavica recém-coletada não demonstrou efeito acumulativo. Em um animal houve desenvolvimento de tolerância contra a dose que anteriormente causou sintomas de intoxicação (5,0 g/kg), mas não contra uma dose maior (10 g/kg). A planta dessecada continuou tóxica até 2 meses após a coleta, mas após 6 meses tinha perdido a sua tox...

  4. Intoxicação experimental por Asclepias curassavica (Asclepiadaceae em bovinos. Dados complementares

    Directory of Open Access Journals (Sweden)

    Tokarnia Carlos Hubinger

    2001-01-01

    Full Text Available Em experimentos com bovinos, que receberam diariamente doses subletais repetidas (2,5 e 5,0 g/kg/dia durante 12 dias até alcançar a dose letal e/ou ultrapassá-la, A. curassavica recém-coletada não demonstrou efeito acumulativo. Em um animal houve desenvolvimento de tolerância contra a dose que anteriormente causou sintomas de intoxicação (5,0 g/kg, mas não contra uma dose maior (10 g/kg. A planta dessecada continuou tóxica até 2 meses após a coleta, mas após 6 meses tinha perdido a sua toxidez. A mistura da planta fresca picada com capim fresco picado não foi ingerida pelos animais em quantidades que pudessem causar sintomas de intoxicação, em nenhuma das proporções que variaram de 1:2 a 1:6, planta : capim. A planta recentemente dessecada picada em mistura com capim fenado picado, na proporção de 1:3, só foi consumida por um de quatro bovinos em quantidades que poderiam provocar sintomas de intoxicação; mas mesmo esse bovino não chegou a adoecer.

  5. Propagação da corticeira do banhado (Erythrina crista-galli L. (FABACEAE pelo processo de estaquia Propagation of swamp corticeira (Erythrina crista-galli L. (Fabacae by the cutting technique

    Directory of Open Access Journals (Sweden)

    Ariane Gratieri-Sossella

    2008-02-01

    Full Text Available A corticeira-do-banhado é uma árvore nativa com uso ornamental no paisagismo urbano e possui potencial de utilização em áreas desprotegidas e degradadas, devido a sua rusticidade. Entretanto, tendo em vista a dificuldade de obtenção de sementes, pela baixa produção e qualidade destas com a conseqüente desuniformidade da germinação, torna-se necessário aprofundar o estudo de outras formas de propagação dessa espécie. Desse modo, conduziu-se este trabalho na Faculdade de Agronomia e Medicina Veterinária da Universidade de Passo Fundo, com o objetivo de estudar a formação de mudas de Erythrina crista-galli L. pela técnica da estaquia. Em quatro experimentos foram testadas doses do fitorregulador ácido indolbutírico (AIB, em diferentes tipos de estacas (lenhosas, semilenhosas, herbáceas e foliares e substratos. Os resultados indicaram que mini-estacas herbáceas, coletadas de plantas jovens, com menos de 1 ano de idade, são as mais indicadas (75% a 100% de enraizamento, e o uso do AIB diminuiu a mortalidade, ao favorecer o processo do enraizamento. Em razão do ataque de insetos (brocas às plantas no seu hábitat, recomenda-se a técnica de jardim clonal, com a formação de matrizeiros no viveiro, fornecendo material juvenil e sadio em maior escala para a propagação dessa espécie por miniestacas.Swamp corticeira is a native tree with ornamental use in urban landscape gardening with the potential to be used in unprotected and degraded areas due to its rustic feature. However, the difficulty of obtaining seeds due to its low productivity and quality, and consequent lack of uniformity in its germination makes it necessary to search for other forms of propagation of this species. Thus, this study was carried out at the Agronomy and Veterinary Medicine College of Passo Fundo University, aiming to study the formation of Erythrina crista-galli L. cuttings by applying the cutting technique. Doses of phytoregulator Indol Butyric

  6. Aspectos produtivos do capim-elefante (Pennisetum purpureum, Schum. cv. Roxo no brejo paraibano Productive aspects of elephant grass (Pennisetum purpureum, Schum. var. Roxo in Paraíba swamp region

    Directory of Open Access Journals (Sweden)

    Estácio Alves dos Santos

    2001-02-01

    Full Text Available O trabalho foi realizado com o objetivo de verificar o efeito de diferentes alturas de corte sobre a produtividade do capim-elefante cv. Roxo em épocas de seca e chuva no Brejo paraibano. O esquema experimental foi um fatorial 4 x 2, sendo quatro alturas de corte (0, 15, 30 e 45 cm, duas épocas (períodos seco e chuvoso e quatro blocos. Foram avaliadas as produções por hectare de massa verde (MV, matéria seca total (MS, de folhas (MSF e colmos (MSC e proteína bruta (PB. Após o corte de uniformização, efetuaram-se dois cortes no período seco em intervalos de 90 dias e três no período chuvoso em intervalos de 60 dias. Não houve interação entre altura de corte e a época. Entretanto, à medida que se elevou a altura do corte, reduziram-se as produções de MV, MS e MSC. As produções de PB e MSF não diferiram. Quando elevadas as alturas dos cortes de 0 para 45 cm, houve redução de aproximadamente 33% na produção para MV, 24,83% para MSF e 60% para MSC. Os cortes no período seco foram mais produtivos em relação aos da época chuvosa. As médias das produções de MS, MV, MSF, MSC e PB foram, respectivamente, 4,12; 21,19; 2,65; 1,47 e 0,32 t/ha no período seco e 12,44; 2,45; 1,81; 0,54 e 0,17 t/ha no período chuvoso.This work was carried to evaluate the effect of different cutting heights on the productivity of elephant grass var. Roxo in dry and rainy season in the Paraíba swamp region. A randomized complete block design in a 4 X 2 factorial, arrangement, with four cutting heights (0, 15, 30 and 45 cm, two periods (dry and rainy seasons and 4 blocks were used. It was evaluated the production/ha of fresh matter (FM, dry matter (DM, leaves (DML, stems (DMS and crude protein (CP. After the uniformity cut, two cuts in dry season with 90 days interval and three cuts in the rainy season with 60 days interval were made. There was no interaction between seasons and cutting heights. However, as cutting height increased, the values

  7. Hyb-Seq: Combining Target Enrichment and Genome Skimming for Plant Phylogenomics

    Directory of Open Access Journals (Sweden)

    Kevin Weitemier

    2014-08-01

    Full Text Available Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. Methods and Results: Genome and transcriptome assemblies for milkweed (Asclepias syriaca were used to design enrichment probes for 3385 exons from 768 genes (>1.6 Mbp followed by Illumina sequencing of enriched libraries. Hyb-Seq of 12 individuals (10 Asclepias species and two related genera resulted in at least partial assembly of 92.6% of exons and 99.7% of genes and an average assembly length >2 Mbp. Importantly, complete plastomes and nuclear ribosomal DNA cistrons were assembled using off-target reads. Phylogenomic analyses demonstrated signal conflict between genomes. Conclusions: The Hyb-Seq approach enables targeted sequencing of thousands of low-copy nuclear exons and flanking regions, as well as genome skimming of high-copy repeats and organellar genomes, to efficiently produce genome-scale data sets for phylogenomics.

  8. Plant-derived differences in the composition of aphid honeydew and their effects on colonies of aphid-tending ants.

    Science.gov (United States)

    Pringle, Elizabeth G; Novo, Alexandria; Ableson, Ian; Barbehenn, Raymond V; Vannette, Rachel L

    2014-11-01

    In plant-ant-hemipteran interactions, ants visit plants to consume the honeydew produced by phloem-feeding hemipterans. If genetically based differences in plant phloem chemistry change the chemical composition of hemipteran honeydew, then the plant's genetic constitution could have indirect effects on ants via the hemipterans. If such effects change ant behavior, they could feed back to affect the plant itself. We compared the chemical composition of honeydews produced by Aphis nerii aphid clones on two milkweed congeners, Asclepias curassavica and Asclepias incarnata, and we measured the responses of experimental Linepithema humile ant colonies to these honeydews. The compositions of secondary metabolites, sugars, and amino acids differed significantly in the honeydews from the two plant species. Ant colonies feeding on honeydew derived from A. incarnata recruited in higher numbers to artificial diet, maintained higher queen and worker dry weight, and sustained marginally more workers than ants feeding on honeydew derived from A. curassavica. Ants feeding on honeydew from A. incarnata were also more exploratory in behavioral assays than ants feeding from A. curassavica. Despite performing better when feeding on the A. incarnata honeydew, ant workers marginally preferred honeydew from A. curassavica to honeydew from A. incarnata when given a choice. Our results demonstrate that plant congeners can exert strong indirect effects on ant colonies by means of plant-species-specific differences in aphid honeydew chemistry. Moreover, these effects changed ant behavior and thus could feed back to affect plant performance in the field.

  9. Naturally occurring cardiac glycosides.

    Science.gov (United States)

    Radford, D J; Gillies, A D; Hinds, J A; Duffy, P

    1986-05-12

    Cardiac glycoside poisoning from the ingestion of plants, particularly of oleanders, occurs with reasonable frequency in tropical and subtropical areas. We have assessed a variety of plant specimens for their cardiac glycoside content by means of radioimmunoassays with antibodies that differ in their specificity for cardiac glycosides. Significant amounts of immunoreactive cardiac glycoside were found to be present in the ornamental shrubs: yellow oleander (Thevetia peruviana); oleander (Nerium oleander); wintersweet (Carissa spectabilis); bushman's poison (Carissa acokanthera); sea-mango (Cerbera manghas); and frangipani (Plumeria rubra); and in the milkweeds: redheaded cotton-bush (Asclepias curassavica); balloon cotton (Asclepias fruiticosa); king's crown (Calotropis procera); and rubber vine (Cryptostegia grandifolia). The venom gland of the cane toad (Bufo marinus) also contained large quantities of cardiac glycosides. The competitive immunoassay method permits the rapid screening of specimens that are suspected to contain cardiac glycosides. Awareness of the existence of these plant and animal toxins and their dangers allows them to be avoided and poisoning prevented. The method is also useful for the confirmation of the presence of cardiac glycosides in serum in cases of poisoning.

