WorldWideScience

Sample records for swamp milkweed asclepias

  1. Variation in pollinator effectiveness in swamp milkweed, Asclepias incarnata (Apocynaceae).

    Science.gov (United States)

    Ivey, Christopher T; Martinez, Pocholo; Wyatt, Robert

    2003-02-01

    The contribution of a pollinator toward plant fitness (i.e., its "effectiveness") can determine its importance for the plant's evolutionary ecology. We compared pollinators in a population of Asclepias incarnata (Apocynaceae) for several components of pollinator effectiveness over two flowering seasons to evaluate their importance to plant reproduction. Insects of the order Hymenoptera predominate in A. incarnata pollination, but there appears to be no specialization for pollination within this order. Pollinators varied significantly in nearly every component of effectiveness that we measured, including pollen load, removal and deposition of pollen, pollination efficiency (deposition/removal), flower-handling time, and potential for geitonogamy (fractional pollen deposition). The visitation rate of pollinators also varied significantly between years and through time within years. Pollination success and percentage fruit-set of unmanipulated plants in the population also varied significantly between years, and pollination success varied among sample times within years. Most components of effectiveness were weakly correlated, suggesting that the contributions of visitor species toward pollination varied among effectiveness components. Mean flower-handling time, however, was strongly correlated with several components, including pollen removal and deposition, pollination efficiency, and fractional pollen deposition. These findings highlight the significance of pollination variability for plant reproduction and suggest that time-dependent foraging behaviors may play an important role in determining pollinator effectiveness.

  2. The common milkweed (Asclepias syriaca): A new industrial crop

    Science.gov (United States)

    Asclepias syriaca L. (the common milkweed) is a perennial plant occurring east of the Rockies in the United States, but particularly east of the Mississippi River and from Southern Canada to Mexico. The plant has many unsavory given names by frustrated farmers including “the Wheat Farmers Nightmare...

  3. Beneficial Insect Attraction to Milkweeds (Asclepias speciosa, Asclepias fascicularis) in Washington State, USA

    OpenAIRE

    David G. James; Lorraine Seymour; Gerry Lauby; Katie Buckley

    2016-01-01

    Native plant and beneficial insect associations are relatively unstudied yet are important in native habitat restoration programs for improving and sustaining conservation biological control of arthropod pests in agricultural crops. Milkweeds (Asclepias spp.) are currently the focus of restoration programs in the USA aimed at reversing a decline in populations of the milkweed-dependent monarch butterfly (Danaus plexippus); however, little is known of the benefits of these plants to other bene...

  4. Transesterified milkweed (Asclepias) seed oil as a biodiesel fuel

    Energy Technology Data Exchange (ETDEWEB)

    Ronald Alan Holser; Rogers Harry-O' Kurua [United States Department of Agriculture, Peoria, IL (United States). Agricultural Research Service, National Center for Utilization Research

    2006-10-15

    The methyl and ethyl esters of milkweed (Asclepias) seed oil were prepared and compared to soybean esters in laboratory tests to determine biodiesel fuel performance properties. The pour points of the methyl and ethyl milkweed esters measured -6{sup o}C and -10{sup o}C, respectively, which is consistent with the high levels of unsaturation characteristic of milkweed seed oil. The oxidative stabilities measured by OSI at 100{sup o}C were between 0.8 and 4.1 h for all samples tested. The kinematic viscosities determined at 40{sup o}C by ASTM D 445 averaged 4.9 mm{sup 2}/s for milkweed methyl esters and 4.2 mm{sup 2}/s for soybean methyl esters. Lubricity values determined by ASTM D 6079 at 60{sup o}C were comparable to the corresponding soybean esters with average ball wear scar values of 118 {mu}m for milkweed methyl esters and 200 {mu}m for milkweed ethyl esters.

  5. Beneficial Insect Attraction to Milkweeds (Asclepias speciosa, Asclepias fascicularis in Washington State, USA

    Directory of Open Access Journals (Sweden)

    David G. James

    2016-06-01

    Full Text Available Native plant and beneficial insect associations are relatively unstudied yet are important in native habitat restoration programs for improving and sustaining conservation biological control of arthropod pests in agricultural crops. Milkweeds (Asclepias spp. are currently the focus of restoration programs in the USA aimed at reversing a decline in populations of the milkweed-dependent monarch butterfly (Danaus plexippus; however, little is known of the benefits of these plants to other beneficial insects. Beneficial insects (predators, parasitoids, pollinators attracted to two milkweed species (Asclepias speciosa, Asclepias fascicularis in central Washington State, WA, USA were identified and counted on transparent sticky traps attached to blooms over five seasons. Combining all categories of beneficial insects, means of 128 and 126 insects per trap were recorded for A. speciosa and A. fascicularis, respectively. Predatory and parasitic flies dominated trap catches for A. speciosa while parasitic wasps were the most commonly trapped beneficial insects on A. fascicularis. Bees were trapped commonly on both species, especially A. speciosa with native bees trapped in significantly greater numbers than honey bees. Beneficial insect attraction to A. speciosa and A. fascicularis was substantial. Therefore, these plants are ideal candidates for habitat restoration, intended to enhance conservation biological control, and for pollinator conservation. In central Washington, milkweed restoration programs for enhancement of D. plexippus populations should also provide benefits for pest suppression and pollinator conservation.

  6. Beneficial Insect Attraction to Milkweeds (Asclepias speciosa, Asclepias fascicularis) in Washington State, USA.

    Science.gov (United States)

    James, David G; Seymour, Lorraine; Lauby, Gerry; Buckley, Katie

    2016-06-29

    Native plant and beneficial insect associations are relatively unstudied yet are important in native habitat restoration programs for improving and sustaining conservation biological control of arthropod pests in agricultural crops. Milkweeds (Asclepias spp.) are currently the focus of restoration programs in the USA aimed at reversing a decline in populations of the milkweed-dependent monarch butterfly (Danaus plexippus); however, little is known of the benefits of these plants to other beneficial insects. Beneficial insects (predators, parasitoids, pollinators) attracted to two milkweed species (Asclepias speciosa, Asclepias fascicularis) in central Washington State, WA, USA were identified and counted on transparent sticky traps attached to blooms over five seasons. Combining all categories of beneficial insects, means of 128 and 126 insects per trap were recorded for A. speciosa and A. fascicularis, respectively. Predatory and parasitic flies dominated trap catches for A. speciosa while parasitic wasps were the most commonly trapped beneficial insects on A. fascicularis. Bees were trapped commonly on both species, especially A. speciosa with native bees trapped in significantly greater numbers than honey bees. Beneficial insect attraction to A. speciosa and A. fascicularis was substantial. Therefore, these plants are ideal candidates for habitat restoration, intended to enhance conservation biological control, and for pollinator conservation. In central Washington, milkweed restoration programs for enhancement of D. plexippus populations should also provide benefits for pest suppression and pollinator conservation.

  7. Identification of triterpenes from milkweed (Asclepias syriaca).

    Science.gov (United States)

    Háznagy-Radnai, Erzsébet; Wéber, Edit; Czigle, Szilvia; Máthé, Imre

    2012-09-01

    The chloroform extract of Asclepias syriaca stem were investigated. Three triterpenes were isolated by TLC, VLC, and preparative chromatography, and their structures established by one and two-dimensional NMR spectroscopy. Lupenyl acetate has been isolated for the first time from A. syriaca; this is thefirst representative of a triterpene bearing a lupane skeleton in this species. In addition, alpha-amyrin acetate and alpha-amyrin butyrate were isolated.

  8. Milkweed Matters: Monarch Butterfly (Lepidoptera: Nymphalidae) Survival and Development on Nine Midwestern Milkweed Species.

    Science.gov (United States)

    Pocius, V M; Debinski, D M; Pleasants, J M; Bidne, K G; Hellmich, R L; Brower, L P

    2017-10-01

    The population of monarch butterflies east of the Rocky Mountains has experienced a significant decline over the past 20 yr. In order to increase monarch numbers in the breeding range, habitat restoration that includes planting milkweed plants is essential. Milkweeds in the genus Asclepias and Cynanchum are the only host plants for larval monarch butterflies in North America, but larval performance and survival across nine milkweeds native to the Midwest is not well documented. We examined development and survival of monarchs from first-instar larval stages to adulthood on nine milkweed species native to Iowa. The milkweeds included Asclepias exaltata (poke milkweed) (Gentianales: Apocynaceae), Asclepias hirtella (tall green milkweed) (Gentianales: Apocynaceae), Asclepias incarnata (swamp milkweed) (Gentianales: Apocynaceae), Asclepias speciosa (showy milkweed) (Gentianales: Apocynaceae), Asclepias sullivantii (prairie milkweed) (Gentianales: Apocynaceae), Asclepias syriaca (common milkweed) (Gentianales: Apocynaceae), Asclepias tuberosa (butterfly milkweed) (Gentianales: Apocynaceae), Asclepias verticillata (whorled milkweed) (Gentianales: Apocynaceae), and Cynanchum laeve (honey vine milkweed) (Gentianales: Apocynaceae). In greenhouse experiments, fewer larvae that fed on Asclepias hirtella and Asclepias sullivantii reached adulthood compared with larvae that fed on the other milkweed species. Monarch pupal width and adult dry mass differed among milkweeds, but larval duration (days), pupal duration (days), pupal mass, pupal length, and adult wet mass were not significantly different. Both the absolute and relative adult lipids were different among milkweed treatments; these differences are not fully explained by differences in adult dry mass. Monarch butterflies can survive on all nine milkweed species, but the expected survival probability varied from 30 to 75% among the nine milkweed species. © The Author 2017. Published by Oxford University Press on behalf

  9. Cytotoxic principles from the formosan milkweed, Asclepias curassavica.

    Science.gov (United States)

    Roy, Michael C; Chang, Fang-Rong; Huang, Hsiao-Chu; Chiang, Michael Y-N; Wu, Yang-Chang

    2005-10-01

    A series of cardenolides and related compounds have been isolated from the aerial parts and roots of the ornamental milkweed, Asclepias curassavica. Their structures were determined by spectroscopic and chemical methods. Among them, three derivatives of calactinic acid methyl ester (13-15), 19-nor-16 alpha-acetoxy-10 beta-hydroxyasclepin (16), 20 beta,21-dihydroxypregna-4,6-dien-3-one (19), and 3,4-seco-urs-20(30)-en-3-oic acid (22) are new compounds. The relative configuration of calactinic acid methyl ester (12) has been confirmed by X-ray diffraction analysis on its derivative 13. Most of the cardenolides obtained showed pronounced cytotoxicity against four cancer cell lines (IC(50) 0.01 to 2.0 microg/mL).

  10. Novel synthetic products from the common milkweed (Asclepias syriaca L) and their potential in the rural farm economy

    Science.gov (United States)

    The common milkweed is of the family Asclepiadaceae which comprises over 200 genera and 2500 species including Asclepias syriaca L and its near relatives, A. speciosa and A. tuberosa. Asclepias syriaca, or the common milkweed, is a perennial that is native to the Americas and is so named because of...

  11. Coexistence of three specialist aphids on common milkweed, Asclepias syriaca.

    Science.gov (United States)

    Smith, R A; Mooney, K A; Agrawal, A A

    2008-08-01

    Coexistence of host-specific herbivores on plants is believed to be governed by interspecific interactions, but few empirical studies have systematically unraveled these dynamics. We investigated the role of several factors in promoting coexistence among the aphids Aphis nerii, Aphis asclepiadis, and Myzocallis asclepiadis that all specialize on common milkweed (Asclepias syriaca). Competitive exclusion is thought to occur when interspecific competition is stronger than intraspecific competition. Consequently, we investigated whether predators, mutualists, or resource quality affected the strength of intra- vs. interspecific competition among aphids in factorial manipulations of competition with exposure to predation, ants, and variable plant genotypes in three separate experiments. In the predation x competition experiment, predators reduced aphid per capita growth by 66%, but the strength of intra- and interspecific competition did not depend on predators. In the ants x competition experiment, ants reduced per capita growth of A. nerii and M. asclepiadis (neither of which were mutualists with ants) by approximately one-half. In so doing, ants ameliorated the negative effects of these competitors on ant-tended A. asclepiadis by two-thirds, representing a novel benefit of ant-aphid mutualism. Nevertheless, ants alone did not explain the persistence of competitively inferior A. asclepiadis as, even in the presence of ants, interspecific competition remained stronger than intraspecific competition. In the plant genotype x competition experiment, both A. asclepiadis and M. asclepiadis were competitively inferior to A. nerii, with the strength of interspecific competition exceeding that of intraspecific competition by 83% and 23%, respectively. Yet these effects differed among milkweed genotypes, and there were one or more plant genotypes for each aphid species where coexistence was predicted. A synthesis of our results shows that predators play little or no role in

  12. The untold story of the common Milkweed (Asclepias syriaca): A new industrial crop

    Science.gov (United States)

    The common milkweed (Asclepias syriaca L.) is a perennial shrub that is native to the Americas from coast to coast, but particularly abundant east of the Mississippi River and from Southern Canada to Mexico. The plant has been given many nonglamorous names by frustrated farmers including “The Wheat...

  13. Demography and monitoring of Welsh's milkweed (Asclepias welshii) at Coral Pink Sand Dunes

    Science.gov (United States)

    Brent C. Palmer; L. Armstrong

    2001-01-01

    Results are presented of a 12-year monitoring program on the Coral Pink Sand Dunes and Sand Hills populations of the threatened Welsh's milkweed, Asclepias welshii N & P Holmgren. The species is an early sera1 member of the dune flora, colonizing blowouts and advancing with shifting dunes. When an area stabilizes and other vegetation encroaches, A. welshii is...

  14. Reciprocal interactions between native and introduced populations of common milkweed, Asclepias syriaca, and the specialist aphid, Aphis nerii

    NARCIS (Netherlands)

    Bukovinszky, T.; Gols, R.; Agrawal, A.A.; Roge, C.; Bezemer, T.M.; Biere, A.; Harvey, J.A.

    2014-01-01

    Following its introduction into Europe (EU), the common milkweed (Asclepias syriaca) has been free of most specialist herbivores that are present in its native North American (NA) range, except for the oleander aphid Aphis nerii. We compared EU and NA populations of A. nerii on EU and NA milkweed

  15. Isolation and characterization of microsatellite loci in the common milkweed, Asclepias syriaca (Apocynaceae).

    Science.gov (United States)

    Kabat, Susan M; Dick, Christopher W; Hunter, Mark D

    2010-05-01

    Microsatellite primers were developed for the common milkweed, Asclepias syriaca L., to assist in genet identification and the analysis of spatial genetic structure. Using an enrichment cloning protocol, eight microsatellite loci were isolated and characterized in a Michigan population of A. syriaca. The primers amplified di- and trinucleotide repeats with 4-13 alleles per locus. The primers will be useful for studies of clonality and gene flow in natural populations.

  16. Common milkweed (Asclepias syriaca L. response to sulcotrione

    Directory of Open Access Journals (Sweden)

    Gajić-Umiljendić Jelena

    2017-01-01

    Full Text Available A laboratory bioassay was conducted to investigate common milkweed response to sulcotrione. Sulcotrione was applied in concentration series of 0.15-0.90 kg a.i./ha without a surfactant and with Dash® at 1 L/ha. Plants grew for 14 days, upon which period morphological (height and fresh weight and physiological parameters (content of carotenoids, chlorophyll a and chlorophyll b were measured. Visual crop injury was estimated 7 and 14 days after treatment. Sulcotrione caused leaf bleaching and reduction in pigments content in common milkweed leaves and the degree of change depended on application rates and whether it was applied with or without the surfactant. Inhibition was slightly higher in plants which were treated with a combination of herbicide and surfactant. Based on the findings in this study, common milkweed showed moderate susceptibility to the recommended field rates of sulcotrione.

  17. Intoxication of sheep exposed to ozark milkweed (Asclepias viridis Walter).

    Science.gov (United States)

    Smith, R A; Scharko, P; Bolin, D; Hong, C B

    2000-12-01

    Some 20 sheep died 1 at a time on a farm in Fleming County, KY, in late July of 1999 after consumption of Asclepias viridis Walter. Major histological lesions were mild multifocal nonsuppurative myocarditis. Gross pathology revealed wet and heavy lungs. Many affected animals had a hunched appearance, and marked posterior paresis was also observed.

  18. Phylogenetic ecology of leaf surface traits in the milkweeds (Asclepias spp.): chemistry, ecophysiology, and insect behavior.

    Science.gov (United States)

    Agrawal, Anurag A; Fishbein, Mark; Jetter, Reinhard; Salminen, Juha-Pekka; Goldstein, Jessica B; Freitag, Amy E; Sparks, Jed P

    2009-08-01

    The leaf surface is the contact point between plants and the environment and plays a crucial role in mediating biotic and abiotic interactions. Here, we took a phylogenetic approach to investigate the function, trade-offs, and evolution of leaf surface traits in the milkweeds (Asclepias). Across 47 species, we found trichome densities of up to 3000 trichomes cm(-2) and epicuticular wax crystals (glaucousness) on 10 species. Glaucous species had a characteristic wax composition dominated by very-long-chain aldehydes. The ancestor of the milkweeds was probably a glaucous species, from which there have been several independent origins of glabrous and pubescent types. Trichomes and wax crystals showed negatively correlated evolution, with both surface types showing an affinity for arid habitats. Pubescent and glaucous milkweeds had a higher maximum photosynthetic rate and lower stomatal density than glabrous species. Pubescent and glaucous leaf surfaces impeded settling behavior of monarch caterpillars and aphids compared with glabrous species, although surface types did not show consistent differentiation in secondary chemistry. We hypothesize that pubescence and glaucousness have evolved as alternative mechanisms with similar functions. The glaucous type, however, appears to be ancestral, lost repeatedly, and never regained; we propose that trichomes are a more evolutionarily titratable strategy.

  19. Building a model: developing genomic resources for common milkweed (Asclepias syriaca with low coverage genome sequencing

    Directory of Open Access Journals (Sweden)

    Weitemier Kevin

    2011-05-01

    Full Text Available Abstract Background Milkweeds (Asclepias L. have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L. could be useful in characterizing the genome of a plant without prior genomic information and for development of genomic resources as a step toward further developing A. syriaca as a model in ecology and evolution. Results A 0.5× genome of A. syriaca was produced using Illumina sequencing. A virtually complete chloroplast genome of 158,598 bp was assembled, revealing few repeats and loss of three genes: accD, clpP, and ycf1. A nearly complete rDNA cistron (18S-5.8S-26S; 7,541 bp and 5S rDNA (120 bp sequence were obtained. Assessment of polymorphism revealed that the rDNA cistron and 5S rDNA had 0.3% and 26.7% polymorphic sites, respectively. A partial mitochondrial genome sequence (130,764 bp, with identical gene content to tobacco, was also assembled. An initial characterization of repeat content indicated that Ty1/copia-like retroelements are the most common repeat type in the milkweed genome. At least one A. syriaca microread hit 88% of Catharanthus roseus (Apocynaceae unigenes (median coverage of 0.29× and 66% of single copy orthologs (COSII in asterids (median coverage of 0.14×. From this partial characterization of the A. syriaca genome, markers for population genetics (microsatellites and phylogenetics (low-copy nuclear genes studies were developed. Conclusions The results highlight the promise of next generation sequencing for development of genomic resources for any organism. Low coverage genome sequencing allows characterization of the high copy fraction of the genome and exploration of the low copy fraction of the genome, which facilitate the development of molecular tools for further study of a target species

  20. Building a model: developing genomic resources for common milkweed (Asclepias syriaca) with low coverage genome sequencing.

    Science.gov (United States)

    Straub, Shannon C K; Fishbein, Mark; Livshultz, Tatyana; Foster, Zachary; Parks, Matthew; Weitemier, Kevin; Cronn, Richard C; Liston, Aaron

    2011-05-04

    Milkweeds (Asclepias L.) have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L.) could be useful in characterizing the genome of a plant without prior genomic information and for development of genomic resources as a step toward further developing A. syriaca as a model in ecology and evolution. A 0.5× genome of A. syriaca was produced using Illumina sequencing. A virtually complete chloroplast genome of 158,598 bp was assembled, revealing few repeats and loss of three genes: accD, clpP, and ycf1. A nearly complete rDNA cistron (18S-5.8S-26S; 7,541 bp) and 5S rDNA (120 bp) sequence were obtained. Assessment of polymorphism revealed that the rDNA cistron and 5S rDNA had 0.3% and 26.7% polymorphic sites, respectively. A partial mitochondrial genome sequence (130,764 bp), with identical gene content to tobacco, was also assembled. An initial characterization of repeat content indicated that Ty1/copia-like retroelements are the most common repeat type in the milkweed genome. At least one A. syriaca microread hit 88% of Catharanthus roseus (Apocynaceae) unigenes (median coverage of 0.29×) and 66% of single copy orthologs (COSII) in asterids (median coverage of 0.14×). From this partial characterization of the A. syriaca genome, markers for population genetics (microsatellites) and phylogenetics (low-copy nuclear genes) studies were developed. The results highlight the promise of next generation sequencing for development of genomic resources for any organism. Low coverage genome sequencing allows characterization of the high copy fraction of the genome and exploration of the low copy fraction of the genome, which facilitate the development of molecular tools for further study of a target species and its relatives. This study represents a first

  1. Cardenolides, induced responses, and interactions between above- and belowground herbivores of milkweed (Asclepias spp.).

    Science.gov (United States)

    Rasmann, Sergio; Agrawal, Anurag A; Cook, Susan C; Erwin, Alexis C

    2009-09-01

    Theory has long predicted allocation patterns for plant defense against herbivory, but only recently have both above- and belowground plant defenses been considered simultaneously. Milkweeds in the genus Asclepias are a classic chemically defended clade of plants with toxic cardenolides (cardiac glycosides) and pressurized latex employed as anti-herbivore weapons. Here we combine a comparative approach to investigate broadscale patterns in allocation to root vs. shoot defenses across species with a species-specific experimental approach to identify the consequences of defense allocational shifts on a specialist herbivore. Our results show phylogenetic conservatism for inducibility of shoot cardenolides by an aboveground herbivore, with only four closely related tropical species showing significant induction; the eight temperate species examined were not inducible. Allocation to root and shoot cardenolides was positively correlated across species, and this relationship was maintained after accounting for phylogenetic nonindependence. In contrast to long-standing theoretical predictions, we found no evidence for a trade-off between constitutive and induced cardenolides; indeed the two were positively correlated across species in both roots and shoots. Finally, specialist root and shoot herbivores of common milkweed (A. syriaca) had opposing effects on latex production, and these effects had consequences for caterpillar growth consistent with latex providing resistance. Although cardenolides were not affected by our treatments, A. syriaca allocated 40% more cardenolides to shoots over roots. We conclude that constitutive and inducible defenses are not trading off across plant species, and shoots of Asclepias are more inducible than roots. Phylogenetic conservatism cannot explain the observed patterns of cardenolide levels across species, but inducibility per se was conserved in a tropical clade. Finally, given that above- and belowground herbivores can systemically

  2. Phylogenetic trends in phenolic metabolism of milkweeds (Asclepias): evidence for escalation.

    Science.gov (United States)

    Agrawal, Anurag A; Salminen, Juha-Pekka; Fishbein, Mark

    2009-03-01

    Although plant-defense theory has long predicted patterns of chemical defense across taxa, we know remarkably little about the evolution of defense, especially in the context of directional phylogenetic trends. Here we contrast the production of phenolics and cardenolides in 35 species of milkweeds (Asclepias and Gomphocarpus). Maximum-likelihood analyses of character evolution revealed three major patterns. First, consistent with the defense-escalation hypothesis, the diversification of the milkweeds was associated with a trend for increasing phenolic production; this pattern was reversed (a declining evolutionary trend) for cardenolides, toxins sequestered by specialist herbivores. Second, phylogenetically independent correlations existed among phenolic classes across species. For example, coumaric acid derivatives showed negatively correlated evolution with caffeic acid derivatives, and this was likely driven by the fact that the former are used as precursors for the latter. In contrast, coumaric acid derivatives were positively correlated with flavonoids, consistent with competition for the precursor p-coumaric acid. Finally, of the phenolic classes, only flavonoids showed correlated evolution (positive) with cardenolides, consistent with a physiological and evolutionary link between the two via malonate. Thus, this study presents a rigorous test of the defense-escalation hypothesis and a novel phylogenetic approach to understanding the long-term persistence of physiological constraints on secondary metabolism.

  3. GEOMORPHOLOGICAL ECOGEOGRAPHICAL VARIABLES DEFINIG FEATURES OF ECOLOGICAL NICHE OF COMMON MILKWEED (ASCLEPIAS SYRIACA L.

    Directory of Open Access Journals (Sweden)

    O. M. Kunah

    2016-04-01

    Full Text Available The role of geomorphological ecogeographical variables have been shown, which are received by means of the digital elevation model created on the basis of remote sensing data as markers of an ecological niche of weeds on an example common milkweed (Asclepias syriaca L.. The research range chooses territory which is in settlement Vovnjanka district (the Poltava region. The range has the linear sizes of 26 kilometres in a direction from the east on the west and 15 kilometres in a direction from the north on the south, the range total area makes 390 км2. As geomorphological variables the topographical wetness index, topographic position index, mass balance index, erosion LS-factor, direct and disseminated insolation, altitude above channel network, multiresolution valley bottom flatness, multiresolution ridge top flatness index, vector ruggedness measure have been considered. It is established, that on set of the geomorphological indicators received by means of digital model of a relief, it is possible to assert, that within a separate agricultural field a wide variety of microconditions which is caused by relief features is formed. Possibly, the variation of thermal and water modes, moisture redistribution, and also productivity mechanical processings of soil and efforts under the control of number of weeds make a background in which limits there is possible a moving of weed plants, including common milkweed.

  4. Impairment of leaf photosynthesis after insect herbivory or mechanical injury on common milkweed, Asclepias syriaca.

    Science.gov (United States)

    Delaney, K J; Haile, F J; Peterson, R K D; Higley, L G

    2008-10-01

    Insect herbivory has variable consequences on plant physiology, growth, and reproduction. In some plants, herbivory reduces photosynthetic rate (Pn) activity on remaining tissue of injured leaves. We sought to better understand the influence of leaf injury on Pn of common milkweed, Asclepias syriaca (Asclepiadaceae), leaves. Initially, we tested whether Pn reductions occurred after insect herbivory or mechanical injury. We also (1) examined the duration of photosynthetic recovery, (2) compared mechanical injury with insect herbivory, (3) studied the relationship between leaf Pn with leaf injury intensity, and (4) considered uninjured leaf compensatory Pn responses neighboring an injured leaf. Leaf Pn was significantly reduced on mechanically injured or insect-fed leaves in all reported experiments except one, so some factor(s) (cardiac glycoside induction, reproductive investment, and water stress) likely interacts with leaf injury to influence whether Pn impairment occurs. Milkweed tussock moth larval herbivory, Euchaetes egle L. (Arctiidae), impaired leaf Pn more severely than mechanical injury in one experiment. Duration of Pn impairment lasted > 5 d to indicate high leaf Pn sensitivity to injury, but Pn recovery occurred within 13 d in one experiment. The degree of Pn reduction was more severe from E. egle herbivory than similar levels of mechanical tissue removal. Negative linear relationships characterized leaf Pn with percentage tissue loss from single E. egle-fed leaves and mechanically injured leaves and suggested that the signal to trigger leaf Pn impairment on remaining tissue of an injured leaf was amplified by additional tissue loss. Finally, neighboring uninjured leaves to an E. egle-fed leaf had a small (approximately 10%) degree of compensatory Pn to partly offset tissue loss and injured leaf Pn impairment.

  5. Different rates of defense evolution and niche preferences in clonal and nonclonal milkweeds (Asclepias spp.).

    Science.gov (United States)

    Pellissier, Loïc; Litsios, Glenn; Fishbein, Mark; Salamin, Nicolas; Agrawal, Anurag A; Rasmann, Sergio

    2016-02-01

    Given the dual role of many plant traits to tolerate both herbivore attack and abiotic stress, the climatic niche of a species should be integrated into the study of plant defense strategies. Here we investigate the impact of plant reproductive strategy and components of species' climatic niche on the rate of chemical defense evolution in the milkweeds using a common garden experiment of 49 species. We found that across Asclepias species, clonal reproduction repeatedly evolved in lower temperature conditions, in species generally producing low concentrations of a toxic defense (cardenolides). Additionally, we found that rates of cardenolide evolution were lower for clonal than for nonclonal species. We thus conclude that because the clonal strategy is based on survival, long generation times, and is associated with tolerance of herbivory, it may be an alternative to toxicity in colder ecosystems. Taken together, these results indicate that the rate of chemical defense evolution is influenced by the intersection of life-history strategy and climatic niches into which plants radiate. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

  6. Differential pollinator effectiveness and importance in a milkweed (Asclepias, Apocynaceae) hybrid zone.

    Science.gov (United States)

    Stoepler, Teresa M; Edge, Andrea; Steel, Anna; O'Quinn, Robin L; Fishbein, Mark

    2012-03-01

    Exceptions to the ideal of complete reproductive isolation between species are commonly encountered in diverse plant, animal, and fungal groups, but often the causative ecological processes are poorly understood. In flowering plants, the outcome of hybridization depends in part on the effectiveness of pollinators in interspecific pollen transport. In the Asclepias exaltata and A. syriaca (Apocynaceae) hybrid zone in Shenandoah National Park, Virginia, extensive introgression has been documented. The objectives of this study were to (1) determine the extent of pollinator overlap among A. exaltata, A. syriaca, and their hybrids and (2) identify the insect taxa responsible for hybridization and introgression. We observed focal plants of parental species and hybrids to measure visitation rate, visit duration, and per-visit pollinia removal and deposition, and we calculated pollinator effectiveness and importance. Visitation rates varied significantly between the 2 yr of the study. Overall, Apis mellifera, Bombus sp., and Epargyreus clarus were the most important pollinators. However, Bombus sp. was the only visitor that was observed to both remove and insert pollinia for both parent species as well as hybrids. We conclude that Bombus may be a key agent of hybridization and introgression in these sympatric milkweed populations, and hybrids are neither preferred nor selected against by pollinators. Thus, we have identified a potential mechanism for how hybrids act as bridges to gene flow between A. exaltata and A. syriaca. These results provide insights into the breakdown of prezygotic isolating mechanisms.

  7. Temporal patterns of foliar ozone symptoms on tall milkweed (Asclepias exaltata L.) in Great Smoky Mountains National Park.

    Science.gov (United States)

    Chappelka, A H; Somers, G L; Renfro, J R

    2007-10-01

    Incidence and severity of ozone-induced foliar symptoms on tall milkweed (Asclepias exaltata L.) along selected trails in Great Smoky Mountains National Park (GRSM) were determined by two surveys/season conducted from 1992 through 1996. Overall incidence was 73%, and was 84%, 44%, 90%, 58%, and 82% for 1992-1996, respectively for the same clusters. Average incidence was 61% and 84% for the 1st and 2nd surveys, respectively. Seasonal comparisons showed two distinct injury groupings regarding incidence and severity of injury: 1992, 1994 and 1996 (high injury); 1993 and 1995 (low injury). No discernible patterns were observed between symptomatic and asymptomatic plants regarding height, herbivory or flowering. Regression analyses indicated no differentiation in foliar symptoms regarding topographic position, aspect, slope or elevation over the 5-year study period. Our findings indicate other micro-site or genetic factors may control ozone sensitivity of tall milkweed in GRSM.

  8. Temporal patterns of foliar ozone symptoms on tall milkweed (Asclepias exaltata L.) in Great Smoky Mountains National Park

    International Nuclear Information System (INIS)

    Chappelka, A.H.; Somers, G.L.; Renfro, J.R.

    2007-01-01

    Incidence and severity of ozone-induced foliar symptoms on tall milkweed (Asclepias exaltata L.) along selected trails in Great Smoky Mountains National Park (GRSM) were determined by two surveys/season conducted from 1992 through 1996. Overall incidence was 73%, and was 84%, 44%, 90%, 58%, and 82% for 1992-1996, respectively for the same clusters. Average incidence was 61% and 84% for the 1st and 2nd surveys, respectively. Seasonal comparisons showed two distinct injury groupings regarding incidence and severity of injury: 1992, 1994 and 1996 (high injury); 1993 and 1995 (low injury). No discernible patterns were observed between symptomatic and asymptomatic plants regarding height, herbivory or flowering. Regression analyses indicated no differentiation in foliar symptoms regarding topographic position, aspect, slope or elevation over the 5-year study period. Our findings indicate other micro-site or genetic factors may control ozone sensitivity of tall milkweed in GRSM. - Ground-level ozone has the potential to cause deleterious effects to tall milkweed growing in Great Smoky Mountains National Park

  9. Temporal patterns of foliar ozone symptoms on tall milkweed (Asclepias exaltata L.) in Great Smoky Mountains National Park

    Energy Technology Data Exchange (ETDEWEB)

    Chappelka, A.H. [School of Forestry and Wildlife Sciences, Auburn University, Auburn, AL 36849 (United States)], E-mail: chappah@auburn.edu; Somers, G.L. [School of Forestry and Wildlife Sciences, Auburn University, Auburn, AL 36849 (United States); Renfro, J.R. [USDI National Park Service, Resource Management and Science Division, Great Smoky Mountains National Park, Gatlinburg, TN 37738 (United States)

    2007-10-15

    Incidence and severity of ozone-induced foliar symptoms on tall milkweed (Asclepias exaltata L.) along selected trails in Great Smoky Mountains National Park (GRSM) were determined by two surveys/season conducted from 1992 through 1996. Overall incidence was 73%, and was 84%, 44%, 90%, 58%, and 82% for 1992-1996, respectively for the same clusters. Average incidence was 61% and 84% for the 1st and 2nd surveys, respectively. Seasonal comparisons showed two distinct injury groupings regarding incidence and severity of injury: 1992, 1994 and 1996 (high injury); 1993 and 1995 (low injury). No discernible patterns were observed between symptomatic and asymptomatic plants regarding height, herbivory or flowering. Regression analyses indicated no differentiation in foliar symptoms regarding topographic position, aspect, slope or elevation over the 5-year study period. Our findings indicate other micro-site or genetic factors may control ozone sensitivity of tall milkweed in GRSM. - Ground-level ozone has the potential to cause deleterious effects to tall milkweed growing in Great Smoky Mountains National Park.

  10. Specificity of herbivore-induced hormonal signaling and defensive traits in five closely related milkweeds (Asclepias spp.).