  10. Use of bioindicators and passive sampling devices to evaluate ambient ozone concentrations in north central Pennsylvania

    Energy Technology Data Exchange (ETDEWEB)

    Yuska, D.E.; Skelly, J.M.; Ferdinand, J.A.; Stevenson, R.E.; Savage, J.E.; Mulik, J.D.; Hines, A

    2003-09-01

    Passive samplers and bioindicator plants detect ozone air pollution in north central Pennsylvania. - Ambient concentrations of tropospheric ozone and ozone-induced injury to black cherry (Prunus serotina) and common milkweed (Asclepias syriaca) were determined in north central Pennsylvania from 29 May to 5 September 2000 and from 28 May to 18 September 2001. Ogawa passive ozone samplers were utilized within openings at 15 forested sites of which six were co-located with TECO model 49 continuous ozone monitors. A significant positive correlation was observed between the Ogawa passive samplers and the TECO model 49 continuous ozone monitors for the 2000 (r=0.959) and 2001 (r=0.979) seasons. In addition, a significant positive correlation existed in 2000 and 2001 between ozone concentration and elevation (r=0.720) and (r=0.802), respectively. Classic ozone-induced symptoms were observed on black cherry and common milkweed. In 2000, initial injury was observed in early June, whereas for the 2001 season, initial injury was initially observed in late June. During both seasons, injury was noted at most sites by mid- to late-July. Soil moisture potential was measured for the 2001 season and a significant positive relationship (P<0.001) showed that injury to black cherry was a function of cumulative ozone concentrations and available soil moisture.

  11. Phylogenetic incongruence and the evolutionary origins of cardenolide-resistant forms of Na(+) ,K(+) -ATPase in Danaus butterflies.

    Science.gov (United States)

    Aardema, Matthew L; Andolfatto, Peter

    2016-08-01

    Many distantly related insect species are specialized feeders of cardenolide-containing host plants such as milkweed (Asclepias spp.). Previous studies have revealed frequent, parallel substitution of a functionally important amino acid substitution (N122H) in the alpha subunit of Na(+) ,K(+) -ATPase in a number of these species. This substitution facilitates the ability of these insects to feed on their toxic hosts and sequester cardenolides for their own use in defense. Among milkweed butterflies of the genus Danaus, the previously established phylogeny for this group suggests that N122H arose independently and fixed in two distinct lineages. We reevaluate this conclusion by examining Danaus phylogenetic relationships using >400 orthologous gene sequences assembled from transcriptome data. Our results indicate that the three Danaus species known to harbor the N122H substitution are more closely related than previously thought, consistent with a single, common origin for N122H. However, we also find evidence of both incomplete lineage sorting and post-speciation genetic exchange among these butterfly species, raising the possibility of collateral evolution of cardenolide-insensitivity in this species group. © 2016 The Author(s). Evolution © 2016 The Society for the Study of Evolution.

  12. Stochastic prey arrivals and crab spider giving-up times: simulations of spider performance using two simple "rules of thumb".

    Science.gov (United States)

    Kareiva, Peter; Morse, Douglass H; Eccleston, Jill

    1989-03-01

    We compared the patch-choice performances of an ambush predator, the crab spider Misumena vatia (Thomisidae) hunting on common milkweed Asclepias syriaca (Asclepiadaceae) umbles, with two stochastic rule-of-thumb simulation models: one that employed a threshold giving-up time and one that assumed a fixed probability of moving. Adult female Misumena were placed on milkweed plants with three umbels, each with markedly different numbers of flower-seeking prey. Using a variety of visitation regimes derived from observed visitation patterns of insect prey, we found that decreases in among-umbel variance in visitation rates or increases in overall mean visitation rates reduced the "clarity of the optimum" (the difference in the yield obtained as foraging behavior changes), both locally and globally. Yield profiles from both models were extremely flat or jagged over a wide range of prey visitation regimes; thus, differences between optimal and "next-best" strategies differed only modestly over large parts of the "foraging landscape". Although optimal yields from fixed probability simulations were one-third to one-half those obtained from threshold simulations, spiders appear to depart umbels in accordance with the fixed probability rule.

  13. Transovum transmission of trypanosomatid cysts in the Milkweed bug, Oncopeltus fasciatus.

    Directory of Open Access Journals (Sweden)

    Felipe de Almeida Dias

    Full Text Available Leptomonas wallacei is a trypanosomatid that develops promastigotes and cystic forms in the gut of the hemipteran insect Oncopeltus fasciatus. Insect trypanosomatids are thought to be solely transmitted from one host to another through the ingestion of parasite-contaminated feces. However, here we show that L. wallacei cysts present on the eggshells of eggs laid by O. fasciatus can also act as infective forms that are transmitted to the insect offspring. Newly hatched O. faciatus nymphs are parasite-free, but some of them become contaminated with L. wallacei after feeding on eggshell remnants. The present study is the first report of transovum transmission of a trypanosomatid, a process that may have a relevant role in parasite's within-host population dynamics.

  14. Western Monarch and Milkweed Habitat Suitability Modeling Project- March 2016 Final Presentation

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — To better understand the distribution of key breeding areas for the declining western population of monarch butterflies, the USFWS, in collaboration with the Xerces...

  15. Investigation of some characteristics of polyhydroxy milkweed triglycerides and their acylated derivatives in relation to lubricity

    Science.gov (United States)

    Most industrial lubricants are derived from non-renewable petroleum-based sources. As useful as these lubricants are, their unintended consequences are the pollution of our environment as a result of the very slow degradation of the spent materials. Native seed oils, on the other hand, are renewa...

  16. Characteristics of polyhydroxy milkweed triglycerides and their acylated derivatives in relation to lubricity

    Science.gov (United States)

    Industrial lubricants are derived from non-renewable petroleum-based resources that can cause pollution due to poor degradation. Seed oils, however, are both renewable and readily biodegradable, but have lower thermal stability and shorter shelf-life. This drawback can be overcome and yet retain the...

  17. Florística e estrutura do componente arbustivo-arbóreo de uma floresta higrófila da bacia do rio Jacaré-Pepira, SP, Brasil Floristics and structure of the shrub and the tree-layer of a swamp forest in Jacaré-Pepira river, Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Márcia C. M. Marques

    2003-12-01

    Full Text Available As florestas higrófilas são formações ribeirinhas caracterizadas por ocorrerem em solo permanentemente encharcado e restritas a pequenos fragmentos junto a outros tipos vegetacionais. Neste trabalho caracterizaram-se a florística e a estrutura do componente arbustivo-arbóreo (plantas com DAP>5cm de uma área de 0,36ha de floresta higrófila localizada em Brotas (48º06'W 22º16'S, 470m.s.m., Estado de São Paulo, usando-se método de parcelas (total de 24 parcelas. No total foram amostrados 735 indivíduos, distribuídos em 32 famílias e 51 espécies. As espécies que se destacaram na comunidade devido aos elevados valores de importância foram Calophyllum brasiliense Camb., Protium almecega L. Marchand, Podocarpus sellowii Klotzch., Tapirira guianensis Aubl. e Dendropanax cuneatum DC. Decne. & Planch. O índice de diversidade de Shannon foi igual a 2,81, valor pouco superior aos descritos para florestas semelhantes. Na comunidade, as espécies generalistas com relação ao encharcamento do solo e as de solo drenado contribuíram na riqueza total (juntas 62% do total de espécies amostradas, enquanto as espécies de solo encharcado tiveram maior contribuição na composição da dominância (66% da dominância total e densidade (67% da densidade total relativas. A diversidade de situações topográficas e a entrada de espécies da vegetação do cerrado adjacente permitiram que espécies com diferentes exigências hídricas se estabelecessem na área relativamente pequena da floresta e influenciaram fortemente a florística e estrutura da comunidade.Swamp forests occur in permanently flooded small forest fragments in southeastern Brazil. We studied the floristic composition and community structure (plants with DBH>5cm of a swamp forest in Brotas municipality (48º06'W 22º16'S, 470m high, São Paulo State, Brazil. A total of 735 individuals, 32 families, and 51 woody species were recorded in the area. The most important species were

  18. Propriedades termodinâmicas de adsorção de água do amido de rizomas do lírio-do-brejo (Hedychium coronarium Thermodynamic properties of water adsortion of the starch of rhizome of swamp lily (Hedychium coronarium

    Directory of Open Access Journals (Sweden)

    Diego Palmiro Ramirez Ascheri

    2009-06-01

    Full Text Available Determinaram-se as propriedades termodinâmicas (entalpia diferencial, entropia diferencial, entalpia integral e entropia integral do amido de rizomas do lírio-do-brejo (Hedychium coronarium por meio de isotermas de adsorção de água. As isotermas foram determinadas em atividades de água no intervalo de 0,11 a 0,84, sob temperaturas que variaram de 30 a 50 °C. A Equação de GAB, que se ajustou bem às isotermas experimentais, foi utilizada para estimar as propriedades termodinâmicas de adsorção. As isotermas apresentaram ligeira inversão, indicando a precença de amido danificado. A entalpia diferencial e a entropia diferencial aumentaram com a diminuição da umidade de equilíbrio e correlacionaram entre si confirmando a compensação química linear. Um modelo exponencial do tipo Y = b.e(a/Xe descreveu adequadamente a dependência destas propriedades diferenciais ao teor de umidade de equilíbrio. A entalpia integral e a entropia integral aumentaram continuamente com o teor de umidade de equil��brio, porém com valores negativos para a entropia integral. Estas propriedades termodinâmicas de adsorção de água demonstraram que o amido extraído dos rizomas do lírio-do-brejo possui baixa higrocopicidade apesar da ocorrência de grânulos de amido danificados.Thermodynamic properties where determined (differential enthalpy, of differential entropy, integral enthalpy, and integral entropy of the starch of rhizomes of swamp lily through water adsorption isotherms. The isotherms were determined in water activities in the range of 0.11 to 0.84, in temperatures ranging from 30 to 50 °C. The GAB equation which fits well to the experimental isotherms was used to estimate the properties of thermodynamic adsorption. The slight reversal of the isotherms indicates damaged starch. The enthalpy and entropy differential gap increased with the decrease in moisture and correlated to each other confirming the chemical linear compensation. An

  19. Lespedeza cuneata and Asclepias verticillata detection by dogs on Neal Smith National Wildlife Refuge, Prairie City, Iowa

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Summary:Working Dogs for Conservation deployed two handlers and three dogs to the Neal Smith National Wildlife Refuge (NSNWR), Prairie City, Iowa, for the detection...

  20. Denning Ecology of Black Bears in the Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Available information on black bear denning ecology in southeastern wetland populations for management and conservation purposes is limited. This researcher...

  1. Sequence Stratigraphic Appraisal: Coastal Swamp Depobelt In The ...

    African Journals Online (AJOL)

    The massive sand formation of the basin floor fan, the sand-rich prograding wedge and the highstand sands as well as the transgressive sands constitute good reservoirs. The distal shale toes of the prograding wedge and transgressive shales as well as highstand shales form seals for the stratigraphic traps formed in the ...

  2. Mathematical model for scheduling irrigation for swamp rice in Port ...

    African Journals Online (AJOL)

    The thirst for increased food production and management of our natural resources (water) is increasing on daily basis and there is a great need for proper utilization of such important resource. Nigerian farmers today still rely on rainfall for cultivation of food crops, this is simply because they do not have the knowledge of ...

  3. Markets and institutional swamps : tensions confronting entrepreneurs in developing countries

    NARCIS (Netherlands)

    Olthaar, Matthias; Dolfsma, Wilfred; Lutz, Clemens; Noseleit, Florian

    Unrealized potential of entrepreneurial activities in developing countries has often been attributed to missing formal market-based institutions. In new institutional economics, the concept of 'voids' is suggested to describe the absence of market-based institutions. In reality, however,

  4. MMed cohort supervision: A path out of the swamp?

    African Journals Online (AJOL)

    The problems currently facing many clinical departments in providing appropriate supervision for the research component of the MMed degree have been highlighted in the SAMJ.[1,2] The most pressing issues are the inadequate numbers of potential supervisors available and time allocation for research activities. Clearly.

  5. Erythrodiplax ana sp. nov. (Odonata: Libellulidae) from Brazilian palm swamps.

    Science.gov (United States)

    Guillermo-Ferreira, Rhainer; Vilela, Diogo S; Del-Claro, Kleber; Bispo, Pitágoras C

    2016-08-29

    Erythrodiplax ana sp. nov. (male holotype, six male and three female paratypes), collected in Vereda wetlands (a unique Neotropical savanna environment) in Uberlândia (Minas Gerais) and Chapada dos Guimarães (Mato Grosso), Brazil, is described and illustrated. The new species fits in Borror's Basalis Group, and can be distinguished from other species by the combination of the following traits: blue pruinosity dorsally on thorax and third to eighth abdominal segments; sides of the thorax olive-green; face ivory or olive-green; wings hyaline with a small apical brown spot on all four wings, well defined in females; male genitalia with sclerotized erectile posterior lobe and inflatable sac-like median process. Last instar larvae were reared in the laboratory, resulting in the description of the larva. We also followed this population for 13 months and present resulting biological notes and comments on ontogenetic color change in males, as well as longevity.

  6. The photosynthetic characteristics of papyrus in a tropical swamp.

    Science.gov (United States)

    Jones, M B

    1987-02-01

    Photosynthesis and transpiration was measured in the large emergent C4 sedge Cyperus papyrus (papyrus) which occupies wide areas of wetland on the African continent. The maximum observed value of net assimilation was 35 μmol CO2 m-2 s-1 at full sunlight but light saturation of photosynthesis did not occur. The quantum yield of photosynthesis obtained from the initial slope of the light response curves (0.06 mol mol-1 incident light) was relatively high and close to previously recorded values for some C4 grasses. Measurements made over two days showed that stomatal conductance was sensitive to the ambient air vapour pressure deficit (VPD) and was consistently lower on the day when VPD's were higher. There was, however, no marked midday closure of the stomata. Photosynthesis was also reduced on the day when VPD's were higher. The relationship between net photosynthesis and stomatal conductance was close to linear over the range of measurement conditions, with the result that intercellular CO2 concentrations (C i ) did not vary markedly. There was some evidence that C i decreased at high VPD's. The regulation of stomatal movement in papyrus appears to minimise excessive water loss while not severely limiting photosynthesis. The significance of this strategy for a wetland species with plentiful supplies of water is discussed.

  7. Prediction of the Swamping Tendencies of Recreational Boats.

    Science.gov (United States)

    1982-01-01

    tines at two wave frequencies in orcer to examine the scatter in the measurements. Still photos were taken of each boat in each load condition and 16 amm...IC V) C) 01 ujI (’Si u-i j - -4 -4J -4 * 0 1 * UL- Lil 4.; 5-00 5. Cl 3 4c Co A.J cfl C V- 0 D (3dOlS 3AYM 30 *93a1E3a) OVNI H~lId 198 I __ I VC ) I C

  8. Role of mangrove swamps in brackishwater fish culture

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, S.; Untawale, A.G.

    stream_size 5 stream_content_type text/plain stream_name Aquaculture_Prod_1992_235.pdf.txt stream_source_info Aquaculture_Prod_1992_235.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  9. MMed cohort supervision: A path out of the swamp?

    African Journals Online (AJOL)

    regulations, this practice is effectively ignoring their purpose, but is applied by academic administrators as a way of complying with the regulations without any thought. Options 2, 3 and 4, all collaborative cohort models (CCMs), provide effective gearing for student research within a limited population of supervisors, but only ...

  10. Fishery Management Plan Great Dismal Swamp National Wildlife Refuge 1986

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The purpose of this plan is to describe the fishery resource of Lake Drummond and present a management scheme which best uses these resources to achieve the goals of...

  11. Swamped by Regulations: Perils of an Ever-Increasing Burden

    Science.gov (United States)

    2015-02-01

    Independent Business randomly surveyed 1,615 small businesses and found their top concerns were health-care costs, regulations, tax com- plexity and economic ...problems plaguing the acquisition system and the military- industrial complex. Any student of government knows that the first goal of bu- reaucratic...organizations, usually unstated, is to perpetuate the organization. This is done largely for selfish reasons such as providing opportunities for

  12. mathematical model for scheduling irrigation for swamp rice in port ...

    African Journals Online (AJOL)

    2017-03-24

    Mar 24, 2017 ... the knowledge of irrigation scheduling and timing and it has affected the rate at which food crops are produced ... food. Production of every food is dependent upon water, though many other factors limit crop growth and yield (Ayotamuno et al., 2000). Rice .... temperature, day light per hour information were.

  13. The Lake Drummond Cypress Tree Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This is a report that outlines a correlation between the number of rings of a Cypress tree on Lake Drummond and lake levels. The author researched information dating...

  14. Seasonal variations in the microflora from mangrove swamps in Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Matondkar, S.G.P.; Mathani, S.; Mavinkurve, S.

    Seasonal variations in bacterial and fungal counts from the water and sediment samples of mangrove ecosystem of Goa (India) show that this ecosystem supports a very high population of fungi and bacteria...

  15. Massive gene swamping among cheese-making Penicillium fungi

    Directory of Open Access Journals (Sweden)

    Jeanne Ropars

    2015-03-01

    Full Text Available Horizontal gene transfers (HGT, i.e., the transmission of genetic material between species not directly attributable to meiotic gene exchange, have long been acknowledged as a major driver of prokaryotic evolution and is increasingly recognized as an important source of adaptation in eukaryotes. In fungi in particular, many convincing examples of HGT have been reported to confer selective advantages on the recipient fungal host, either promoting fungal pathogenicity on plants or increasing their toxicity by the acquisition of secondary metabolic clusters, resulting in adaptation to new niches and in some cases eventually even in speciation. These horizontal gene transfers involve single genes, complete metabolic pathways or even entire chromosomes. A recent study has uncovered multiple recent horizontal transfers of a 575 kb genomic island in cheese Penicillium fungi, representing ca. 2% of the Penicillium roqueforti’s genome, that may confer selective advantage in the competing cheese environment where bacteria and fungi occur. Novel phylogenomic methods are being developed, revealing massive HGT among fungi. Altogether, these recent studies indicate that HGT is a crucial mechanism of rapid adaptation, even among eukaryotes.

  16. The Road Inventory of Bond Swamp National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — To determine the relative needs of the U.S. Fish and Wildlife Service, the Federal Highway Administration (FHWA) was asked to inventory all public access and...

  17. Great Swamp National Wildlife Refuge Wilderness Character Monitoring Summary

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The table and the report that follow are part of a national initiative to establish a baseline wilderness character assessment for all of the National Wildlife...

  18. mathematical model for scheduling irrigation for swamp rice in port ...

    African Journals Online (AJOL)

    2017-03-24

    Mar 24, 2017 ... d2 - Initial depth of water in the field (mm). Kc – Crop factor. Mc – Soil moisture content (mm). PwP – Permanent wilting point (mm). INTRODUCTION. Rice is a food crop universally accepted and eaten all over the world. It is the most important staple food for about half of the human race (Hawksworth, 1985).

  19. Enhanced stress responses and metabolic adjustments linked to diapause and onset of migration in the large milkweed bug Oncopeltus fasciatus

    Czech Academy of Sciences Publication Activity Database

    Dean, C. A. E.; Teets, N. M.; Košťál, Vladimír; Šimek, Petr; Denlinger, D. L.

    2016-01-01

    Roč. 41, č. 2 (2016), s. 152-161 ISSN 0307-6962 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : diapause * heat shock proteins * metabolome Subject RIV: ED - Physiology Impact factor: 1.364, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/phen.12140/abstract

  20. Western Monarch and Milkweed Habitat Suitability Modeling Project- Environmental Covariate Rasters for the Western U.S.

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Each set of these three sets of rasters cover the Western 11 conterminous U.S. states. They share the same extent, cell size, and projection so that they can easily...

  1. Pollination success following loss of a frequent pollinator: the role of compensatory visitation by other effective pollinators.

    Science.gov (United States)

    Hallett, Allysa C; Mitchell, Randall J; Chamberlain, Evan R; Karron, Jeffrey D

    2017-05-01

    Pollinator abundance is declining worldwide and may lower the quantity and quality of pollination services to flowering plant populations. Loss of an important pollinator is often assumed to reduce the amount of pollen received by stigmas of a focal species (pollination success), yet this assumption has rarely been tested experimentally. The magnitude of the effect, if any, may depend on the relative efficiency of the remaining pollinators, and on whether the loss of one pollinator leads to changes in visitation patterns by other pollinators. To explore how a change in pollinator composition influences pollination of Asclepias verticillata, we excluded bumble bees from plots in large and small populations of this milkweed species. We then quantified pollinator visitation rates, pollen export and pollen receipt for control plots and for plots where bumble bees were experimentally excluded. We found that exclusion of bumble bees did not reduce pollen receipt by A. verticillata flowers. Visitation by Polistes wasps increased markedly following bumble bee exclusion, both in small populations (186 % increase) and in large populations (400 % increase). Because Polistes wasps were as efficient as bumble bees at pollen transfer, increased wasp visitation offset lost bumble bee pollination services. Thus, loss of a frequent pollinator will not necessarily lead to a decline in pollination success. When pollinator loss is followed by a shift in the composition and abundance of remaining pollinators, pollination success will depend on the net change in the quantity and quality of pollination services.