    Science.gov (United States)

    Agrawal, Anurag A; Hastings, Amy P; Patrick, Eamonn T; Knight, Anna C

    2014-07-01

    Despite the recognition that phytohormonal signaling mediates induced responses to herbivory, we still have little understanding of how such signaling varies among closely related species and may generate herbivore-specific induced responses. We studied closely related milkweeds (Asclepias) to link: 1) plant damage by two specialist chewing herbivores (milkweed leaf beetles Labidomera clivicolis and monarch caterpillars Danaus plexippus); 2) production of the phytohormones jasmonic acid (JA), salicylic acid (SA), and abscisic acid (ABA); 3) induction of defensive cardenolides and latex; and 4) impacts on Danaus caterpillars. We first show that A. syriaca exhibits induced resistance following monarch herbivory (i.e., reduced monarch growth on previously damaged plants), while the defensively dissimilar A. tuberosa does not. We next worked with a broader group of five Asclepias, including these two species, that are highly divergent in defensive traits yet from the same clade. Three of the five species showed herbivore-induced changes in cardenolides, while induced latex was found in four species. Among the phytohormones, JA and ABA showed specific responses (although they generally increased) to insect species and among the plant species. In contrast, SA responses were consistent among plant and herbivore species, showing a decline following herbivore attack. Jasmonic acid showed a positive quantitative relationship only with latex, and this was strongest in plants damaged by D. plexippus. Although phytohormones showed qualitative tradeoffs (i.e., treatments that enhanced JA reduced SA), the few significant individual plant-level correlations among hormones were positive, and these were strongest between JA and ABA in monarch damaged plants. We conclude that: 1) latex exudation is positively associated with endogenous JA levels, even among low-latex species; 2) correlations among milkweed hormones are generally positive, although herbivore damage induces a

  11. Effects of seed preparation and oil pressing on milkweed (Asclepias spp.) protein functional properties

    Science.gov (United States)

    The effects of seed cooking and oil processing conditions on functional properties of milkweed seed proteins were determined to identify potential value-added uses for the meal. Milkweed seeds were flaked and then cooked in the seed conditioner at 82°C for 30, 60 or 90 min. Oil was extracted by scre...

  12. Seasonal development of ozone-induced foliar injury on tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park.

    Science.gov (United States)

    Souza, Lara; Neufeld, Howard S; Chappelka, Arthur H; Burkey, Kent O; Davison, Alan W

    2006-05-01

    The goals of this study were to document the development of ozone-induced foliar injury, on a leaf-by-leaf basis, and to develop ozone exposure relationships for leaf cohorts and individual tall milkweeds (Asclepias exaltata L.) in Great Smoky Mountains National Park. Plants were classified as either ozone-sensitive or insensitive based on the amount of foliar injury. Sensitive plants developed injury earlier in the season and to a greater extent than insensitive plants. Older leaf cohorts were more likely to belong to high injury classes by the end of each of the two growing seasons. In addition, leaf loss was more likely for older cohorts (2000) and lower leaf positions (2001) than younger cohorts and upper leaves, respectively. Most leaves abscised without prior ozone-like stippling or chlorosis. Failure to take this into account can result in underestimation of the effects of ozone on these plants.

  13. Seasonal and diurnal gas exchange differences in ozone-sensitive common milkweed (Asclepias syriaca L.) in relation to ozone uptake.

    Science.gov (United States)

    Bergweiler, Chris; Manning, William J; Chevone, Boris I

    2008-03-01

    Stomatal conductance and net photosynthesis of common milkweed (Asclepias syriaca L.) plants in two different soil moisture regimes were directly quantified and subsequently modeled over an entire growing season. Direct measurements captured the dynamic response of stomatal conductance to changing environmental conditions throughout the day, as well as declining gas exchange and carbon assimilation throughout the growth period beyond an early summer maximum. This phenomenon was observed in plants grown both with and without supplemental soil moisture, the latter of which should theoretically mitigate against harmful physiological effects caused by exposure to ozone. Seasonally declining rates of stomatal conductance were found to be substantial and incorporated into models, making them less susceptible to the overestimations of effective exposure that are an inherent source of error in ozone exposure indices. The species-specific evidence presented here supports the integration of dynamic physiological processes into flux-based modeling approaches for the prediction of ozone injury in vegetation.

  14. Attenuation of the jasmonate burst, plant defensive traits, and resistance to specialist monarch caterpillars on shaded common milkweed (Asclepias syriaca).

    Science.gov (United States)

    Agrawal, Anurag A; Kearney, Emily E; Hastings, Amy P; Ramsey, Trey E

    2012-07-01

    Plant responses to herbivory and light competition are often in opposing directions, posing a potential conflict for plants experiencing both stresses. For sun-adapted species, growing in shade typically makes plants more constitutively susceptible to herbivores via reduced structural and chemical resistance traits. Nonetheless, the impact of light environment on induced resistance has been less well-studied, especially in field experiments that link physiological mechanisms to ecological outcomes. Accordingly, we studied induced resistance of common milkweed (Asclepias syriaca, a sun-adapted plant), and linked hormonal responses, resistance traits, and performance of specialist monarch caterpillars (Danaus plexippus) in varying light environments. In natural populations, plants growing under forest-edge shade showed reduced levels of resistance traits (lower leaf toughness, cardenolides, and trichomes) and enhanced light-capture traits (higher specific leaf area, larger leaves, and lower carbon-to-nitrogen ratio) compared to paired plants in full sun. In a field experiment repeated over two years, only milkweeds growing in full sun exhibited induced resistance to monarchs, whereas plants growing in shade were constitutively more susceptible and did not induce resistance. In a more controlled field experiment, plant hormones were higher in the sun (jasmonic acid, salicylic acid, abscisic acid, indole acidic acid) and were induced by herbivory (jasmonic acid and abscisic acid). In particular, the jasmonate burst following herbivory was halved in plants raised in shaded habitats, and this correspondingly reduced latex induction (but not cardenolide induction). Thus, we provide a mechanistic basis for the attenuation of induced plant resistance in low resource environments. Additionally, there appears to be specificity in these interactions, with light-mediated impacts on jasmonate-induction being stronger for latex exudation than cardenolides.

  15. PHYSICOCHEMICAL PROPERTIES OF THE PROTEOLYTIC ENZYME FROM THE LATEX OF THE MILKWEED, ASCLEPIAS SPECIOSA TORR. SOME COMPARISONS WITH OTHER PROTEASES

    Science.gov (United States)

    Winnick, Theodore; Davis, Alva R.; Greenberg, David M.

    1940-01-01

    1. A study has been made of the properties of a hitherto unreported proteolytic enzyme from the latex of the milkweed, Asclepias speciosa. The new protease has been named asclepain by the authors. 2. The results of chemical, diffusion, and denaturation tests indicate that asclepain is a protein. 3. Like papain, asclepain dots milk and digests most proteins, particularly if they are dissolved in concentrated urea solution. Unlike papain, asclepain did not clot blood. 4. The activation and inhibition phenomena of asclepain resemble those of papain, and seem best explained on the assumption that free sulfhydryl in the enzyme is necessary for proteolytic activity. The sulfhydryl of asclepain appears more labile than that of papain. 5. The measurement of pH-activity curves of asclepain on casein, ovalbumin, hemoglobin, edestin, and ovovitellin showed no definite digestion maxima for most of the undenatured proteins, while in urea solution there were well defined maxima near pH 7.0. Native hemoglobin and ovovitellin were especially undigestible, while native casein was rapidly attacked. 6. Temperature-activity curves were determined for asclepain on hemoglobin, casein, and milk solutions. The optimum temperature was shown to increase with decreasing time of digestion. PMID:19873154

  16. Seasonal development of ozone-induced foliar injury on tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park

    International Nuclear Information System (INIS)

    Souza, Lara; Neufeld, Howard S.; Chappelka, Arthur H.; Burkey, Kent O.; Davison, Alan W.

    2006-01-01

    The goals of this study were to document the development of ozone-induced foliar injury, on a leaf-by-leaf basis, and to develop ozone exposure relationships for leaf cohorts and individual tall milkweeds (Asclepias exaltata L.) in Great Smoky Mountains National Park. Plants were classified as either ozone-sensitive or insensitive based on the amount of foliar injury. Sensitive plants developed injury earlier in the season and to a greater extent than insensitive plants. Older leaf cohorts were more likely to belong to high injury classes by the end of each of the two growing seasons. In addition, leaf loss was more likely for older cohorts (2000) and lower leaf positions (2001) than younger cohorts and upper leaves, respectively. Most leaves abscised without prior ozone-like stippling or chlorosis. Failure to take this into account can result in underestimation of the effects of ozone on these plants. - Leaf loss was not necessarily accompanied by symptoms of foliar ozone injury

  17. Seasonal development of ozone-induced foliar injury on tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Lara [Department of Biology, 572 Rivers Street, Appalachian State University, Boone, NC 28608 (United States)]. E-mail: lsouza@utk.edu; Neufeld, Howard S. [Department of Biology, 572 Rivers Street, Appalachian State University, Boone, NC 28608 (United States); Chappelka, Arthur H. [School of Forestry and Wildlife Sciences, 108 M White-Smith Hall, Auburn University, Auburn, AL 36849 (United States); Burkey, Kent O. [US Department of Agriculture, Agricultural Research Service, Plant Science Research Unit and Department of Crop Science, North Carolina State University, 3908 Inwood Road, Raleigh, NC 26703 (United States); Davison, Alan W. [School of Biology, Ridley Building, University of Newcastle, Newcastle Upon Tyne, NE1 7RU (United Kingdom)

    2006-05-15

    The goals of this study were to document the development of ozone-induced foliar injury, on a leaf-by-leaf basis, and to develop ozone exposure relationships for leaf cohorts and individual tall milkweeds (Asclepias exaltata L.) in Great Smoky Mountains National Park. Plants were classified as either ozone-sensitive or insensitive based on the amount of foliar injury. Sensitive plants developed injury earlier in the season and to a greater extent than insensitive plants. Older leaf cohorts were more likely to belong to high injury classes by the end of each of the two growing seasons. In addition, leaf loss was more likely for older cohorts (2000) and lower leaf positions (2001) than younger cohorts and upper leaves, respectively. Most leaves abscised without prior ozone-like stippling or chlorosis. Failure to take this into account can result in underestimation of the effects of ozone on these plants. - Leaf loss was not necessarily accompanied by symptoms of foliar ozone injury.

  18. Seasonal and diurnal gas exchange differences in ozone-sensitive common milkweed (Asclepias syriaca L.) in relation to ozone uptake

    International Nuclear Information System (INIS)

    Bergweiler, Chris; Manning, William J.; Chevone, Boris I.

    2008-01-01

    Stomatal conductance and net photosynthesis of common milkweed (Asclepias syriaca L.) plants in two different soil moisture regimes were directly quantified and subsequently modeled over an entire growing season. Direct measurements captured the dynamic response of stomatal conductance to changing environmental conditions throughout the day, as well as declining gas exchange and carbon assimilation throughout the growth period beyond an early summer maximum. This phenomenon was observed in plants grown both with and without supplemental soil moisture, the latter of which should theoretically mitigate against harmful physiological effects caused by exposure to ozone. Seasonally declining rates of stomatal conductance were found to be substantial and incorporated into models, making them less susceptible to the overestimations of effective exposure that are an inherent source of error in ozone exposure indices. The species-specific evidence presented here supports the integration of dynamic physiological processes into flux-based modeling approaches for the prediction of ozone injury in vegetation. - Temporal variation in physiological processes underlying diurnal and seasonal ozone uptake are described for a key ozone bioindicator species of North America

  19. Seasonal and diurnal gas exchange differences in ozone-sensitive common milkweed (Asclepias syriaca L.) in relation to ozone uptake

    Energy Technology Data Exchange (ETDEWEB)

    Bergweiler, Chris [Department of Plant, Soil, and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)], E-mail: bergweiler@nre.umass.edu; Manning, William J. [Department of Plant, Soil, and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States); Chevone, Boris I. [Department of Plant Pathology, Physiology, and Weed Science, Virginia Polytechnic Institute and State University, Blacksburg, VA 24061 (United States)

    2008-03-15

    Stomatal conductance and net photosynthesis of common milkweed (Asclepias syriaca L.) plants in two different soil moisture regimes were directly quantified and subsequently modeled over an entire growing season. Direct measurements captured the dynamic response of stomatal conductance to changing environmental conditions throughout the day, as well as declining gas exchange and carbon assimilation throughout the growth period beyond an early summer maximum. This phenomenon was observed in plants grown both with and without supplemental soil moisture, the latter of which should theoretically mitigate against harmful physiological effects caused by exposure to ozone. Seasonally declining rates of stomatal conductance were found to be substantial and incorporated into models, making them less susceptible to the overestimations of effective exposure that are an inherent source of error in ozone exposure indices. The species-specific evidence presented here supports the integration of dynamic physiological processes into flux-based modeling approaches for the prediction of ozone injury in vegetation. - Temporal variation in physiological processes underlying diurnal and seasonal ozone uptake are described for a key ozone bioindicator species of North America.

  20. Study on the seed production and germination dynamic of common milkweed (Asclepias syriaca L.).

    Science.gov (United States)

    Sárkány, S E; Lehoczky, E; Nagy, P

    2008-01-01

    The common milkweed causes considerable damages on the agricultural and nature conservation areas. The area occupied by this weed is continuously bigger. The common milkweed is spread over North-America between the 35th and 50th degree of western Latitude and 60th 103rd degree of longitude. Millions of hectares are polluted by this weed in the United States. Important is its spread also in Asia (Iraq), in Europe (Carpathian Basin, Poland, Bulgaria, Switzerland, France, Austria, Germany), as well as in the area of the former Soviet Union (Belorussia, The Baltic Countries, Caucasus, and the Ukraine). Though the basic biological characters of this plant are well known, still its control is a significant problem, the damages increase on the areas occupied by this weed. We collect seed samples from several Hungarian areas in 2007. After the sampling we determined the average sprout length and the number of follicle as well as the average seed numbers in the follicle. We determined also the weight of thousand seeds of the resultant seed samples. At natural circumstances the seedlings appear at a soil temperature of 15 degrees C during the end of April and first week of May. Under Laboratory circumstances the dormancy of the seeds ceases continuously from November on, germinate at a temperature of 20-30 degrees C, the maximum germination can be achieved in the first part of April. At January we started germination examinations with the seeds in Petri dish, among laboratory condition.

  1. Population differences in self-fertility in the "self-incompatible" milkweed Asclepias exaltata (Asclepiadaceae).

    Science.gov (United States)

    Lipow, S R; Broyles, S B; Wyatt, R

    1999-08-01

    Individual plants of Asclepias exaltata (Asclepiadaceae) typically express an unusual self-incompatibility system under single-gene control. Hand-pollinations performed in six natural populations detected occasional self-fertile plants. The frequency of self-fertile individuals ranged from 0 to 34.0% and differed significantly among populations. Self-fertility appears to be under genetic control, as the ability of most plants (80.0 %) to set fruit following self-pollinations was identical under natural and greenhouse conditions. Seed- and fruit-set, however, were significantly lower from self- vs. cross-pollinations. Allozyme analysis of the population with the highest frequency of self-fertility revealed that adult plants were not significantly inbred. Finally, fruit-set following within-population cross-pollinations did not differ from that following wide, between-population cross-pollinations.

  2. Single gene control of postzygotic self-incompatibility in poke milkweed, Asclepias exaltata L.

    Science.gov (United States)

    Lipow, S R; Wyatt, R

    2000-02-01

    Most individuals of Asclepias exaltata are self-sterile, but all plants lack prezygotic barriers to self-fertilization. To determine whether postzygotic rejection of self-fertilized ovules is due to late-acting self-incompatibility or to extreme, early acting inbreeding depression, we performed three diallel crosses among self-sterile plants related as full-sibs. The full-sibs segregated into four compatibility classes, suggesting that late acting self-incompatibility is controlled by a single gene (S-locus). Crosses between plants sharing one or both alleles at the S-locus are incompatible. An additional diallel cross was done among full-sib progeny from a cross of a self-sterile and a self-fertile plant. These progeny grouped into two compatibility classes, and plants within classes displayed varying levels of self-fertility. This suggests that the occasional self-fertility documented in natural pollinations is caused by pseudo-self-fertility alleles that alter the functioning of the S-locus.

  3. Single gene control of postzygotic self-incompatibility in poke milkweed, Asclepias exaltata L.

    Science.gov (United States)

    Lipow, S R; Wyatt, R

    2000-01-01

    Most individuals of Asclepias exaltata are self-sterile, but all plants lack prezygotic barriers to self-fertilization. To determine whether postzygotic rejection of self-fertilized ovules is due to late-acting self-incompatibility or to extreme, early acting inbreeding depression, we performed three diallel crosses among self-sterile plants related as full-sibs. The full-sibs segregated into four compatibility classes, suggesting that late acting self-incompatibility is controlled by a single gene (S-locus). Crosses between plants sharing one or both alleles at the S-locus are incompatible. An additional diallel cross was done among full-sib progeny from a cross of a self-sterile and a self-fertile plant. These progeny grouped into two compatibility classes, and plants within classes displayed varying levels of self-fertility. This suggests that the occasional self-fertility documented in natural pollinations is caused by pseudo-self-fertility alleles that alter the functioning of the S-locus. PMID:10655239

  4. Evaluation of ozone injury on foliage of black cherry (Prunus serotina) and tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park.

    Science.gov (United States)

    Chappelka, A; Renfro, J; Somers, G; Nash, B

    1997-01-01

    The incidence and severity of visible foliar ozone injury on black cherry (Prunus serotina) seedlings and saplings and tall milkweed (Asclepias exaltata) plants in Great Smoky Mountains National Park (GRSM) were determined by surveys along selected trails conducted during late summer 1992. The incidence (% injured plants) of ozone injury on black cherry was 47% and the percent injured leaves/injured plant and average leaf area injured were 43 and 6%, respectively. Maximum severity (avg. leaf area of the most severely injured leaf) was 12%. Black cherry seedlings and saplings exhibiting ozone injury were taller than non-injured plants. When insect feeding was present, it occurred 96% of the time on plants with ozone injury. Significantly more injury (p=0.007) on black cherry (% injured leaves/injured black cherry) occurred in the NW section of GRSM compared with the other Park sections. Regression analyses showed no relationships in ozone injury with respect to aspect, slope or elevation. Tall milkweed was evaluated twice during August for ozone injury. The incidence (% injured plants) of ozone injury was 74 and 79% for the first and second survey, respectively. The percentage of injured leaves per plant from the first to second survey was 63 to 79%, respectively. Tall milkweeds showing ozone injury were taller than the non-injured plants. The percentage of insect-damaged plants was 50% among plants without ozone injury and 60% among ozone-injured plants. Non-injured tall milkweed had fewer flowers and/or pods than the injured plants. Mean leaf area injured increased over time, and mean maximum leaf area injured increased from 8 to 11% during the same period. Regression analyses showed no differences in ozone injury regarding aspect, slope or elevation. Our findings indicate that ozone injury is widespread throughout the Park on sensitive vegetation.

  5. Self-pollination rate and floral-display size in Asclepias syriaca (Common Milkweed) with regard to floral-visitor taxa.

    Science.gov (United States)

    Howard, Aaron F; Barrows, Edward M

    2014-06-23

    Animals fertilize thousands of angiosperm species whose floral-display sizes can significantly influence pollinator behavior and plant reproductive success. Many studies have measured the interactions among pollinator behavior, floral-display size, and plant reproductive success, but few studies have been able to separate the effects of pollinator behavior and post-pollination processes on angiosperm sexual reproduction. In this study, we utilized the highly self-incompatible pollinium-pollination system of Asclepias syriaca (Common Milkweed) to quantify how insect visitors influenced male reproductive success measured as pollen removal, female reproductive success measured as pollen deposition, and self-pollination rate. We also determined how floral-display size impacts both visitor behavior and self-pollination rate. Four insect taxonomic orders visited A. syriaca: Coleoptera, Diptera, Hymenoptera, and Lepidoptera. We focused on three groups of visitor taxa within two orders (Hymenoptera and Lepidoptera) with sample sizes large enough for quantitative analysis: Apis mellifera (Western Honey Bee), Bombus spp. (bumble bees) and lepidopterans (butterflies and moths). Qualitatively, lepidopterans had the highest pollinator importance values, but the large variability in the lepidopteran data precluded meaningful interpretation of much of their behavior. The introduced A. mellifera was the most effective and most important diurnal pollinator with regard to both pollen removal and pollen deposition. However, when considering the self-incompatibility of A. syriaca, A. mellifera was not the most important pollinator because of its high self-pollination rate as compared to Bombus spp. Additionally, the rate of self-pollination increased more rapidly with the number of flowers per inflorescence in A. mellifera than in the native Bombus spp. Apis mellifera's high rate of self-pollination may have significant negative effects on both male and female reproductive successes

  6. PHYSICOCHEMICAL PROPERTIES OF THE PROTEOLYTIC ENZYME FROM THE LATEX OF THE MILKWEED, ASCLEPIAS SPECIOSA TORR. SOME COMPARISONS WITH OTHER PROTEASES

    Science.gov (United States)

    Winnick, Theodore; Davis, Alva R.; Greenberg, David M.

    1940-01-01

    1. The kinetics of milk clotting by asclepain, the protease of Asclepias speciosa, were investigated. At higher concentrations of enzyme, the clotting time was inversely proportional to the enzyme concentration. 2. The digestion of casein and hemoglobin in 6.6 M urea by asclepain follows the second order reaction rate. The rate was roughly second order for casein in water. 3. Evaluation of the nature of the enzyme-substrate intermediate indicates that one molecule of asclepain combines with one molecule of casein or hemoglobin in urea solution. 4. Inhibition by the reaction products was deduced from the fact that the digestion velocity of hemoglobin in urea solution varied with the asclepain concentration in agreement with the Schütz-Borissov rule. PMID:19873155

  7. Learning in two butterfly species when using flowers of the tropical milkweed Asclepias curassavica: No benefits for pollination.

    Science.gov (United States)

    Ramos, Bruna de Cássia Menezes; Rodríguez-Gironés, Miguel Angel; Rodrigues, Daniela

    2017-08-08

    The ability of insect visitors to learn to manipulate complex flowers has important consequences for foraging efficiency and plant fitness. We investigated learning by two butterfly species, Danaus erippus and Heliconius erato , as they foraged on the complex flowers of Asclepias curassavica , as well as the consequences for pollination. To examine learning with respect to flower manipulation, butterflies were individually tested during four consecutive days under insectary conditions. At the end of each test, we recorded the number of pollinaria attached to the body of each butterfly and scored visited flowers for numbers of removed and inserted pollinia. We also conducted a field study to survey D. erippus and H. erato visiting flowers of A. curassavica , as well as to record numbers of pollinaria attached to the butterflies' bodies, and surveyed A. curassavica plants in the field to inspect flowers for pollinium removal and insertion. Learning improves the ability of both butterfly species to avoid the nonrewarding flower parts and to locate nectar more efficiently. There were no experience effects, for either species, on the numbers of removed and inserted pollinia. Heliconius erato removed and inserted more pollinia than D. erippus . For both butterfly species, pollinium removal was higher than pollinium insertion. This study is the first to show that Danaus and Heliconius butterflies can learn to manipulate complex flowers, but this learning ability does not confer benefits to pollination in A. curassavica . © 2017 Botanical Society of America.

  8. Cercosporoid leaf pathogens from whorled milkweed and spineless safflower in California

    NARCIS (Netherlands)

    Koike, S.K.; Baameur, A.; Groenewald, J.Z.; Crous, P.W.

    2011-01-01

    Two cercosporoid species are respectively described from Mexican whorled milkweed (Asclepias fascicularis), and spineless safflower (Carthamus tinctorius) from California. Passalora californica represents a new pathogen on Asclepias fascicularis, while Ramularia cynarae is confirmed on Carthamus

  9. Ecogeographical determinants of the ecological niche of the common milkweed (Asclepias syriaca on the basis of indices of remote sensing of land images

    Directory of Open Access Journals (Sweden)

    O. M. Kunah

    2016-03-01

    Full Text Available The patterns of variation in vegetative indices received by means of data of remote land sensing are described as being dependant on geomorphological predictors and the sizes of agricultural fields in an experimental polygon within Poltava region. The possibilities of application of vegetative indices have been explored through ecogeographical determinants of the ecological niche of the common milkweed (Asclepias syriaca L. and other weeds. On the basis of images of the land surface taken on 23 March and 27 August 2015 by the sensor control Operational Land Imager (OLI, installed on the satellite Landsat 8, vegetative indices have been calculated (AC-Index – aerosol/coastal index, Hydrothermal Composite, NDTI – Normalized Difference Tillage Index, NDVI – Normalized Difference Vegetation Index, VI – Vegetation Index, MNDW – Modified Normalized Difference Water Index, LSWI – Land Surface Water Index, NBR – Normalized Burn Ratio, M15. The data obtained have been subjected to principal component analysis and the revealed principal components have been interpreted with the help of regression analysis, in which geomorphological variables have been applied as predictors. It was possible to explain the trends of variability of the vegetative cover, formalized in the form of the principal component, by means of indices which quantitatively characterise features of relief. The various aspects of variation of vegetative cover have been shown to be characterised by the specificity of the influence of relief factors. A prominent aspect of the variation of the vegetative cover of agroecosystems is variability within a field. The degree of a variation of conditions is proportional to the size of a field. Large fields occupy level plain positions. In turn, within small fields sources of variation are changes in ecological conditions which arise owing to unevenness of relief, which increases in proximity to gullies and ravines. We have identified

  10. Effects of Cooking and Screw-Pressing on Functional Properties of Protein in Milkweed (Asclepias spp.) Seed Meals and Press Cakes

    Science.gov (United States)

    This study determined the effects of oil processing conditions on functional properties of milkweed seed proteins to evaluate their potential for value-added uses. Flaked milkweed seeds were cooked at 82 degrees C (180 degrees F) for 30, 60 or 90 min in the seed conditioner, and then screw-pressed ...

  11. Propagating native milkweeds for restoring monarch butterfly habitat

    Science.gov (United States)

    Thomas D. Landis; R. Kasten. Dumroese

    2015-01-01

    The number of monarch butterflies, charismatic nomads of North America, is rapidly declining. Milkweeds (Asclepias spp.), which are the sole food source for monarch caterpillars, have also experienced a decline throughout the breeding range of this butterfly. Milkweeds can be grown from seeds or vegetatively from root cuttings or rhizomes. Seed germination is often...

  12. Floral function: effects of traits on pollinators, male and female pollination success, and female fitness across three species of milkweeds (Asclepias).

    Science.gov (United States)

    La Rosa, Raffica J; Conner, Jeffrey K

    2017-01-01

    Central questions in plant reproductive ecology are whether the functions of floral traits in hermaphrodites create conflict between sexes that could slow evolution, and whether individual floral traits function in pollinator attraction, efficiency, or both. We studied how floral traits affect pollinator visitation and efficiency, and how they affect male and female function and female fitness within and across three Asclepias species that differ in floral morphology. Using separate multiple regressions, we regressed pollen removal, deposition, and fruit number onto six floral traits. We also used path analyses integrating these variables with pollinator visitation data for two of the species to further explore floral function and its effects on fruit production. Most traits affected male pollination success only, and these effects often differed between species. The exception was increased slit length, which increased pollinia insertion in two of the species. There were no interspecific differences in the effects of the traits on female pollination success. All traits except horn reach affected pollination efficiency in at least one species, and horn reach and two hood dimensions were the only traits to affect pollinator attraction, but in just one species. Traits tended to function in only one sex, and more traits affected function through pollinator efficiency than through attraction. There was no significant link between female pollination success and female fitness in any of the three species; this pattern is consistent with fruit production not being limited by pollen deposition. © 2017 Botanical Society of America.

  13. Cercosporoid leaf pathogens from whorled milkweed and spineless safflower in California.

    Science.gov (United States)

    Koike, Steven T; Baameur, Aziz; Groenewald, Johannes Z; Crous, Pedro W

    2011-06-01

    Two cercosporoid species are respectively described from Mexican whorled milkweed (Asclepias fascicularis), and spineless safflower (Carthamus tinctorius) from California. Passalora californica represents a new pathogen on Asclepias fascicularis, while Ramularia cynarae is confirmed on Carthamus tinctorius and Cynara cardunculus (Asteraceae), and an epitype designated. Pathogenicity is also established for both pathogens based on Koch's postulate.

  14. Synthesis, rheological characterization, and constitutive modeling of polyhydroxy triglycerides derived from milkweed oil.

    Science.gov (United States)

    Harry-O'kuru, R E; Carriere, C J

    2002-05-22

    Asclepias syriaca L., the common milkweed, is a new industrial crop. The seed contains about 20-30 wt % of a highly unsaturated oil having unusual fatty acids. Exploring value-added products from the oil, milkweed triglycerides have been oxidized by in situ performic acid to the polyoxirane and polyhydroxy triglycerides (PHTG). The rheological properties of milkweed PHTG were characterized in various shear flows. Milkweed PHTG displayed nonlinear viscoelastic behavior at applied strains greater than 1%. Milkweed PHTG was found to obey time-strain separability. A nonlinear Wagner constitutive model was used successfully to qualitatively predict the behavior of milkweed PHTG in both start-up and cessation of steady-state shear flow.

  15. Antioxidation behavior of milkweed oil 4-hydroxy-3-methyoxycinnamate esters in phospholipid bilayers

    Science.gov (United States)

    Milkweed (Asclepia syriaca) has seed oil that is rich in polyunsaturated triacylglycerides that contain olefinic groups. The olefinic groups can be chemically oxidized to form either epoxy or polyhydroxy triacylglycerides that can be esterified with trans-4-hydroxy-3-methoxoycinnamic acid, commonly...

  16. Interspecific variation within the genus Asclepias in response to herbivory by a phloem-feeding insect herbivore.

    Science.gov (United States)

    Zehnder, Caralyn B; Hunter, Mark D

    2007-11-01

    Induced plant responses to leaf-chewing insects have been well studied, but considerably less is known about the effects of phloem-feedings insects on induction. In a set of laboratory experiments, we examined density-dependent induction by the milkweed-oleander aphid, Aphis nerii, of putative defenses in four milkweed species (Asclepias incarnata, Asclepias syriaca, Asclepias tuberosa, and Asclepias viridis). We hypothesized that high aphid density would lead to increased cardenolide expression in species with low constitutive levels of cardenolides (e.g., A. tuberosa), but that there would be no induction in high constitutive cardenolide species (e.g., A. viridis). Based on previous studies, we did not expect cardenolide induction in A. incarnata. Contrary to our predictions, we observed feeding-induced declines of cardenolide concentrations in A. viridis. Cardenolide concentrations did not respond to aphid feeding in the other three milkweed species. Aphids also caused reductions in biomass accumulation by two of four Asclepias species, A. viridis and A. incarnata. High aphid density led to a decrease in A. viridis foliar nitrogen concentration. However, aphids had no effect on the defensive chemistry, growth, or nutritional quality of either A. syriaca or A. tuberosa. Our results highlight that congeneric plant species may respond differently to the same levels of herbivore damage.

  17. Evolutionary assembly of the milkweed fauna: cytochrome oxidase I and the age of Tetraopes beetles.

    Science.gov (United States)

    Farrell, B D

    2001-03-01

    The insects that feed on the related plant families Apocynaceae and Asclepiadaceae (here collectively termed "milkweeds") comprise a "component community" of highly specialized, distinctive lineages of species that frequently sequester toxic cardiac glycosides from their host plants for defense against predators and are thus often aposematic, advertising their consequent unpalatability. Such sets of specialized lineages provide opportunities for comparative studies of the rate of adaptation, diversification, and habitat-related effects on molecular evolution. The cerambycid genus Tetraopes is the most diverse of the new world milkweed herbivores and the species are generally host specific, being restricted to single, different species of Asclepias, more often so than most other milkweed insects. Previous work revealed correspondence between the phylogeny of these beetles and that of their hosts. The present study provides analyses of near-complete DNA sequences for Tetraopes and relatives that are used to establish a molecular clock and temporal framework for Tetraopes evolution with their milkweed hosts. Copyright 2001 Academic Press.

  18. Horizontal transfer of DNA from the mitochondrial to the plastid genome and its subsequent evolution in milkweeds (Apocynaceae)

    Science.gov (United States)

    Shannon C.K. Straub; Richard C. Cronn; Christopher Edwards; Mark Fishbein; Aaron. Liston

    2013-01-01

    Horizontal gene transfer (HGT) of DNA from the plastid to the nuclear and mitochondrial genomes of higher plants is a common phenomenon; however, plastid genomes (plastomes) are highly conserved and have generally been regarded as impervious to HGT. We sequenced the 158 kb plastome and the 690 kb mitochondrial genome of common milkweed (Asclepias syriaca [Apocynaceae...

  19. Generalised pollination systems for three invasive milkweeds in Australia.

    Science.gov (United States)

    Ward, M; Johnson, S D

    2013-05-01

    Because most plants require pollinator visits for seed production, the ability of an introduced plant species to establish pollinator relationships in a new ecosystem may have a central role in determining its success or failure as an invader. We investigated the pollination ecology of three milkweed species - Asclepias curassavica, Gomphocarpus fruticosus and G. physocarpus - in their invaded range in southeast Queensland, Australia. The complex floral morphology of milkweeds has often been interpreted as a general trend towards specialised pollination requirements. Based on this interpretation, invasion by milkweeds contradicts the expectation than plant species with specialised pollination systems are less likely to become invasive that those with more generalised pollination requirements. However, observations of flower visitors in natural populations of the three study species revealed that their pollination systems are essentially specialised at the taxonomic level of the order, but generalised at the species level. Specifically, pollinators of the two Gomphocarpus species included various species of Hymenoptera (particularly vespid wasps), while pollinators of A. curassavica were primarily Lepidoptera (particularly nymphalid butterflies). Pollinators of all three species are rewarded with copious amounts of highly concentrated nectar. It is likely that successful invasion by these three milkweed species is attributable, at least in part, to their generalised pollinator requirements. The results of this study are discussed in terms of how data from the native range may be useful in predicting pollination success of species in a new environment. © 2012 German Botanical Society and The Royal Botanical Society of the Netherlands.

  20. Evolution of specialization: a phylogenetic study of host range in the red milkweed beetle (Tetraopes tetraophthalmus).

    Science.gov (United States)

    Rasmann, Sergio; Agrawal, Anurag A

    2011-06-01

    Specialization is common in most lineages of insect herbivores, one of the most diverse groups of organisms on earth. To address how and why specialization is maintained over evolutionary time, we hypothesized that plant defense and other ecological attributes of potential host plants would predict the performance of a specialist root-feeding herbivore (the red milkweed beetle, Tetraopes tetraophthalmus). Using a comparative phylogenetic and functional trait approach, we assessed the determinants of insect host range across 18 species of Asclepias. Larval survivorship decreased with increasing phylogenetic distance from the true host, Asclepias syriaca, suggesting that adaptation to plant traits drives specialization. Among several root traits measured, only cardenolides (toxic defense chemicals) correlated with larval survival, and cardenolides also explained the phylogenetic distance effect in phylogenetically controlled multiple regression analyses. Additionally, milkweed species having a known association with other Tetraopes beetles were better hosts than species lacking Tetraopes herbivores, and milkweeds with specific leaf area values (a trait related to leaf function and habitat affiliation) similar to those of A. syriaca were better hosts than species having divergent values. We thus conclude that phylogenetic distance is an integrated measure of phenotypic and ecological attributes of Asclepias species, especially defensive cardenolides, which can be used to explain specialization and constraints on host shifts over evolutionary time.

  1. Investigation of some characteristics of polyhydroxy milkweed triglycerides and their acylated derivatives in relation to lubricity.

    Science.gov (United States)

    Harry-O'kuru, Rogers E; Biresaw, Girma; Cermak, Steven C; Gordon, Sherald H; Vermillion, Karl

    2011-05-11

    Most industrial lubricants are derived from nonrenewable petroleum-based sources. As useful as these lubricants are, their unintended consequences are the pollution of the Earth's environment as a result of the slow degradation of the spent materials. Native seed oils, on the other hand, are renewable and are also biodegradable in the environment, but these oils often suffer a drawback in having lower thermal stability and a shorter shelf life because of the intrinsic -C═C- unsaturation in their structures. This drawback can be overcome, yet the inherent biodegradative property retained, by appropriate derivatization of the oil. Pursuant to this, this study investigated derivatized polyhydroxy milkweed oil to assess its suitability as lubricant. The milkweed plant is a member of the Asclepiadaceae, a family with many genera including the common milkweeds, Asclepias syriaca L., Asclepias speciosa L., Asclepias tuberosa L., etc. The seeds of these species contain mainly C-18 triglycerides that are highly unsaturated, 92%. The olefinic character of this oil has been chemically modified by generating polyhydroxy triglycerides (HMWO) that show high viscosity and excellent moisturizing characteristics. In this work, HMWO have been chemically modified by esterifying their hydroxyl groups with acyl groups of various chain lengths (C2-C5). The results of investigation into the effect of the acyl derivatives' chemical structure on kinematic and dynamic viscosity, oxidation stability, cold-flow (pour point, cloud point) properties, coefficient of friction, wear, and elastohydrodynamic film thickness are discussed.

  2. Climate Change May Alter Breeding Ground Distributions of Eastern Migratory Monarchs (Danaus plexippus) via Range Expansion of Asclepias Host Plants

    Science.gov (United States)

    Lemoine, Nathan P.

    2015-01-01

    Climate change can profoundly alter species’ distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus) may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp.) host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in summer months

  3. Climate change may alter breeding ground distributions of eastern migratory monarchs (Danaus plexippus via range expansion of Asclepias host plants.

    Directory of Open Access Journals (Sweden)

    Nathan P Lemoine

    Full Text Available Climate change can profoundly alter species' distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp. host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in

  4. Climate change may alter breeding ground distributions of eastern migratory monarchs (Danaus plexippus) via range expansion of Asclepias host plants.

    Science.gov (United States)

    Lemoine, Nathan P

    2015-01-01

    Climate change can profoundly alter species' distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus) may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp.) host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in summer months

  5. 4-Hydroxy-3-methoxycinnamate esters of milkweed oil: synthesis and characterization.

    Science.gov (United States)

    Harry-O'kuru, Rogers E

    2005-11-01

    The common milkweed (Asclepias syriaca L.) is a new industrial crop. Its seed oil (TAG) is highly polyunsaturated. In the search for novel applications for milkweed seed oil, the olefinic groups in the TAG were oxidized to polyhydroxy TAG via epoxidation and subsequent epoxy ring-opening reactions. These polyhydroxy TAG exhibit unique industrially desirable emulsoid properties in water. Esterification of the secondary polyhydroxy functionalities of the TAG derivatives of the oil with trans-4-hydroxy-3-methoxycinnamic acid (ferulic acid) has resulted in the development of novel cinnamate esters of milkweed oil. These cinnamates are also obtainable via direct ring-opening of the epoxy TAG intermediate with ferulic acid. Among the interesting characteristics of the ester derivatives is their UV radiation-absorbing property.

  6. Monarchs (Danaus plexippus) and milkweeds (Asclepias species): The current situation and methods for propagating milkweeds

    Science.gov (United States)

    Tara Luna; R. Kasten Dumroese

    2013-01-01

    An international effort is under way to conserve populations of the monarch butterfly (Danaus plexippus L. [Lepidoptera: Nymphalidae]). Monarchs complete an impressive migration each year, flying from winter roosts on the California coast and the central mountains of Mexico to breeding areas throughout North America. Monarchs depend on habitats along their migratory...

  7. The Isolation of Rubber from Milkweed Leaves. An Introductory Organic Chemistry Lab

    Science.gov (United States)

    Volaric, Lisa; Hagen, John P.

    2002-01-01

    We present an introductory organic chemistry lab in which students isolate rubber from the leaves of milkweed plants (Asclepias syriaca). Students isolated rubber with a recovery of 2.4 ± 1.8% and 1.8 ± 0.7% for the microscale and macroscale procedures, respectively. Infrared spectra of their products were compared with the spectrum of synthetic rubber, cis-polyisoprene. Students tested for elasticity of their product by twisting it on a spatula and pulling; all students found some degree of elasticity.

  8. Induced responses to herbivory and jasmonate in three milkweed species.

    Science.gov (United States)

    Rasmann, Sergio; Johnson, M Daisy; Agrawal, Anurag A

    2009-11-01

    We studied constitutive and induced defensive traits (latex exudation, cardenolides, proteases, and C/N ratio) and resistance to monarch caterpillars (Danaus plexippus) in three closely related milkweed species (Asclepias angustifolia, A. barjoniifolia and A. fascicularis). All traits showed significant induction in at least one of the species. Jasmonate application only partially mimicked the effect of monarch feeding. We found some correspondence between latex and cardenolide content and reduced larval growth. Larvae fed cut leaves of A. angustifolia grew better than larvae fed intact plants. Addition of the cardenolide digitoxin to cut leaves reduced larval growth but ouabain (at the same concentration) had no effect. We, thus, confirm that latex and cardenolides are major defenses in milkweeds, effective against a specialist herbivore. Other traits such as proteases and C/N ratio additionally may be integrated in the defense scheme of those plants. Induction seems to play an important role in plants that have an intermediate level of defense, and we advocate incorporating induction as an additional axis of the plant defense syndrome hypothesis.

  9. Intragenomic polymorphisms among high-copy loci: a genus-wide study of nuclear ribosomal DNA in Asclepias (Apocynaceae).

    Science.gov (United States)

    Weitemier, Kevin; Straub, Shannon C K; Fishbein, Mark; Liston, Aaron

    2015-01-01

    Despite knowledge that concerted evolution of high-copy loci is often imperfect, studies that investigate the extent of intragenomic polymorphisms and comparisons across a large number of species are rarely made. We present a bioinformatic pipeline for characterizing polymorphisms within an individual among copies of a high-copy locus. Results are presented for nuclear ribosomal DNA (nrDNA) across the milkweed genus, Asclepias. The 18S-26S portion of the nrDNA cistron of Asclepias syriaca served as a reference for assembly of the region from 124 samples representing 90 species of Asclepias. Reads were mapped back to each individual's consensus and at each position reads differing from the consensus were tallied using a custom perl script. Low frequency polymorphisms existed in all individuals (mean = 5.8%). Most nrDNA positions (91%) were polymorphic in at least one individual, with polymorphic sites being less frequent in subunit regions and loops. Highly polymorphic sites existed in each individual, with highest abundance in the "noncoding" ITS regions. Phylogenetic signal was present in the distribution of intragenomic polymorphisms across the genus. Intragenomic polymorphisms in nrDNA are common in Asclepias, being found at higher frequency than any other study to date. The high and variable frequency of polymorphisms across species highlights concerns that phylogenetic applications of nrDNA may be error-prone. The new analytical approach provided here is applicable to other taxa and other high-copy regions characterized by low coverage genome sequencing (genome skimming).

  10. Seed dormancy and germination vary within and among species of milkweeds

    Science.gov (United States)

    Kaye, Thomas N; Sandlin, Isaac J; Bahm, Matt A

    2018-01-01

    Abstract Pollinators in general and monarch butterflies in particular are in decline due to habitat loss. Efforts to restore habitats for insects that rely on specific plant groups as larvae or adults depend on the ability of practitioners to grow and produce these plants. Monarch larvae feed exclusively on milkweed species, primarily in the genus Asclepias, making propagation and restoration of these plants crucial for habitat restoration. Seed germination protocols for milkweeds are not well established, in part due to the large number of milkweed species and conflicting reports of seed dormancy in the genus. We tested for seed dormancy and the optimum period of cold stratification in 15 populations of A. speciosa and 1–2 populations of five additional species, including A. asperula, A. fascicularis, A. subulata, A. subverticillata and A. syriaca. We exposed seeds to cold (5 °C) moist conditions for 0, 2, 4, 6 and 8 weeks and then moved them to 15 °C/25 °C alternating temperatures. In A. speciosa, dormancy was detected in eight populations, and this dormancy was broken by 2–4 weeks of cold stratification. The remaining seven populations showed no dormancy. Seed dormancy was also detected in two populations of A. fascicularis (broken by 4–6 weeks of cold stratification) and a single population of A. syriaca (broken by 2 weeks of cold stratification). No dormancy was detected in A. asperula, A. subulata or A. subverticillata. Seed dormancy appears to be widespread in the genus (confirmed in 15 species) but can vary between populations even within the same species. Variation in seed dormancy and cold stratification requirements within and among Asclepias species suggests local adaptation and maternal environments may drive seedling ecology, and that growers should watch for low germination and use cold stratification as needed to maximize seed germination and retain genetic variability in restored populations. PMID:29593856

  11. Characterization of a structurally and functionally diverged acyl-acyl carrier protein desaturase from milkweed seed.

    Science.gov (United States)

    Cahoon, E B; Coughlan, S J; Shanklin, J

    1997-04-01

    A cDNA for a structurally variant acyl-acyl carrier protein (ACP) desaturase was isolated from milkweed (Asclepias syriaca) seed, a tissue enriched in palmitoleic (16:1delta9)* and cis-vaccenic (18:1delta11) acids. Extracts of Escherichia coli that express the milkweed cDNA catalyzed delta9 desaturation of acyl-ACP substrates, and the recombinant enzyme exhibited seven- to ten-fold greater specificity for palmitoyl (16:0)-ACP and 30-fold greater specificity for myristoyl (14:0)-ACP than did known delta9-stearoyl (18:0)-ACP desaturases. Like other variant acyl-ACP desaturases reported to date, the milkweed enzyme contains fewer amino acids near its N-terminus compared to previously characterized delta9-18:0-ACP desaturases. Based on the activity of an N-terminal deletion mutant of a delta9-18:0-ACP desaturase, this structural feature likely does not account for differences in substrate specificities.

  12. Milkweed (Gentianales: Apocynaceae): a farmscape resource for increasing parasitism of stink bugs (Hemiptera: Pentatomidae) and providing nectar to insect pollinators and monarch butterflies.

    Science.gov (United States)

    Tillman, P G; Carpenter, J E

    2014-04-01

    In peanut-cotton farmscapes in Georgia, the stink bugs Nezara viridula (L.) and Chinavia hilaris (Say) (Hemiptera: Pentatomidae) and the leaffooted bug, Leptoglossus phyllopus (L.) (Hemiptera: Coreidae), disperse at crop-to-crop interfaces to feed on bolls in cotton. The main objective of this study was to determine whether insecticide-free tropical milkweed (Asclepias curassavica L.), a nectar-producing plant, can increase parasitism of these bugs by Trichopoda pennipes (F.) (Diptera: Tachinidae) and provide nectar to monarch butterflies and insect pollinators in these farmscapes. Peanut-cotton plots with and without flowering milkweed plants were established in 2009 and 2010. Adult T. pennipes, monarch butterflies, honey bees, and native insect pollinators readily fed on floral nectar of milkweed. Monarch larvae feeding on milkweed vegetation successfully developed into pupae. In 2009, N. viridula was the primary host of T. pennipes in cotton, and parasitism of this pest by the parasitoid was significantly higher in milkweed cotton (61.6%) than in control cotton (13.3%). In 2010, parasitism of N. viridula, C. hilaris, and L. phyllopus by T. pennipes was significantly higher in milkweed cotton (24.0%) than in control cotton (1.1%). For both years of the study, these treatment differences were not owing to a response by the parasitoid to differences in host density, because density of hosts was not significantly different between treatments. In conclusion, incorporation of milkweed in peanut-cotton plots increased stink bug parasitism in cotton and provided nectar to insect pollinators and monarch butterflies.

  13. Cytotoxicity of cardenolides and cardenolide glycosides from Asclepias curassavica.

    Science.gov (United States)

    Li, Jun-Zhu; Qing, Chen; Chen, Chang-Xiang; Hao, Xiao-Jiang; Liu, Hai-Yang

    2009-04-01

    A new cardenolide, 12beta,14beta-dihydroxy-3beta,19-epoxy-3alpha-methoxy-5alpha-card-20(22)-enolide (6), and a new doubly linked cardenolide glycoside, 12beta-hydroxycalotropin (13), together with eleven known compounds, coroglaucigenin (1), 12beta-hydroxycoroglaucigenin (2), calotropagenin (3), desglucouzarin (4), 6'-O-feruloyl-desglucouzarin (5), calotropin (7), uscharidin (8), asclepin (9), 16alpha-hydroxyasclepin (10), 16alpha-acetoxycalotropin (11), and 16alpha-acetoxyasclepin (12), were isolated from the aerial part of ornamental milkweed, Asclepias curassavica and chemically elucidated through spectral analyses. All the isolates were evaluated for their cytotoxic activity against HepG2 and Raji cell lines. The results showed that asclepin (9) had the strongest cytotoxic activity with an IC(50) value of 0.02 microM against the two cancer cell lines and the new compound 13 had significant cytotoxic activity with IC(50) values of 0.69 and 1.46 microM, respectively.

  14. Corneal Toxicity Following Exposure to Asclepias Tuberosa.

    Science.gov (United States)

    Mikkelsen, Lauge Hjorth; Hamoudi, Hassan; Gül, Cigdem Altuntas; Heegaard, Steffen

    2017-01-01

    To present a case of corneal toxicity following exposure to milky plant latex from Asclepias tuberosa. A 70-year-old female presented with blurred vision and pain in her left eye after handling an Ascepias tuberosa . Clinical examination revealed a corneal stromal oedema with small epithelial defects. The corneal endothelium was intact and folds in Descemets membrane were observed. The oedema was treated with chloramphenicol, dexamethasone and scopolamine. The corneal oedema had appeared after corneal exposure to the plant, Asclepias tuberosa , whose latex contains cardenolides that inhibit the Na + / K + -ATPase in the corneal endothelium. The oedema resolved after 96 hours. After nine months the best corrected visual acuity was 20/20. Corneal toxicity has previously been reported for plants of the Asclepias family. This is a rare case describing severe corneal toxicity caused by exposure to latex from Asclepias tuberosa . Handling of plants of the Asclepias family should be kept as a differential diagnosis in cases of acute corneal toxicity.

  15. Characterization of papain-like isoenzymes from latex of Asclepias curassavica by molecular biology validated by proteomic approach.

    Science.gov (United States)

    Obregón, Walter D; Liggieri, Constanza S; Trejo, Sebastian A; Avilés, Francesc X; Vairo-Cavalli, Sandra E; Priolo, Nora S

    2009-01-01

    Latices from Asclepias spp are used in wound healing and the treatment of some digestive disorders. These pharmacological actions have been attributed to the presence of cysteine proteases in these milky latices. Asclepias curassavica (Asclepiadaceae), "scarlet milkweed" is a perennial subshrub native to South America. In the current paper we report a new approach directed at the selective biochemical and molecular characterization of asclepain cI (acI) and asclepain cII (acII), the enzymes responsible for the proteolytic activity of the scarlet milkweed latex. SDS-PAGE spots of both purified peptidases were digested with trypsin and Peptide Mass Fingerprints (PMFs) obtained showed no equivalent peptides. No identification was possible by MASCOT search due to the paucity of information concerning Asclepiadaceae latex cysteine proteinases available in databases. From total RNA extracted from latex samples, cDNA of both peptidases was obtained by RT-PCR using degenerate primers encoding Asclepiadaceae cysteine peptidase conserved domains. Theoretical PMFs of partial polypeptide sequences obtained by cloning (186 and 185 amino acids) were compared with empirical PMFs, confirming that the sequences of 186 and 185 amino acids correspond to acI and acII, respectively. N-terminal sequences of acI and acII, characterized by Edman sequencing, were overlapped with those coming from the cDNA to obtain the full-length sequence of both mature peptidases (212 and 211 residues respectively). Alignment and phylogenetic analysis confirmed that acI and acII belong to the subfamily C1A forming a new group of papain-like cysteine peptidases together with asclepain f from Asclepias fruticosa. We conclude that PMF could be adopted as an excellent tool to differentiate, in a fast and unequivocal way, peptidases with very similar physicochemical and functional properties, with advantages over other conventional methods (for instance enzyme kinetics) that are time consuming and afford less

  16. Analysis and optimization of a synthetic milkweed floral attractant for mosquitoes.

    Science.gov (United States)

    Otienoburu, Philip E; Ebrahimi, Babak; Phelan, P Larry; Foster, Woodbridge A

    2012-07-01

    A pentane extract of flowers of common milkweed, Asclepias syriaca (Asclepiadaceae), elicited significant orientation from both male and female Culex pipiens in a dual-port flight olfactometer. Analysis of the extract by gas chromatography-mass spectrometry revealed six major constituents in order of relative abundance: benzaldehyde, (E)-β-ocimene, phenylacetaldehyde, benzyl alcohol, nonanal, and (E)-2-nonenal. Although not all were collected from the headspace profile of live flowers, a synthetic blend of these six compounds, when presented to mosquitoes in the same levels and proportions that occur in the extract, elicited a response comparable to the extract. Subtractive behavioral bioassays demonstrated that a three-component blend consisting of benzaldehyde, phenylacetaldehyde, and (E)-2-nonenal was as attractive as the full blend. These findings suggest the potential use of synthetic floral-odor blends for monitoring or control of both male and female disease-vectoring mosquitoes.

  17. Molecular characterization, ecology, and epidemiology of a novel Tymovirus in Asclepias viridis from Oklahoma.

    Science.gov (United States)

    Min, Byoung-Eun; Feldman, Tracy S; Ali, Akhtar; Wiley, Graham; Muthukumar, Vijay; Roe, Bruce A; Roossinck, Marilyn; Melcher, Ulrich; Palmer, Michael W; Nelson, Richard S

    2012-02-01

    Native virus-plant interactions require more understanding and their study will provide a basis from which to identify potential sources of emerging destructive viruses in crops. A novel tymovirus sequence was detected in Asclepias viridis (green milkweed), a perennial growing in a natural setting in the Tallgrass Prairie Preserve (TGPP) of Oklahoma. It was abundant within and frequent among A. viridis plants and, to varying extents, within other dicotyledonous and one grass (Panicum virgatum) species obtained from the TGPP. Extracts from A. viridis containing the sequence were infectious to a limited number of species. The virus genome was cloned and determined to be closely related to Kennedya yellow mosaic virus. The persistence of the virus within the Oklahoma A. viridis population was monitored for five successive years. Virus was present in a high percentage of plants within representative areas of the TGPP in all years and was spreading to additional plants. Virus was present in regions adjacent to the TGPP but not in plants sampled from central and south-central Oklahoma. Virus was present in the underground caudex of the plant during the winter, suggesting overwintering in this tissue. The RNA sequence encoding the virus coat protein varied considerably between individual plants (≈3%), likely due to drift rather than selection. An infectious clone was constructed and the virus was named Asclepias asymptomatic virus (AsAV) due to the absence of obvious symptoms on A. viridis.

  18. Oil sorption and retention capacities of thermally-bonded hybrid nonwovens prepared from cotton, kapok, milkweed and polypropylene fibers.

    Science.gov (United States)

    Thilagavathi, G; Praba Karan, C; Das, Dipayan

    2018-08-01

    This work reports on a series of thermally-bonded, hybrid and oil-sorbent nonwovens developed from binary and tertiary mixing of cotton, kapok, and three varieties of milkweed fibers (Asclepias Syriaca, Calotropis Procera and Calotropis Gigantea) and polypropylene fibers. The physical and chemical properties of the fibers were investigated to examine their oleophilic character. It was observed that all the fiber surfaces were covered with natural wax. Further, kapok and milkweed fibers were found to have less cell wall thickness and high void ratio. Oil sorption and retention characteristics of these fibers were studied in loose fibrous form as well as in structured assembly form (thermally-bonded nonwovens) using high density oil and diesel oil. The effects of fiber diameter, fiber cross-sectional shape, fiber surface area and porosity on the oil sorption behavior were discussed. An excellent and a selective oil sorption behavior of milkweed fibers (Calotropis Procera and Calotropis Gigantea) blended with cotton and polypropylene fibers were observed. The maximum oil sorption capacity of the developed thermal bonded nonwoven was 40.16 g/g for high density (HD) oil and 23.00 g/g for diesel oil. Further, a high porosity combined with high surface area played a major role in deciding the oil sorption and retention characteristics. Copyright © 2018 Elsevier Ltd. All rights reserved.

  19. Arbuscular mycorrhizal fungi alter above- and below-ground chemical defense expression differentially among Asclepias species

    Science.gov (United States)

    Vannette, Rachel L.; Hunter, Mark D.; Rasmann, Sergio

    2013-01-01

    Below-ground (BG) symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above- (AG) and BG herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF) on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed)—which all produce toxic cardenolides—with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in AG and BG plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and defense. PMID:24065971

  20. Arbuscular mycorrhizal fungi alter above- and below-ground chemical defense expression differentially among Asclepias species.

    Science.gov (United States)

    Vannette, Rachel L; Hunter, Mark D; Rasmann, Sergio

    2013-01-01

    Below-ground (BG) symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above- (AG) and BG herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF) on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed)-which all produce toxic cardenolides-with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in AG and BG plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and defense.

  1. Arbuscular mycorrhizal fungi alter above- and below-ground chemical defense expression differentially among Asclepias species

    Directory of Open Access Journals (Sweden)

    Rachel L Vannette

    2013-09-01

    Full Text Available Belowground symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above and belowground herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed--which all produce toxic cardenolides--with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in above- and below-ground plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and

  2. Milkweed butterfly resistance to plant toxins is linked to sequestration, not coping with a toxic diet.

    Science.gov (United States)

    Petschenka, Georg; Agrawal, Anurag A

    2015-11-07

    Insect resistance to plant toxins is widely assumed to have evolved in response to using defended plants as a dietary resource. We tested this hypothesis in the milkweed butterflies (Danaini) which have progressively evolved higher levels of resistance to cardenolide toxins based on amino acid substitutions of their cellular sodium-potassium pump (Na(+)/K(+)-ATPase). Using chemical, physiological and caterpillar growth assays on diverse milkweeds (Asclepias spp.) and isolated cardenolides, we show that resistant Na(+)/K(+)-ATPases are not necessary to cope with dietary cardenolides. By contrast, sequestration of cardenolides in the body (as a defence against predators) is associated with the three levels of Na(+)/K(+)-ATPase resistance. To estimate the potential physiological burden of cardenolide sequestration without Na(+)/K(+)-ATPase adaptations, we applied haemolymph of sequestering species on isolated Na(+)/K(+)-ATPase of sequestering and non-sequestering species. Haemolymph cardenolides dramatically impair non-adapted Na(+)/K(+)-ATPase, but had systematically reduced effects on Na(+)/K(+)-ATPase of sequestering species. Our data indicate that major adaptations to plant toxins may be evolutionarily linked to sequestration, and may not necessarily be a means to eat toxic plants. Na(+)/K(+)-ATPase adaptations thus were a potential mechanism through which predators spurred the coevolutionary arms race between plants and insects. © 2015 The Author(s).

  3. Intragenomic polymorphisms among high-copy loci: a genus-wide study of nuclear ribosomal DNA in Asclepias (Apocynaceae

    Directory of Open Access Journals (Sweden)

    Kevin Weitemier

    2015-01-01

    Full Text Available Despite knowledge that concerted evolution of high-copy loci is often imperfect, studies that investigate the extent of intragenomic polymorphisms and comparisons across a large number of species are rarely made. We present a bioinformatic pipeline for characterizing polymorphisms within an individual among copies of a high-copy locus. Results are presented for nuclear ribosomal DNA (nrDNA across the milkweed genus, Asclepias. The 18S-26S portion of the nrDNA cistron of Asclepias syriaca served as a reference for assembly of the region from 124 samples representing 90 species of Asclepias. Reads were mapped back to each individual’s consensus and at each position reads differing from the consensus were tallied using a custom perl script. Low frequency polymorphisms existed in all individuals (mean = 5.8%. Most nrDNA positions (91% were polymorphic in at least one individual, with polymorphic sites being less frequent in subunit regions and loops. Highly polymorphic sites existed in each individual, with highest abundance in the “noncoding” ITS regions. Phylogenetic signal was present in the distribution of intragenomic polymorphisms across the genus. Intragenomic polymorphisms in nrDNA are common in Asclepias, being found at higher frequency than any other study to date. The high and variable frequency of polymorphisms across species highlights concerns that phylogenetic applications of nrDNA may be error-prone. The new analytical approach provided here is applicable to other taxa and other high-copy regions characterized by low coverage genome sequencing (genome skimming.

  4. Milkweed control by food imprinted rabbits.

    Science.gov (United States)

    Ducs, Anita; Kazi, Andrea; Bilkó, Ágnes; Altbäcker, Vilmos

    2016-09-01

    Many species of invasive plants are spreading out rapidly in Europe. The common milkweed occupies increasingly more area. Being poisonous, most animals will not graze on it however rabbits would be an effective organism for the biological control of milkweed. Rabbit kittens can learn the maternal diet in various ways. They prefer aromatic foods which their mother had eaten during pregnancy or lactation period, -even if it is poisonous- but they can also learn the maternal diet from the fecal pellets deposited by the mother into the nest during the nursing events. The present study was aimed to investigate if rabbit kittens can learn that the common milkweed is a potential food also. In the first 10days of their lives kits got fecal pellets originating from individuals having fed on common milkweed previously. When weaned on day 28 postpartum, these pups preferred the milkweed in the 3-way food choice test, opposite to the control group. Most surprisingly in a second experiment it was also shown that the common milkweed was also preferred by the kittens if their mother ate it not during, but one month before pregnancy. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Corneal Toxicity Following Exposure to Asclepias Tuberosa

    DEFF Research Database (Denmark)

    Mikkelsen, Lauge Hjorth; Hamoudi, Hassan; Gül, Cigdem Altuntas

    2017-01-01

    PURPOSE: To present a case of corneal toxicity following exposure to milky plant latex from Asclepias tuberosa. METHODS: A 70-year-old female presented with blurred vision and pain in her left eye after handling an Ascepias tuberosa. Clinical examination revealed a corneal stromal oedema with small...... epithelial defects. The corneal endothelium was intact and folds in Descemets membrane were observed. The oedema was treated with chloramphenicol, dexamethasone and scopolamine. RESULTS: The corneal oedema had appeared after corneal exposure to the plant, Asclepias tuberosa, whose latex contains cardenolides...... that inhibit the Na+/ K+-ATPase in the corneal endothelium. The oedema resolved after 96 hours. After nine months the best corrected visual acuity was 20/20. CONCLUSION: Corneal toxicity has previously been reported for plants of the Asclepias family. This is a rare case describing severe corneal toxicity...

  6. Horizontal Transfer of DNA from the Mitochondrial to the Plastid Genome and Its Subsequent Evolution in Milkweeds (Apocynaceae)

    Science.gov (United States)

    Straub, Shannon C.K.; Cronn, Richard C.; Edwards, Christopher; Fishbein, Mark; Liston, Aaron

    2013-01-01

    Horizontal gene transfer (HGT) of DNA from the plastid to the nuclear and mitochondrial genomes of higher plants is a common phenomenon; however, plastid genomes (plastomes) are highly conserved and have generally been regarded as impervious to HGT. We sequenced the 158 kb plastome and the 690 kb mitochondrial genome of common milkweed (Asclepias syriaca [Apocynaceae]) and found evidence of intracellular HGT for a 2.4-kb segment of mitochondrial DNA to the rps2–rpoC2 intergenic spacer of the plastome. The transferred region contains an rpl2 pseudogene and is flanked by plastid sequence in the mitochondrial genome, including an rpoC2 pseudogene, which likely provided the mechanism for HGT back to the plastome through double-strand break repair involving homologous recombination. The plastome insertion is restricted to tribe Asclepiadeae of subfamily Asclepiadoideae, whereas the mitochondrial rpoC2 pseudogene is present throughout the subfamily, which confirms that the plastid to mitochondrial HGT event preceded the HGT to the plastome. Although the plastome insertion has been maintained in all lineages of Asclepiadoideae, it shows minimal evidence of transcription in A. syriaca and is likely nonfunctional. Furthermore, we found recent gene conversion of the mitochondrial rpoC2 pseudogene in Asclepias by the plastid gene, which reflects continued interaction of these genomes. PMID:24029811

  7. Honey bees are the dominant diurnal pollinator of native milkweed in a large urban park.

    Science.gov (United States)

    MacIvor, James Scott; Roberto, Adriano N; Sodhi, Darwin S; Onuferko, Thomas M; Cadotte, Marc W

    2017-10-01

    In eastern North America, the field milkweed, Asclepias syriaca L. (Asclepiadaceae), is used in planting schemes to promote biodiversity conservation for numerous insects including the endangered monarch butterfly, Danaus plexippus (Linnaeus) (Nymphalidae). Less is known about its pollinators, and especially in urban habitats where it is planted often despite being under increasing pressure from invasive plant species, such as the related milkweed, the dog-strangling vine (DSV), Vincetoxicum rossicum (Kleopow) Barbar. (Asclepiadaceae). During the A. syriaca flowering period in July 2016, we surveyed bees in open habitats along a DSV invasion gradient and inspected 433 individuals of 25 bee species in 12 genera for pollinia: these were affixed to bees that visited A. syriaca for nectar and contain pollen packets that are vectored (e.g., transferred) between flowers. Of all bees sampled, pollinia were found only on the nonindigenous honeybee, Apis mellifera (43% of all bees identified), as well as one individual bumblebee, Bombus impatiens Cresson. Pollinia were recorded from 45.2% of all honeybees collected. We found no relationship between biomass of DSV and biomass of A. syriaca per site. There was a significant positive correlation between A. syriaca biomass and the number of pollinia, and the proportion vectored. No relationship with DSV biomass was detected for the number of pollinia collected by bees but the proportion of vectored pollinia declined with increasing DSV biomass. Although we find no evidence of DSV flowers attracting potential pollinators away from A. syriaca and other flowering plants, the impacts on native plant-pollinator mutualisms relate to its ability to outcompete native plants. As wild bees do not appear to visit DSV flowers, it could be altering the landscape to one which honeybees are more tolerant than native wild bees.

  8. Density-dependent reduction and induction of milkweed cardenolides by a sucking insect herbivore.

    Science.gov (United States)

    Martel, John W; Malcolm, Stephen B

    2004-03-01

    The effect of aphid population size on host-plant chemical defense expression and the effect of plant defense on aphid population dynamics were investigated in a milkweed-specialist herbivore system. Density effects of the aposematic oleander aphid, Aphis nerii, on cardenolide expression were measured in two milkweed species, Asclepias curassavica and A. incarnata. These plants vary in constitutive chemical investment with high mean cardenolide concentration in A. curassavica and low to zero in A. incarnata. The second objective was to determine whether cardenolide expression in these two host plants impacts mean A. nerii colony biomass (mg) and density. Cardenolide concentration (microgram/g) of A. curassavica in both aphid-treated leaves and opposite, herbivore-free leaves decreased initially in comparison with aphid-free controls, and then increased significantly with A. nerii density. Thus, A. curassavica responds to aphid herbivory initially with density-dependent phytochemical reduction, followed by induction of cardenolides to concentrations above aphid-free controls. In addition, mean cardenolide concentration of aphid-treated leaves was significantly higher than that of opposite, herbivore-free leaves. Therefore, A. curassavica induction is strongest in herbivore-damage tissue. Conversely, A. incarnata exhibited no such chemical response to aphid herbivory. Furthermore, neither host plant responded chemically to herbivore feeding duration time (days) or to the interaction between herbivore initial density and feeding duration time. There were also no significant differences in mean colony biomass or population density of A. nerii reared on high cardenolide (A. curassavica) and low cardenolide (A. incarnata) hosts.

  9. Corneal Toxicity Following Exposure to Asclepias Tuberosa

    OpenAIRE

    Mikkelsen, Lauge Hjorth; Hamoudi, Hassan; G?l, Cigdem Altuntas; Heegaard, Steffen

    2017-01-01

    PURPOSE: To present a case of corneal toxicity following exposure to milky plant latex from Asclepias tuberosa.METHODS: A 70-year-old female presented with blurred vision and pain in her left eye after handling an Ascepias tuberosa. Clinical examination revealed a corneal stromal oedema with small epithelial defects. The corneal endothelium was intact and folds in Descemets membrane were observed. The oedema was treated with chloramphenicol, dexamethasone and scopolamine.RESULTS: The corneal ...

  10. Induced defences alter the strength and direction of natural selection on reproductive traits in common milkweed.

    Science.gov (United States)

    Thompson, K A; Cory, K A; Johnson, M T J

    2017-06-01

    Evolutionary biologists have long sought to understand the ecological processes that generate plant reproductive diversity. Recent evidence indicates that constitutive antiherbivore defences can alter natural selection on reproductive traits, but it is unclear whether induced defences will have the same effect and whether reduced foliar damage in defended plants is the cause of this pattern. In a factorial field experiment using common milkweed, Asclepias syriaca L., we induced plant defences using jasmonic acid (JA) and imposed foliar damage using scissors. We found that JA-induced plants experienced selection for more inflorescences that were smaller in size (fewer flowers), whereas control plants only experienced a trend towards selection for larger inflorescences (more flowers); all effects were independent of foliar damage. Our results demonstrate that induced defences can alter both the strength and direction of selection on reproductive traits, and suggest that antiherbivore defences may promote the evolution of plant reproductive diversity. © 2017 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2017 European Society For Evolutionary Biology.