  2. Incidence of ozone symptoms on vegetation within a National Wildlife Refuge in New Jersey, USA

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Donald D. [Department of Plant Pathology, Ecology Program, Penn State Institutes of the Environment, Pennsylvania State University, University Park, PA 16803 (United States)]. E-mail: ddd2@psu.edu; Orendovici, Teodora [Department of Plant Pathology, Ecology Program, Penn State Institutes of the Environment, Pennsylvania State University, University Park, PA 16803 (United States)

    2006-10-15

    During 1993-1996 and 2001-2003, we evaluated the percentage of plants (incidence) exhibiting ozone-induced foliar symptoms on vegetation within a National Wildlife Refuge located along the Atlantic Ocean coast of New Jersey, USA. Incidence varied among plant species and years. Bioindicator plants most sensitive to ozone, across all years, included native common milkweed (Asclepias syriaca) and wild grape (Vitis spp.), as well as introduced tree-of-heaven (Ailanthus altissima). Less sensitive bioindicators included Virginia creeper (Parthenocissus quinquefolia) and winged sumac (Rhus coppolina). Black cherry (Prunus serotina) and sassafras (Sassafras albidum) were least sensitive. The greatest incidence of ozone symptoms, across all plant species, occurred in 1996, followed by 2001 > 1995 > 1994 > 1993 > 2003 > 2002. A model was developed that showed a statistically significant relationship between incidence of ozone symptoms and the following parameters: plant species, Palmer Drought Severity Index, and the interaction of W126 x N100 measures of ambient ozone. - Vegetation in a National Wildlife Refuge containing a Class I wilderness area exhibits foliar symptoms from ambient ozone.

  3. Feeding on toxic prey. The praying mantis (Mantodea) as predator of poisonous butterfly and moth (Lepidoptera) caterpillars.

    Science.gov (United States)

    Mebs, Dietrich; Wunder, Cora; Pogoda, Werner; Toennes, Stefan W

    2017-06-01

    Caterpillars of the monarch butterfly, Danaus plexippus, feed on milkweed plants, Asclepias spp. (Apocynaceae), and sequester their toxic cardenolides aimed at deterring predators. Nevertheless, Chinese praying mantids, Tenodera sinensis, consume these caterpillars after removing the midgut ("gutting") including its plant content. In the present study, monarch caterpillars raised on A. curassavica, and those of the death's-head hawkmoth, Acherontia atropos, raised on Atropa belladonna containing atropine, were fed to mantids, Hierodula membranacea, which removed the gut of both species discarding about 59% of cardenolides and more than 90% of atropine, respectively. The ingestion of these compounds produced no apparent ill effects in the mantids and both were excreted with faeces. On the other hand, when mantids were fed with larvae of two moth species, Amata mogadorensis and Brahmaea certia, raised on non-poisonous host plants, the mantids showed the same gutting behaviour, thereby discarding indigestible plant material. As polar compounds, e.g. cardenolides and atropine, are not absorbed from the mantids midgut and do not pass the gut membrane, this enables the mantids to feed on toxic prey. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Evolution of pyrrolizidine alkaloid biosynthesis in Apocynaceae: revisiting the defence de-escalation hypothesis.

    Science.gov (United States)

    Livshultz, Tatyana; Kaltenegger, Elisabeth; Straub, Shannon C K; Weitemier, Kevin; Hirsch, Elliot; Koval, Khrystyna; Mema, Lumi; Liston, Aaron

    2018-02-26

    Plants produce specialized metabolites for their defence. However, specialist herbivores adapt to these compounds and use them for their own benefit. Plants attacked predominantly by specialists may be under selection to reduce or eliminate production of co-opted chemicals: the defence de-escalation hypothesis. We studied the evolution of pyrrolizidine alkaloids (PAs) in Apocynaceae, larval host plants for PA-adapted butterflies (Danainae, milkweed and clearwing butterflies), to test if the evolutionary pattern is consistent with de-escalation. We used the first PA biosynthesis specific enzyme (homospermidine synthase, HSS) as tool for reconstructing PA evolution. We found hss orthologues in diverse Apocynaceae species, not all of them known to produce PAs. The phylogenetic analysis showed a monophyletic origin of the putative hss sequences early in the evolution of one Apocynaceae lineage (the APSA clade). We found an hss pseudogene in Asclepias syriaca, a species known to produce cardiac glycosides but no PAs, and four losses of an HSS amino acid motif. APSA clade species are significantly more likely to be Danainae larval host plants than expected if all Apocynaceae species were equally likely to be exploited. Our findings are consistent with PA de-escalation as an adaptive response to specialist attack. © 2018 The Authors New Phytologist © 2018 New Phytologist Trust.

  5. Contribution to Early Holocene vegetation and climate history of Eastern Orinoco Llanos, Venezuela, from a paleoecological record of a Mauritia L.f. swamp Contribuição para a história da vegetação e clima durante o Holoceno Temprano do Llanos Orientais do Orinoco, Venezuela, a partir de um registro paleoecológico de um pântano Mauritia L.f.

    Directory of Open Access Journals (Sweden)

    Alejandra Leal

    2011-01-01

    Full Text Available A palynological analysis of an organic paleosol found at 150-125 cm depth in a Mauritia swamp from the Eastern Orinoco Llanos is presented. The 25 cm pollen record summarizes the vegetation history during the Early Holocene, from 10,225 to 7,800 calendar yr BP. The vegetation was characterized by a Poaceae marsh, where Asteraceae, Melastomataceae, Schefflera-type and Phyllanthus were the most abundant shrubs and trees. Pollen-types richness was lower than that recorded today in similar environments, and Mauritia pollen was absent. Results suggest that climate was as humid as present during the beginning of the Holocene, with a decreasing trend in humidity from around 8,000-7,000 yr BP, in coincidence with the beginning of the "Early-Mid-Holocene Dryness" that affected deeply the Amazon Basin and neighboring areas. Dry climatic conditions could have existed in the study site until the Mid-Late Holocene when a Mauritia swamp developed, and humid conditions similar to present established. Main climate phases inferred in our study site fit well with regional trends recorded in other places located north Amazon Basin. However, conclusions are still limited by the lack of additional Quaternary records in the Orinoco Llanos area, avoiding regional correlations.Realizou-se uma análise de pólen amostrada em paleossolos orgânicos, entre 150-125 cm de profundidade, em um pântano Mauritia os lhanos do Orinoco. O registro de pólen dessa amostra resumiu a história da vegetação durante o Holoceno Temprano, entre 10,225-7,800 cal. anos AP. A vegetação durante esse período foi caracterizada por um pântano de Poaceae, com maior abundância de arbustos e árvores de Asteraceae, Melastomataceae, tipo-Schefflera e Phyllanthus. Encontrou-se que a riqueza de tipos polínicos no Holoceno Temprano foi menor do que a riqueza atualmente encontrada em ambientes similares; o pólen de Mauritia esteve ausente de todas as amostras. Os resultados deste estudo

  6. Asclepiasterol, a novel C21 steroidal glycoside derived from Asclepias curassavica, reverses tumor multidrug resistance by down-regulating P-glycoprotein expression.

    Science.gov (United States)

    Yuan, Wei-Qi; Zhang, Rong-Rong; Wang, Jun; Ma, Yan; Li, Wen-Xue; Jiang, Ren-Wang; Cai, Shao-Hui

    2016-05-24

    Multidrug resistance (MDR) mediated by P-glycoprotein (P-gp) is a major cause of cancer therapy failure. In this study, we identified a novel C21 steroidal glycoside, asclepiasterol, capable of reversing P-gp-mediated MDR. Asclepiasterol (2.5 and 5.0μM) enhanced the cytotoxity of P-gp substrate anticancer drugs in MCF-7/ADR and HepG-2/ADM cells. MDR cells were more responsive to paclitaxel in the presence of asclepiasterol, and colony formation of MDR cells was only reduced upon treatment with a combination of asclepiasterol and doxorubicin. Consistent with these findings, asclepiasterol treatment increased the intracellular accumulation of doxorubicin and rhodamine 123 (Rh123) in MDR cells. Asclepiasterol decreased expression of P-gp protein without stimulating or suppressing MDR1 mRNA levels. Asclepiasterol-mediated P-gp suppression caused inhibition of ERK1/2 phosphorylation in two MDR cell types, and EGF, an activator of the MAPK/ERK pathway, reversed the P-gp down-regulation, implicating the MAPK/ERK pathway in asclepiasterol-mediated P-gp down-regulation. These results suggest that asclepiasterol could be developed as a modulator for reversing P-gp-mediated MDR in P-gp-overexpressing cancer variants.

  7. Evidence for an invasive aphid "superclone": extremely low genetic diversity in Oleander aphid (Aphis nerii populations in the southern United States.

    Directory of Open Access Journals (Sweden)

    John Scott Harrison

    Full Text Available BACKGROUND: The importance of genetic diversity in successful biological invasions is unclear. In animals, but not necessarily plants, increased genetic diversity is generally associated with successful colonization and establishment of novel habitats. The Oleander aphid, Aphis nerii, though native to the Mediterranean region, is an invasive pest species throughout much of the world. Feeding primarily on Oleander (Nerium oleander and Milkweed (Asclepias spp. under natural conditions, these plants are unlikely to support aphid populations year round in the southern US. The objective of this study was to describe the genetic variation within and among US populations of A. nerii, during extinction/recolonization events, to better understand the population ecology of this invasive species. METHODOLOGY/PRINCIPAL FINDINGS: We used five microsatellite markers to assess genetic diversity over a two year period within and among three aphid populations separated by small (100 km and large (3,700 km geographic distances on two host plant species. Here we provide evidence for A. nerii "superclones". Genotypic variation was absent in all populations (i.e., each population consisted of a single multilocus genotype (MLG or "clone" and the genetic composition of only one population completely changed across years. There was no evidence of sexual reproduction or host races on different plant species. CONCLUSIONS/SIGNIFICANCE: Aphis nerii is a well established invasive species despite having extremely low genetic diversity. As this aphid appears to be obligatorily asexual, it may share more similarities with clonally reproducing invasive plants, than with other animals. Patterns of temporal and geographic genetic variation, viewed in the context of its population dynamics, have important implications for the management of invasive pests and the evolutionary biology of asexual species.

  8. Establishing native warm season grasses on Eastern Kentucky strip mines

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, T.G.; Larkin, J.L.; Arnett, M.B. [Univ. of Kentucky, Lexington, KY (United States). Dept. of Forestry

    1998-12-31

    The authors evaluated various methods of establishing native warm season grasses on two reclaimed Eastern Kentucky mines from 1994--1997. Most current reclamation practices incorporate the use of tall fescue (Festuca arundinacea) and other cool-season grasses/legumes that provide little wildlife habitats. The use of native warm season grasses will likely improve wildlife habitat on reclaimed strip mines. Objectives of this study were to compare the feasibility of establishing these grasses during fall, winter, or spring using a native rangeland seeder or hydroseeding; a fertilizer application at planting; or cold-moist stratification prior to hydroseeding. Vegetative cover, bare ground, species richness, and biomass samples were collected at the end of each growing season. Native warm season grass plantings had higher plant species richness compared to cool-season reclamation mixtures. There was no difference in establishment of native warm season grasses as a result of fertilization or seeding technique. Winter native warm season grass plantings were failures and cold-moist stratification did not increase plant establishment during any season. As a result of a drought during 1997, both cool-season and warm season plantings were failures. Cool-season reclamation mixtures had significantly more vegetative cover and biomass compared to native warm season grass mixtures and the native warm season grass plantings did not meet vegetative cover requirements for bond release. Forbs and legumes that established well included pale purple coneflower (Echinacea pallida), lance-leaf coreopsis (Coreopsis lanceolata), round-headed lespedeza (Lespedeza capitata), partridge pea (Cassia fasiculata), black-eyed susan (Rudbeckia hirta), butterfly milkweed (Asclepias tuberosa), and bergamot (Monarda fistulosa). Results from two demonstration plots next to research plots indicate it is possible to establish native warm season grasses on Eastern Kentucky strip mines for wildlife habitat.

  9. A genetically-based latitudinal cline in the emission of herbivore-induced plant volatile organic compounds.

    Science.gov (United States)

    Wason, Elizabeth L; Agrawal, Anurag A; Hunter, Mark D

    2013-08-01

    The existence of predictable latitudinal variation in plant defense against herbivores remains controversial. A prevailing view holds that higher levels of plant defense evolve at low latitudes compared to high latitudes as an adaptive plant response to higher herbivore pressure on low-latitude plants. To date, this prediction has not been examined with respect to volatile organic compounds (VOCs) that many plants emit, often thus attracting the natural enemies of herbivores. Here, we compared genetically-based constitutive and herbivore-induced aboveground vegetative VOC emissions from plants originating across a gradient of more than 10° of latitude (>1,500 km). We collected headspace VOCs from Asclepias syriaca (common milkweed) originating from 20 populations across its natural range and grown in a common garden near the range center. Feeding by specialist Danaus plexippus (monarch) larvae induced VOCs, and field environmental conditions (temperature, light, and humidity) also influenced emissions. Monarch damage increased plant VOC concentrations and altered VOC blends. We found that genetically-based induced VOC emissions varied with the latitude of plant population origin, although the pattern followed the reverse of that predicted-induced VOC concentration increased with increasing latitude. This pattern appeared to be driven by a greater induction of sesquiterpenoids at higher latitudes. In contrast, constitutive VOC emission did not vary systematically with latitude, and the induction of green leafy volatiles declined with latitude. Our results do not support the prevailing view that plant defense is greater at lower than at higher latitudes. That the pattern holds only for herbivore-induced VOC emission, and not constitutive emission, suggests that latitudinal variation in VOCs is not a simple adaptive response to climatic factors.

  10. Rare earth elements (REEs): effects on germination and growth of selected crop and native plant species.

    Science.gov (United States)

    Thomas, Philippe J; Carpenter, David; Boutin, Céline; Allison, Jane E

    2014-02-01

    The phytotoxicity of rare earth elements (REEs) is still poorly understood. The exposure-response relationships of three native Canadian plant species (common milkweed, Asclepias syriaca L., showy ticktrefoil, Desmodium canadense (L.) DC. and switchgrass, Panicum virgatum L.) and two commonly used crop species (radish, Raphanus sativus L., and tomato, Solanum lycopersicum L.) to the REEs lanthanum (La), yttrium (Y) and cerium (Ce) were tested. In separate experiments, seven to eight doses of each element were added to the soil prior to sowing seeds. Effects of REE dose on germination were established through measures of total percent germination and speed of germination; effects on growth were established through determination of above ground biomass. Ce was also tested at two pH levels and plant tissue analysis was conducted on pooled samples. Effects on germination were mostly observed with Ce at low pH. However, effects on growth were more pronounced, with detectable inhibition concentrations causing 10% and 25% reductions in biomass for the two native forb species (A. syriaca and D. canadense) with all REEs and on all species tested with Ce in both soil pH treatments. Concentration of Ce in aboveground biomass was lower than root Ce content, and followed the dose-response trend. From values measured in natural soils around the world, our results continue to support the notion that REEs are of limited toxicity and not considered extremely hazardous to the environment. However, in areas where REE contamination is likely, the slow accumulation of these elements in the environment could become problematic. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  11. Characteristics of mangrove swamps managed for mosquito control in eastern Florida, USA: a re-examination

    National Research Council Canada - National Science Library

    Jorge R. Rey; Sheila M. O’Connell; Douglas B. Carlson; Ronald E. Brockmeyer

    2009-01-01

    .... Methodological problems include inadequate sampling for the stated purpose, in particular using results of one-time sampling of very small marsh areas to characterize entire marshes and groups of marshes...

  12. Seasonal Use of Nest Boxes by Peromyscus and Ochrotomys in the Dismal Swamp of Virginia

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — We used tree-mounted nest boxes to evaluate levels of activity of Peromyscus leucopus and Ochrotomys nuttalli on four large grids in the seasonally flooded Dismal...

  13. Carbon Sequestration and Sedimentation in Mangrove Swamps Influenced by Hydrogeomorphic Conditions and Urbanization in Southwest Florida

    Directory of Open Access Journals (Sweden)

    Daniel A. Marchio

    2016-05-01

    Full Text Available This study compares carbon sequestration rates along two independent tidal mangrove creeks near Naples Bay in Southwest Florida, USA. One tidal creek is hydrologically disturbed due to upstream land use changes; the other is an undisturbed reference creek. Soil cores were collected in basin, fringe, and riverine hydrogeomorphic settings along each of the two tidal creeks and analyzed for bulk density, total organic carbon profiles, and sediment accretion. Radionuclides 137Cs and 210Pb were used to estimate recent sediment accretion and carbon sequestration rates. Carbon sequestration rates (mean ± standard error for seven sites in the two tidal creeks on the Naples Bay (98 ± 12 g-C m−2·year−1 (n = 18 are lower than published global means for mangrove wetlands, but consistent with other estimates from the same region. Mean carbon sequestration rates in the reference riverine setting were highest (162 ± 5 g-C m−2·year−1, followed by rates in the reference fringe and disturbed riverine settings (127 ± 6 and 125 ± 5 g-C m−2·year−1, respectively. The disturbed fringe sequestered 73 ± 10 g-C m−2·year−1, while rates within the basin settings were 50 ± 4 g-C m−2·year−1 and 47 ± 4 g-C m−2·year−1 for the reference and disturbed creeks, respectively. These data support our hypothesis that mangroves along a hydrologically disturbed tidal creek sequestered less carbon than did mangroves along an adjacent undisturbed reference creek.

  14. Great Swamp National Wildlife Refuge: A Report on Wilderness Character Monitoring

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document is the completed effort of the U.S. Fish and Wildlife Service, Wilderness Fellows program to develop a monitoring strategy and evaluate the status of...

  15. Mucking through the Swamp: Changing the Pedagogy of a Social Welfare Policy Course

    Science.gov (United States)

    Anderson, Debra K.

    2006-01-01

    Despite the fact that social welfare problems do not lend themselves to rational definition and analysis, most undergraduate social welfare policy courses use technical rational approaches to teach policy analysis. This article argues that analysts need to descend from the high ground of rational analysis to the "swampy lowlands of human concern"…

  16. Improved open-sun drying method for local swamp rice in Uganda

    African Journals Online (AJOL)

    ACSS

    drying equipment and owing to the low volumes of their harvests, these farmers use open-sun drying methods, where the paddy is spread on tarpaulins, cemented floors or bare ground. In most cases the paddy is badly dried and is highly fissured. Such paddy on milling contributes to low levels of mill recovery and head rice ...

  17. Improved open-sun drying method for local swamp rice in Uganda ...

    African Journals Online (AJOL)

    Due to lack of mechanized drying equipment and owing to the low volumes of their harvests, these farmers use open-sun drying methods, where the paddy is spread on tarpaulins, cemented floors or bare ground. In most cases the paddy is badly dried and is highly fissured. Such paddy on milling contributes to low levels of ...

  18. Mangrove swamps as fry source for shrimp culture - a case study

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.; Nair, S.R.S.

    .02%) and P. merguiensis (22.32%). Premonsoon season (February-May) sustained their maximum abundance in this mangrove. Juveniles (10-30 mm) constituted the largest portion of the penaeid population. M. dobsoni grows to 50-60 mm length within 5-6 months and M...

  19. Songbird Use in the Great Dismal Swamp National Wildlife Refuge 1991 Jericho Ditch Banding Station

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The station is operated only during the breeding season and winter periods, no migration banding is undertaken. This project is a program to monitor breeding...

  20. Songbird Use in the Great Dismal Swamp National Wildlife Refuge 1992 Jericho Ditch Banding Station

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The station is operated only during the breeding season and winter periods, no migration banding is undertaken. This project is a program to monitor breeding...

  1. Spectral discrimination of papyrus vegetation ( Cyperus papyrus L.) in swamp wetlands using field spectrometry

    Science.gov (United States)

    Adam, Elhadi; Mutanga, Onisimo

    Techniques for mapping and monitoring wetland species are critical for their sustainable management. Papyrus ( Cyperus papyrus L.) is one of the most important species-rich habitats that characterize the Greater St. Lucia Wetlands Park (GSWP) in South Africa. This paper investigates whether papyrus could be discriminated from its co-existing species using ASD field spectrometer data ranging from 300 nm to 2500 nm, yielding a total of 2151 bands. Canopy spectral measurements from papyrus and three other species were collected in situ in the Greater St. Lucia Wetlands Park, South Africa. A new hierarchical method based on three integrated analysis levels was proposed and implemented to spectrally discriminate papyrus from other species as well as to reduce and subsequently select optimal bands for the potential discrimination of papyrus. In the first level of the analysis using ANOVA, we found that there were statistically significant differences in spectral reflectance between papyrus and other species on 412 wavelengths located in different portions of the electromagnetic spectrum. Using the selected 412 bands, we further investigated the use of classification and regression trees (CART) in the second level of analysis to identify the most sensitive bands for spectral discrimination. This analysis yielded eight bands which are considered to be practical for upscaling to airborne or space borne sensors for mapping papyrus vegetation. The final sensitivity analysis level involved the application of Jeffries-Matusita (JM) distance to assess the relative importance of the selected eight bands in discriminating papyrus from other species. The results indicate that the best discrimination of papyrus from its co-existing species is possible with six bands located in the red-edge and near-infrared regions of the electromagnetic spectrum. Overall, the study concluded that spectral reflectance of papyrus and its co-existing species is statistically different, a promising result for the use of airborne and satellite sensors for mapping papyrus. The three-step hierarchical approach employed in this study could systematically reduce the dimensionality of bands to manageable levels, a move towards operational implementation with band specific sensors.