  11. Long-term trends in midwestern milkweed abundances and their relevance to monarch butterfly declines

    Science.gov (United States)

    Zaya, David N.; Pearse, Ian; Spyreas, Gregory

    2017-01-01

    Declines in monarch butterfly populations have prompted investigation into the sensitivity of their milkweed host plants to land-use change. Documented declines in milkweed abundance in croplands have spurred efforts to promote milkweeds in other habitats. Nevertheless, our current understanding of milkweed populations is poor. We used a long-term plant survey from Illinois to evaluate whether trends in milkweed abundance have caused monarch decline and to highlight the habitat-management practices that promote milkweeds. Milkweed abundance in natural areas has not declined precipitously, although when croplands are considered, changes in agricultural weed management have led to a 68% loss of milkweed available for monarchs across the region. Midsuccessional plant communities with few invasive species provide optimal milkweed habitat. The augmentation of natural areas and the management of existing grasslands, such as less frequent mowing and woody- and exotic-species control, may replace some of the milkweed that has been lost from croplands.

  12. Thermogravimetric analysis and fast pyrolysis of Milkweed.

    Science.gov (United States)

    Kim, Seung-Soo; Agblevor, Foster A

    2014-10-01

    Pyrolysis of Milkweed was carried out in a thermogravimetric analyzer and a bubbling fluidized bed reactor. Total liquid yield of Milkweed pyrolysis was between 40.74% and 44.19 wt% between 425 °C and 550 °C. The gas yield increased from 27.90 wt% to 33.33 wt% with increasing reaction temperature. The higher heating values (HHV) of the Milkweed bio-oil were relatively high (30.33-32.87 MJ/kg) and varied with reaction temperature, feeding rate and fluidization velocity. The selectivity for CO2 was highest within non-condensable gases, and the molar ratio of CO2/CO was about 3 at the different reaction conditions. The (13)C NMR analysis, of the bio-oil showed that the relative concentration carboxylic group and its derivatives was higher at 425 °C than 475 °C, which resulted in slightly higher oxygen content in bio-oil. The pH of aqueous phase obtained at 475 °C was 7.37 which is the highest reported for any lignocellulosic biomass pyrolysis oils. Copyright © 2014 Elsevier Ltd. All rights reserved.

  13. Structures, chemotaxonomic significance, cytotoxic and Na(+),K(+)-ATPase inhibitory activities of new cardenolides from Asclepias curassavica.

    Science.gov (United States)

    Zhang, Rong-Rong; Tian, Hai-Yan; Tan, Ya-Fang; Chung, Tse-Yu; Sun, Xiao-Hui; Xia, Xue; Ye, Wen-Cai; Middleton, David A; Fedosova, Natalya; Esmann, Mikael; Tzen, Jason T C; Jiang, Ren-Wang

    2014-11-28

    Five new cardenolide lactates (1–5) and one new dioxane double linked cardenolide glycoside (17) along with 15 known compounds (6–16 and 18–21) were isolated from the ornamental milkweed Asclepias curassavica. Their structures were elucidated by extensive spectroscopic methods (IR, UV, MS, 1D- and 2D-NMR). The molecular structures and absolute configurations of 1–3 and 17 were further confirmed by single-crystal X-ray diffraction analysis. Simultaneous isolation of dioxane double linked cardenolide glycosides (17–21) and cardenolide lactates (1–5) provided unique chemotaxonomic markers for this genus. Compounds 1–21 were evaluated for the inhibitory activities against DU145 prostate cancer cells. The dioxane double linked cardenolide glycosides showed the most potent cytotoxic effect followed by normal cardenolides and cardenolide lactates, while the C21 steroids were non-cytotoxic. Enzymatic assay established a correlation between the cytotoxic effects in DU145 cancer cells and the Ki for the inhibition of Na(+),K(+)-ATPase. Molecular docking analysis revealed relatively strong H-bond interactions between the bottom of the binding cavity and compounds 18 or 20, and explained why the dioxane double linked cardenolide glycosides possessed higher inhibitory potency on Na(+),K(+)-ATPase than the cardenolide lactate.

  14. Magruder Park Swamp

    Science.gov (United States)

    Hotchkiss, N.; Uhler, F.M.

    1967-01-01

    The last Tuesday in August, between five-thirty and seven in the evening, we zigzaged through this glorious jungle, attended by a family of Wood Pewees for whom we seemed to be stirring up a feast of flying insects. There was gentle background music by Mole Crickets. A few steps in from the playing field and we were out of sight in ten-foot-high Cattails. All through, we met -- as high as we, or higher--clumped Cinnamon Ferns, deep-rose Joe Pye Weed, and orange, pendent flowers of Jewelweed (first cousins to Balsam and Sultana). Here and there were soft, white spikes of Canadian Burnet, a rare plant hereabouts, and deep purple Ironweed. Dense-foliaged Hempweed climbed over bushes and up small trees, filling the air with its delicate fragrance. Arrowleaf Tear-thumb snatched at us with tiny prongs on its angled stems. Once in a while we tripped over huge sedge tussocks, half-hidden in the tangle. A few times we steered around a small bush of Poison Sumac. The next day We remembered seeing ninety kinds of plants on this hasty trip. Skunk Cabbage leaves recalled April, when a person, from the edge of the lawn, could see huge clumps of them all the way across the swamp. The sky had been washed by last week's downpours; scattered Gums were reddening; and Maples were getting ready for crimson beauty a month from now. There wasn't a mosquito! (Ed. Note.-The Hyattsville City Council is taking pains to preserve this interesting swamp.)

  15. Acylated-oxypregnane glycosides from the roots of Asclepias syriaca.

    Science.gov (United States)

    Warashina, Tsutomu; Noro, Tadataka

    2009-02-01

    Twenty new pregnane glycosides were obtained from the roots of Asclepias syriaca L. (Asclepiadaceae). These glycosides were confirmed to contain ikemagenin, 12-O-nicotinoyllineolon, 5alpha,6-dihydroikemagenin, and 12-O-tigloylisolineolon, as their aglycones, using both spectroscopic and chemical methods.

  16. Steroidal glycosides from the roots of Asclepias curassavica.

    Science.gov (United States)

    Warashina, Tsutomu; Noro, Tadataka

    2008-03-01

    Twenty-six new acylated-oxypregnane glycosides were obtained along with three known cardenolide glycosides from the roots of Asclepias curassavica (Asclepiadaceae). The new compounds were confirmed to contain 12-O-benzoylsarcostin, 12-O-benzoyldeacylmetaplexigenin, kidjolanin, and 12-O-benzoyltayloron, and one new acylated-oxypregnane, 12-O-(E)-cinnamoyltayloron, as their aglycones, using both spectroscopic and chemical methods.

  17. Patterns of adaptive trait evolution across the North American Asclepias

    OpenAIRE

    Rosa, Raffica La

    2016-01-01

    We conducted analyses using an Asclepias phylogeny constructed by Fishbein et al. (2011), floral traits measured from pickled specimens, and bioclimatic data for 117 species. Bioclimatic data was extracted by combining WorldClim data and occurrence data of individual specimens collected by iDigBio, GBIF, and SEINet.

  18. Milkweed Seed Dispersal: A Means for Integrating Biology and Physics.

    Science.gov (United States)

    Bisbee, Gregory D.; Kaiser, Cheryl A.

    1997-01-01

    Describes an activity that integrates biology and physics concepts by experimenting with the seed dispersal of common milkweed or similar wind-dispersed seeds. Student teams collect seeds and measure several parameters, review principles of trajectory motion, perform experiments, and graph data. Students examine the ideas of…

  19. Flavonoids in the leaves of Asclepias incarnata L.

    Science.gov (United States)

    Sikorska, Maria

    2003-01-01

    Seven flavonoid compounds: quercelin 3-O-beta-galactopyranoside, 3-O-beta-glucopyranoside, 3-O-arabinoside, 3-O-beta-glucopyranosyl (1-->2)-beta-galactopyranoside, 3-O-beta-xylopyranosyl (1-->2)-beta-galactopyranoside, 3-O-alpha-rhamnopyranosyl (1-->2)-beta-galactopyranoside and kaempferol 3-beta-glucopyranoside were isolated and identified from the leaves of Asclepias incarnata, L. (Asclepiadaceae).

  20. Ocular toxicity secondary to asclepias physocarpa: the balloon plant

    OpenAIRE

    Pina, S; Pedrosa, C; Santos, C; Feijóo, B; Pego, P; Vendrell, C; Santos, MJ; Prieto, I

    2014-01-01

    We report a case of a 65-year-old woman with symptoms of blurred vision and ocular irritation a few hours after accidental contact of the right eye with Asclepias physocarpa milky latex. Observation showed a diffuse conjunctival hyperemia and stromal corneal edema with Descemet's membrane folds. Recovery was fast and apparently complete in less than one month. However, specular microscopy at 6-months follow-up showed an abnormal endothelial morphology as sequelae, suggesting this condition is...

  1. Poor sequestration of toxic host plant cardenolides and their rapid loss in the milkweed butterfly Danaus chrysippus (Lepidoptera: Nymphalidae: Danainae: Danaini).

    Science.gov (United States)

    Mebs, Dietrich; Wunder, Cora; Toennes, Stefan W

    2017-06-01

    Butterflies of the genus Danaus are known to sequester toxic cardenolides from milkweed host plants (Apocynaceae). In particular, Danaus plexippus efficiently sequesters and stores these compounds, whereas D. chrysippus, is considered to poorly sequester cardenolides. To estimate its sequestration capability compared with that of D. plexippus, larvae of both species were jointly reared on Asclepias curassavica and the major cardenolides of the host plant, calotropin and calactin, were analyzed in adults sampled at different time intervals after eclosion. Both cardenolides were detected in body and wings of D. plexippus. Whereas the calotropin-concentration remained constant over a period of 24 days, that of calactin steadily decreased. In the body, but not in the wings of D. chrysippus, calactin only was detected in low amounts, which was then almost completely lost during the following 8 days after eclosion, suggesting that in contrast to D. plexippus, cardenolides seem to be less important for that butterfly's defence against predators. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Evaluation of Indian milkweed (Calotropis gigantea) seed oil as alternative feedstock for biodiesel

    Science.gov (United States)

    Calotropis gigantea (Indian milkweed) is a common plant in Asia that grows as a weed on open waste ground. Flowering and fruiting take place throughout the year. In this study, Indian milkweed oil was evaluated as a potential feedstock for biodiesel production. The oil was extracted from Indian milk...

  3. Milkweed: A resource for increasing stink bug parasitism and aiding insect pollinator and monarch butterfly conservation

    Science.gov (United States)

    The flowers of milkweed species can produce a rich supply of nectar, and therefore, planting an insecticide-free milkweed habitat in agricultural farmscapes could possibly conserve monarch butterflies, bees and other insect pollinators, as well as enhance parasitism of insect pests. In peanut-cotton...

  4. Monarch butterfly oviposition preference supports a diversity of milkweed species on the landscape

    Science.gov (United States)

    Over the past two decades, the population of monarch butterflies east of the Rocky Mountains has experienced a significant decline in overwintering numbers. Habitat restoration that includes planting milkweeds is essential to boost monarch numbers within the breeding range. Milkweeds are the only ho...

  5. Cytotoxic cardiac glycosides and other compounds from Asclepias syriaca.

    Science.gov (United States)

    Araya, Juan J; Kindscher, Kelly; Timmermann, Barbara N

    2012-03-23

    Phytochemical investigation of the dried biomass of Asclepias syriaca afforded five new compounds (1-5), along with 19 known structures. Overall, the secondary metabolites isolated and identified from this plant showed a wide structural diversity including pentacyclic triterpenes, cardiac glycosides, flavonoid glycosides, lignans, a phenylethanoid, and a glycosylated megastigmane. In addition, the isolates were tested against the cancer breast cell line Hs578T, and those showing IC(50) values lower than 50 μM (1 and 6-9) were further investigated in three additional breast cancer cell lines (MCF-7, T47D, and Sk-Br-3) and the normal breast cell line Hs578Bst.

  6. Ocular Toxicity Secondary to Asclepias physocarpa: The Balloon Plant

    Directory of Open Access Journals (Sweden)

    Susana Pina

    2014-01-01

    Full Text Available We report a case of a 65-year-old woman with symptoms of blurred vision and ocular irritation a few hours after accidental contact of the right eye with Asclepias physocarpa milky latex. Observation showed a diffuse conjunctival hyperemia and stromal corneal edema with Descemet’s membrane folds. Recovery was fast and apparently complete in less than one month. However, specular microscopy at 6-months follow-up showed an abnormal endothelial morphology as sequelae, suggesting this condition is not as innocuous as it has been suggested.

  7. Ocular Toxicity Secondary to Asclepias physocarpa: The Balloon Plant.

    Science.gov (United States)

    Pina, Susana; Pedrosa, Catarina; Santos, Cristina; Feijóo, Bernardo; Pego, Peter; Vendrell, Cristina; Santos, Maria João; Prieto, Isabel

    2014-01-01

    We report a case of a 65-year-old woman with symptoms of blurred vision and ocular irritation a few hours after accidental contact of the right eye with Asclepias physocarpa milky latex. Observation showed a diffuse conjunctival hyperemia and stromal corneal edema with Descemet's membrane folds. Recovery was fast and apparently complete in less than one month. However, specular microscopy at 6-months follow-up showed an abnormal endothelial morphology as sequelae, suggesting this condition is not as innocuous as it has been suggested.

  8. Peat swamp forest of Thailand

    Energy Technology Data Exchange (ETDEWEB)

    Niyomdham, C.; Urapeepatanapong, C.; Pitayakajornwute, P. [Pikoolthong Royal Development Study Center, Bangkok (Thailand). Royal Forest Department

    1996-12-31

    Peat swamp forest in Thailand occurs extensively along coastal flatlands in the central and southern parts of the country and some small patches of topogenous peatland are present locally on several mountain tops of the northern region. Many have been deteriorated by recent extensive development programs. However, one large area, about 347.04 km{sup 2}, of ombrogenous peatland is still left intact in the Pru Toh Dang area where conservation activities are being strictly enforced under one of the Royal Initiative Projects. Pru Toh Dang peat consists of 5 metres of fibrous organic soil overlying pyritic marine clay. Despite an inhospitable, submerged and unstable forest floor, the floristic composition of the peat swamp forest is extremely complicated, consisting of 124 families and 470 species of which 109 families and 437 species of flowering plants, and 15 families and 33 species of ferns recorded between 1983-1989 by a team from the Forest Herbarium of the Royal Forest Department of Thailand. (orig.) (4 refs.)

  9. Climate niches of milkweeds with plesiomorphic traits (Secamonoideae; Apocynaceae) and the milkweed sister group link ancient African climates and floral evolution.

    Science.gov (United States)

    Livshultz, Tatyana; Mead, Jerry V; Goyder, David J; Brannin, Michelle

    2011-12-01

    Climate change that increases mortality of plants and pollinators can create mate-finding Allee effects and thus act as a strong selective force on floral morphology. Milkweeds (Secamonoideae and Asclepiadoideae; Apocynaceae) are typically small plants of seasonally dry habitats, with pollinia and high pollen-transfer efficiency. Their sister group (tribe Baisseeae and Dewevrella) is mostly comprised of giant lianas of African rainforests, with pollen in monads. Comparison of the two groups motivated a new hypothesis: milkweeds evolved in the context of African aridification and the shifting of rainforest to dry forest. Pollinia and high pollen-transfer efficiency may have been adaptations that alleviated mate-finding Allee effects generated by high mortality during droughts. We formally tested whether milkweeds have a drier climate niche by comparing milkweeds with plesiomorphic traits (Secamonoideae) and the milkweed sister group in continental Africa. We georeferenced specimens of the milkweed sister group and Secamonoideae in continental Africa, extracted 19 climatic variables from the Worldclim model, conducted factor analysis to identify correlated suites of variables, and compared the frequency distributions of the two lineages relative to each factor. The distributions of Secamonoideae and the milkweed sister group differed significantly relative to four factors, each correlated with a distinct suite of climate parameters: (1) air temperature (Secamonoideae: cooler), (2) total and (3) summer precipitation (Secamonoideae: drier), and (4) temperature seasonality and isothermality (Secamonoideae: more seasonal and less isothermal). Secamonoideae in continental Africa inhabit drier, cooler sites than do the milkweed sister group, consistent with a shift from rainforests to dry forests in a cooling climate.

  10. Kennedy Space Center: Swamp Works

    Science.gov (United States)

    DeFilippo, Anthony Robert

    2013-01-01

    When I began my internship with the Granular Mechanics and Regolith Operations laboratory (GMRO), also known as Swamp Works, I was given the unique opportunity to shadow many teams working on various projects, and decide what projects I wanted to take part in. Before I go into details of my experiences at Swamp Works, I would like to take a moment to explain what I discovered Swamp Works to be. Swamp Works is a family of hardworking, dedicated, and driven people from various backgrounds and skill sets. These people all work to advance technologies and make science fiction science fact through means of rapid prototyping. They support and encourage failure as an option when learning new things, as long as lesson learned from said failure. In fact, their motto states "Fail, Fast, Forward." What this means is, not if but when one fails he or she must do so quickly and spring forward from the failure so that his or her progress is not delayed. With this acceptance, it provided me the confidence to dive into a multitude of projects working in various fields and with a wide range of skill sets. The first project I joined was Badger. My motivation for taking on this project was the opportunity I would have to obtain valuable experience working with 3D modeling and 3D printing technologies. Badger was a digging apparatus to be used in a highly dusty environment in a material known as Regolith. Regolith is a scientific term for the dirt or top soil found on planetary bodies. Regolith contains a large quantity of sediments less than lOppm and as a result poses a challenge of keeping it out of any cracks and crevices. Furthermore, regolith can create high levels of electrostatic energy, which can prove damaging to sensitive electrical hardware. With these characteristics in mind, I decided to take on the task of designing and manufacturing a dust proof cover for the sensitive electrical hardware. When I began this project, I did not have the slightest idea as to how to use 3D

  11. Field responses of Prunus serotina and Asclepias syriaca to ozone around southern Lake Michigan

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, J.P. [U.S. Geological Survey and Institute for Environmental Studies, University of Wisconsin, Madison, WI 53706 (United States)]. E-mail: jpbennet@wisc.edu; Jepsen, E.A. [Bureau of Air Management, Wisconsin Department of Natural Resources, Madison, WI 53707 (United States); Roth, J.A. [Bureau of Air Management, Wisconsin Department of Natural Resources, Madison, WI 53707 (United States)

    2006-07-15

    Higher ozone concentrations east of southern Lake Michigan compared to west of the lake were used to test hypotheses about injury and growth effects on two plant species. We measured approximately 1000 black cherry trees and over 3000 milkweed stems from 1999 to 2001 for this purpose. Black cherry branch elongation and milkweed growth and pod formation were significantly higher west of Lake Michigan while ozone injury was greater east of Lake Michigan. Using classification and regression tree (CART) analyses we determined that departures from normal precipitation, soil nitrogen and ozone exposure/peak hourly concentrations were the most important variables affecting cherry branch elongation, and milkweed stem height and pod formation. The effects of ozone were not consistently comparable with the effects of soil nutrients, weather, insect or disease injury, and depended on species. Ozone SUM06 exposures greater than 13 ppm-h decreased cherry branch elongation 18%; peak 1-h exposures greater than 93 ppb reduced milkweed stem height 13%; and peak 1-h concentrations greater than 98 ppb reduced pod formation 11% in milkweed. - Decreased cherry branch elongation, milkweed stem height and pod production, and foliar injury on both species occurred at sites around southern Lake Michigan at ozone exposures of 13 SUM06 ppm-h and 93-98 ppb peak hourly.

  12. Field responses of Prunus serotina and Asclepias syriaca to ozone around southern Lake Michigan

    International Nuclear Information System (INIS)

    Bennett, J.P.; Jepsen, E.A.; Roth, J.A.

    2006-01-01

    Higher ozone concentrations east of southern Lake Michigan compared to west of the lake were used to test hypotheses about injury and growth effects on two plant species. We measured approximately 1000 black cherry trees and over 3000 milkweed stems from 1999 to 2001 for this purpose. Black cherry branch elongation and milkweed growth and pod formation were significantly higher west of Lake Michigan while ozone injury was greater east of Lake Michigan. Using classification and regression tree (CART) analyses we determined that departures from normal precipitation, soil nitrogen and ozone exposure/peak hourly concentrations were the most important variables affecting cherry branch elongation, and milkweed stem height and pod formation. The effects of ozone were not consistently comparable with the effects of soil nutrients, weather, insect or disease injury, and depended on species. Ozone SUM06 exposures greater than 13 ppm-h decreased cherry branch elongation 18%; peak 1-h exposures greater than 93 ppb reduced milkweed stem height 13%; and peak 1-h concentrations greater than 98 ppb reduced pod formation 11% in milkweed. - Decreased cherry branch elongation, milkweed stem height and pod production, and foliar injury on both species occurred at sites around southern Lake Michigan at ozone exposures of 13 SUM06 ppm-h and 93-98 ppb peak hourly

  13. Palp-faction: an African milkweed dismembers its wasp pollinators.

    Science.gov (United States)

    Shuttleworth, Adam; Johnson, Steven D

    2009-06-01

    Interactions between pollinators and nectar-producing flowers are usually assumed to be mutualistic, but the exploitative basis of these relationships can lead to antagonistic interactions. Flowers of the African milkweed, Pachycarpus appendiculatus E. Mey, produce concentrated nectar that is consumed primarily by the large spider-hunting wasp Hemipepsis dedjas Guerin (Hymenoptera: Pompilidae). Pollinaria of this milkweed become attached to the palps of these wasps during nectar feeding. Broken wasp palps were found between guide rails, attached to corpuscula that were trapped behind the guide rails, and attached to pollinia that were inserted into the stigmatic chambers of the flowers. Approximately 85% of wasps captured on flowers of P. appendiculatus were missing one or more palps, whereas only 9% of wasps captured on flowers of another asclepiad species were missing any palps. It thus seems that wasps face a high risk of losing their palps when foraging on these flowers. The interaction may thus be antagonistic for the wasps if the cost of losing their sensory palps (not yet established) is greater than the benefits of the nectar reward. The plants, however, gain clear benefit from the interaction, as verified by the removal and insertion of pollinia in flowers exposed solely to visits by pompilid wasps.

  14. Evolution at the tips: Asclepias phylogenomics and new perspectives on leaf surfaces.

    Science.gov (United States)

    Fishbein, Mark; Straub, Shannon C K; Boutte, Julien; Hansen, Kimberly; Cronn, Richard C; Liston, Aaron

    2018-03-01

    Leaf surface traits, such as trichome density and wax production, mediate important ecological processes such as anti-herbivory defense and water-use efficiency. We present a phylogenetic analysis of Asclepias plastomes as a framework for analyzing the evolution of trichome density and presence of epicuticular waxes. We produced a maximum-likelihood phylogeny using plastomes of 103 species of Asclepias. We reconstructed ancestral states and used model comparisons in a likelihood framework to analyze character evolution across Asclepias. We resolved the backbone of Asclepias, placing the Sonoran Desert clade and Incarnatae clade as successive sisters to the remaining species. We present novel findings about leaf surface evolution of Asclepias-the ancestor is reconstructed as waxless and sparsely hairy, a macroevolutionary optimal trichome density is supported, and the rate of evolution of trichome density has accelerated. Increased sampling and selection of best-fitting models of evolution provide more resolved and robust estimates of phylogeny and character evolution than obtained in previous studies. Evolutionary inferences are more sensitive to character coding than model selection. © 2018 The Authors. American Journal of Botany is published by Wiley Periodicals, Inc. on behalf of the Botanical Society of America.

  15. Field responses of Prunus serotina and Asclepias syriaca to ozone around southern Lake Michigan.

    Science.gov (United States)

    Bennett, J P; Jepsen, E A; Roth, J A

    2006-07-01

    Higher ozone concentrations east of southern Lake Michigan compared to west of the lake were used to test hypotheses about injury and growth effects on two plant species. We measured approximately 1000 black cherry trees and over 3000 milkweed stems from 1999 to 2001 for this purpose. Black cherry branch elongation and milkweed growth and pod formation were significantly higher west of Lake Michigan while ozone injury was greater east of Lake Michigan. Using classification and regression tree (CART) analyses we determined that departures from normal precipitation, soil nitrogen and ozone exposure/peak hourly concentrations were the most important variables affecting cherry branch elongation, and milkweed stem height and pod formation. The effects of ozone were not consistently comparable with the effects of soil nutrients, weather, insect or disease injury, and depended on species. Ozone SUM06 exposures greater than 13 ppm-h decreased cherry branch elongation 18%; peak 1-h exposures greater than 93 ppb reduced milkweed stem height 13%; and peak 1-h concentrations greater than 98 ppb reduced pod formation 11% in milkweed.

  16. Studies on mangrove swamps of Goa 1. Heterotrophic bacterial flora from mangrove swamps

    Digital Repository Service at National Institute of Oceanography (India)

    Matondkar, S.G.P; Mathani, S; Mavinkurve, S

    Heterotrophic bacterial flora from the mangrove swamps of Goa consisted of physiologically active organisms exhibiting cellulolytic, pectinolytic, amylolytic, proteolytic and H2S forming activities, throughout the year. Coryneform and Bacillus were...

  17. Six new C21 steroidal glycosides from Asclepias curassavica L.

    Science.gov (United States)

    Li, Jun-Zhu; Liu, Hai-Yang; Lin, Yi-Ju; Hao, Xiao-Jiang; Ni, Wei; Chen, Chang-Xiang

    2008-07-01

    Six new C(21) steroidal glycosides, named curassavosides A-F (3-8), were obtained from the aerial parts of Asclepias curassavica (Asclepiadaceae), along with two known oxypregnanes, 12-O-benzoyldeacylmetaplexigenin (1) and 12-O-benzoylsarcostin (2). By spectroscopic methods, the structures of the six new compounds were determined as 12-O-benzoyldeacylmetaplexigenin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (3), 12-O-benzoylsarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (4), sarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (5), sarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-digitoxopyranoside (6), 12-O-benzoyldeacylmetaplexigenin 3-O-beta-D-glucopyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-d-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (7), and 12-O-benzoylsarcostin 3-O-beta-D-glucopyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-d-canaropyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (8), respectively. All compounds (1-8) were tested for in vitro cytotoxicity; only compound 3 showed weak inhibitory activity against Raji and AGZY cell lines.

  18. New cardenolide and acylated lignan glycosides from the aerial parts of Asclepias curassavica.

    Science.gov (United States)

    Warashina, Tsutomu; Shikata, Kimiko; Miyase, Toshio; Fujii, Satoshi; Noro, Tadataka

    2008-08-01

    Three new cardenolide glycosides and six new acylated lignan glycosides were obtained along with nineteen known compounds from the aerial parts of Asclepias curassavica L. (Asclepiadaceae). The structure of each compound was determined based on interpretations of NMR and MS measurements and chemical evidence.

  19. Antiproliferative and apoptotic activities of extracts of Asclepias subulata.

    Science.gov (United States)

    Rascón Valenzuela, Luisa Alondra; Jiménez Estrada, Manuel; Velázquez Contreras, Carlos Arturo; Garibay Escobar, Adriana; Medina Juárez, Luis Angel; Gámez Meza, Nohemi; Robles Zepeda, Ramón Enrique

    2015-01-01

    Asclepias subulata Decne. (Apocynaceae) is a shrub used in the Mexican traditional medicine for the treatment of cancer. The objective of this study was to evaluate the antiproliferative activity of methanol extract of aerial parts of A. subulata and its fractions against different cancer cell lines. Additionally, we analyzed the mechanism of action of the active fractions. Methanol extract fractions were prepared by serial extraction with n-hexane, ethyl acetate, and ethanol. The antiproliferative activity of methanol extract and its fractions was evaluated, against several murine (M12.C3.F6, RAW 264.7, and L929) and human (HeLa, A549, PC-3, LS 180, and ARPE-19) cell lines by the MTT assay, using concentrations of 0.4-400 µg/mL for 48 h. Ethanol and residual fractions were separated using silica gel column. Apoptosis induction of cancer cells was evaluated by Annexin and JC-1 staining using flow cytometry. Methanol extract and its fractions showed antiproliferative activity against all human cancer cell lines tested. Methanol extract had the highest antiproliferative activity on A549 and HeLa cells (IC50 values < 0.4 and 8.7 µg/mL, respectively). Ethanol and residual fractions exerted significant antiproliferative effect on A549 (IC50 < 0.4 µg/mL) and PC3 cells (IC50 1.4 and 5.1 µg/mL). Apoptotic assays showed that CEF7, CEF9, CRF6, and CRF5 fractions induced mitochondrial depolarization in A549 cells, 70, 73, 77, and 80%, respectively. Those fractions triggered the apoptosis mitochondrial pathway. Our data show that A. subulata extracts have potent antiproliferative properties on human cancer cell lines. This plant should be considered an important source of potent anticancer compounds.

  20. Antiproliferative activity of cardenolide glycosides from Asclepias subulata.

    Science.gov (United States)

    Rascón-Valenzuela, L; Velázquez, C; Garibay-Escobar, A; Medina-Juárez, L A; Vilegas, W; Robles-Zepeda, R E

    2015-08-02

    Asclepias subulata Decne. is a shrub occurring in Sonora-Arizona desert (Mexico-USA). The ethnic groups, Seris and Pimas, use this plant for the treatment of sore eyes, gastrointestinal disorders and cancer. To isolate the compounds responsible for antiproliferative activity of the methanol extract of A. subulata. A bioguided fractionation of methanol extract of A. subulata was performed using MTT assay to measure the antiproliferative activity of different compounds on three human cancer cell lines (A549, LS 180 and PC-3), one murine cancer cell line (RAW 264.7) and one human normal cell line (ARPE-19). The methanol extract was partitioned with hexane, ethyl acetate and ethanol. The active fractions, ethanol and residual, were fractioned by silica-column chromatography and active sub-fractions were separated using HPLC. The chemical structures of isolated compounds were elucidated with different chemical and spectroscopic methods. A new cardenolide glycoside, 12, 16-dihydroxycalotropin, and three known, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin, were isolated of active sub-fractions. All isolated compounds showed a strong antiproliferative activity in human cancer cells. Calotropin was the more active with IC50 values of 0.0013, 0.06 and 0.41 µM on A549, LS 180 and PC-3 cell lines, respectively; while 12, 16-dihydroxycalotropin reached values of 2.48, 5.62 and 11.70 µM, on the same cells; corotoxigenin 3-O-glucopyranoside had IC50 of 2.64, 3.15 and 6.62 µM and desglucouzarin showed values of 0.90, 6.57 and 6.62, µM. Doxorubicin, positive control, showed IC50 values of 1.78, 6.99 and 3.18 µM, respectively. The isolated compounds had a weak effect on murine cancer cells and human normal cells, exhibiting selectivity to human cancer cells. In this study, we found that 12, 16-dihydroxicalotropin, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin are responsible of antiproliferative properties of A. subulata, and that these

  1. Apoptotic activities of cardenolide glycosides from Asclepias subulata.

    Science.gov (United States)

    Rascón-Valenzuela, L A; Velázquez, C; Garibay-Escobar, A; Vilegas, W; Medina-Juárez, L A; Gámez-Meza, N; Robles-Zepeda, R E

    2016-12-04

    Asclepias subulata Decne. (Apocynaceae) is a shrub occurring in Sonora-Arizona desert. The ethnic groups of Sonora, Mexico, Seris and Pimas, use this plant for the treatment of sore eyes, gastrointestinal disorders and cancer. To determine the cell death pathways that the cardenolide glycosides with antiproliferative activity found in the methanol extract of A. subulata are able to activate. The effect of cardenolide glycosides isolated of A. subulata on induction of apoptosis in cancer cells was evaluated through the measuring of several key events of apoptosis. A549 cells were treated for 12h with doses of 3.0, 0.2, 3.0 and 1.0µM of 12, 16-dihydroxicalotropin, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin, respectively. Apoptotic and necrotic cell levels were measured by double staining with annexin V-FITC/PI. Mitochondrial membrane depolarization was examined through JC-1 staining. Apoptosis cell death and the apoptosis pathways activated by cardenolide glycosides isolated of A. subulata were further characterized by the measurement of caspase-3, caspase-8 and caspase-9 activity. Apoptotic assays showed that the four cardenolide glycosides isolated of A. subulata induced apoptosis in A549 cells, which was evidencing by phosphatidylserine externalization in 18.2%, 17.0%, 23.9% and 22.0% for 12, 16-dihydroxicalotropin, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin, respectively, compared with 4.6% of control cells. Cell death was also associated with a decrease in mitochondrial membrane potential, which was more than 75% in the treated cultures respect to control. The activation of caspase-3 was observed in all cardenolide glycosides-treated cancer cells indicating the caspase-dependent apoptosis of A549 cells. Extrinsic and intrinsic apoptosis pathways were activated by cardenolide glycosides treatment at the doses tested. In this study was found that cardenolide glycosides, 12, 16-dihydroxicalotropin, calotropin

  2. Synthesis of formyl esters of vegetable oils: Milkweed, Pennycress and Soy

    Science.gov (United States)

    In a previous study of the characteristics of acyl derivatives of polyhydroxy milkweed oil (PHMWO), it was observed that the densities and viscosities of the respective derivatives decreased with increased chain length of the substituent acyl group. Thus, from the polyhydroxyl starting material, att...

  3. Secondary Defense Chemicals in Milkweed Reduce Parasite Infection in Monarch Butterflies, Danaus plexippus.

    Science.gov (United States)

    Gowler, Camden D; Leon, Kristoffer E; Hunter, Mark D; de Roode, Jacobus C

    2015-06-01

    In tri-trophic systems, herbivores may benefit from their host plants in fighting parasitic infections. Plants can provide parasite resistance in two contrasting ways: either directly, by interfering with the parasite, or indirectly, by increasing herbivore immunity or health. In monarch butterflies, the larval diet of milkweed strongly influences the fitness of a common protozoan parasite. Toxic secondary plant chemicals known as cardenolides correlate strongly with parasite resistance of the host, with greater cardenolide concentrations in the larval diet leading to lower parasite growth. However, milkweed cardenolides may covary with other indices of plant quality including nutrients, and a direct experimental link between cardenolides and parasite performance has not been established. To determine if the anti-parasitic activity of milkweeds is indeed due to secondary chemicals, as opposed to nutrition, we supplemented the diet of infected and uninfected monarch larvae with milkweed latex, which contains cardenolides but no nutrients. Across three experiments, increased dietary cardenolide concentrations reduced parasite growth in infected monarchs, which consequently had longer lifespans. However, uninfected monarchs showed no differences in lifespan across treatments, confirming that cardenolide-containing latex does not increase general health. Our results suggest that cardenolides are a driving force behind plant-derived resistance in this system.

  4. Integral handling of the swamps for indigenous communities - Caribbean of Colombia

    International Nuclear Information System (INIS)

    Sanchez Paez, Heliodoro; Ulloa Delgado Giovanni, Andres; Tavera Escobar, Hector Arsenio

    2004-06-01

    The book includes topics like the ecosystems of swamps, zonification for its handling, growth of species of swamps, restoration and vegetation, integral plan of handling of swamps and its fauna among other topics

  5. Gulf-Wide Information System, Environmental Sensitivity Index Swamps, Geographic NAD83, LDWF (2001) [esi_swamp_LDWF_2001

    Data.gov (United States)

    Louisiana Geographic Information Center — This data set contains Environmental Sensitivity Index (ESI) swamps data of coastal Louisiana. The ESI is a classification and ranking system, which characterizes...

  6. Study of oil sorption behavior of filled and structured fiber assemblies made from polypropylene, kapok and milkweed fibers.

    Science.gov (United States)

    Rengasamy, R S; Das, Dipayan; Karan, C Praba

    2011-02-15

    This article reports on oil sorption behavior of fiber assemblies made up of single natural and synthetic fibers as well as blend of natural and synthetic fibers when tested with high density oil and diesel oil. A series of filled fiber assemblies were prepared from 100% polypropylene, kapok, and milkweed fibers and another series of bonded structured fiber assemblies were prepared from a 70/30 blend of kapok and polypropylene fibers and a 70/30 blend of milkweed and polypropylene fibers. It was observed that the porosity of the fiber assemblies played a very important role in determining its oil sorption capacity. The polypropylene fiber assembly exhibited the highest sorption capacity (g/g) followed by the kapok and milkweed fiber assemblies at porosity milkweed fibers have intra fiber porosities of 0.81 and 0.83, respectively. All the fiber assemblies showed higher oil sorption capacity with the high density oil as compared to the diesel oil. As the kapok and milkweed fiber have low cellulose content, hence their slow degradation is an advantage in fresh and marine water applications. The good sorption capacity of kapok and milkweed fiber assemblies along with their bio-degradable nature offer great scope for structuring them into fiber assemblies with large porosity and uniform pores to have efficient oil sorbents. Copyright © 2010 Elsevier B.V. All rights reserved.

  7. Swamp Rice Production in Ogun Waterside Local Government Area ...

    African Journals Online (AJOL)

    This study examined the economics of swamp rice production among peasant farmers in the Waterside Local Government Area of Ogun State for 2001 cropping year. A total of 50 swamp rice farmers were randomly selected from 5 villages using multistage sampling technique. The data collected, with the aid of ...

  8. Economic analysis of swamp rice production in Ebonyi Southern ...

    African Journals Online (AJOL)

    The aim of the paper is to analyze the determinants and profitability of the output of swamp rice farmers in Ebonyi southern Agricultural zone of Ebonyi State. Primary data were obtained through the use of structured questionnaires. A total of eighty (80) swamp rice farmers were randomly selected from the different blocks ...

  9. Analysis of Technical Efficiency among Swamp Rice Farmers in ...

    African Journals Online (AJOL)

    This study was conducted to evaluate the Technical efficiency among swamp rice farmers in Niger State, Nigeria. A multi-stage sampling technique was used to select 159 swamp rice farmers. The data collected were analysed using descriptive statistics, and the stochastic frontier production function. The results showed ...

  10. Diagnose of the ingestion of Asclepias mellodora St. Hil. by sheep through microhistological analysis of their digestive contents

    Directory of Open Access Journals (Sweden)

    María Silvia Cid

    2011-02-01

    Full Text Available Asclepias mellodora St. Hil. is a native acute toxic species frequent in the grasslands of the Buenos Aires province, Argentina, whose toxicity had not been assessed until now. This study evaluates the minimal lethal dose of this species for sheep, and the possibility of microscopically recognizing its fragments in gastrointestinal contents as a complementary diagnostic tool in necropsies. Three Frisona sheep (average LW=55±4.5 kg were dosed via an esophageal tube with each one of the following doses of asclepias: 8.0, 5.0, 2.0 and 0.8 g DM.kg LW-1. Sheep poisoned with the three higher doses died between 10 and 85 h after intoxication, but those receiving the lower dose did not. During necropsies we: 1 determined the dry weight of the contents of rumen+reticulum, omasum+abomasum, and large intestine, 2 estimated the percentages of asclepias fragments by microanalysis correcting for digestion effects on fragment recognition, and 3 calculated the total mass of asclepias in the digestive tract of each animal. For the three higher doses, the mass of asclepias identified in the total ingesta was 12.3±3.4% of the amount supplied, possibly because of the strong diarrhea its ingestion produced. The percentages of asclepias in rumen+reticulum did not differ from the average quantified for the entire tract. The results of this study indicate that the minimal lethal doses of asclepias for sheep is between 2.0 and 0.8g DM·kg LW-1, and that the microhistological analysis of the rumen+reticulum, the easiest region to sample, can be used to confirm the ingestion of this toxic species, although the estimated percentage will be not a good estimator of the ingested percentage.

  11. Thrombin like activity of Asclepias curassavica L. latex: action of cysteine proteases.

    Science.gov (United States)

    Shivaprasad, H V; Rajesh, R; Nanda, B L; Dharmappa, K K; Vishwanath, B S

    2009-05-04

    To validate the scientific basis of plant latex to stop bleeding on fresh cuts. Cysteine protease(s) from Asclepias curassavica (Asclepiadaceae) plant latex was assessed for pro-coagulant and thrombin like activities. A waxy material from the latex of Asclepias curassavica latex was removed by freezing and thawing. The resulted latex enzyme fraction was assayed for proteolytic activity using denatured casein as substrate. Its coagulant activity and thrombin like activity were determined using citrated plasma and pure fibrinogen, respectively. Inhibition studies were performed using specific protease inhibitors to know the type of protease. The latex enzyme fraction exhibited strong proteolytic activity when compared to trypsin and exerted pro-coagulant action by reducing plasma clotting time from 195 to 58 s whereas trypsin reduced clotting time marginally from 195 to 155 s. The pro-coagulant activity of this enzyme fraction was exerted by selectively hydrolyzing A alpha and B beta subunits of fibrinogen to form fibrin clot when pure fibrinogen was used as substrate as assessed by fibrinogen-agarose plate method and fibrinogen polymerization assay. Trypsin failed to induce any fibrin clot under similar conditions. The electrophoretic pattern of latex enzyme fraction-induced fibrin clot was very much similar to that of thrombin-induced fibrin clot and mimic thrombin like action. The proteolytic activity including thrombin like activity of Asclepias curassavica latex enzyme fraction was completely inhibited by iodoaceticacid (IAA). Cysteine proteases from Asclepias curassavica latex exhibited strong pro-coagulant action and were found to be specific in its action (Thrombin like). This could be the basis for the use of plant latex in pharmacological applications that justify their use as folk medicine.

  12. 8,14-Secopregnane glycosides from the aerial parts of Asclepias tuberosa.

    Science.gov (United States)

    Warashina, Tsutomu; Noro, Tadataka

    2009-07-01

    Twenty pregnane glycosides, tuberoside A(1)-L(5), were isolated from the diethyl ether-soluble fraction of the MeOH extract from the aerial parts of Asclepias tuberosa (Asclepiadaceae). The pregnane glycosides were composed of 8,12;8,20-diepoxy-8,14-secopregnane as aglycon, and D-cymarose, D-oleandrose, D-digitoxose and/or D-glucose as the component sugars. Their structures were established using NMR spectroscopic analysis and chemical methodologies.

  13. Kaempferol and its glycosides in the seeds hair of Asclepias syriaca L.

    Science.gov (United States)

    Sikorska, M; Matławska, I; Frański, R

    2001-01-01

    The following flavonoid compounds have been isolated and identified from the seeds hair of Asclepias syriaca L.: kaempferol, kaempferol 3-O-beta-galactopyranoside, kaempferol 3-O-beta-xylopyranosyl (1 --> 2)-beta-galactopyranoside, kaempferol 3-O-beta-glucopyranosyl (1 --> 2)-beta-galactopyranoside, kaempferol 3-O-alpha-rhamnopyranosyl (1 --> 2)-beta-galactopyranoside. Their structures were established by acid hydrolysis, H2O2 oxidation and spectral analysis (UV, 1H, 3C NMR, MS).

  14. The scientific value and potential of New Zealand swamp kauri

    Science.gov (United States)

    Lorrey, Andrew M.; Boswijk, Gretel; Hogg, Alan; Palmer, Jonathan G.; Turney, Christian S. M.; Fowler, Anthony M.; Ogden, John; Woolley, John-Mark

    2018-03-01

    New Zealand swamp kauri (Agathis australis) are relic trees that have been buried and preserved in anoxic bog environments of northern New Zealand for centuries through to hundreds of millennia. Kauri are massive in proportion to other native New Zealand trees and they can attain ages greater than 1000 years. The export market for swamp (subfossil) kauri has recently been driven by demand for a high-value workable timber, but there are concerns about the sustainability of the remaining resource, a situation exacerbated in recent years by the rapid extraction of wood. Economic exploitation of swamp kauri presents several unique opportunities for Quaternary science, however the scientific value of this wood is not well understood by the wider research community and public. Here, we summarise the history of scientific research on swamp kauri, and explore the considerable potential of this unique resource. Swamp kauri tree-ring chronologies are temporally unique, and secondary analyses (such as radiocarbon and isotopic analyses) have value for improving our understanding of Earth's recent geologic history and pre-instrumental climate history. Swamp kauri deposits that span the last interglacial-glacial cycle show potential to yield "ultra-long" multi-millennia tree-ring chronologies, and composite records spanning large parts of MIS3 (and most of the Holocene) may be possible. High-precision radiocarbon dating of swamp kauri chronologies can improve the resolution of the global radiocarbon calibration curve, while testing age modelling and chronologic alignment of other independent long-term high-resolution proxy records. Swamp kauri also has the potential to facilitate absolute dating and verification of cosmogenic events found in long Northern Hemisphere tree-ring chronologies. Future efforts to conserve these identified values requires scientists to work closely with swamp kauri industry operators, resource consent authorities, and export regulators to mitigate

  15. Monitoring of BHT-quinone and BHT-CHO in the gas of capsules of Asclepias physocarpa.

    Science.gov (United States)

    Ma, Bing-Ji; Peng, Hua; Liu, Ji-Kai

    2006-01-01

    Three volatile components, namely benzoic acid ethyl ester (1), 2,6-di-tert-butyl-p-benzoquinone (BHT-quinone) (2), and 3,5-di-tert-butyl-4-hydroxybenzaldehyde (BHT-CHO) (3), were detected from the gas in the capsules of Asclepias physocarpa by means of GC/MS analysis. BHT-quinone and BHT-CHO as organic pollutants are the degradation products of the antioxidant 2,6-di-tert-butyl-4-methylphenol (BHT). Ground water, lake water and/or rain water are a source of BHT metabolites in the plant Asclepias physocarpa.

  16. The fungal flora of the mangrove swamps of Goa

    Digital Repository Service at National Institute of Oceanography (India)

    Matondkar, S.G.P.; Mahtani, S.; Mavinkurve, S.

    Mangrove swamps of Goa (India) showed the presence of fungi belonging to 14 different genera, predominant ones being Monilia, Mucor, Syncephalastrum, Aspergillus and Trichothecium. Most of the isolates were found to be physiologically active...

  17. Regeneration potential of Taxodium distichum swamps and climate change

    Science.gov (United States)

    Middleton, B.A.

    2009-01-01

    Seed bank densities respond to factors across local to landscape scales, and therefore, knowledge of these responses may be necessary in forecasting the effects of climate change on the regeneration of species. This study relates the seed bank densities of species of Taxodium distichum swamps to local water regime and regional climate factors at five latitudes across the Mississippi River Alluvial Valley from southern Illinois to Louisiana. In an outdoor nursery setting, the seed banks of twenty-five swamps were exposed to non-flooded (freely drained) or flooded treatments, and the number and species of seeds germinating were recorded from each swamp during one growing season. Based on ANOVA analysis, the majority of dominant species had a higher rate of germination in non-flooded versus flooded treatments. Similarly, an NMS comparison, which considered the local water regime and regional climate of the swamps, found that the species of seeds germinating, almost completely shifted under non-flooded versus flooded treatments. For example, in wetter northern swamps, seeds of Taxodium distichum germinated in non-flooded conditions, but did not germinate from the same seed banks in flooded conditions. In wetter southern swamps, seeds of Eleocharis cellulosa germinated in flooded conditions, but did not germinate in non-flooded conditions. The strong relationship of seed germination and density relationships with local water regime and regional climate variables suggests that the forecasting of climate change effects on swamps and other wetlands needs to consider a variety of interrelated variables to make adequate projections of the regeneration responses of species to climate change. Because regeneration is an important aspect of species maintenance and restoration, climate drying could influence the species distribution of these swamps in the future. ?? 2008 Springer Science+Business Media B.V.

  18. Results of the 2000 Creek Plantation Swamp Survey

    International Nuclear Information System (INIS)

    Fledderman, P.D.

    2000-01-01

    This report is a survey of the Creek Plantation located along the Savannah River and borders the southeast portion of the Savannah River Site. The land is primarily undeveloped and agricultural; its purpose is to engage in equestrian-related operations. A portion of Creek Plantation along the Savannah River is a low-lying swamp, known as the Savannah River Swamp, which is uninhabited and not easily accessible

  19. Verticillosides A-M: Polyoxygenated pregnane glycosides from Asclepias verticillata L.

    Science.gov (United States)

    Araya, Juan J; Binns, Franklin; Kindscher, Kelly; Timmermann, Barbara N

    2012-06-01

    As part of our ongoing effort to explore the chemical diversity of plants of the United States Midwest region, the isolation and identification of 13 pregnane glycosides named verticillosides A-M from Asclepias verticillata L. are reported. The structures of these compounds were elucidated by various spectroscopic techniques, including 1D and 2D NMR, IR, UV, and HRMS. The cytotoxicity of the isolates was evaluated against paired breast cell lines Hs578T (cancer) and Hs578Bst (normal), however, no significant growth inhibition was observed. Copyright © 2012 Elsevier Ltd. All rights reserved.

  20. Kaempferol, isorhamnetin and their glycosides in the flowers of Asclepias syriaca L.

    Science.gov (United States)

    Sikorska, M; Matławska, I

    2001-01-01

    The following flavonoid compounds have been isolated and identified from the flowers of Asclepias svriaca L.: kaempferol, kaempferol 7-O-beta-glucoside, kaempferol 3-O-beta-galactopyranoside, kaempferol 3-O-beta-xylopyranosyl (1-->2)-beta-galactopyranoside, kaempferol 3-O-beta-glucopyranosyl (1-->2)-beta-galactopyranoside, isorhamnetin, isorhamnetin 7-O-beta-glucoside, isorhamnetin 3-O-beta-galactoside and isorhamnetin 3-O-beta-xylopyranosyl (1-->2)-beta-galactopyranoside. Their structures were established by conventional (acid, enzymatic hydrolysis and H2O2 oxidation) and spectral analysis (UV, 1H NMR, 13C NMR).

  1. Assessment of atmospheric pollution level using Asclepias procera leaves as biomonitor

    Energy Technology Data Exchange (ETDEWEB)

    Daud, M.; Khalid, N.; Ahmad, S. [Pakistan Inst. of Nuclear Science and Technology, Islamabad (Pakistan). Nuclear Chemistry Div.; Iqbal, J. [University of the Punjab, Lahore (Pakistan). Inst. of Chemistry

    2007-07-01

    The potential of Asclepias procera plant leaves as biomonitor for air pollution monitoring has been explored by analyzing 36 elements in the leaf samples employing Instrumental Neutron Activation Analysis (INAA) and Atomic Absorption Spectrometric (AAS) techniques. The leaf samples were collected in summer and winter seasons from urban areas of Islamabad with different anthropogenic activities as well as from a rural area as a reference site. The soil samples of the respective sites were also analyzed. The reliability of the methods used was established by analyzing the certified reference materials under identical experimental conditions and comparing the results obtained with the certified values, which are in quite good agreement with each other. Pollution Load Index (PLI) of the determined elements was computed and is discussed accordingly. The uptake of metals from soil to roots, stem and leaves has also been investigated by analyzing these parts of the same plant. The results suggest that the leaves of Asclepias procera plant have a good potential to indicate the air pollution levels both in the vicinity of industrial as well as near roadside areas. (orig.)

  2. Assessment of atmospheric pollution level using Asclepias procera leaves as biomonitor

    International Nuclear Information System (INIS)

    Daud, M.; Khalid, N.; Ahmad, S.; Iqbal, J.

    2007-01-01

    The potential of Asclepias procera plant leaves as biomonitor for air pollution monitoring has been explored by analyzing 36 elements in the leaf samples employing Instrumental Neutron Activation Analysis (INAA) and Atomic Absorption Spectrometric (AAS) techniques. The leaf samples were collected in summer and winter seasons from urban areas of Islamabad with different anthropogenic activities as well as from a rural area as a reference site. The soil samples of the respective sites were also analyzed. The reliability of the methods used was established by analyzing the certified reference materials under identical experimental conditions and comparing the results obtained with the certified values, which are in quite good agreement with each other. Pollution Load Index (PLI) of the determined elements was computed and is discussed accordingly. The uptake of metals from soil to roots, stem and leaves has also been investigated by analyzing these parts of the same plant. The results suggest that the leaves of Asclepias procera plant have a good potential to indicate the air pollution levels both in the vicinity of industrial as well as near roadside areas. (orig.)

  3. Postpartum anoestrus in the suckled swamp buffalo

    International Nuclear Information System (INIS)

    Jainudeen, M.R.; Sharifuddin, W.; Yap, K.C.; Bakar Dahari, A.

    1984-01-01

    Postpartum anoestrus is a serious cause of infertility in the swamp buffalo. Our studies have revealed that it is due to a failure in the resumption of ovarian cyclicity. Parity was inversely related to the calving interval being longer in primiparous than multiparous suckled buffaloes. This effect may be partly due to the higher nutrient demands for growth as well as for lactation in the primiparous animal. The effects of suckling on ovarian and pituitary function of postpartum buffaloes were investigated with the aid of radioimmunoassays for progesterone and luteinizing hormone (LH) as well as rectal palpation and laparoscopic inspection of the ovaries. The incidence of postpartum anoestrus was higher in suckled than non-suckled buffaloes. Weaning buffalo calves at 30 d postpartum resulted in the resumption of normal ovarian cycles within 60 d postpartum. LH release in response to a single injection of a synthetic gonadotropin-releasing hormone (GnRH) indicated that pituitary responsiveness to GnRH was restored by Day 30 postpartum in suckled buffaloes whereas anoestrous buffaloes were able to release levels of LH comparable to that of the preovulatory surge. A progesterone-releasing intra-vaginal device (PRID) induced an anovulatory oestrus in the anoestrous suckled buffalo which was partially overcome by human chorionic gonadotropin (HCG) administered at the induced oestrus. However, a 72 h separation of the calf from its dam combined with PRID was the most effective substitute to weaning in initiating ovarian cycles in the suckled buffalo. Our data suggest that suckling inhibits ovarian function not by an effect on the pituitary gland but rather on GnRH release by the hypothalamus. (author)

  4. Benefits of Riverine Water Discharge into the Lorian Swamp, Kenya

    Directory of Open Access Journals (Sweden)

    Zipporah Musyimi

    2012-12-01

    Full Text Available Use and retention of river water in African highlands deprive communities in arid lowlands of their benefits. This paper reviews information on water use in the Ewaso Ng’iro catchment, Kenya, to evaluate the effects of upstream abstraction on the Lorian Swamp, a wetland used by pastoralists downstream. We first assess the abstractions and demands for water upstream and the river water supplies at the upper and the lower end of the Lorian Swamp. Further analysis of 12 years of monthly SPOT-VEGETATION satellite imagery reveals higher NDVI (Normalized Differential Vegetation Index values in the swamp than nearby rainfed areas, with the difference in NDVI between the two positively related to river water discharged into the swamp. The paper next reviews the benefits derived from water entering the swamp and the vulnerability to abstractions for three categories of water: (i the surface water used for drinking and sanitation; (ii the surface water that supports forage production; and (iii the water that recharges the Merti Aquifer. Our results suggest that benefits from surface water for domestic use and forage production are vulnerable to abstractions upstream whereas the benefits from the aquifer, with significant fossil water, are likely to be affected in the long run, but not the short term.

  5. Thermal Properties of Extruded Injection-Molded Poly (lactic acid) and Milkweed Composites: Degradation Kinectics and Enthalpic Relaxation

    Science.gov (United States)

    In order to determine the degree of compatibility between Poly (lactic Acid) (PLA) and different biomaterials, PLA was compounded with milkweed fiber, a new crop oil seed. After oil extraction, the remaining cake retained approximately 10% residual oil and 47% protein. The pressed seed cake (10% mo...

  6. Which native milkweeds are acceptable host plants for larval monarch butterflies (Danaus plexippus) within the Midwestern U.S.

    Science.gov (United States)

    Over the past two decades, the population of monarch butterflies east of the Rocky Mountains has experienced a significant decline. Habitat restoration within the summer breeding range is crucial to boost population numbers. Monarch butterfly larvae use milkweeds as their only host plant. However, l...

  7. Swamp Buffalo in South Kalimantan : Problem, Disease and Control

    Directory of Open Access Journals (Sweden)

    Lily Natalia

    2006-12-01

    Full Text Available In recent years, several studies have been carried out to evaluate and investigate the important diseases of swamp buffaloes (Bubalus carabanensis in Kalimantan . More attention has been focused on the case of acute infectious diseases and sudden death in the buffaloes . Fasciolosis black disease, acute enteritis, especially fatal enterotoxaemia haemorrhagic septicaemia . and trypanosomiasis (Surra, are some of the important diseases found in these animals . Black disease caused by toxigenic Clostridium novyi occurs in the presence of the organism in the liver and the degree of liver fluke Fasciola gigantica infestation . In regions where black disease is enzootic, Cl. novvi can be isolated from livers of normal healthy animals . In Hulu Sungai Utara district, South Kalimantan, the prevalence of fasciolosis caused by Fasciola gigantica in swamp buffalo was 77% in 1991 . A gross sudden change in diet due to seasonal changes could induce rumen and intestinal stasis, which provide a favourable environment for the rapid proliferation of commensal toxigenic Clostridium perfringens in the small intestine . Subsequent absorption of the toxin produced through the gut wall and its generalized dissemination culminated in a fatal enterotoxaemia . Haemorrhagic septicaemia (HS is an acute, fatal disease affecting swamp buffalo, and caused by Pasteurella multocida B : 2 . The swamp buffalo is particularly susceptible for HS, and the reported greatest losses of swamp buffalo in Kalimantan due to HS is recorded in 1980s. The clinical signs of Surra in swamp buffalo were also found in certain areas in Danau Panggang area . Hulu Sungai Utara district . Vaccination is the accepted method for controlling Black disease, enterotoxaemia and HS. Multi component vaccine, alum adjuvant containing at least 5 types of clostridial toxoids and P. multocida B2 bacterin have been used and provide good protection to the animals . Control and treatment of liver fluke infestation

  8. Climate change and an invasive, tropical milkweed: an ecological trap for monarch butterflies.

    Science.gov (United States)

    Faldyn, Matthew J; Hunter, Mark D; Elderd, Bret D

    2018-05-01

    While it is well established that climate change affects species distributions and abundances, the impacts of climate change on species interactions has not been extensively studied. This is particularly important for specialists whose interactions are tightly linked, such as between the monarch butterfly (Danaus plexippus) and the plant genus Asclepias, on which it depends. We used open-top chambers (OTCs) to increase temperatures in experimental plots and placed either nonnative Asclepias curassavica or native A. incarnata in each plot along with monarch larvae. We found, under current climatic conditions, adult monarchs had higher survival and mass when feeding on A. curassavica. However, under future conditions, monarchs fared much worse on A. curassavica. The decrease in adult survival and mass was associated with increasing cardenolide concentrations under warmer temperatures. Increased temperatures alone reduced monarch forewing length. Cardenolide concentrations in A. curassavica may have transitioned from beneficial to detrimental as temperature increased. Thus, the increasing cardenolide concentrations may have pushed the larvae over a tipping point into an ecological trap; whereby past environmental cues associated with increased fitness give misleading information. Given the ubiquity of specialist plant-herbivore interactions, the potential for such ecological traps to emerge as temperatures increase may have far-reaching consequences. © 2018 by the Ecological Society of America.

  9. Palynology, sedimentology and environmental significance of Holocene swamps at northern Kaitoke, Great Barrier Island, New Zealand

    International Nuclear Information System (INIS)

    Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.

    2000-01-01

    Pollen and sediment analyses of two cores from coastal freshwater swamps at northern Kaitoke (Kaitoke Swamp and Police Station Swamp), Great Barrier Island, show that c. 7300 calibrated yr BP Kaitoke Swamp was an estuary with tidal flats. Avicennia, now absent from the swamp area, was present in the estuary. By c. 4500 yr BP fresh water conditions had developed at the Kaitoke Swamp site as marine influences decreased. Around the same time, fresh water swamp conditions commenced at the Police Station Swamp site on the surface of a low lying area of a Late Pleistocene dune. A sandy layer at Kaitoke may represent rapid infilling followed by a dry soil surface until c. 1000 yr BP. Conifer-hardwood forest on the hills surrounding the sites c. 7300-c. 1800 yr BP was dominated by Dacrydium and Metrosideros. During this period, environmental conditions were relatively stable, with little change in forest composition. Between 1800 yr and 800 yr BP Kaitoke Swamp was reflooded, and the Police Station Swamp extended as a shallow lake over the nearby dune flat. These new shallow swamps were invaded by swamp forest (mainly Dacrycaprus with some Laurelia). The presence of charcoal and Pteridium spores above the Kaharoa Tephra suggests that major Polynesian deforestation at northern Kaitoke began c. 600 calibrated yr BP. (author). 41 refs., 4 figs., 2 tabs

  10. Characteristics of mangrove swamps managed for mosquito control in eastern Florida, USA

    Science.gov (United States)

    Middleton, B.; Devlin, D.; Proffitt, E.; McKee, K.; Cretini, K.F.

    2008-01-01

    Manipulations of the vegetation and hydrology of wetlands for mosquito control are common worldwide, but these modifications may affect vital ecosystem processes. To control mosquitoes in mangrove swamps in eastern Florida, managers have used rotational impoundment management (RIM) as an alternative to the worldwide practice of mosquito ditching. Levees surround RIM swamps, and water is pumped into the impoundment during the summer, a season when natural swamps have low water levels. In the New World, these mosquito-managed swamps resemble the mixed basin type of mangrove swamp (based on PCA analysis). An assessment was made of RIM, natural (control), and breached-RIM (restored) swamps in eastern Florida to compare their structural complexities, soil development, and resistance to invasion. Regarding structural complexity, dominant species composition differed between these swamps; the red mangrove Rhizophora mangle occurred at a higher relative density in RIM and breached-RIM swamps, and the black mangrove Avicennia germinans had a higher relative density in natural swamps. Tree density and canopy cover were higher and tree height lower in RIM swamps than in natural and breached-RIM swamps. Soil organic matter in RIM swamps was twice that in natural or breached-RIM swamps. RIM swamps had a lower resistance to invasion by the Brazilian pepper tree Schinus terebinthifolius, which is likely attributable to the lower porewater salinity in RIM swamps. These characteristics may reflect differences in important ecosystem processes (primary production, trophic structure, nutrient cycling, decomposition). Comparative assessments of managed wetlands are vital for land managers, so that they can make informed decisions compatible with conservation objectives. ?? Inter-Research 2008.

  11. Production Efficiency of Swamp Rice Production in Cross River ...

    African Journals Online (AJOL)

    This study compares profit maximization, output optimization and resource use efficiency in ... of two varieties of swamp rice by farmers in Cross River State of Nigeria. ... The result of the finding also shows that small-scale farmers were more ...

  12. Pen Branch Delta and Savannah River Swamp Hydraulic Model

    International Nuclear Information System (INIS)

    Chen, K.F.

    1999-01-01

    The proposed Savannah River Site (SRS) Wetlands Restoration Project area is located in Barnwell County, South Carolina on the southwestern boundary of the SRS Reservation. The swamp covers about 40.5 km2 and is bounded to the west and south by the Savannah River and to the north and east by low bluffs at the edge of the Savannah River floodplain. Water levels within the swamp are determined by stage along the Savannah River, local drainage, groundwater seepage, and inflows from four tributaries, Beaver Dam Creek, Fourmile Branch, Pen Branch, and Steel Creek. Historic discharges of heated process water into these tributaries scoured the streambed, created deltas in the adjacent wetland, and killed native vegetation in the vicinity of the delta deposits. Future releases from these tributaries will be substantially smaller and closer to ambient temperatures. One component of the proposed restoration project will be to reestablish indigenous wetland vegetation on the Pen Branch delta that covers about 1.0 km2. Long-term predictions of water levels within the swamp are required to determine the characteristics of suitable plants. The objective of the study was to predict water levels at various locations within the proposed SRS Wetlands Restoration Project area for a range of Savannah River flows and regulated releases from Pen Branch. TABS-MD, a United States Army Corps of Engineer developed two-dimensional finite element open channel hydraulic computer code, was used to model the SRS swamp area for various flow conditions

  13. Sequence Stratigraphic Appraisal: Coastal Swamp Depobelt In The ...

    African Journals Online (AJOL)

    Mid-Lower Miocene Agbada sedimentary intercalations of “AB” Field in the coastal swamp depobelt, Western Niger-Delta, were evaluated to determine their sequence stratigraphic character. The analysis was based on a combination of data sets including logs of six wells to describe lithic variations of the Agbada Formation ...

  14. Biology and control of swamp dodder (Cuscuta gronovii)

    International Nuclear Information System (INIS)

    Bewick, T.A.

    1987-01-01

    A simple model predicting swamp dodder (Cuscuta gronovii Willd.) emergence was developed. The model states that 0.1% of the cranberry seedlings will emerge after 150 to 170 GDD have accumulated after the winter ice has melted on the cranberry beds, using 0 C as the low temperature threshold. Experiments in cranberry showed that pronamide [3,5-dichloro-(N-1,1-dimethyl-2-propynyl)benzamide] was effective in controlling swamp dodder when applied preemergence. Rates below 2.4 kg ai/ha appeared to be safe for cranberry plants and fruit. Experiments with 14 C glyphosate showed that the herbicide moved out of carrot leaves to the physiological sinks in the plant. In carrots parasitized by swamp dodder the dodder acted as one of the strongest sinks for photosynthates from the host. In cranberry glyphosate moved out of the leaves, but most remained in the stem to which the treated leaves were attached. The only physiological sinks that accumulated significant amounts of label were the stem apices. The concentration of the herbicide in this sink decreased with time. Swamp dodder stems were able to absorb glyphosate directly from solution

  15. SURVEY OF ECONOMIC TREES IN FRESH WATER SWAMP OF

    African Journals Online (AJOL)

    1

    2011-05-16

    May 16, 2011 ... availability because it determines the number of surviving individuals. This is true for all species of .... 2010). CRUTECH, Calabar forest is a pseudo forest having characteristics of rain and swamp forests. ... as reflected in the random and contiguous distribution. (clumped or aggregated population) of the ...

  16. Aluminum and iron contents in phosphate treated swamp rice farm ...

    African Journals Online (AJOL)

    In 2006 aluminum and iron contents were determined in phosphate treated swamp rice farm of Mbiabet, Akwa Ibom State. The objectives were to determine the aluminum and iron contents, the effect of drying, phosphate and lime application in an acid sulphate soil grown to rice in Nigeria. The soil samples used were ...

  17. Swamp tours in Louisiana post Hurricane Katrina and Hurricane Rita

    Science.gov (United States)

    Dawn J. Schaffer; Craig A. Miller

    2007-01-01

    Hurricanes Katrina and Rita made landfall in southern Louisiana during August and September 2005. Prior to these storms, swamp tours were a growing sector of nature-based tourism that entertained visitors while teaching about local flora, fauna, and culture. This study determined post-hurricane operating status of tours, damage sustained, and repairs made. Differences...

  18. Coatal salt marshes and mangrove swamps in China

    Science.gov (United States)

    Yang, Shi-Lun; Chen, Ji-Yu

    1995-12-01

    Based on plant specimen data, sediment samples, photos, and sketches from 45 coastal crosssections, and materials from two recent countrywide comprehensive investigations on Chinese coasts and islands, this paper deals with China’s vegetative tidal-flats: salt marshes and mangrove swamps. There are now 141700 acres of salt marshes and 51000 acres of mangrove swamps which together cover about 30% of the mud-coast area of the country and distribute between 18°N (Southern Hainan Island) and 41 °N (Liaodong Bay). Over the past 45 years, about 1750000 acres of salt marshes and 49400 acres of mangrove swamps have been reclaimed. The 2.0×109 tons of fine sediments input by rivers into the Chinese seas form extensive tidal flats, the soil basis of coastal helophytes. Different climates result in the diversity of vegetation. The 3˜8 m tidal range favors intertidal zone development. Of over 20 plant species in the salt marshes, native Suaeda salsa, Phragmites australis, Aeluropus littoralis, Zoysia maerostachys, Imperata cylindrica and introduced Spartina anglica are the most extensive in distribution. Of the 41 mangrove swamps species, Kandelia candel, Bruguiera gymnorrhiza, Excoecaria agallocha and Avicennia marina are much wider in latitudinal distribution than the others. Developing stages of marshes originally relevant to the evolution of tidal flats are given out. The roles of pioneer plants in decreasing flood water energy and increasing accretion rate in the Changjiang River delta are discussed.

  19. 8,12;8,20-Diepoxy-8,14-secopregnane glycosides from the aerial parts of Asclepias tuberosa.

    Science.gov (United States)

    Warashina, Tsutomu; Noro, Tadataka

    2010-02-01

    Further study of constituents from the aerial parts of Asclepias tuberosa afforded twenty-two new steroidal glycosides along with tuberoside B(5) and G(5). These glycosides were confirmed to contain 8,12;8,20-diepoxy-8,14-secopregnanes, tuberogenin and its congeners, as their aglycones. The structure of each of these compounds was elucidated based on the interpretation of NMR and MS measurements and from chemical evidence.