  2. Winding out of the Swamp: Evading the weak gravity conjecture with F-term winding inflation?

    Directory of Open Access Journals (Sweden)

    Arthur Hebecker

    2015-09-01

    Full Text Available We present a new model of large field inflation along a winding trajectory in the field space of two axionic fields, where the “axions” originate from the complex structure moduli sector of a Calabi–Yau 3-fold at large complex structure. The winding trajectory arises from fixing one combination of axions by bulk fluxes and allows for a transplanckian effective field range. The inflaton potential arises from small “instantonic” corrections to the geometry and realises natural inflation. By working in a regime of large complex structure for two complex structure moduli the inflaton potential can be made subdominant without severe tuning. We also discuss the impact of the recent ‘no-go theorems’ for transplanckian axion periodicities on our work. Interestingly, our setup seems to realise a loophole pointed out in arXiv:1503.00795 and arXiv:1503.04783: our construction is a candidate for a string theory model of large field inflation which is consistent with the mild form of the weak gravity conjecture for axions.

  3. Sulfate-reducing bacteria from mangrove swamps. 2. Their ecology and physiology

    Digital Repository Service at National Institute of Oceanography (India)

    LokaBharathi, P.A.; Oak, S.; Chandramohan, D.

    oxidizing SRB were widespread and occurred in numbers up to 6.62 x 103/g dry sediment. The next highest in number were lactate utilizing SRB. On an average there were more propionate and butyrate utilizers than acetate utilizers. While Agasaim at the mouth...

  4. Observations of Phytoplankton Composition from Standing Water in the Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Fifty-six phytoplankters were found in a temporary standing water site which persisted over a five-month period. A seasonal succession of species was noted from...

  5. Ambient iron concentration regulates the sulfate reducing activity in the mangrove swamps of Diwar, Goa, India

    Digital Repository Service at National Institute of Oceanography (India)

    Attria, K.; Kerkar,S.; LokaBharathi, P.A.

    In order to test the hypothesis that the ambient iron concentrations could regulate sulfate reducing activity (SRA) in mangrove areas, 10 cm cores were examined from test and reference sites. The test site at Diwar mangrove ecosystem is highly...

  6. Swamp rabbits as indicators of optimal scale for bottomland forest management

    Science.gov (United States)

    Joanne C. Crawford; Clayton K. Nielsen; Eric M. Schauber; John W. Groninger

    2014-01-01

    Specialist wildlife that evolved within forest ecosystems can be sensitive to disturbance regime changes and thereby serve as indicators of optimal scale for forest management. Bottomland hardwood (BLH) forests were once extensive within the Lower Mississippi Alluvial Valley, but land cover conversion has reduced BLH by about 80 percent over the last century. Since...

  7. The Munchausen paradigm for deprived neighbourhoods: pulling yourself out of the swamp of deprivation

    NARCIS (Netherlands)

    J.E. Nijkamp; J. Burgers; Dr. C.H.Z. Kuiper

    2017-01-01

    Since the 1980s, many initiatives have attempted to tackle the deprivation currently experienced in South Rotterdam. Efforts have been made to attract creative workers and, in a counter-reaction, other initiatives have aimed to encourage the creative talents of poorer residents to strengthen

  8. Water and habitat dynamics of the Mingo Swamp in southeastern Missouri

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The present report describes surface water relations in a lowland hardwood wetland in the Upper Mississippi Alluvial Valley (MAV). Water regimes were examined by...

  9. The Late Cenozoic Geology Of Southeastern Virginia And The Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The objectives of this field trip are to acquaint the participants with the late Cenozoic stratigraphic, paleontologic and geomorphic features of the Great Dis ma 1...

  10. Mobile Acoustical Bat Monitoring Annual Summary Report CY 2016- Panther Swamp National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These reports summarize bat calls collected along transects at Coldwater National Wildlife Refuge for the CY 2016. Calls were classified using Bat Call ID software...

  11. The Influence Of Ground Water Dynamics In A Periodically Flooded Ecosystem The Great Dismal Swamp

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Frequency, duration, depth, and timing of flooding are major influences on the structure and functional dynamics of wetland ecosystems. In the present study,...

  12. Methods for monitoring tidal flushing in large animal burrows in tropical mangrove swamps

    Science.gov (United States)

    Hollins, Suzanne E.; Heron, Scott F.; Ridd, Peter V.

    2009-05-01

    The typically anaerobic nature of mangrove sediments provides significant challenges to the mangrove trees and biota inhabiting them. The burrowing activities and flow of water through the numerous and complex animal burrows perforating the sediments of mangroves have a major influence on the biogeochemistry of the sediments and are important to the enhancement of nutrient and oxygen exchange. Two new methods are presented for monitoring the tidal flushing of Sesarma messa and Alpheus cf macklay burrows in a Rhizophora stylosa mangrove forest - by measuring oxygen content of burrow water and by determining the change in fluorescence of a dye tracer through tidal inundation. A case study using the first of these showed oxygen consumption rates at the burrow wall deep within the burrow were found to be between 210 and 460 μmol O 2 m -2 h -1. The influx of oxygen during a flood tide was found to be significant and indicated that approximately 40% of the burrow water is flushed during a single tidal event. However, the high consumption rate of oxygen within the burrow resulted in the oxygen concentration remaining at or below one-third of the oxygen content of the flooding tidal water. A test application of the second method, using rhodamine dye as a tracer, indicated that the exchange of water between the burrow and the flooding tide was found to be in the order of 30% of the burrow volume. These new techniques provide a means to further study the nutrient exchange within these burrow systems and verify the initial findings that several tidal inundations are necessary to completely flush the burrows.

  13. Mobile Acoustical Bat Monitoring Annual Summary Report CY 2014- Panther Swamp National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — These reports summarize bat calls collected along transects at Coldwater National Wildlife Refuge for the CY 2014. Calls were classified using Bat Call ID software...

  14. Contaminants in fish and sediments of Great Swamp National Wildlife Refuge, Morris County, New Jersey

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This study was designed to achieve three goals which would assist future refuge management and serve to focus further study: 1) identify toxic contaminants present...

  15. Tropical Peat Swamp Management Options: A Case Study Using System Dynamic in Southern Aceh

    Directory of Open Access Journals (Sweden)

    Aswandi

    2015-12-01

    Full Text Available Tropical peat forest ecosystems have multiple benefits as regulating hydrological system, carbon storage, timber and non-timber products, and protecting the biodiversity. Lack of understanding of these functions, short-term economic benefits is more preferable despite reducing its ecological benefits. This study proposed a system dynamics model of tropical peat forest ecosystem in determining its optimum management for extractive utilizations (timber and non-timber forest products, environmental services, and biodiversity. A dynamics model was used to describe changes in peatland and forest cover, biomass accumulation and carbon storage, and total economic value of tropical peat forest ecosystem in Trumon and Singkil, Southern Aceh. The projection showed that peat forest ecosystem benefits would decline in the long term if degradations continue at the same rate over last decade. Efforts to change the primary peat forest to plantation would reduce the total economic value of ecosystem and biodiversity values at level -19.63% and -26.28% from current conditions. Carbon emissions were increased at 117.32 ton CO2 eq ha-1 year-1, higher than average of carbon losses from peatland oxidation. Preserving 50% of forest vegetation on moderate depth and protection very deep peatlands would reduce emission -6.96% to -35.06% and increase forest carbon storage at significant rate +15.06% to +63.32%, respectively. These mitigation schemes would improve the biodiversity and hydrological function. Forest rehabilitation with agroforestry practices will enhance carbon uptake, especially on degraded lands.

  16. Investigating Issues in the Laboratory: The Behavior of Red Swamp Crayfish as an Invasive Species

    Science.gov (United States)

    Hewitt, Krissi M.; Kayes, Lori J.; Hubert, David; Chouinard, Adam

    2014-01-01

    Recent reform initiatives in undergraduate biology call for curricula that prepare students for dealing with real-world issues and making important links between science and society. In response to this call, we have developed an issues-based laboratory module that uses guided inquiry to integrate the concepts of animal behavior and population…

  17. Cresolase, catecholase and laccase activities in haemocytes of the red swamp crayfish.

    Science.gov (United States)

    Cárdenas, W; Dankert, J R

    2000-01-01

    Phenoloxidase activity in crayfish haemocyte lysates and extracts of haemocyte membranes were studied using native PAGE and SDS-PAGE gels and staining for cresolase, catecholase and laccase activities. The activation of the proenzyme, prophenoloxidase to phenoloxidase, in native PAGE was demonstrated following exposure to SDS. By staining samples separated in SDS-PAGE followed by renaturation, a high molecular mass phenoloxidase activity was identified in both the soluble and membrane fractions of haemocyte preparations. The membrane-associated activity appeared at only relatively high molecular mass (> 300 kDa), and could easily be eluted from membranes using detergents or NaCl. Further, this membrane-associated activity has a catecholase activity but not the cresolase activity seen in the soluble preparations. In addition, several other phenoloxidase enzymes were identified with different relative mobilities (250, 80, 72 and 10 kDa). Crayfish haemocytes also contained laccase activity, thought to be restricted to cuticle sclerotisation in the integument. Laccase activity in haemocytes might aid in the formation of capsule used to contain pathogens.

  18. Water quality of a coastal Louisiana swamp and how dredging is undermining restoration efforts

    Science.gov (United States)

    Lane, Robert R.; Huang, Haosheng; Day, John W.; Justic, Dubravko; DeLaune, Ronald D.

    2015-01-01

    The Bayou Boeuf Basin (BBB), a sub-basin of the Barataria Basin estuary in coastal Louisiana, consists of forested and floating wetlands receiving drainage from surrounding agricultural fields and urban watersheds. We characterized surface water quality in the BBB, and determined through hydrologic modeling if a series of levee breaks along major drainage channels would significantly improve water quality by allowing flow into surrounding wetlands. Surface water monitoring found surrounding sugarcane farm fields to be major sources of nutrient and sediment loading. Hydrological modeling indicated that levee breaks would increase N reduction from the current 21.4% to only 29.2%, which is much lower than the anticipated 90-100% removal rate. This was due to several factors, one them being dredging of main drainage channels to such a degree that water levels do not rise much above the surrounding wetland elevation even during severe storms, so only a very small fraction of the stormwater carried in the channel is exposed to wetlands. These unexpected results provide insight into an undoubtedly pervasive problem in human dominated wetland systems; that of decreased flooding during storm events due to channel deepening by dredging activities. Additional water quality management practices should be implemented at the farm field level, prior to water entering major drainage canals.

  19. Response to different rates of nitrogen by five varieties of swamp rice

    African Journals Online (AJOL)

    A field experiment was conducted in 2011 and 2012 in Ini Local Government Area of Akwa Ibom State, Nigeria; mainly to determine the optimum nitrogen fertilizer rate for the area as well as select the rice varieties that responded optimally. A split plot design was used with five N rates (0, 50, 100, 150and 200kg/ha) as the ...

  20. Probabilistic ecorisk assessment for fish, mammals, and birds at the Great Dismal Swamp National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The primary objective of this study was to conduct a probabilistic ecological risk assessment for birds and evaluate risk to fish and mammals that may be exposed to...

  1. Micromorphology and Histochemistry of the Laticifers from Vegetative Organs of Asclepiadoideae species (Apocynaceae)

    National Research Council Canada - National Science Library

    Diego DEMARCO

    2015-01-01

      Micromorphology and main substances of the laticifer walls and latex of Asclepias curassavica, Fischeria stellata, Gonioanthela axillaris, Matelea denticulata, and Oxypetalum banksii were analyzed...

  2. Assessment and prediction of the invasiveness of some alien plants in conditions of climate change in the steppe Dnieper region

    Directory of Open Access Journals (Sweden)

    Y. V. Lykholat

    2017-02-01

    Full Text Available The flora of the steppe Dnieper region is characterized by an abundance of naturalized alien species, some of which colonised over the last decade. Climate change, associated primarily with increasing temperature, became clearly manifested in this period. We tested the hypothesis that there is an association between climate change and the initiation of invasiveness of some alien plant species in the steppe Dnieper region. For this purpose, comparative studies of the distribution boundaries of naturalized alien trees, shrubs and herbaceous plants were conducted. Along the research route numerous 5–10-year-old broadleaf linden trees (Tilia platyphyllos Scop. were found in the man-made plantation communities of Dnipro city in areas with moist soil; seeded undergrowth was located at a significant distance from the adult linden plants. Numerous groups of young 7–10-year-old plants of the smoke trees (Cotinus coggygria Scop., which had a seed origin, were found in the shelterbelt and urban recreational plantations. Young 10–12-year-old virginal and generative plants of the black cherry (Padus serotina Ehrh. were found in large numbers in both the semi-natural and artificial plant communities at great distances from the adult trees. The alien plant species common hackberry (Celtis occidentalis L. showed the ability to form fairly sparse seminal seedlings, which was presented by the plants at the age of 4–7 years in both the natural and urban plant communities. The perennial herbaceous plant common milkweed (Asclepias syriaca L. was found in the course of the research in ruderal habitats, urban plant communities, and also in the agrocoenoses. The common milkweed reached its greatest abundance in fields of winter crops, where the spread of this species was accompanied by a sharp decrease in the number of other species of segetal plants. Our study results confirm that the extension of the distribution boundaries of alien species over the last

  3. Preliminary Evaluation of Some Engineering Geological Properties ...

    African Journals Online (AJOL)

    Michael Horsfall

    ) Saltwater, mangrove swamps. (c) Freshwater swamps, back-swamps, deltaic plain alluvium and meander belt. (d) Dry deltaic plain with abundant freshwater swamps (Sombreiro-Warri deltaic plain) and. (e) Dry flat land and plain.

  4. A Comprehensive Inventory of Alabama Coastal Zone Wetland Habitats (Swamps, Marshes, Submersed Grassbeds) from 1980 to 1982 (NCEI Accession 0161311)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Digitized maps of Mobile Bay and other coastal areas of Alabama, showing habitat types and species compositions of the vegetation in three broad categories of...

  5. In-depth comparative transcriptome analysis of intestines of red swamp crayfish, Procambarus clarkii, infected with WSSV.

    Science.gov (United States)

    Du, Zhiqiang; Jin, Yanhui; Ren, Daming

    2016-06-10

    Crayfish has become one of the most important farmed aquatic species in China due to its excellent disease resistance against bacteria and viruses. However, the antiviral mechanism of crayfish is still not very clear. In the present study, many high-quality sequence reads from crayfish intestine were obtained using Illumina-based transcriptome sequencing. For the normal group (GN), 44,600,142 high-quality clean reads were randomly assembled to produce 125,394 contigs. For the WSSV-challenged group (GW), 47,790,746 high-quality clean reads were randomly assembled to produce 148,983 contigs. After GO annotation, 39,482 unigenes were annotated into three ontologies: biological processes, cellular components, and molecular functions. In addition, 15,959 unigenes were mapped to 25 different COG categories. Moreover, 7,000 DEGs were screened out after a comparative analysis between the GN and GW samples, which were mapped into 250 KEGG pathways. Among these pathways, 36 were obviously changed (P-values < 0.05) and 28 pathways were extremely significantly changed (P-values < 0.01). Finally, five key DEGs involved in the JAK-STAT signaling pathway were chosen for qRT-PCR. The results showed that these five DEGs were obviously up-regulated at 36 h post WSSV infection in crayfish intestine. These results provide new insight into crayfish antiviral immunity mechanisms.

  6. In-depth comparative transcriptome analysis of intestines of red swamp crayfish, Procambarus clarkii, infected with WSSV

    OpenAIRE

    Zhiqiang Du; Yanhui Jin; Daming Ren

    2016-01-01

    Crayfish has become one of the most important farmed aquatic species in China due to its excellent disease resistance against bacteria and viruses. However, the antiviral mechanism of crayfish is still not very clear. In the present study, many high-quality sequence reads from crayfish intestine were obtained using Illumina-based transcriptome sequencing. For the normal group (GN), 44,600,142 high-quality clean reads were randomly assembled to produce 125,394 contigs. For the WSSV-challenged ...

  7. Big Cypress fox squirrel (Sciurus niger avicennia) ecology and habitat use in a cypress dome swamp-pine forest mosaic

    Science.gov (United States)

    Kellam, John O.; Jansen, Deborah K.; Johnson, Annette T.; Arwood, Ralph W.; Merrick, Melissa J.; Koprowski, John L.

    2016-01-01

    Forested wetlands are in decline, as are many species that are obligate residents. Big Cypress fox squirrels (BCFS; Sciurus niger avicennia) are a threatened endemic to wet pine and cypress forests in southwestern Florida. The region is characterized by development resulting in habitat loss, habitat fragmentation, and hydrological change that influence the quality of these wet forests. Through radiotelemetry and field observations, we examined the ecology and habitat use of BCFS in a natural cypress dome-pine forest mosaic. BCFS selected cypress domes for food and nests throughout the year. Cypress dome habitats were the only habitat type to be used more than available; however, the availability of nearby pine forest was also important. Home ranges were large relative to other tree squirrels, with male home ranges exceeding female ranges. Males overlapped more females than males, while sharing similar food preferences and use patterns with females, suggesting that the sexual dimorphism in home range size is related to mate searching. Roads and oil extraction pads were used less frequently than expected and were incorporated into home ranges less than randomly generated features. The importance of cypress domes within the wet forests and grasslands of Big Cypress National Preserve demonstrates the value of maintaining this delicate mosaic. PMID:26989265

  8. Flood Plain Information, Toms River, Union Branch Ridgeway Branch, and Long Swamp Creek, Ocean County, New Jersey.

    Science.gov (United States)

    1972-06-01

    heights at Brook Road along Union Branch ........ .. 24 N * COUNTY PENI SYLvANIA JRE - LOCAT ION / *"MW OF STUDY JACKSON TOWNSHIP TONSI j cl VICINITY...34 "Million Dollars Damage in Ocean County" "Island Heights Lost its 1,200ft. Boardwalk Erected in 1949 at $20,000- Total Damages Estimated at $100,000" Toms...roads, Jersey coast line, rendering it helpless and and several thousand families lost electricity almost unrecognizable. The storm brought for

  9. Incidence Factors of Negative Environmental Behavior towards the Swamps of Bañó and Los Negros

    Directory of Open Access Journals (Sweden)

    Jorge Villadiego-Lorduy

    2015-09-01

    Full Text Available The purpose of this article is to determine the factors that are influencing the environmentally negative behavior of the inhabitants of Bañó and Los Negros towards these wetlands. For this, a questionnaire was designed, validated by a panel of experts, and implemented. Based on a population of 645 households, we used two types of sample designs –systematic and random– to implement the research instrument. In addition to their respective statistical analysis, a content analysis was carried out with the secondary information collected using index cards. Factors such as low education, scarce employment opportunities, and low income per household have a direct impact on the deterioration of these wetlands. Almost 50% of the population living in the wetlands has not completed basic education. Thus, the possibilities to reflect on the actions done by people against the water mirrors are poor, especially when family incomes are very low (53% of the families receive incomes of less than COL$ 10,000 a day. The scarce organization of the communities has prejudiced the development of joint activities between the neighboring communities of the wetlands, as well as the achievement of common goals. Furthermore, the ineffectiveness of local and national environmental authorities has contributed to the degradation of ecosystems due to an inefficient environmental management over the years. Wetlands are the main source of natural resources for these people and the permanence of such communities in the territory is directly related to the wetlands’ conservation. The synergy of the above factors has unleashed environmental problems that have resulted in the reduction of the ecological capacity of these wetlands and the deterioration of environmental conditions in the area of study.

  10. Using Flow-Ecology Relationships to Evaluate Ecosystem Service Trade-Offs and Complementarities in the Nation's Largest River Swamp.