  20. Structural polarity and dynamics of male germline stem cells in an insect (milkweed bug Oncopeltus fasciatus).

    Science.gov (United States)

    Dorn, David C; Dorn, August

    2008-01-01

    Knowing the structure opens a door for a better understanding of function because there is no function without structure. Male germline stem cells (GSCs) of the milkweed bug (Oncopeltus fasciatus) exhibit a very extraordinary structure and a very special relationship with their niche, the apical cells. This structural relationship is strikingly different from that known in the fruit fly (Drosophila melanogaster) -- the most successful model system, which allowed deep insights into the signaling interactions between GSCs and niche. The complex structural polarity of male GSCs in the milkweed bug combined with their astonishing dynamics suggest that cell morphology and dynamics are causally related with the most important regulatory processes that take place between GSCs and niche and ensure maintenance, proliferation, and differentiation of GSCs in accordance with the temporal need of mature sperm. The intricate structure of the GSCs of the milkweed bug (and probably of some other insects, i.e., moths) is only accessible by electron microscopy. But, studying singular sections through the apical complex (i.e., GSCs and apical cells) is not sufficient to obtain a full picture of the GSCs; especially, the segregation of projection terminals is not tangible. Only serial sections and their overlay can establish whether membrane ingrowths merely constrict projections or whether a projection terminal is completely cut off. To sequence the GSC dynamics, it is necessary to include juvenile stages, when the processes start and the GSCs occur in small numbers. The fine structural analysis of segregating projection terminals suggests that these terminals undergo autophagocytosis. Autophagosomes can be labeled by markers. We demonstrated acid phosphatase and thiamine pyrophosphatase (TPPase). Both together are thought to identify autophagosomes. Using the appropriate substrate of the enzymes and cerium chloride, the precipitation of electron-dense cerium phosphate granules

  1. Pheromones of milkweed bugs (Heteroptera: Lygaeidae) attract wayward plant bugs: Phytocoris mirid sex pheromone.

    Science.gov (United States)

    Zhang, Qing-He; Aldrich, Jeffrey R

    2003-08-01

    The synthetic aggregation pheromone of the large milkweed bug, Oncopeltus fasciatus (Dallas) (Lygaeinae), also attracted males of the plant bug, Phytocoris difficilis Knight (Miridae). Field testing partial blends against the six-component blend comprising the Oncopeltus pheromone showed that cross-attraction of P. difficilis males was due to synergism between (E)-2-octenyl acetate and (E,E)-2,4-hexadienyl acetate. Hexyl acetate was abundant in the metathoracic scent gland (MSG) secretion of P. difficilis males, but because female P. difficilis could not initially be found in the field, further combinatorial tests were guided by prior research on the pheromones of two Phytocoris species in the western United States. The combination of hexyl, (E)-2-hexenyl, and (E)-2-octenyl acetates was as attractive to P. difficilis males as the milkweed bug pheromone, yet no milkweed bugs were drawn to this blend. Gas chromatographic (GC)-electroantennographic detection (EAD) and GC-mass spectrometric (MS) analyses of female P. difficilis MSGs determined that their secretion contained predominantly hexyl, (E)-2-hexenyl, and (E)-2-octenyl acetates (all strongly EAD-active)-the latter two compounds found only in trace amounts from males-plus five minor female-specific compounds, three of which were EAD-active. (E,E)-2,4-Hexadienyl acetate was not detected from P. difficilis females or males. The blend of the three major components, hexyl, (E)-2-hexenyl, and (E)-2-octenyl acetates (2:1.5:1 by volume), was as attractive as the blend of all six EAD-active compounds identified from females, indicating that this ternary blend constitutes the sex pheromone of P. difficilis. Hexyl acetate with (E)-2-octenyl acetate also attracted males of another species, P. breviusculus Reuter, but addition of (E)-2-hexenyl acetate and/or (E,E)-2,4-hexadienyl acetate inhibited attraction of P. breviusculus males. Attraction of P. difficilis males occurred mainly during the first half of scotophase. The

  2. Sterility and mating competitiveness of irradiated males of the large milkweed bug, Oncopeltus fasciatus

    International Nuclear Information System (INIS)

    Moursy, L.E.; Eesa, N.M.; Cutkomp, L.K.

    1991-01-01

    Low level gamma radiation adversely affected the reproductive capacity of the large milkweed bug, oncopeltus fasciatus dallas, as expressed by fecundity and fertility. Treatment was applied to late 5th instar male nymphs. Both fecundity and fertility decreased linearly with the treatment dose and complete sterility occurred when males were exposed to 6 kilorads and mated with normal females. The mating competitiveness of O. fasciatus males irradiated at late 5th instar nymphs decreased linearly with the treatment dose. A strong negative relationship existed between dose and mating competitiveness ( r = -0.93). A 3:2 ratio of irradiated males at 4 kilorads ( as late 5th instar as many progeny as normal in F 1 .2 tab.,1 fig

  3. Hox gene function and interaction in the milkweed bug Oncopeltus fasciatus (Hemiptera).

    Science.gov (United States)

    Angelini, David R; Liu, Paul Z; Hughes, Cynthia L; Kaufman, Thomas C

    2005-11-15

    Studies in genetic model organisms such as Drosophila have demonstrated that the homeotic complex (Hox) genes impart segmental identity during embryogenesis. Comparative studies in a wide range of other insect taxa have shown that the Hox genes are expressed in largely conserved domains along the anterior-posterior body axis, but whether they are performing the same functions in different insects is an open question. Most of the Hox genes have been studied functionally in only a few holometabolous insects that undergo metamorphosis. Thus, it is unclear how the Hox genes are functioning in the majority of direct-developing insects and other arthropods. To address this question, we used a combination of RNAi and in situ hybridization to reveal the expression, functions, and regulatory interactions of the Hox genes in the milkweed bug Oncopeltus fasciatus. Our results reveal many similarities and some interesting differences compared to Drosophila. We find that the gene Antennapedia is required for the identity of all three thoracic segments, while Ultrabithorax, abdominal-A and Abdominal-B cooperate to pattern the abdomen. The three abdominal genes exhibit posterior prevalence like in Drosophila, but apparently via some post-transcriptional mechanism. The functions of the head genes proboscipedia, Deformed, and Sex combs reduced were shown previously, and here we find that the complex temporal expression of pb in the labium is like that of other insects, but its regulatory relationship with Scr is unique. Overall, our data reveal that the evolution of insect Hox genes has included many small changes within general conservation of expression and function, and that the milkweed bug provides a useful model for understanding the roles of Hox genes in a direct-developing insect.

  4. Synthesis of Polyformate Esters of Vegetable Oils: Milkweed, Pennycress, and Soy

    Directory of Open Access Journals (Sweden)

    Rogers E. Harry-O’kuru

    2016-01-01

    Full Text Available In a previous study of the characteristics of acyl derivatives of polyhydroxy milkweed oil (PHMWO, it was observed that the densities and viscosities of the respective derivatives decreased with increased chain length of the substituent acyl group. Thus from the polyhydroxy starting material, attenuation in viscosity of the derivatives relative to PHMWO was found in the order: PHMWO ≫ PAcMWE ≫ PBuMWE ≫ PPMWE (2332 : 1733 : 926.2 : 489.4 cSt, resp., at 40°C, where PAcMWE, PBuMWE, and PPMWE were the polyacetyl, polybutyroyl, and polypentanoyl ester derivatives, respectively. In an analogous manner, the densities also decreased as the chain length increased although not as precipitously compared to the viscosity drop. By inference, derivatives of vegetable oils with short chain length substituents on the triglyceride would be attractive in lubricant applications in view of their higher densities and possibly higher viscosity indices. Pursuant to this, we have explored the syntheses of formyl esters of three vegetable oils in order to examine the optimal density, viscosity, and related physical characteristics in relation to their suitability as lubricant candidates. In the absence of ready availability of formic anhydride, we opted to employ the epoxidized vegetable oils as substrates for formyl ester generation using glacial formic acid. The epoxy ring-opening process was smooth but was apparently followed by a simultaneous condensation reaction of the putative α-hydroxy formyl intermediate to yield vicinal diformyl esters from the oxirane. All three polyformyl esters milkweed, soy, and pennycress derivatives exhibited low coefficient of friction and a correspondingly much lower wear scar in the 4-ball antiwear test compared to the longer chain acyl analogues earlier studied.

  5. Synthesis of Polyformate Esters of Vegetable Oils: Milkweed, Pennycress, and Soy.

    Science.gov (United States)

    Harry-O'kuru, Rogers E; Biresaw, Girma; Tisserat, Brent; Evangelista, Roque

    2016-01-01

    In a previous study of the characteristics of acyl derivatives of polyhydroxy milkweed oil (PHMWO), it was observed that the densities and viscosities of the respective derivatives decreased with increased chain length of the substituent acyl group. Thus from the polyhydroxy starting material, attenuation in viscosity of the derivatives relative to PHMWO was found in the order: PHMWO ≫ PAcMWE ≫ PBuMWE ≫ PPMWE (2332 : 1733 : 926.2 : 489.4 cSt, resp., at 40°C), where PAcMWE, PBuMWE, and PPMWE were the polyacetyl, polybutyroyl, and polypentanoyl ester derivatives, respectively. In an analogous manner, the densities also decreased as the chain length increased although not as precipitously compared to the viscosity drop. By inference, derivatives of vegetable oils with short chain length substituents on the triglyceride would be attractive in lubricant applications in view of their higher densities and possibly higher viscosity indices. Pursuant to this, we have explored the syntheses of formyl esters of three vegetable oils in order to examine the optimal density, viscosity, and related physical characteristics in relation to their suitability as lubricant candidates. In the absence of ready availability of formic anhydride, we opted to employ the epoxidized vegetable oils as substrates for formyl ester generation using glacial formic acid. The epoxy ring-opening process was smooth but was apparently followed by a simultaneous condensation reaction of the putative α-hydroxy formyl intermediate to yield vicinal diformyl esters from the oxirane. All three polyformyl esters milkweed, soy, and pennycress derivatives exhibited low coefficient of friction and a correspondingly much lower wear scar in the 4-ball antiwear test compared to the longer chain acyl analogues earlier studied.

  6. Transcriptional profile and differential fitness in a specialist milkweed insect across host plants varying in toxicity.

    Science.gov (United States)

    Birnbaum, Stephanie S L; Rinker, David C; Gerardo, Nicole M; Abbot, Patrick

    2017-12-01

    Interactions between plants and herbivorous insects have been models for theories of specialization and co-evolution for over a century. Phytochemicals govern many aspects of these interactions and have fostered the evolution of adaptations by insects to tolerate or even specialize on plant defensive chemistry. While genomic approaches are providing new insights into the genes and mechanisms insect specialists employ to tolerate plant secondary metabolites, open questions remain about the evolution and conservation of insect counterdefences, how insects respond to the diversity defences mounted by their host plants, and the costs and benefits of resistance and tolerance to plant defences in natural ecological communities. Using a milkweed-specialist aphid (Aphis nerii) model, we test the effects of host plant species with increased toxicity, likely driven primarily by increased secondary metabolites, on aphid life history traits and whole-body gene expression. We show that more toxic plant species have a negative effect on aphid development and lifetime fecundity. When feeding on more toxic host plants with higher levels of secondary metabolites, aphids regulate a narrow, targeted set of genes, including those involved in canonical detoxification processes (e.g., cytochrome P450s, hydrolases, UDP-glucuronosyltransferases and ABC transporters). These results indicate that A. nerii marshal a variety of metabolic detoxification mechanisms to circumvent milkweed toxicity and facilitate host plant specialization, yet, despite these detoxification mechanisms, aphids experience reduced fitness when feeding on more toxic host plants. Disentangling how specialist insects respond to challenging host plants is a pivotal step in understanding the evolution of specialized diet breadths. © 2017 John Wiley & Sons Ltd.

  7. Indirect organogenesis in milkweed ( Calotropis procera from mature zygotic embryo explants

    Directory of Open Access Journals (Sweden)

    Hojatollah Abbasi

    2018-01-01

    Full Text Available Milkweed ( Calotropis procera is a valuable medicinal plant which grows in many regions of Iran. Its significant medicinal properties have made it an important crop which is cultivated commercially. This plant is propagated from seeds as well as root and shoot cuttings. Due to problems in the usage of these reproduction methods, new propagation methods such as tissue culturing should be developed. This study was aimed at obtaining appropriate concentrations of plant hormones for indirect organogenesis of milkweed. The experiment was arranged in a completely randomized design (CRD with 3 replications. The effects of various concentrations of (2,4-dichlorophenoxyacetic acid 2,4-D (0.1, 0.5, 1, 2 and 3 mg/l were studied in terms of callus induction and shoot regeneration on an MS based medium supplemented with BA (benzyl amino purine and NAA (naphthalene acetic acid at the same concentration. Mature embryos were used as explants and morphological traits such as embryo size, callus size, number and size of shoots and roots were recorded. The results showed that 2,4-D significantly increased the size of cultured embryos (P < 0.05. The largest embryo volume was observed in cultures treated with 3 mg/l 2,4-D. The highest callusing was recorded in 2 mg/l 2,4-D. The effects of BA and NAA concentrations on shoot regeneration were significant and the highest values were observed for a combination of 1 mg/l BA and 2 mg/l NAA. 1 mg/l IBA (Indole 3-butyric acid was able to induce the highest number of better quality roots and shoots.

  8. Utilization of Swamp Forages from South Kalimantan on Local Goat Performances

    Directory of Open Access Journals (Sweden)

    T. Rostini

    2014-04-01

    Full Text Available Forages in swamp area consist of grass and legumes that have good productivity and nutrient quality. This research was aimed to evaluate the potency of swamp forage on digestibility and performance of goats. There were 24 local male goats aged 10-12 months with initial body weight of 13.10±1.55 kg, allocated into 6 treatments. Those were control (R0: 60% grass and 40% legumes; (R1: 60% swamp forages and 40% concentrate; (R2: 100% swamp forages; (R3: 100% swamp forage hay; (R4: 100% swamp forage silage; (R5: 100% haylage swamp forages. Results showed that silage treatment significantly increased (P<0.05 consumption and digestibility. Swamp forages could be utilized well by preservation (silage, hay, and haylage. Ensilage of swamp forages increased protein content from 13.72% to 14.02%, protein intake (74.62 g/d, dry matter intake (532.11 g/d, nitrogen free extract intake (257.39 g/d, with total body weight gain (3.5 kg in eight weeks and average daily gain (62.60 g/d. It is concluded that ensilage of swamp forages (R4 is very potential to be utilized as forage source for ruminants such as goats.

  9. The exploitation of swamp plants for dewatering liquid sewage sludge

    Directory of Open Access Journals (Sweden)

    Jiří Šálek

    2006-01-01

    Full Text Available The operators of little rural wastewater treatment plants have been interested in economic exploitation of sewage sludge in local conditions. The chance is searching simply and natural ways of processing and exploitation stabilized sewage sludge in agriculture. Manure substrate have been obtained by composting waterless sewage sludge including rest plant biomass after closing 6–8 years period of filling liquid sewage sludge to the basin. Main attention was focused on exploitation of swamp plants for dewatering liquid sewage sludge and determination of influence sewage sludge on plants, intensity and course of evapotranspiration and design and setting of drying beds. On the base of determined ability of swamp plants evapotranspiration were edited suggestion solutions of design and operation sludge bed facilities in the conditions of small rural wastewater treatment plant.

  10. Weathering of a petroleum spill in a tropical mangrove swamp

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, S.J.; Alexander, R.; Kagi, R.I. [Curtin Univ., Perth (Australia)

    1996-12-31

    In August 1987, an indeterminate amount of petroleum condensate was released from a buried pipe leading to contamination of a tropical mangrove swamp surrounding a tidal creek in North Western Australia. Since no bioremediation was attempted at this site, we have monitored the natural weathering of the condensate by detailed analysis of the petroleum hydrocarbons extracted from sediment samples collected on 11 occasions over a 3 year period.

  11. Response of tropical peat swamp forest tree species seedlings to macro nutrients

    Directory of Open Access Journals (Sweden)

    Tri Wira Yuwati

    2015-10-01

    Full Text Available Abstract Efforts of restoration of degraded tropical peat swamp forest were facing constraints due to the low available nutrient level of peat. The transplanted peat swamp forest species seedlings experienced low survival rate and poor growth performance. This study aimed to demonstrate the response of ten tropical peat swamp forest species seedlings whether climax and pioneer species to macro-nutrients addition in the nursery. The growth performance of climax and pioneer tropical peat swamp species seedlings was recorded following addition of macro nutrients of Nitrogen (N, Phosphorus(P, Potassium(K and Dolomitic limestone (CaMg. The result showed that Alstonia spatulata and Parartocarpus venenosus showed positive growth response following macro nutrients addition. This study concluded that tropical peat swamp pioneer species has lower necessity for macro-nutrients addition than tropical peat swamp climax species.

  12. Food Swamps Predict Obesity Rates Better Than Food Deserts in the United States

    OpenAIRE

    Cooksey-Stowers, Kristen; Schwartz, Marlene B.; Brownell, Kelly D.

    2017-01-01

    This paper investigates the effect of food environments, characterized as food swamps, on adult obesity rates. Food swamps have been described as areas with a high-density of establishments selling high-calorie fast food and junk food, relative to healthier food options. This study examines multiple ways of categorizing food environments as food swamps and food deserts, including alternate versions of the Retail Food Environment Index. We merged food outlet, sociodemographic and obesity data ...

  13. Study of Antibacterial Activity and Bacteriology of Latex from Asclepias syriaca L

    Science.gov (United States)

    McCay, Steven; Mahlberg, Paul

    1973-01-01

    Whole and fractionated latex of Asclepias syriaca was tested for antimicrobial or growth-promoting activity with 16 genera and species of bacteria. Latex and extracted fractions (distilled water, acetic acid, sodium bicarbonate, sulfuric acid, and ethyl ether) possessed no detectable antimicrobial activity. Comparison of growth curves of selected bacteria incubated with serum and rubber fractions, as well as controls, revealed no detectable inhibition of growth, except for a slight inhibitory response to autoclaved serum. Most bacteria were capable of utilizing latex for a substrate as indicated by the increased growth rate in the exponential phase. The stationary phase was entered simultaneously by both the treated cultures and the controls. Various bacteria cultured in a litmus latex mixture yielded populations which ranged from <104 organisms/ml for Lactobacillus casei, Staphylococcus aureus and Micrococcus lysodeikticus to 1.1 × 1010 organisms/ml for Clostridium acetobutylicum. Whole latex, as well as the serum and rubber fractions, support the growth of various bacteria, but under field conditions there is no evidence for systemic infection of this type of cell by bacteria. PMID:4790590

  14. Detection and plant monitoring programs: lessons from an intensive survey of Asclepias meadii with five observers.

    Directory of Open Access Journals (Sweden)

    Helen M Alexander

    Full Text Available Monitoring programs, where numbers of individuals are followed through time, are central to conservation. Although incomplete detection is expected with wildlife surveys, this topic is rarely considered with plants. However, if plants are missed in surveys, raw count data can lead to biased estimates of population abundance and vital rates. To illustrate, we had five independent observers survey patches of the rare plant Asclepias meadii at two prairie sites. We analyzed data with two mark-recapture approaches. Using the program CAPTURE, the estimated number of patches equaled the detected number for a burned site, but exceeded detected numbers by 28% for an unburned site. Analyses of detected patches using Huggins models revealed important effects of observer, patch state (flowering/nonflowering, and patch size (number of stems on probabilities of detection. Although some results were expected (i.e. greater detection of flowering than nonflowering patches, the importance of our approach is the ability to quantify the magnitude of detection problems. We also evaluated the degree to which increased observer numbers improved detection: smaller groups (3-4 observers generally found 90 - 99% of the patches found by all five people, but pairs of observers or single observers had high error and detection depended on which individuals were involved. We conclude that an intensive study at the start of a long-term monitoring study provides essential information about probabilities of detection and what factors cause plants to be missed. This information can guide development of monitoring programs.

  15. Structure of Asclepias syriaca L. population against phytocenotic and habitat conditions in Widuchowa (West Pomerania

    Directory of Open Access Journals (Sweden)

    Bacieczko Wanda

    2015-12-01

    Full Text Available Asclepias syriaca L. is on the invasive species list in Poland. Its sites are scattered, with the exception of cultivation sites; they are also not well identified in the country and that is why they have not been presented in the ATPOL (Distribution Atlas of Vascular Plants in Poland yet. In this study, spatial structure of A. syriaca population against phytocenotic and soil conditions in Widuchowa (West Pomeraniawere examined. Number of specimens, their density per 1 m2, and mean crowding were determined. In addition, the population spatial structure type was identified through observations and by calculation of the dispersion coefficient. On the basis of the conducted research, it was found that the investigated population comprised 1 500 specimens and occupied the area of 38 m2. It exhibited regular spatial distribution type (dispersion coefficient<1 and was characterized by high value of mean shoot density, which amounted to 29 spec./1 m2 (max. 35 spec./1 m2. On the basis of the conducted chemical analysis of the soil from the A. syriaca habitat, the substrate was classified as alkaline soil (pH=7.3-7.6, of low total nitrogen (0.07-0.15%, as well as low total carbon content (0.8-1.45%.

  16. Properties of Single K+ and Cl− Channels in Asclepias tuberosa Protoplasts 1

    Science.gov (United States)

    Schauf, Charles L.; Wilson, Kathryn J.

    1987-01-01

    Potassium and chloride channels were characterized in Asclepias tuberosa suspension cell derived protoplasts by patch voltage-clamp. Whole-cell currents and single channels in excised patches had linear instantaneous current-voltage relations, reversing at the Nernst potentials for K+ and Cl−, respectively. Whole cell K+ currents activated exponentially during step depolarizations, while voltage-dependent Cl− channels were activated by hyperpolarizations. Single K+ channel conductance was 40 ± 5 pS with a mean open time of 4.5 milliseconds at 100 millivolts. Potassium channels were blocked by Cs+ and tetraethylammonium, but were insensitive to 4-aminopyridine. Chloride channels had a single-channel conductance of 100 ± 17 picosiemens, mean open time of 8.8 milliseconds, and were blocked by Zn2+ and ethacrynic acid. Whole-cell Cl− currents were inhibited by abscisic acid, and were unaffected by indole-3-acetic acid and 2,4-dichlorophenoxyacetic acid. Since internal and external composition can be controlled, patch-clamped protoplasts are ideal systems for studying the role of ion channels in plant physiology and development. Images Fig. 5 PMID:16665712

  17. Purification and biochemical characterization of asclepain c I from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Arribére, M Cecilia; Trejo, Sebastián A; Canals, Francesc; Avilés, Francesc X; Priolo, Nora S

    2004-08-01

    In this work we report the isolation, purification and characterization of a new protease from latex of Asclepias curassavica L. Crude extract (CE) was obtained by gathering latex on 0.1 M citric-phosphate buffer with EDTA and cysteine with subsequent ultracentrifugation. Proteolytic assays were made on casein or azocasein as substrates. Caseinolytic activity was completely inhibited by E-64. Stability at different temperatures, optimum pH and ionic strength were evaluated by measuring the residual caseinolytic activity at different times after the incubation. CE showed the highest caseinolytic activity at pH 8.5 in the presence of 12 mM cysteine. CE was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by SDS-PAGE, were isolated. The major purified protease (asclepain cI) showed a molecular mass of 23.2 kDa by mass spectrometry and a pI higher than 9.3. The N-terminal sequence showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-aminoacid-p-nitrophenyl esters, the enzyme showed higher preference for the glutamine derivative. Determinations of kinetic parameter (km and Kcat) were performed with PFLNA.

  18. Detection and plant monitoring programs: lessons from an intensive survey of Asclepias meadii with five observers.

    Science.gov (United States)

    Alexander, Helen M; Reed, Aaron W; Kettle, W Dean; Slade, Norman A; Bodbyl Roels, Sarah A; Collins, Cathy D; Salisbury, Vaughn

    2012-01-01

    Monitoring programs, where numbers of individuals are followed through time, are central to conservation. Although incomplete detection is expected with wildlife surveys, this topic is rarely considered with plants. However, if plants are missed in surveys, raw count data can lead to biased estimates of population abundance and vital rates. To illustrate, we had five independent observers survey patches of the rare plant Asclepias meadii at two prairie sites. We analyzed data with two mark-recapture approaches. Using the program CAPTURE, the estimated number of patches equaled the detected number for a burned site, but exceeded detected numbers by 28% for an unburned site. Analyses of detected patches using Huggins models revealed important effects of observer, patch state (flowering/nonflowering), and patch size (number of stems) on probabilities of detection. Although some results were expected (i.e. greater detection of flowering than nonflowering patches), the importance of our approach is the ability to quantify the magnitude of detection problems. We also evaluated the degree to which increased observer numbers improved detection: smaller groups (3-4 observers) generally found 90 - 99% of the patches found by all five people, but pairs of observers or single observers had high error and detection depended on which individuals were involved. We conclude that an intensive study at the start of a long-term monitoring study provides essential information about probabilities of detection and what factors cause plants to be missed. This information can guide development of monitoring programs.

  19. Biophysics environmental conditions of swamp buffalo Bubalus bubalis Pampangan in district Rambutan South Sumatera

    Directory of Open Access Journals (Sweden)

    Yuanita Windusari

    2015-06-01

    Full Text Available Swamp buffalo (Bubalus bubalis is a germ plasm specific of Pampangan and endemic in South Sumatera with low productivity and limited distribution. The aims of this study was to obtain information regarding biophysical conditions in the central areas of swamp buffalo in South Sumatera. The method used is purposive sampling method. Data collected in the form of quantitative and qualitative. Primary data were obtained through direct observation, interviews breeders selected as respondents while secondary data obtained from various related. The data obtained are presented descriptively and data tabulation. Productivity of swamp buffalo Pampangan can be increased by managing and maintaining habitat conditions although traditional maintenance. The results of observations of the biophysical condition of swamp buffalo (B. bubalis Pampangan showed that habitat of swamp buffalo Pampangan consists of dominated by lowland swamp area is overgrown with shrubs and grass. The conclution of the research are productivity and population of swamp buffalo (B. bubalis pampangan as specific plasma nutfah of South Sumatra can be improved by studying the characteristics and preferred habitat of the buffalo, although developed in a traditional farms but is good enough and so need to be developed, grass is most preferred by swamp buffalo Pampangan derived from ‘Kumpai’ grass group, and ‘Kasur’grass and ‘Kumpai’ grass is the dominant grass type found in habitat swamp buffalo Pampangan.

  20. UGT74AN1, a Permissive Glycosyltransferase from Asclepias curassavica for the Regiospecific Steroid 3-O-Glycosylation.

    Science.gov (United States)

    Wen, Chao; Huang, Wei; Zhu, Xue-Lin; Li, Xiao-San; Zhang, Fan; Jiang, Ren-Wang

    2018-02-02

    A permissive steroid glycosyltransferase (UGT74AN1) from Asclepias curassavica exhibited robust capabilities for the regiospecific C3 glycosylation of cardiotonic steroids and C 21 steroid precursors, and unprecedented promiscuity toward 53 structurally diverse natural and unnatural compounds to form O-, N-, and S-glycosides, along with the catalytic reversibility for a one-pot transglycosylation reaction. These findings highlight UGT74AN1 as the first regiospecific catalyst for cardiotonic steroid C3 glycosylation and exhibit significant potential for glycosylation of diverse bioactive molecules in drug discovery.

  1. Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora

    2009-02-01

    Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.

  2. Wastewater treatment by a natural wetland: the Nakivubo swamp, Uganda : processes and implications

    NARCIS (Netherlands)

    Kansiime, F.; Nalubega, M.

    1999-01-01

    An investigation to assess the capacity of the Nakivubo swamp, Kampala-Uganda (which has been receiving partially treated sewage from the city for more than 30 years now), to remove nutrients and pathogens was carried out. The aim of the study was to evaluate the potential of this swamp to

  3. Influence of Soil Type and Drainage on Growth of Swamp Chestnut Oak (Quercus Michauxii Nutt.) Seedlings

    Science.gov (United States)

    Donald D. Hook

    1969-01-01

    Swamp chestnut oak (Quercus michauxii Nutt.) seedlings were grown for 2 years in five soil types in drained and undrained pots. First-year height growth was related to soil type and pot drainage, but second-year height growth was related only to soil type. Results suggest that swamp chestnut oak is site-sensitive. But slow growth, a maximum of 2...

  4. Dynamics of growth zone patterning in the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Auman, Tzach; Vreede, Barbara M I; Weiss, Aryeh; Hester, Susan D; Williams, Terri A; Nagy, Lisa M; Chipman, Ariel D

    2017-05-15

    We describe the dynamic process of abdominal segment generation in the milkweed bug Oncopeltus fasciatus We present detailed morphological measurements of the growing germband throughout segmentation. Our data are complemented by cell division profiles and expression patterns of key genes, including invected and even-skipped as markers for different stages of segment formation. We describe morphological and mechanistic changes in the growth zone and in nascent segments during the generation of individual segments and throughout segmentation, and examine the relative contribution of newly formed versus existing tissue to segment formation. Although abdominal segment addition is primarily generated through the rearrangement of a pool of undifferentiated cells, there is nonetheless proliferation in the posterior. By correlating proliferation with gene expression in the growth zone, we propose a model for growth zone dynamics during segmentation in which the growth zone is functionally subdivided into two distinct regions: a posterior region devoted to a slow rate of growth among undifferentiated cells, and an anterior region in which segmental differentiation is initiated and proliferation inhibited. © 2017. Published by The Company of Biologists Ltd.

  5. Evaluation of synthetic hydrocarbons for mark-recapture studies on the red milkweed beetle.

    Science.gov (United States)

    Ginzel, Matthew D; Hanks, Lawrence M

    2002-05-01

    This study evaluates the potential for using blends of synthetic hydrocarbons in mark-recapture studies of insects. To test the durability of hydrocarbons, we applied a blend of five straight-chain hydrocarbons (C24, C21, C26. C28, C30) to detached elytra of the red milkweed beetle, Tetraopes tetrophthalmus (Forster) (Coleoptera: Cerambycidae), mounted the elytra on pins, and placed them in an exposed location outdoors. The amount of hydrocarbons on the elytra did not change over time, even after two months of exposure to sun and rain. Synthetic hydrocarbons applied to the elytra of living beetles did not significantly influence their longevity or mating success in a laboratory study. and the amounts of hydrocarbons did not change with age. The invariability of hydrocarbon ratios over time suggests that blends could provide a nearly infinite variety of ratios to mark individual insects uniquely and indelibly with a hydrocarbon "fingerprint." This technique offers a convenient, safe, and durable means of individually marking insects and may find application in field studies of larger bodied insects that are long-lived and sedentary.

  6. Evidence against a germ plasm in the milkweed bug Oncopeltus fasciatus, a hemimetabolous insect

    Directory of Open Access Journals (Sweden)

    Ben Ewen-Campen

    2013-04-01

    Primordial germ cell (PGC formation in holometabolous insects like Drosophila melanogaster relies on maternally synthesised germ cell determinants that are asymmetrically localised to the oocyte posterior cortex. Embryonic nuclei that inherit this “germ plasm” acquire PGC fate. In contrast, historical studies of basally branching insects (Hemimetabola suggest that a maternal requirement for germ line genes in PGC specification may be a derived character confined principally to Holometabola. However, there have been remarkably few investigations of germ line gene expression and function in hemimetabolous insects. Here we characterise PGC formation in the milkweed bug Oncopeltus fasciatus, a member of the sister group to Holometabola, thus providing an important evolutionary comparison to members of this clade. We examine the transcript distribution of orthologues of 19 Drosophila germ cell and/or germ plasm marker genes, and show that none of them localise asymmetrically within Oncopeltus oocytes or early embryos. Using multiple molecular and cytological criteria, we provide evidence that PGCs form after cellularisation at the site of gastrulation. Functional studies of vasa and tudor reveal that these genes are not required for germ cell formation, but that vasa is required in adult males for spermatogenesis. Taken together, our results provide evidence that Oncopeltus germ cells may form in the absence of germ plasm, consistent with the hypothesis that germ plasm is a derived strategy of germ cell specification in insects.

  7. The buck in the milkweed: evidence of male-male interference among pollinaria on pollinators.

    Science.gov (United States)

    Cocucci, Andrea A; Marino, Salvador; Baranzelli, Matías; Wiemer, Ana P; Sérsic, Alicia

    2014-07-01

    Direct physical confrontation among conspecifics for access to mates is a form of sexual selection well known among animals, but not thought to take place in plants. Consequently, no structures are known that can be considered as weapons that evolved under such confrontation. Pollinaria of milkweeds may physically compete for access to attachment points on the pollinators' body, and occasionally pollinaria may link onto pre-existing pollinaria on a pollinator resulting in concatenation. We hypothesized that concatenation may result in interference between proximal and distal pollinaria, and that features of nonconcatenating pollinaria might be attributed to prevention of concatenation. We tested this by analyzing pollen donation efficiency, experimental manipulation of the phenotype and the phylogenetic patterns of co-occurrence of traits. It is shown that concatenation was able to diminish the reproductive performance of proximal pollinaria, that horns on pollinaria prevented concatenation, and that horn acquisition was correlated with a loss of concatenation. The experimental removal of horns in species that did not concatenate caused reversion to concatenation. The present work could be the first evidence of male physical struggles and of the acquisition of weapons related to these struggles, that are analogous to those known in animals. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.

  8. Structural polarity and dynamics of male germline stem cells in the milkweed bug (Oncopeltus fasciatus).

    Science.gov (United States)

    Schmidt, Esther D; Dorn, August

    2004-11-01

    The male germline stem cells (GSCs) of the milkweed bug present an extraordinary structural polarity that is, to our knowledge, unequalled by any other type of stem cells. They consist of a perikaryon and numerous projections arising from the cell pole directed toward the apical cells, the proposed niche of the GSCs. The projections can traverse a considerable distance until their terminals touch the apical cells. From hatching until death, the GSC projections undergo conspicuous changes, the sequence of which has been deduced from observations of all developmental stages. Projection formation starts from lobular cell protrusions showing trabecular ingrowths of the cell membrane. Finger-like projections result from a process of growth and "carving out". The newly formed projections contain mostly only free ribosomes other than a few mitochondria. A stereotyped degradation process commences in the projection terminals: profiles of circular, often concentric, cisternae of rough endoplasmic reticulum appear and turn into myelin bodies, whereas mitochondria become more numerous. The cytoplasm vesiculates, lysosomal bodies appear, and mitochondria become swollen. At the same time, the projection terminals are segregated by transverse ingrowths of the cell membrane. Finally, autophagic vacuoles and myelin bodies fill the segregated terminals, which then rupture. Simultaneously, new projections seem to sprout from the perikaryon of the GSCs. These dynamics, which are not synchronized among the GSCs, indicate that a novel type of signal exchange and transduction between the stem cells and their niche is involved in the regulation of asymmetric versus symmetric division of GSCs.