    Science.gov (United States)

    Kozak, Justin P; Bennett, Micah G; Hayden-Lesmeister, Anne; Fritz, Kelley A; Nickolotsky, Aaron

    2015-06-01

    Large river systems are inextricably linked with social systems; consequently, management decisions must be made within a given ecological, social, and political framework that often defies objective, technical resolution. Understanding flow-ecology relationships in rivers is necessary to assess potential impacts of management decisions, but translating complex flow-ecology relationships into stakeholder-relevant information remains a struggle. The concept of ecosystem services provides a bridge between flow-ecology relationships and stakeholder-relevant data. Flow-ecology relationships were used to explore complementary and trade-off relationships among 12 ecosystem services and related variables in the Atchafalaya River Basin, Louisiana. Results from Indicators of Hydrologic Alteration were reduced to four management-relevant hydrologic variables using principal components analysis. Multiple regression was used to determine flow-ecology relationships and Pearson correlation coefficients, along with regression results, were used to determine complementary and trade-off relationships among ecosystem services and related variables that were induced by flow. Seven ecosystem service variables had significant flow-ecology relationships for at least one hydrologic variable (R (2) = 0.19-0.64). River transportation and blue crab (Callinectes sapidus) landings exhibited a complementary relationship mediated by flow; whereas transportation and crawfish landings, crawfish landings and crappie (Pomoxis spp.) abundance, and blue crab landings and blue catfish (Ictalurus furcatus) abundance exhibited trade-off relationships. Other trade-off and complementary relationships among ecosystem services and related variables, however, were not related to flow. These results give insight into potential conflicts among stakeholders, can reduce the dimensions of management decisions, and provide initial hypotheses for experimental flow modifications.

  11. Organic carbon and iron modulate nitrification rates in mangrove swamps of Goa, south west coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Krishnan, K.P.; LokaBharathi, P.A.

    ) and the other relatively undisturbed (control). We hypothesize that besides organic carbon, iron could also influence the rate of nitrification. The study also contrasts the distributive pattern of autotrophic and heterotrophic nitrifiers in the two regions...

  12. "The Trampoline Tree and the Swamp Monster with 18 Heads": Outdoor Play in the Foundation Stage and Foundation Phase

    Science.gov (United States)

    Waller, Tim

    2007-01-01

    This paper considers pedagogy and outdoor play in the early years. The particular focus is on the specific features and benefits of outdoor play in the Foundation Stage (England) and Foundation Phase (Wales). The paper will draw on current international literature and evidence from outdoor learning constructed in an ongoing research project in two…

  13. The swamp of Dutch politics: how the impact of modernization on political institutions is modified by institutional context

    NARCIS (Netherlands)

    Aarts, Kees; Thomassen, Jacques J.A.; van Wijnen, Pieter; van Heffen, Oscar; Kickert, Walter J.M.

    2000-01-01

    As argued in the introductory chapter, the institutions of government and the relations between government and society are currently undergoing important changes. Firstly, the distinction between different levels of government has become more diffuse than ever. Due to processes of globalization and

  14. Pesticide and nutrient contamination in the Cypress Swamp of the A.R.M Loxahatchee National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Surface water and sediment contamination of the Loxahatchee National Wildlife Refuge (Refuge) is a management concern given the proximity of both agriculture and...

  15. The effects of high temperature and roof modification on physiological responses of swamp buffalo ( Bubalus bubalis) in the tropics

    Science.gov (United States)

    Khongdee, Titaporn; Sripoon, S.; Vajrabukka, C.

    2013-05-01

    The objective of the experiments reported here was to measure the effects of cooling techniques (Modified roof vs Normal roof) on the performance and physiology of 12 young male buffaloes with a similar live weight of 160 kg. The study was conducted at Chainat Agriculture and Technology College, Chainat Province, Thailand. The animals were divided randomly into two groups, each group comprising six buffaloes, and the two groups were studied to evaluate the effects of modified roofing (normal roof fitted with woven polypropylene shade cloth) on the subjects' physiological responses to heat stress under hot humid conditions. The modified roof resulted in lowered heat stress in buffaloes compared to those under a standard roof. The difference was shown by the buffaloes having a significantly lower mean rectal temperature (39.14 ± 0.07 vs 40.00 ± 0.10°C) and plasma cortisol (2.14 ± 0.24 vs 3.38 ± 0.37 ng/ml). The average daily water consumption was significantly lower in the MR group (MR, 29.71 ± 0.86 vs NR, 34.14 ± 1.06 L head -1 day-1), while there was a tendency for the roughage intake to be higher in the MR group compared to that of the NR group (MR, 5.88 ± 0.18 vs NR, 6.44 ± 0.19 kg head-1 -1 day-1; P = 0.0508). It was concluded that roof modification facilitated a reduction in heat load from roof re-radiation, and was an effective means of alleviating thermal stress in young buffaloes.

  16. The relationship between the abundance of Mansonia mosquitoes inhabiting a peat swamp forest and remotely sensed data.

    Science.gov (United States)

    Apiwathnasorn, Chamnarn; Asavanich, Achara; Komalamisra, Narumon; Samung, Yudthana; Prummongkol, Samrerng; Kanjanopas, Kobkan

    2006-05-01

    The present study aimed to demonstrate the relationship of some environmental factors, vegetation greenness index (NDVI) and land surface temperature (LST), with the seasonal variations of Mansonia bonneae and Ma. uniformis in Khosit Subdistrict, Narathiwat Province. It was found that the Mansonia population lagged one month behind but correlated positively to NDVI, LST and rainfall. A rise in the number of mosquitoes was directly related to a rise in vegetation, temperature and rainfall.

  17. Novel Insights into Antiviral Gene Regulation of Red Swamp Crayfish, Procambarus clarkii, Infected with White Spot Syndrome Virus

    Directory of Open Access Journals (Sweden)

    Shaokui Yi

    2017-11-01

    Full Text Available White spot syndrome virus (WSSV, one of the major pathogens of Procambarus clarkii, has caused severe disruption to the aquaculture industry of P. clarkii in China. To reveal the gene regulatory mechanisms underlying WSSV infection, a comparative transcriptome analysis was performed among WSSV-infected susceptible individuals (GS, viral resistant individuals (GR, and a non-infected control group (GC. A total of 61,349 unigenes were assembled from nine libraries. Subsequently, 515 and 1033 unigenes exhibited significant differential expression in sensitive and resistant crayfish individuals compared to the control group (GC. Many differentially expressed genes (e.g., C-type lectin 4, Peroxinectin, Prophenoloxidase, and Serine/threonine-protein kinase observed in GR and GS play critical roles in pathogen recognition and viral defense reactions after WSSV infection. Importantly, the glycosaminoglycan biosynthesis-chondroitin sulfate/dermatan sulfate pathway was identified to play critical roles in defense to WSSV infection for resistant crayfish individuals by upregulating the chondroitin sulfate related genes for the synthesis of WSSV-sensitive, functional chondroitin sulfate chains containing E units. Numerous genes and the key pathways identified between resistant and susceptible P. clarkii individuals provide valuable insights regarding antiviral response mechanisms of decapoda species and may help to improve the selective breeding of P. clarkii WSSV-resistance.

  18. Geomorphological and ecological researches inferring swamp areas inside endorheic cacthment basin: The Asso graben-polje case study (south Italy).

    Science.gov (United States)

    Delle Rose, M.; Beccarisi, L.; Zuccarello, V.

    2009-04-01

    Peoples living inside flat karstic areas frequently deal with both socio-economic and environmental problems related to the superficial waters management. Karst morphologies, such as dolines and water sinks mostly, characterize the plane territory of Salento (southern Italy). Since their first settlements, Salento landscapes had been modified to drain surface waters, discharge floods and reclaim marshlands. This contribution deals with the Asso graben-polje which is about 200 kmq wide and lies in a regional lowered tectonic structure. It is highly vulnerable owing to both flooding and groundwater pollution and the hazard due to the occurrence of sinkholes is impending. The Asso streams is network of natural and artificial channels which was linked to six water sinks about 75 years ago, i. e. during the last extensive hydrographic arrangement to solve flooding and epidemiological problems. At present, the terminal sinks of the Asso fluvial-karst system absolved the functions of: storm water drainage wells, aquifer remediation-related wells and underground injection regulated wastewater disposal systems. So, the water management of the system is an hard task, being the mitigation of the amplitude of flooding events, achieved by means of the increasing of water sinks discharge, in contrast with the safeguard aquifers by pollutant displacements and the need to protect the public health. In spite of the efforts made till now by Public Bodies, the knowledge related to the speleogenesis and the hydraulic properties of the sinks is disregarded by the current water resource management. The carried out geomorphological researches allow us to distinguish natural, partially modified and human bored water sinks. Some of the natural water sinks can be described us collapse dolines, but a number of them present different origin and development, as karst wells and karst shaft. To each water sink type, specific drainage properties can be assigned. Even if the depressions prone to be flooded are thought by geologists as hazard zones, they also represent ecologically significant habitats. Moreover, natural vegetation is a good indicator of the local environmental characteristics of the hydrographical system. So, this study also dealt with the definition of the plant communities and the characterization of the habitats related to such communities. Through the sampling and the analysis of the hydrophitic and riparian vegetation, a series of plant communities is been characterized. Such communities responds to the length of the period of flooding, to the typology of substratum and to the form of the river bed section. In order to make tools useful to the catchment basin management, existing and collected geological and ecological data are in phase of implementation in a Geographical Information System database.

  19. Estimation of pathways of the production of greenhouse gases in the tropical swamp forest in Thailand by stable isotope investigation.

    Science.gov (United States)

    Boontanon, Narin; Ueda, Shingo; Wada, Eitaro

    2008-09-01

    Dynamics of greenhouse gases (N(2)O and CH(4)) with the dry-wet cycle along with the variation of oxidation-reduction boundaries were investigated in the tropical wetland in monsoon Asia. It was clarified that the production of N(2)O and CH(4) was closely related to the development of a redox boundary in the Bang Nara River systems. An intermittent increase in N(2)O was observed at the beginning of the rainy season, when a large amount of easily decomposable organic matter was introduced into the river. After 10 days, when dissolved oxygen was consumed completely at the middle reaches, the emission of CH(4) became maximal due to the possible occurrence of denitrification. The distribution of stable isotope ratios in N(2)O clearly demonstrated that nitrification is the major process for its production. Furthermore, the production of N(2)O in this study area was found to vary in time and space with changes in the redox boundary along the water flow.

  20. The Effects of Hydroperiod and Nutrient Levels on Root Dynamics in a Seasonally Flooded Swamp Ecosystem 1986

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The major objectives of this study were; 1) to test and evaluate several modified methods for measuring root production and decay, 2) to measure root production and...