  9. Late extraembryonic morphogenesis and its zen(RNAi)-induced failure in the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Panfilio, Kristen A

    2009-09-15

    Many insects undergo katatrepsis, essential reorganization by the extraembryonic membranes that repositions the embryo. Knockdown of the zen gene by RNA interference (RNAi) prevents katatrepsis in the milkweed bug Oncopeltus fasciatus. However, the precise morphogenetic defect has been uncertain, and katatrepsis itself has not been characterized in detail. The dynamics of wild type and zen(RNAi) eggs were analyzed from time-lapse movies, supplemented by analysis of fixed specimens. These investigations identify three zen(RNAi) defects. First, a reduced degree of tissue contraction implies a role for zen in baseline compression prior to katatrepsis. Subsequently, a characteristic 'bouncing' activity commences, leading to the initiation of katatrepsis in wild type eggs. The second zen(RNAi) defect is a delay in this activity, suggesting that a temporal window of opportunity is missed after zen knockdown. Ultimately, the extraembryonic membranes fail to rupture in zen(RNAi) eggs: the third defect. Nevertheless, the outer serosal membrane manages to contract, albeit in an aberrant fashion with additional phenotypic consequences for the embryo. These data identify a novel epithelial morphogenetic event - rupture of the 'serosal window' structure - as the ultimate site of defect. Overall, Oncopeltus zen seems to have a role in coordinating a number of pre-katatreptic events during mid embryogenesis.

  10. Evidence against a germ plasm in the milkweed bug Oncopeltus fasciatus, a hemimetabolous insect.

    Science.gov (United States)

    Ewen-Campen, Ben; Jones, Tamsin E M; Extavour, Cassandra G

    2013-06-15

    Primordial germ cell (PGC) formation in holometabolous insects like Drosophila melanogaster relies on maternally synthesised germ cell determinants that are asymmetrically localised to the oocyte posterior cortex. Embryonic nuclei that inherit this "germ plasm" acquire PGC fate. In contrast, historical studies of basally branching insects (Hemimetabola) suggest that a maternal requirement for germ line genes in PGC specification may be a derived character confined principally to Holometabola. However, there have been remarkably few investigations of germ line gene expression and function in hemimetabolous insects. Here we characterise PGC formation in the milkweed bug Oncopeltus fasciatus, a member of the sister group to Holometabola, thus providing an important evolutionary comparison to members of this clade. We examine the transcript distribution of orthologues of 19 Drosophila germ cell and/or germ plasm marker genes, and show that none of them localise asymmetrically within Oncopeltus oocytes or early embryos. Using multiple molecular and cytological criteria, we provide evidence that PGCs form after cellularisation at the site of gastrulation. Functional studies of vasa and tudor reveal that these genes are not required for germ cell formation, but that vasa is required in adult males for spermatogenesis. Taken together, our results provide evidence that Oncopeltus germ cells may form in the absence of germ plasm, consistent with the hypothesis that germ plasm is a derived strategy of germ cell specification in insects.

  11. The maize milkweed pod1 mutant reveals a mechanism to modify organ morphology.

    Science.gov (United States)

    Johnston, Robyn; Candela, Héctor; Hake, Sarah; Foster, Toshi

    2010-07-01

    Plant lateral organs, such as leaves, have three primary axes of growth-proximal-distal, medial--lateral and adaxial-abaxial (dorsal-ventral). Although most leaves are planar, modified leaf forms, such as the bikeeled grass prophyll, can be found in nature. A detailed examination of normal prophyll development indicates that polarity is established differently in the keels than in other parts of the prophyll. Analysis of the maize HD-ZIPIII gene rolled leaf1 (rld1) suggests that altered expression patterns are responsible for keel outgrowth. Recessive mutations in the maize (Zea mays) KANADI (KAN) gene milkweed pod1 (mwp1), which promotes abaxial cell identity, strongly affect development of the prophyll and silks (fused carpels). The prophyll is reduced to two unfused midribs and the silks are narrow and misshapen. Our data indicate that the prophyll and other fused organs are particularly sensitive to disruptions in adaxial-abaxial polarity. In addition, lateral and proximal-distal growth of most lateral organs is reduced in the mwp1-R mutant, supporting a role for the adaxial-abaxial boundary in promoting growth along both axes. We propose that the adaxial-abaxial patterning mechanism has been co-opted during evolution to generate diverse organ morphologies. (c) 2010 Wiley-Liss, Inc.

  12. 137Cs Transfer Factor from Latosol Soil to Swamp Gabbages (Ipomea Reptans Poir)

    International Nuclear Information System (INIS)

    Leli-Nirwani; Yurfida; Buchori

    2001-01-01

    A study of 137 Cs transfer factor from Latosol soil to swamp cabbages plant has been conducted using pot treatment system with complete random design. The aim of the research is to determine transfer factor of 137 Cs from latosol soil to swamp cabbages plant. Cs-137 concentration administered was 7.5287 kBq/pot. The number of swamp cabbages planted in 137 Cs treated soil and in cannot soil respectively was 12 pots filled with 1 kg soil/pot. After harvest, the weight of dried plant was measured. Transfer factor was determined according to the accumulation of 137 Cs concentration in swamp cabbages and soil and counted using Spectrometer Gamma. It was found that is a significant difference between 137 Cs concentration in swamp cabbages planted inthe treated soil and that of control soil. Transfer factor ranges between 0.02 and 0.13 with the averageof 0.08. (author)

  13. Recycling of phenolic compounds in Borneo's tropical peat swamp forests.

    Science.gov (United States)

    Yule, Catherine M; Lim, Yau Yan; Lim, Tse Yuen

    2018-02-07

    Tropical peat swamp forests (TPSF) are globally significant carbon stores, sequestering carbon mainly as phenolic polymers and phenolic compounds (particularly as lignin and its derivatives) in peat layers, in plants, and in the acidic blackwaters. Previous studies show that TPSF plants have particularly high levels of phenolic compounds which inhibit the decomposition of organic matter and thus promote peat accumulation. The studies of phenolic compounds are thus crucial to further understand how TPSF function with respect to carbon sequestration. Here we present a study of cycling of phenolic compounds in five forests in Borneo differing in flooding and acidity, leaching of phenolic compounds from senescent Macaranga pruinosa leaves, and absorption of phenolics by M. pruinosa seedlings. The results of the study show that total phenolic content (TPC) in soil and leaves of three species of Macaranga were highest in TPSF followed by freshwater swamp forest and flooded limestone forest, then dry land sites. Highest TPC values were associated with acidity (in TPSF) and waterlogging (in flooded forests). Moreover, phenolic compounds are rapidly leached from fallen senescent leaves, and could be reabsorbed by tree roots and converted into more complex phenolics within the leaves. Extreme conditions-waterlogging and acidity-may facilitate uptake and synthesis of protective phenolic compounds which are essential for impeded decomposition of organic matter in TPSF. Conversely, the ongoing drainage and degradation of TPSF, particularly for conversion to oil palm plantations, reverses the conditions necessary for peat accretion and carbon sequestration.

  14. Holocene mangrove swamps of West Africa sedimentology and soils

    Science.gov (United States)

    Marius, C.; Lucas, J.

    The mangrove swamps of West African Coast belong to the Atlantic type which is characterized by a small number of species. They colonize tidal environments which are dissected by numerous meandering tidal channels and are presently subject to a low rate of sediment accumulation. The mangrove vegetation exhibits a characteristic zonation pattern that basically reflects the adaptation of the various species to saline conditions. The typical zonation sequence is: Rhizophora racemosa (or Rh. mangle), Rh. mangle + Avicennia africana, Avicennia, flooded tanne, barren tanne, herbaceous tanne. The tannes are generated by aridic climatic conditions, heavy soil and water salt content, and are, in a way a peculiar feature of mangrove swamps in West Africa. The sediment colonized by the mangroves is relatively homogenous. Mineralogically, they are dominated by quartz and clay to which are associated halite, pyrite and jarosite. The clay suite is mainly composed of smectite and kaolinite. Smectite is predominant in the inlet areas and is replaced inland by kaolinite. Chemically, the sediments contain very low amounts of Ca, bases and trace elements. The mangrove swamp floodwaters have a chemical composition similar to that of seawater. It is dominated by sodium and chloride. Morphologically, the ripening of the soils appears with a chestnut mash colour horizon and buttery consistency in relation with the decomposition of fibrous roots of Rhizophora and also with pale yellow jarosite mottles in the top horizons of the tanne profiles due to the oxidation of pyrine. The two main properties of the mangrove soils of West Africa are acidity and salinity; the first is related to the high content of sulphur and the second to the sea influence. The acidity has to be connected mainly to the Rhizophora vegetation whose the root system is a real trap for catching the pyrites resulting from the reduction of the sulphates of sea water by the sulphate reducing bacteria, in a reduced

  15. Stepwise evolution of resistance to toxic cardenolides via genetic substitutions in the Na+/K+ -ATPase of milkweed butterflies (lepidoptera: Danaini).

    Science.gov (United States)

    Petschenka, Georg; Fandrich, Steffi; Sander, Nils; Wagschal, Vera; Boppré, Michael; Dobler, Susanne

    2013-09-01

    Despite the monarch butterfly (Danaus plexippus) being famous for its adaptations to the defensive traits of its milkweed host plants, little is known about the macroevolution of these traits. Unlike most other animal species, monarchs are largely insensitive to cardenolides, because their target site, the sodium pump (Na(+)/K(+) -ATPase), has evolved amino acid substitutions that reduce cardenolide binding (so-called target site insensitivity, TSI). Because many, but not all, species of milkweed butterflies (Danaini) are associated with cardenolide-containing host plants, we analyzed 16 species, representing all phylogenetic lineages of milkweed butterflies, for the occurrence of TSI by sequence analyses of the Na(+)/K(+) -ATPase gene and by enzymatic assays with extracted Na(+)/K(+) -ATPase. Here we report that sensitivity to cardenolides was reduced in a stepwise manner during the macroevolution of milkweed butterflies. Strikingly, not all Danaini typically consuming cardenolides showed TSI, but rather TSI was more strongly associated with sequestration of toxic cardenolides. Thus, the interplay between bottom-up selection by plant compounds and top-down selection by natural enemies can explain the evolutionary sequence of adaptations to these toxins. © 2013 The Author(s). Evolution © 2013 The Society for the Study of Evolution.

  16. Effect of captivity on genetic variance for five traits in the large milkweed bug (Oncopeltus fasciatus).

    Science.gov (United States)

    Rodríguez-Clark, K M

    2004-07-01

    Understanding the changes in genetic variance which may occur as populations move from nature into captivity has been considered important when populations in captivity are used as models of wild ones. However, the inherent significance of these changes has not previously been appreciated in a conservation context: are the methods aimed at founding captive populations with gene diversity representative of natural populations likely also to capture representative quantitative genetic variation? Here, I investigate changes in heritability and a less traditional measure, evolvability, between nature and captivity for the large milkweed bug, Oncopeltus fasciatus, to address this question. Founders were collected from a 100-km transect across the north-eastern US, and five traits (wing colour, pronotum colour, wing length, early fecundity and later fecundity) were recorded for founders and for their offspring during two generations in captivity. Analyses reveal significant heritable variation for some life history and morphological traits in both environments, with comparable absolute levels of evolvability across all traits (0-30%). Randomization tests show that while changes in heritability and total phenotypic variance were highly variable, additive genetic variance and evolvability remained stable across the environmental transition in the three morphological traits (changing 1-2% or less), while they declined significantly in the two life-history traits (5-8%). Although it is unclear whether the declines were due to selection or gene-by-environment interactions (or both), such declines do not appear inevitable: captive populations with small numbers of founders may contain substantial amounts of the evolvability found in nature, at least for some traits.

  17. Isolation of peat swamp forest foliar endophyte fungi as biofertilizer

    Directory of Open Access Journals (Sweden)

    Safinah Surya Hakim

    2017-01-01

    Full Text Available Peatland restoration activity is facing many obstacles, particularly in planting techniques and poor nutrient in peat soil. Naturally, endophytic fungi are abundant and have great potential as biofertilizer. This research investigates the potential endophytic fungi isolated from leaves of peat swamp tree species for biofertilizer. Research activities include: exploration, in vitro test to examine the phosphate solubilization and identification. Result showed that there were 360 leave segments collected from 4 sampling locations. The colonization percentage of 222 isolates ranged from 52.17% - 60.17%. Fifty seven morphospecies were selected from 222 isolates. Twelve isolates demonstrated ability to produce clear zones and ten isolates were selected for identification. It is concluded that twelve isolated demonstrated potential ability to produce clear zone and Penicillum citrinum isolate P3.10 was identified as an isolate that show the highest potential ability as a biofertilizer

  18. SWAMP+: multiple subsequence alignment using associative massive parallelism

    Energy Technology Data Exchange (ETDEWEB)

    Steinfadt, Shannon Irene [Los Alamos National Laboratory; Baker, Johnnie W [KENT STATE UNIV.

    2010-10-18

    A new parallel algorithm SWAMP+ incorporates the Smith-Waterman sequence alignment on an associative parallel model known as ASC. It is a highly sensitive parallel approach that expands traditional pairwise sequence alignment. This is the first parallel algorithm to provide multiple non-overlapping, non-intersecting subsequence alignments with the accuracy of Smith-Waterman. The efficient algorithm provides multiple alignments similar to BLAST while creating a better workflow for the end users. The parallel portions of the code run in O(m+n) time using m processors. When m = n, the algorithmic analysis becomes O(n) with a coefficient of two, yielding a linear speedup. Implementation of the algorithm on the SIMD ClearSpeed CSX620 confirms this theoretical linear speedup with real timings.

  19. Weeds optimally grow in peat swamp after burning

    Directory of Open Access Journals (Sweden)

    P.D. Susanti

    2014-07-01

    Full Text Available After clearing land by burning the peat, then the weeds and undergrowth will flourish. Even sometimes, the weeds are eventually burned again. Weed is known as a destroyer plant that has to be controlled. Through proper treatment, the existing weeds in peatlands can be potentiallly exploited. The purpose of this study was to determine the calorific value of briquettes as one of peatland weeds utilization. The results showed that the calorific value ranged from 2,492 cal/g to 5,230 cal/g. The lowest calorific value was on ‘teki kecil’ grass (Scirpus grossus Lf, while the highest calorific value was observed for ‘bantalaki grass’ (Hymenachne amplexicaulis Nees. The high calorific value of the peat weeds are potential for biomass briquettes raw materials. The utilization and use of peat weed briquettes as a raw materials expected can reduce land degradation due to peat swamp burning

  20. Ornithological aspects on the swamp Herghelie – Mangalia (Romania

    Directory of Open Access Journals (Sweden)

    GACHE Carmen

    2005-09-01

    Full Text Available This ornithological notice present information on the avifauna recorded in the swamp Herghelie – Mangalia beginning with the 1998’s summer. We identified 132 species of birds. The reedbeds cover about 35% of the swamp’s surface, offering good conditions for the breeding season (Ixobrychus minutus, Botaurus stellaris, Cygnus olor, Himantopus himantopus, Recurvirostra avosetta and Sterna hirundo but also for migration period. The breeding population is low due the high level of the human pressure. Due the presence of sulphurous sources and peat bed, the water is not freezing during the winter, transforming this territory in an important wintering site in the southeastern Dobroudja. Interesting is also the presence in this area during the winter of some summer visitors’ species for Romania like: Phalacrocorax pygmeus, Botaurus stellaris and Rallus aquaticus.

  1. Food Swamps Predict Obesity Rates Better Than Food Deserts in the United States

    Directory of Open Access Journals (Sweden)

    Kristen Cooksey-Stowers

    2017-11-01

    Full Text Available This paper investigates the effect of food environments, characterized as food swamps, on adult obesity rates. Food swamps have been described as areas with a high-density of establishments selling high-calorie fast food and junk food, relative to healthier food options. This study examines multiple ways of categorizing food environments as food swamps and food deserts, including alternate versions of the Retail Food Environment Index. We merged food outlet, sociodemographic and obesity data from the United States Department of Agriculture (USDA Food Environment Atlas, the American Community Survey, and a commercial street reference dataset. We employed an instrumental variables (IV strategy to correct for the endogeneity of food environments (i.e., that individuals self-select into neighborhoods and may consider food availability in their decision. Our results suggest that the presence of a food swamp is a stronger predictor of obesity rates than the absence of full-service grocery stores. We found, even after controlling for food desert effects, food swamps have a positive, statistically significant effect on adult obesity rates. All three food swamp measures indicated the same positive association, but reflected different magnitudes of the food swamp effect on rates of adult obesity (p values ranged from 0.00 to 0.16. Our adjustment for reverse causality, using an IV approach, revealed a stronger effect of food swamps than would have been obtained by naïve ordinary least squares (OLS estimates. The food swamp effect was stronger in counties with greater income inequality (p < 0.05 and where residents are less mobile (p < 0.01. Based on these findings, local government policies such as zoning laws simultaneously restricting access to unhealthy food outlets and incentivizing healthy food retailers to locate in underserved neighborhoods warrant consideration as strategies to increase health equity.

  2. Geomorphic controls on fluvial carbon exports and emissions from upland swamps in eastern Australia.

    Science.gov (United States)

    Cowley, Kirsten; Looman, Arun; Maher, Damien T; Fryirs, Kirstie

    2018-03-15

    Temperate Highland Peat Swamps on Sandstone (THPSS) are upland wetlands, similar to fens in the Northern Hemisphere and are found at the headwaters of low-order streams on the plateaus of Eastern Australia. They are classified as endangered ecological communities under State and National legislation. Previous works have identified particular geomorphic characteristics that are important to carbon storage in these low energy sediment accumulation zones. Changes in the geomorphic structure of THPSS, such as channelisation, may have profound implications for carbon storage. To assess the effect of channelisation on carbon budgets in these ecosystems it is essential to identify and quantify differences in carbon export, emissions and stocks of carbon of intact swamps and those that have become channelised. We undertook seasonal sampling of the perched swamp aquifers and surface waters of two intact swamps and two channelised fills in the Blue Mountains of New South Wales, Australia, to investigate differences in carbon exports and emissions between the two swamp types. We found that channelised fills' mean CO 2 emissions were almost four times higher than intact swamps with mean CH 4 emissions up to five times higher. Annual fluvial carbon exports for channelised fills were up to 18 times that of intact swamps. Channelised fill exports and emissions can represent up to 2% of the total swamp carbon stocks per annum which is 40 times higher than the intact swamps. This work clearly demonstrates that changes in geomorphic structure brought about by incision and channelisation results in profound changes to the carbon storage function of THPSS. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Food Swamps Predict Obesity Rates Better Than Food Deserts in the United States.

    Science.gov (United States)

    Cooksey-Stowers, Kristen; Schwartz, Marlene B; Brownell, Kelly D

    2017-11-14

    This paper investigates the effect of food environments, characterized as food swamps, on adult obesity rates. Food swamps have been described as areas with a high-density of establishments selling high-calorie fast food and junk food, relative to healthier food options. This study examines multiple ways of categorizing food environments as food swamps and food deserts, including alternate versions of the Retail Food Environment Index. We merged food outlet, sociodemographic and obesity data from the United States Department of Agriculture (USDA) Food Environment Atlas, the American Community Survey, and a commercial street reference dataset. We employed an instrumental variables (IV) strategy to correct for the endogeneity of food environments (i.e., that individuals self-select into neighborhoods and may consider food availability in their decision). Our results suggest that the presence of a food swamp is a stronger predictor of obesity rates than the absence of full-service grocery stores. We found, even after controlling for food desert effects, food swamps have a positive, statistically significant effect on adult obesity rates. All three food swamp measures indicated the same positive association, but reflected different magnitudes of the food swamp effect on rates of adult obesity ( p values ranged from 0.00 to 0.16). Our adjustment for reverse causality, using an IV approach, revealed a stronger effect of food swamps than would have been obtained by naïve ordinary least squares (OLS) estimates. The food swamp effect was stronger in counties with greater income inequality ( p food outlets and incentivizing healthy food retailers to locate in underserved neighborhoods warrant consideration as strategies to increase health equity.

  4. Food Swamps Predict Obesity Rates Better Than Food Deserts in the United States

    Science.gov (United States)

    Cooksey-Stowers, Kristen; Schwartz, Marlene B.; Brownell, Kelly D.

    2017-01-01

    This paper investigates the effect of food environments, characterized as food swamps, on adult obesity rates. Food swamps have been described as areas with a high-density of establishments selling high-calorie fast food and junk food, relative to healthier food options. This study examines multiple ways of categorizing food environments as food swamps and food deserts, including alternate versions of the Retail Food Environment Index. We merged food outlet, sociodemographic and obesity data from the United States Department of Agriculture (USDA) Food Environment Atlas, the American Community Survey, and a commercial street reference dataset. We employed an instrumental variables (IV) strategy to correct for the endogeneity of food environments (i.e., that individuals self-select into neighborhoods and may consider food availability in their decision). Our results suggest that the presence of a food swamp is a stronger predictor of obesity rates than the absence of full-service grocery stores. We found, even after controlling for food desert effects, food swamps have a positive, statistically significant effect on adult obesity rates. All three food swamp measures indicated the same positive association, but reflected different magnitudes of the food swamp effect on rates of adult obesity (p values ranged from 0.00 to 0.16). Our adjustment for reverse causality, using an IV approach, revealed a stronger effect of food swamps than would have been obtained by naïve ordinary least squares (OLS) estimates. The food swamp effect was stronger in counties with greater income inequality (p < 0.05) and where residents are less mobile (p < 0.01). Based on these findings, local government policies such as zoning laws simultaneously restricting access to unhealthy food outlets and incentivizing healthy food retailers to locate in underserved neighborhoods warrant consideration as strategies to increase health equity. PMID:29135909

  5. Old carbon efflux from tropical peat swamp drainage waters

    Science.gov (United States)

    Vihermaa, Leena; Waldron, Susan; Evers, Stephanie; Garnett, Mark; Newton, Jason

    2014-05-01

    Tropical peatlands constitute ~12% of the global peatland carbon pool, and of this 10% is in Malaysia1. Due to rising demand for food and biofuels, large areas of peat swamp forest ecosystems have been converted to plantation in Southeast Asia and are being subjected to degradation, drainage and fire, changing their carbon fluxes eg.2,3. Dissolved organic carbon (DOC) lost from disturbed tropical peat can be derived from deep within the peat column and be aged from centuries to millennia4 contributing to aquatic release and cycling of old carbon. Here we present the results of a field campaign to the Raja Musa Peat Swamp Forest Reserve in N. Selangor Malaysia, which has been selectively logged for 80 years before being granted timber reserve status. We measured CO2 and CH4efflux rates from drainage systems with different treatment history, and radiocarbon dated the evasion CO2 and associated [DOC]. We also collected water chemistry and stable isotope data from the sites. During our sampling in the dry season CO2 efflux rates ranged from 0.8 - 13.6 μmol m-2 s-1. Sediments in the channel bottom contained CH4 that appeared to be primarily lost by ebullition, leading to sporadic CH4 efflux. However, dissolved CH4 was also observed in water samples collected from these systems. The CO2 efflux was aged up to 582±37 years BP (0 BP = AD 1950) with the associated DOC aged 495±35 years BP. Both DOC and evasion CO2 were most 14C-enriched (i.e. younger) at the least disturbed site, and implied a substantial component of recently fixed carbon. In contrast, CO2 and DOC from the other sites had older 14C ages, indicating disturbance as the trigger for the loss of old carbon. 1Page et al., 2010 2Hooijer et al., 2010 3Kimberly et al., 2012 4Moore et al., 2013

  6. Report of mortmorilloniticas clay in the Medina swamp (Cerro Largo district)

    International Nuclear Information System (INIS)

    Gomez Rifas, C.; Heinzen, W.; Theune, C.

    1980-01-01

    This report describes the prospect ion work for the montmorillonitics clay in the region of Medina swamp in Cerro Largo district. The existence of new deposits was detected by cartography and geological study.

  7. Swamp land optimization in supporting food security and enhancing farmers welfare in South Sumatra Indonesia

    Science.gov (United States)

    Herwenita; Hutapea, Y.

    2018-02-01

    Swamp land in Indonesia spread in Sumatra, Kalimantan and West Papua. In Sumatra the largest swamp land area is located in South Sumatera Province. Unfortunately only few of the areas have been utilized due to its fragility, in which farmers could only cultivate rice on it once a year. The purpose of this paper is to develop a feasible farming pattern in swamp land to help farmers and practitioners in optimizing it by managing its water level. Shallow and mid swamp land can be cultivated using rotation model of crops (rice, corn, cassava), horticulture (cucumber, long beans, watermelon etc), fish farming (catfish, snake head fish, tilapia), and duck farming, whereas submergence tolerant rice varieties can be cultivated alternating with fish farming in deep swamp land. This study shows that such swamp land management is financially feasible showing by its positive NPV value, BCR value is above 1.00, and IRR value is greater than the interest rate. Therefore, implementation of this farming pattern is expected to increase farmers’ income and household food supply as well as village food supply.

  8. Isolation of heat-tolerant myoglobin from Asian swamp eel Monopterus albus.

    Science.gov (United States)

    Chotichayapong, Chatrachatchaya; Wiengsamut, Kittipong; Chanthai, Saksit; Sattayasai, Nison; Tamiya, Toru; Kanzawa, Nobuyuki; Tsuchiya, Takahide

    2012-10-01

    Myoglobin from Asian swamp eel Monopterus albus was purified from fish muscle using salt fractionation followed by column chromatography and molecular filtration. The purified Mb of 0.68 mg/g wet weight of muscle was determined for its molecular mass by MALDI-TOF-MS to be 15,525.18 Da. Using isoelectric focusing technique, the purified Mb showed two derivatives with pI of 6.40 and 7.12. Six peptide fragments of this protein identified by LC-MS/MS were homologous to Mbs of sea raven Hemitripterus americanus, yellowfin tuna Thunnus albacores, blue marlin Makaira nigicans, common carp Cyprinus carpio, and goldfish Carassius auratus. According to the Mb denaturation, the swamp eel Mb had thermal stability higher than walking catfish Clarias batrachus Mb and striped catfish Pangasius hypophthalmus Mb, between 30 and 60 (°)C. For the thermal stability of Mb, the swamp eel Mb showed a biphasic behavior due to the O(2) dissociation and the heme orientation disorder, with the lowest increase in both Kd(f) and Kd(s). The thermal sensitivity of swamp eel Mb was lower than those of the other Mbs for both of fast and slow reaction stages. These results suggest that the swamp eel Mb globin structure is thermally stable, which is consistent with heat-tolerant behavior of the swamp eel particularly in drought habitat.

  9. Fish measurement using Android smart phone: the example of swamp eel

    Science.gov (United States)

    Chen, Baisong; Fu, Zhuo; Ouyang, Haiying; Sun, Yingze; Ge, Changshui; Hu, Jing

    The body length and weight are critical physiological parameters for fishes, especially eel-like fishes like swamp eel(Monopterusalbus).Fast and accurate measuring of body length is significant for swamp eel culturing as well as its resource investigation and protection. This paper presents an Android smart phone-based photogrammetry technology for measuring and estimating the length and weight of swamp eel. This method utilizes the feature that the ratio of lengths of two objects within an image is equal to that of in reality to measure the length of swamp eels. And then, it estimates the weight via a pre-built length-weight regression model. Analysis and experimental results have indicated that this method is a fast and accurate method for length and weight measurements of swamp eel. The cross-validation results shows that the RMSE (root-mean-square error) of total length measurement of swamp eel is0.4 cm, and the RMSE of weight estimation is 11 grams.

  10. The maternal and early embryonic transcriptome of the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Ewen-Campen, Ben; Shaner, Nathan; Panfilio, Kristen A; Suzuki, Yuichiro; Roth, Siegfried; Extavour, Cassandra G

    2011-01-25

    Most evolutionary developmental biology ("evo-devo") studies of emerging model organisms focus on small numbers of candidate genes cloned individually using degenerate PCR. However, newly available sequencing technologies such as 454 pyrosequencing have recently begun to allow for massive gene discovery in animals without sequenced genomes. Within insects, although large volumes of sequence data are available for holometabolous insects, developmental studies of basally branching hemimetabolous insects typically suffer from low rates of gene discovery. We used 454 pyrosequencing to sequence over 500 million bases of cDNA from the ovaries and embryos of the milkweed bug Oncopeltus fasciatus, which lacks a sequenced genome. This indirectly developing insect occupies an important phylogenetic position, branching basal to Diptera (including fruit flies) and Hymenoptera (including honeybees), and is an experimentally tractable model for short-germ development. 2,087,410 reads from both normalized and non-normalized cDNA assembled into 21,097 sequences (isotigs) and 112,531 singletons. The assembled sequences fell into 16,617 unique gene models, and included predictions of splicing isoforms, which we examined experimentally. Discovery of new genes plateaued after assembly of ~1.5 million reads, suggesting that we have sequenced nearly all transcripts present in the cDNA sampled. Many transcripts have been assembled at close to full length, and there is a net gain of sequence data for over half of the pre-existing O. fasciatus accessions for developmental genes in GenBank. We identified 10,775 unique genes, including members of all major conserved metazoan signaling pathways and genes involved in several major categories of early developmental processes. We also specifically address the effects of cDNA normalization on gene discovery in de novo transcriptome analyses. Our sequencing, assembly and annotation framework provide a simple and effective way to achieve high

  11. The maternal and early embryonic transcriptome of the milkweed bug Oncopeltus fasciatus

    Directory of Open Access Journals (Sweden)

    Roth Siegfried

    2011-01-01

    Full Text Available Abstract Background Most evolutionary developmental biology ("evo-devo" studies of emerging model organisms focus on small numbers of candidate genes cloned individually using degenerate PCR. However, newly available sequencing technologies such as 454 pyrosequencing have recently begun to allow for massive gene discovery in animals without sequenced genomes. Within insects, although large volumes of sequence data are available for holometabolous insects, developmental studies of basally branching hemimetabolous insects typically suffer from low rates of gene discovery. Results We used 454 pyrosequencing to sequence over 500 million bases of cDNA from the ovaries and embryos of the milkweed bug Oncopeltus fasciatus, which lacks a sequenced genome. This indirectly developing insect occupies an important phylogenetic position, branching basal to Diptera (including fruit flies and Hymenoptera (including honeybees, and is an experimentally tractable model for short-germ development. 2,087,410 reads from both normalized and non-normalized cDNA assembled into 21,097 sequences (isotigs and 112,531 singletons. The assembled sequences fell into 16,617 unique gene models, and included predictions of splicing isoforms, which we examined experimentally. Discovery of new genes plateaued after assembly of ~1.5 million reads, suggesting that we have sequenced nearly all transcripts present in the cDNA sampled. Many transcripts have been assembled at close to full length, and there is a net gain of sequence data for over half of the pre-existing O. fasciatus accessions for developmental genes in GenBank. We identified 10,775 unique genes, including members of all major conserved metazoan signaling pathways and genes involved in several major categories of early developmental processes. We also specifically address the effects of cDNA normalization on gene discovery in de novo transcriptome analyses. Conclusions Our sequencing, assembly and annotation framework

  12. Sunken wood habitat for thiotrophic symbiosis in mangrove swamps.

    Science.gov (United States)

    Laurent, Mélina C Z; Gros, Olivier; Brulport, Jean-Pierre; Gaill, Françoise; Bris, Nadine Le

    2009-03-01

    Large organic falls to the benthic environment, such as dead wood or whale bones, harbour organisms relying on sulfide-oxidizing symbionts. Nothing is known however, concerning sulfide enrichment at the wood surface and its relation to wood colonization by sulfide-oxidizing symbiotic organisms. In this study we combined in situ hydrogen sulfide and pH measurements on sunken wood, with associated fauna microscopy analyses in a tropical mangrove swamp. This shallow environment is known to harbour thiotrophic symbioses and is also abundantly supplied with sunken wood. A significant sulfide enrichment at the wood surface was revealed. A 72h sequence of measurements emphasized the wide fluctuation of sulfide levels (0.1->100muM) over time with both a tidal influence and rapid fluctuations. Protozoans observed on the wood surface were similar to Zoothamnium niveum and to vorticellids. Our SEM observations revealed their association with ectosymbiotic bacteria, which are likely to be sulfide-oxidizers. These results support the idea that sunken wood surfaces constitute an environment suitable for sulfide-oxidizing symbioses.

  13. Mineral uptake by taro (colocasla esculenta) in swamp agroecosystem following gramoxone paraquat herbicide spraying

    International Nuclear Information System (INIS)

    Nashriyah Mat; Mazleha Maskin; Abdul Khalik Wood

    2006-01-01

    Mineral elemental uptake by Colocasia esculenta growing in swamp agroecosystem was studied following 14, 18 or 28 months of field spraying (MAT, months after treatment) with herbicide Gramoxone paraquat. In overall, Al (68226.67 ± 24066.56 μ/g dw) was the major element in riverine alluvial swamp soil, followed by micronutrient Fe (22280.00 ± 6328.87 μ/g dw). Concentration of macronutrient K (20733.33 ± 7371.82, μ/g dw) was the highest in swamp taro leaf followed by macronutrient Ca (7050.00 ± 3767.26 μ/g dw). In overall, the order of importance of the average mineral concentration in swamp taro leaf was K > Ca > Mn > Al > Na > Fe > Zn > Br > Co. However at 14 MAT, the order of importance of mineral content concentration in swamp taro leaf was K > Ca > Al > Na > Mn > Fe > Zn > Br > Co. At 18 MAT, the order of importance of mineral content concentration in swamp taro leaf was K > Ca > Mn > Al > Fe > Na > Zn > Br > Co. At 28 AMT, the order of importance of mineral content concentration in swamp taro leaf was K > Ca > Mn > Fe > Al > Zn > Na > Br > Co. In overall, the average order of importance of mineral elemental uptake or the soil plant transfer coefficient was Mn > K > Na > Zn > Co > Fe > Al; similar with the order at 28 MAT However, at 14 MAT the order of importance of the soil plant transfer coefficient was different at Mn > K > Na > Co > Zn > Al > Fe. (Author)

  14. Performance measures for a Mississippi River reintroduction into the forested wetlands of Maurepas Swamp

    Science.gov (United States)

    Krauss, Ken W.; Shaffer, Gary P.; Keim, Richard F.; Chambers, Jim L.; Wood, William B.; Hartley, Stephen B.

    2017-06-09

    The use of freshwater diversions (river reintroductions) from the Mississippi River as a restoration tool to rehabilitate Louisiana coastal wetlands has been promoted widely since the first such diversion at Caernarvon became operational in the early 1990s. To date, aside from the Bonnet Carré Spillway (which is designed and operated for flood control), there are only four operational Mississippi River freshwater diversions (two gated structures and two siphons) in coastal Louisiana, and they all target salinity intrusion, shellfish management, and (or) the enhancement of the integrity of marsh habitat. River reintroductions carry small sediment loads for various design reasons, but they can be effective in delivering fresh­water to combat saltwater intrusion and increase the delivery of nutrients and suspended fine-grained sediments to receiving wetlands. River reintroductions may be an ideal restoration tool for targeting coastal swamp forest habitat; much of the area of swamp forest habitat in coastal Louisiana is undergo­ing saltwater intrusion, high rates of submergence, and lack of riverine flow leading to reduced concentrations of important nutrients and suspended sediments, which sustain growth and regeneration, help to aerate swamp soils, and remove toxic compounds from the rhizosphere.The State of Louisiana Coastal Protection and Restora­tion Authority (CPRA) has made it a priority to establish a small freshwater river diversion into a coastal swamp forest located between Baton Rouge and New Orleans, Louisiana, to reintroduce Mississippi River water to Maurepas Swamp. While a full understanding of how a coastal swamp forest will respond to new freshwater loading through a Mississippi River reintroduction is unknown, this report provides guidance based on the available literature for establishing performance measures that can be used for evaluating the effectiveness of a Mississippi River reintroduction into the forested wetlands of Maurepas Swamp

  15. Zoneamento ambiental em Pantanais (Banhados Environmental zoning in swamp regions

    Directory of Open Access Journals (Sweden)

    Fabio C. Kurtz

    2001-05-01

    Full Text Available O zoneamento ambiental em pantanais (Banhados permitiu avaliar a deterioração ambiental dos ecossistemas existentes na Estação Ecológica do Taim (ESEC/TAIM municípios de Rio Grande, RS, e Santa Vitória do Palmar, RS. Considerou-se dois tipos distintos de ecossistemas: o do Banhado (ECO1 = Ecossistema Límnico e o da Planície Marítima (ECO2 = Ecossistema Planície Marítima. A ECO TOTAL (ECO1 + ECO2 apresentou 64% da classe APP (Área de Preservação Permanente, 27,6% de ACP (Área de Conservação Permanente, e 5,6% de AUO (Área de Uso e Ocupação, enquanto em menor porcentagem se encontra a classe AR (Área de Restauração com 2,8%. A deterioração ambiental da ESEC/TAIM (ECO TOTAL ficou em 13,65%. Com relação à análise fatorial, conclui-se que esta técnica permitiu conhecer a estrutura dos dados, mostrando as correlações entre cada variável (classes de exuberância e seu respectivo fator; entretanto, não foi possível separar grupos ou quantificar a influência de uma ou mais variáveis sobre outra de interesse (variável resposta. Recomenda-se que o zoneamento ambiental seja elaborado pelos órgãos públicos ambientais, nas demais estações ecológicas e nas unidades de conservação.The environmental zoning in swamp regions allowed the evaluation of the environmental deterioration of the ecosystems in the Ecological Station of Taim (ESEC/TAIM, in Rio Grande and Santa Vitória of Palmar (in the State of Rio Grande do Sul - Brazil. Two different types of ecosystems were considered: swamp regions (ECO1 = Límnico Ecosystem and the Marine Plain (ECO2 = Ecosystem Marine Plain. The ECO TOTAL (ECO1 + ECO2 presented 64% of the class APP (Permanent Preservation Area, 27.6% of ACP (Permanent Conservation Area, 5.6% of AUO (Occupation and Use Area, and in a smaller percentage the class AR (Restoration Area with 2.8%. The environmental deterioration of ESEC/TAIM (ECO TOTAL was 13.65%. The factorial analysis technique permitted

  16. CORRELATION ANALYSIS OF AGRONOMIC CHARACTERS AND GRAIN YIELD OF RICE FOR TIDAL SWAMP AREAS

    Directory of Open Access Journals (Sweden)

    Aris Hairmansis

    2013-05-01

    Full Text Available Development of rice varieties for tidal swamp areas is emphasized on the improvement of rice yield potential in specific environment. However, grain yield is a complex trait and highly dependent on the other agronomic characters; while information related to the relationship between agronomic characters and grain yield in the breeding program particularly for tidal swamp areas is very limited. The objective of this study was to investigate relationship between agronomic characters and grain yield of rice as a basis for selection of high yielding rice varieties for tidal swamp areas. Agronomic characters and grain yield of nine advanced rice breeding lines and two rice varieties were evaluated in a series of experiments in tidal swamp areas, Karang Agung Ulu Village, Banyuasin, South Sumatra, for four cropping seasons in dry season (DS 2005, wet season (WS 2005/2006, DS 2006, and DS 2007. Result from path analysis revealed that the following characters had positive direct effect on grain yield, i.e. number of productive tillers per hill (p = 0.356, number of filled grains per panicle (p = 0.544, and spikelet fertility (p = 0.215. Plant height had negative direct effect (p = -0.332 on grain yield, while maturity, number of spikelets per panicle, and 1000-grain weight showed negligible effect on rice grain yield. Present study suggests that indirect selection of high yielding tidal swamp rice can be done by selecting breeding lines which have many product tive tillers, dense filled grains, and high spikelet fertility.

  17. Genetic characteristic of swamp buffalo (Bubalus bubalis) from Pampangan, South Sumatra based on blood protein profile

    Science.gov (United States)

    Windusari, Yuanita; Hanum, Laila; Wahyudi, Rizki

    2017-11-01

    Swamp buffalo (Bubalus bubalis) is an endemic species and one of the genetic wealth of South Sumatra with a distribution area in the district of Pampangan (OganIlir and OganOganIlir). Suspected inbreeding causes decreased phenotypic properties. Inbreeding among various swamp buffalo is certainly not only lower the qualities but also genotypes and phenotypes. It is of interest to determine kinship variants swamp buffaloes from Pampangan through the analysis of a blood protein profile. Blood protein profile of four variants swamps buffalo was studied by using five electrophoresis system i.e. pre-albumin (Palb), albumin (Alb), ceruloplasmin (Cp), transferrin (Tf) and transferrin post (Ptf). In this paper, it is obtained that there was no significant differences among the four variants of the buffaloes were used as a sample. Prealbumin has two alleles (Palb1 and Palb2), albumin has three alleles (Alba, AlbB, AlbC), ceruloplasmin has one allele (BPA), post-transferrin has one allele (PTFA) with an allele frequency 1.0000 at any time transferrin has two alleles (TFA and TFB) with the allele frequency of 0.7500 and 1.0000. Characteristics prealbumin (Palb), albumin (Alb), ceruloplasmin (Cp), and post-transferrin (P-tf) is monomorphic, while transferrin is polymorphic average heterozygosity values all loci (H) 0.1286. Based on average heterozygosity, the swamp buffalo (Bubalusbubalis) from Pampangan has low genetic variation and closest genetic relationship.

  18. Floristic and phytosociological analysis of palm swamps in the central part of the Brazilian savanna

    Directory of Open Access Journals (Sweden)

    Isa Lucia de Morais Resende

    2013-03-01

    Full Text Available We analyzed the floristics and phytosociology of three palm swamps in the municipality of Bela Vista de Goiás, located in the state of Goiás, Brazil, in the central part of the Brazilian savanna (Cerrado. The floristic surveys were conducted monthly from May 2008 to April 2009, and 310 species were recorded (seven bryophytes, 15 ferns and 288 angiosperms. Bryophytes belonged to five genera and five families; ferns belonged to nine genera and nine families; and angiosperms belonged to 134 genera and 45 families. The angiosperm families with the highest species richness were Poaceae, Cyperaceae, Asteraceae, Eriocaulaceae, Xyridaceae, Lentibulariaceae, Melastomataceae, Rubiaceae and Fabaceae. The palm swamps were divided into three zones of increasing humidity: edge, middle and core. The number of species was higher in the middle than at the edge and the core. The families with the highest cover values were Cyperaceae, Melastomataceae, Arecaceae and Poaceae. Although the palm swamps had been disturbed to varying degrees, those disturbances did not affect the flora in the middle or the core. Floristic similarity was high between these two zones within a given palm swamp and low between the edges of different palm swamps.

  19. Project conservation and handling for the multiple uses and the development of the swamps of Colombia

    International Nuclear Information System (INIS)

    Sanchez Paez, Heliodoro

    1998-01-01

    In Colombia the swamps are distributed in the Atlantic and Pacific coasts; they are located in areas with conditions of pluvial precipitation that varies from annual 200 mm in the Guajira department; nine species of mangroves have registered for Colombia, which are related following a zonation starting from the tide line, still when this pattern not always stays and it depends on the influence of diverse factors and local conditions. The project conservation and handling for the multiple use and the development of the swamps of Colombia, had as objectives; to watch and to control the parameters of salinity, level of water and flow to laminate and of strengthening the generation of alternative productive social and environmentally appropriate for the sustainable use, guaranteeing their conservation and preservation of the swamps. The project was developed in two phases, one of diagnostic and planning and the other of dynamics of growth, phenology and natural regeneration

  20. Influences of deforestation on radiation and heat balances in tropical peat swamp forest in Thailand

    International Nuclear Information System (INIS)

    Suzuki, S.; Ishida, T.; Nagano, T.; Matsukawa, S.

    1997-01-01

    The difference of radiation and heat balances between a natural peat swamp forest and a deforested secondary forest has been investigated in Narathiwat Province, Thailand. Micrometeorological measurements were conducted continuously on observation towers 38 m and 4 m in heights in the primary forest and the secondary forest respectively. Results show that the deforestation of peat swamp forest leads to an increase in the sensible heat flux in the secondary forest. The yearly average ratio of the sensible heat flux to the net radiation was 20.9% in the peat swamp forest, and 33.2% in the secondary forest from Aug. 1995 to Jul. 1996. A ratio more than 40% was observed only in the dry season in the secondary forest. The change in sensible heat flux seemed to be influenced by the change in ground water levels. (author)

  1. The Effects of Corrosive Chemicals on Corrosion Rate of Steel Reinforcement Bars: II. Swamp Sludges

    Directory of Open Access Journals (Sweden)

    Henki Ashadi

    2010-10-01

    Full Text Available A polluted environment will influence the building age. The objective of this research was to find out the influence of corrosive chemicals within the sludge swamp area with the corrosion rate of steel concrete. Corrosion in steel concrete usually occur in acid area which contain of SO42-, Cl- and NO3-. The research treatment used by emerging ST 37 andST 60 within 60 days in 'polluted' sludge swamp area. Three variation of 'polluted' swamp sludge were made by increasing the concentration a corrosive unsure up to 1X, 5X and 10X. The corrosion rate measured by using an Immersion Method. The result of Immersion test showed that sulphate had a greatest influence to corrosion rate of ST 37 and ST 60 and followed by chloride and nitrate. Corrosion rate value for ST 37 was 17.58 mpy and for ST 60 was 12.47 mpy.

  2. Calotropin from Asclepias curasavica induces cell cycle arrest and apoptosis in cisplatin-resistant lung cancer cells.

    Science.gov (United States)

    Mo, En-Pan; Zhang, Rong-Rong; Xu, Jun; Zhang, Huan; Wang, Xiao-Xiong; Tan, Qiu-Tong; Liu, Fang-Lan; Jiang, Ren-Wang; Cai, Shao-Hui

    2016-09-16

    Calotropin (M11), an active compound isolated from Asclepias curasavica L., was found to exert strong inhibitory and pro-apoptotic activity specifically against cisplatin-induced resistant non-small cell lung cancer (NSCLC) cells (A549/CDDP). Molecular mechanism study revealed that M11 induced cell cycle arrest at the G2/M phase through down-regulating cyclins, CDK1, CDK2 and up-regulating p53 and p21. Furthermore, M11 accelerated apoptosis through the mitochondrial apoptotic pathway which was accompanied by increase Bax/Bcl-2 ratio, decrease in mitochondrial membrane potential, increase in reactive oxygen species production, activations of caspases 3 and 9 as well as cleavage of poly ADP-ribose polymerase (PARP). The activation and phosphorylation of JNK was also found to be involved in M11-induced apoptosis, and SP610025 (specific JNK inhibitor) partially prevented apoptosis induced by M11. In contrast, all of the effects that M11 induce cell cycle arrest and apoptosis in A549/CDDP cells were not significant in A549 cells. Drugs with higher sensitivity against resistant tumor cells than the parent cells are rather rare. Results of this study supported the potential application of M11 on the non-small lung cancer (NSCLC) with cisplatin resistance. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. Extensive bilateral corneal edema 6 weeks after cataract surgery: Keratopathy due to Asclepias physocarpa: a case report.

    Science.gov (United States)

    Matsuura, Kazuki; Hatta, Shiro; Terasaka, Yuki; Inoue, Yoshitsugu

    2017-01-18

    Surgeons may be unaware of the ability of plant toxins to cause corneal damage. Therefore, corneal damage following intraocular surgery due to plant toxins may be misdiagnosed as postoperative infection. A 74-year-old man presented with hyperemia and reduced visual acuity in both eyes 6 weeks after uneventful cataract surgery. We observed extensive hyperemia and corneal stromal edema with Descemet's folds in both eyes. After obtaining a detailed patient history, we diagnosed plant toxin-induced corneal edema due to Asclepias physocarpa, which can induce corneal edema by inhibiting the Na + /K + ATPase activity of the corneal endothelium. Antimicrobial and steroid eye drops and an oral steroid were prescribed accordingly. Symptons began to improve on day 3 and had almost completely resolved by day 6. At 1 month, the patient had fully recovered without any sequelae. The correct diagnosis was possible in the present case as symptoms were bilateral and the patient was able to report his potential exposure to plant toxins. However, if the symptoms had been unilateral and the patient had been unaware of these toxins, he may have undergone unnecessary surgical interventions to treat non-existent postoperative endophthalmitis.

  4. Sequencing and characterization of asclepain f: the first cysteine peptidase cDNA cloned and expressed from Asclepias fruticosa latex.

    Science.gov (United States)

    Trejo, Sebastián A; López, Laura M I; Caffini, Néstor O; Natalucci, Claudia L; Canals, Francesc; Avilés, Francesc X

    2009-07-01

    Asclepain f is a papain-like protease previously isolated and characterized from latex of Asclepias fruticosa. This enzyme is a member of the C1 family of cysteine proteases that are synthesized as preproenzymes. The enzyme belongs to the alpha + beta class of proteins, with two disulfide bridges (Cys22-Cys63 and Cys56-Cys95) in the alpha domain, and another one (Cys150-Cys201) in the beta domain, as was determined by molecular modeling. A full-length 1,152 bp cDNA was cloned by RT-RACE-PCR from latex mRNA. The sequence was predicted as an open reading frame of 340 amino acid residues, of which 16 residues belong to the signal peptide, 113 to the propeptide and 211 to the mature enzyme. The full-length cDNA was ligated to pPICZalpha vector and expressed in Pichia pastoris. Recombinant asclepain f showed endopeptidase activity on pGlu-Phe-Leu-p-nitroanilide and was identified by PMF-MALDI-TOF MS. Asclepain f is the first peptidase cloned and expressed from mRNA isolated from plant latex, confirming the presence of the preprocysteine peptidase in the latex.

  5. The impact of the Suwannee River Sill on the surface hydrology of Okefenokee Swamp, USA

    Science.gov (United States)

    Yin, Zhi-Yong; Brook, George A.

    1992-08-01

    Okefenokee Swamp, located in southeastern Georgia and northeastern Florida, is one of the largest freshwater wetland complexes and a National Wildlife Refuge in the United States. A low earthen dam, the Suwannee River Sill, was built on the largest outlet stream of Okefenokee Swamp in the early 1960s. The purpose was to raise the water level and thus reduce fire frequency in this National Wildlife Refuge. In this study, hydrologic conditions in the swamp prior to (1937-1962) and after (1963-1986) sill construction were compared by statistical procedures. An average 9 cm increase in swamp water level at the Suwannee Canal Recreation Area was attributed to the sill. Increased precipitation and decreased evapotranspiration during the study period caused another 5 cm increase in water levels. Seasonal changes in climatic factors were also responsible for seasonal changes in water levels and streamflow in the pre- and post-sill periods. Although the effect of the sill on water level was more significant during dry periods, it is doubtful that the Suwannee River Sill actually prevented occurrence of severe fibres in the post-sill period, which was wetter than the period before sill construction. The sill diverted 2.6% of swamp outflow from the Suwannee River to the St. Mary's River. Diversion of flow was more marked during low flow periods. Therefore, the discharge of the St. Mary's River in the post-sill increased more than the discharge of the Suwannee River and its variability became lower that of the Suwannee River. The relationships between swamp water level, streamflow and precipitation were also changed due to construction of the sill.

  6. The Effects of Corrosive Chemicals on Corrosion Rate of Steel Reinforcement Bars: I. Swamp Water

    Directory of Open Access Journals (Sweden)

    Sulistyoweni Widanarko

    2010-10-01

    Full Text Available Most of infrastructures using steel concrete to reinforce the strength of concrete. Steel concrete is so vulnerable to chemical compounds that can cause corrosion. It can happen due to the presence of chemical compounds in acid environment in low pH level. These chemical compounds are SO42-, Cl-, NO3-. There are many swamp area in Indonesia. The acid contents and the concentration of ion sulphate, chlorides, and nitrate are higher in the swamp water than in the ground water .The objective of this research was to find out the influence of corrosive chemicals in the swamp water to the steel concrete corrosion rate. There were two treatment used: (1 emerging ST 37 and ST 60 within 60 days in the 'polluted' swamp water, (2 moving the ST 37 up and down periodically in the ' polluted' swamp water. Three variation of 'polluted' swamp water were made by increasing the concentration of corrosive chemical up to 1X, 5X and 10X respectively. The corrosion rate was measured by using an Immersion Method. The result of Immersion test showed that chloride had the greatest influence to corrosion rate of ST 37 and ST 60 and followed by sulphate and Nitrate. Corrosion rate value for ST 37 is 24.29 mpy and for ST 60 is 22.76 mpy. By moving the sample up and down, the corrosion rate of ST 37 increase up to 37.59 mpy, and chloride still having the greatest influence, followed by sulphate and nitrate.

  7. Radionuclides distribution in artificial reservoir V-17 (old swamp)

    Energy Technology Data Exchange (ETDEWEB)

    Kuzmenkova, N. [Vernadsky Institute of geochemistry and analytical chemistry RAS (Russian Federation); Vlasova, I.; Sapozhnikov, Y.; Kalmykov, S. [Lomonosov MSU, Chemistry Dep. (Russian Federation); Pryakhin, E. [Urals Research center for radiation medicine (Russian Federation); Ivanov, I. [FSUE Mayak PA (Russian Federation)

    2014-07-01

    Reservoir V-17 (Old Swamp) was formed as a result of the construction of dams in 1952 and 1954 (MAYAK Production Association),located in a natural depression relief. Intermediate level liquid radioactive wastes (ILLW) have been discharged to this reservoir since 1949. The water surface area of the lake is 0.13 km{sup 2} with the volume of 0.36 Mm{sup 3}. The maximum depth is 6.5 m with the average value of 2.8 m. Among 74 PBq deposited to the reservoir, the major portion is concentrated in the bottom sediments (as determined in 2007). The aim of this study is to determine radionuclide distribution among abiotic and biotic aquatic components, that includes study of various radionuclides distribution between water and bottom sediments, their speciation and evaluation of condition of zooplankton community. As a result of field research at the reservoir, 4 sampling locations were chosen from which bottom sediments, water samples and some hydrobionts were collected. Pore waters were separated from the wet sediments by high-speed centrifugation. All samples were analyzed by gamma spectrometry using HPGe detector Canberra GR 3818.The radioactivity of tritium in the pore and lake waters was determined by liquid-scintillation spectrometry. The strontium-90 was detected by Cherenkov counting of the daughter {sup 90}Y. The preliminary data show for sediments samples: for {sup 137}Cs amount varies from 75,5 KBq/g to 232 KBq/g, {sup 154}Eu - from 460 to 990 Bq/g, {sup 241}Am - from 1 to 4 KBq/g, {sup 134}Cs - from 50 to 220 Bq/g; for water samples: large contribution from strontium-90 and tritium (varies from 2 to 25 Bq/g). Pore water contains medium amount of radionuclides between sediments and water samples. For {sup 137}Cs varies between 160 to 1100 Bq/g, {sup 154}Eu - from 0,1 to 0,3 Bq/g, {sup 241}Am - from 0,3 to 11 Bq/g, {sup 134}Cs - from 0,1 to 1,7 Bq/g. Variation depends on the sampling place. Activity distribution among hydrobionts was studied by digital Radiography

  8. Long-term disturbance dynamics and resilience of tropical peat swamp forests.

    Science.gov (United States)

    Cole, Lydia E S; Bhagwat, Shonil A; Willis, Katherine J

    2015-01-01

    1. The coastal peat swamp forests of Sarawak, Malaysian Borneo, are undergoing rapid conversion, predominantly into oil palm plantations. This wetland ecosystem is assumed to have experienced insignificant disturbance in the past, persisting under a single ecologically-stable regime. However, there is limited knowledge of the past disturbance regime, long-term functioning and fundamentally the resilience of this ecosystem to changing natural and anthropogenic perturbations through time. 2. In this study, long-term ecological data sets from three degraded peatlands in Sarawak were collected to shed light on peat swamp forest dynamics. Fossil pollen and charcoal were counted in each sedimentary sequence to reconstruct vegetation and investigate responses to past environmental disturbance, both natural and anthropogenic. 3. Results demonstrate that peat swamp forest taxa have dominated these vegetation profiles throughout the last c . 2000-year period despite the presence of various drivers of disturbance. Evidence for episodes of climatic variability, predominantly linked to ENSO events, and wildfires is present throughout. However, in the last c . 500 years, burning and indicators of human disturbance have elevated beyond past levels at these sites, concurrent with a reduction in peat swamp forest pollen. 4. Two key insights have been gained through this palaeoecological analysis: (i) peat swamp forest vegetation has demonstrated resilience to disturbance caused by burning and climatic variability in Sarawak in the late Holocene, however (ii) coincident with increased fire combined with human impact c . 500 years ago, these communities started to decline. 5. Synthesis . Sarawak's coastal peat swamps have demonstrated resilience to past natural disturbances, with forest vegetation persisting through episodes of fire and climatic variability. However, palaeoecological data presented here suggest that recent, anthropogenic disturbances are of a greater magnitude

  9. Biocontrol for Rhizoctonia Stem Rot Disease by Using Combination of Specific Endophyte in Paddy Tidal Swamp

    OpenAIRE

    Budi, Ismed Setya; Mariana, Mariana

    2013-01-01

    The use of combination of specific endophytic in tidal swamps to control stem root disease as biological control agents has not been done. It is expected that this combination is able to continuously protect plants from pathogen interference. The research was carried out in type C tidal swamp in Banjar regency of South Kalimantan, from March to November 2011, temperature 29-32oC, and pH 4.0-5.5. The method used was Split Plot design. Biocontrol preparation for both types of endophytic was ap...

  10. ¿Envenenamiento por consumo de Asclepias curassavica o nematodiasis gastrointestinal en ovinos en pastoreo? Hallazgos de un estudio de caso

    OpenAIRE

    Macedo Barragán, Rafael; Arredondo Ruiz, Victalina; Ramírez Rodríguez, Julia; García Márquez, Luis Jorge

    2009-01-01

    Se realizó un estudio de caso con el objetivo de documentar la posible ocurrencia de envenenamiento por el consumo de Asclepias curassavica o de casos agudos de nematodiasis gastrointestinal en ovinos en pastoreo. Se registró la densidad de población, la ubicación espacial de la maleza y el tipo de vegetación; además, se observaron los hábitos de pastoreo del rebaño y la semiología mostrada por los ovinos afectados. Posteriormente se realizó una necropsia con la finalidad de describir hallazg...

  11. 8,12;8,20-diepoxy-8,14-secopregnane glycosides from roots of Asclepias tuberosa and their effect on proliferation of human skin fibroblasts.

    Science.gov (United States)

    Warashina, Tsutomu; Umehara, Kaoru; Miyase, Toshio; Noro, Tadataka

    2011-10-01

    A pregnane glycoside fraction from the roots of Asclepias tuberosa L. caused normal human skin fibroblasts to proliferate. This fraction contained 21 pregnane glycosides whose structures were established using NMR spectroscopic analysis and chemical evidence. The aglycones of most of these compounds were identified as 8,12;8,20-diepoxy-8,14-secopregnanes, such as tuberogenin or 5,6-didehydrotuberogenin, the same aglycones as constituents of the aerial parts of this plant. Some of these compounds also caused proliferation of skin fibroblasts. Copyright © 2011 Elsevier Ltd. All rights reserved.

  12. Are there evidences of a complex mimicry system among Asclepias curassavica (Apocynaceae), Epidendrum fulgens (Orchidaceae), and Lantana camara (Verbenaceae) in Southern Brazil?

    OpenAIRE

    Fuhro, Daniela; Araújo, Aldo Mellender de; Irgang, Bruno Edgar

    2010-01-01

    The goal of this paper was to test the presence of mimicry in Asclepias curassavica L., Epidendrum fulgens Brong., and Lantana camara L. The study was carried out at the Parque Estadual de Itapeva, RS, southern Brazil, from 2004 to 2006. Flowering period of each of the three species was followed up; focal observations of butterflies visiting flowers, from fixed point and during random walks were carried out. We also estimated the frequency of pollinaria removal in the orchid, as well as its m...

  13. Differential recovery of a deepwater swamp forest across a gradient of disturbance intensity

    Science.gov (United States)

    Diane De Steven; Rebecca R. Sharitz

    1997-01-01

    On the Savannah River Site, South Carolina, USA, large areas of floodplain swamp forest of baldcypress (Taxodium distichum) and water tupelo (Nyssa aquatica) were destroyed by the cumulative impacts of cooling-water discharges over a 35-year period of nuclear reactor operations. In one floodplain area, four years after thermal...

  14. Potential roles of fish, birds, and water in swamp privet (Forestiera acuminata) seed dispersal

    Science.gov (United States)

    Susan B. Adams; Paul B. Hamel; Kristina Connor; Bryce Burke; Emile S. Gardiner; David Wise

    2007-01-01

    Forestiera acuminata (swamp privet) is a common wetland shrub/small tree native to the southeastern United States. We examined several possible dispersal avenues for the plant. We tested germination of seeds exposed to various treatments, including passage through Ictalurus punctatus (Channel Catfi sh) guts, and conducted other...

  15. Composition and species diversity of pine-wiregrass savannas of the Green Swamp, North Carolina

    Science.gov (United States)

    Joan Walker; Robert K. Peet

    1983-01-01

    Fire-maintained, species-rich pines wiregrass savannas in the Green Swamp, North Carolina were sampled over their natural range of environmental conditions and fire frequencies. Species composition, species richness, diversity (Exp H', I/ C), and aboveground production were documented and fertilization experiments conducted to assess possible mechanisms for the...

  16. Decline of the Maurepas Swamp, Pontchartrain Basin, Louisiana, and Approaches to Restoration

    Directory of Open Access Journals (Sweden)

    Gary P. Shaffer

    2016-03-01

    Full Text Available The Maurepas swamp is the second largest contiguous coastal forest in Louisiana but it is highly degraded due to subsidence, near permanent flooding, nutrient starvation, nutria herbivory, and saltwater intrusion. Observed tree mortality rates at study sites in the Maurepas swamp are very high (up to 100% tree mortality in 11 years and basal area decreased with average salinities of <1 ppt. Habitat classification, vegetation productivity and mortality, and surface elevation changes show a clear trajectory from stagnant, nearly permanently flooded forests with broken canopy to degraded forests with sparse baldcypress and dominated by herbaceous species and open water to open water habitat for most of the Maurepas swamp without introduction of fresh water to combat saltwater intrusion and stimulate productivity and accretion. Healthy forests in the Maurepas are receiving fresh water containing nutrients and sediments from urban areas, high quality river water, or secondarily treated municipal effluent. Currently, two proposed diversions into the swamp are via Hope Canal (57 m3·s−1 and Blind River (142 m3·s−1. These diversions would greatly benefit their immediate area but they are too small to influence the entire Maurepas sub-basin, especially in terms of accretion. A large diversion (>1422 m3·s−1 is needed to deliver the adequate sediments to achieve high accretion rates and stimulate organic soil formation.

  17. Net ecosystem CO2 exchange of a primary tropical peat swamp forest in Sarawak, Malaysia

    Science.gov (United States)

    Tang Che Ing, A.; Stoy, P. C.; Melling, L.

    2014-12-01

    Tropical peat swamp forests are widely recognized as one of the world's most efficient ecosystems for the sequestration and storage of carbon through both their aboveground biomass and underlying thick deposits of peat. As the peat characteristics exhibit high spatial and temporal variability as well as the structural and functional complexity of forests, tropical peat ecosystems can act naturally as both carbon sinks and sources over their life cycles. Nonetheless, few reports of studies on the ecosystem-scale CO2 exchange of tropical peat swamp forests are available to-date and their present roles in the global carbon cycle remain uncertain. To quantify CO2 exchange and unravel the prevailing factors and potential underlying mechanism regulating net CO2 fluxes, an eddy covariance tower was erected in a tropical peat swamp forest in Sarawak, Malaysia. We observed that the diurnal and seasonal patterns of net ecosystem CO2 exchange (NEE) and its components (gross primary productivity (GPP) and ecosystem respiration (RE)) varied between seasons and years. Rates of NEE declined in the wet season relative to the dry season. Conversely, both the gross primary productivity (GPP) and ecosystem respiration (RE) were found to be higher during the wet season than the dry season, in which GPP was strongly negatively correlated with NEE. The average annual NEE was 385 ± 74 g C m-2 yr-1, indicating the primary peat swamp forest functioned as net source of CO2 to the atmosphere over the observation period.

  18. 75 FR 8107 - Bond Swamp National Wildlife Refuge, Bibb and Twiggs Counties, GA

    Science.gov (United States)

    2010-02-23

    ... impact. SUMMARY: We, the U.S. Fish and Wildlife Service (Service), announce the availability of our final comprehensive Conservation Plan (CCP) and finding of no significant impact (FONSI) for the environmental..., including upland mixed pine/hardwood, bottomland hardwood, and tupelo gum swamp forests. Creeks, beaver...

  19. Diversity and Antagonistic Activity of Actinomycete Strains From Myristica Swamp Soils Against Human Pathogens

    Directory of Open Access Journals (Sweden)

    Varghese Rlnoy

    2014-05-01

    Full Text Available Under the present investigation Actinomycetes were isolated from the soils of Myristica swamps of southern Western Ghats and the antagonistic activity against different human bacterial pathogens was evaluated. Results of the present study revealed that Actinomycetes population in the soils of Myristica swamp was spatially and seasonally varied. Actinomycetes load was varied from 24×104 to 71×103, from 129×103 to 40×103 and from 31×104 to 84×103 in post monsoon, monsoon and pre monsoon respectively. A total of 23 Actinomycetes strains belonging to six genera were isolated from swamp soils. Identification of the isolates showed that most of the isolates belonged to the genus Streptomyces (11, followed by Nocardia (6, Micromonospora (3, Pseudonocardia (1, Streptosporangium (1, and Nocardiopsis (1. Antagonistic studies revealed that 91.3% of Actinomycete isolates were active against one or more tested pathogens, of that 56.52% exhibited activity against Gram negative and 86.95% showed activity against Gram positive bacteria. 39.13% isolates were active against all the bacterial pathogens selected and its inhibition zone diameter was also high. 69.5% of Actinomycetes were exhibited antibacterial activity against Listeria followed by Bacillus cereus (65.21%, Staphylococcus (60.86%, Vibrio cholera (52.17%, Salmonella (52.17% and E. coli (39.13%. The results indicate that the Myristica swamp soils of Southern Western Ghats might be a remarkable reserve of Actinomycetes with potential antagonistic activity.

  20. Utilization of Organic Fertilizer on Sweet Corn (Zea mays saccharata Sturt Crop at Shallow Swamp Land

    Directory of Open Access Journals (Sweden)

    Midranisiah

    2017-01-01

    Full Text Available Shallow lowland swamp area has significant potential for cultivation of sweet corn crop. This lowland swamp has rich natural resources such as organic fertilizers from chicken dunk, cow dunk, oil palm fresh bunches and legume cover crops (LCC that are not maximally utilized yet by farmers. These organic fertilizers can be utilized to increase the growth and production of sweet corn crop. The research objective was to determine organic fertilizer types that capable to increase the growth and production of sweet corn crop at shallow lowland swamp area. This research had been conducted from January to April 2015 in Pulau Semambu Village, North Indralaya Subdistrict, Ogan Ilir District, South Sumatra Province. The design used in this research was non-factorial Randomized Block Design (RBD with four treatments of organic fertilizer types with six replications for each treatment. The treatments were consisted of organic fertilizers from chicken dunk, cow dunk, oil palm fresh bunches and legume cover crops (LCC. The results showed that treatment of organic fertilizers from chicken dunk could increase the growth and production of sweet corn at shallow lowland swamp area with yield level of 4.37 kg.plot −1.

  1. The Productivity and Natural Increase of Swamp Buffalo in District Malang

    Science.gov (United States)

    Budiarto, A.; Ciptadi, G.

    2018-02-01

    The purpose of this research was to collect the basic information needed to develop a sustainable breeding program, which includes the potential for production and reproduction of buffaloes. This research was conducted on swamp buffalo in Malang Regency East Java. The research method used was survey method. Primary data was obtained from direct observation on 323 tails owned by 98 breeders. Variables observed were population growth and reproductive performance. The data obtained were analyzed descriptively. The result showed that the initial population study of swamp Buffaloes in Malang as many as 1155 with male and female ratio 1: 2. The ratios of male and female swamp Buffalo 20 percent male and 80 percent female. Overall, the buffalo reproduction performance was still low. Service per conception 2.06 ± 0.88; Anestrus Postpartum 7.46 ± 3.83 months; calving interval distance 17.82 ± 4.86 months; 20.43 % birth rate and 4.33% mortality rate of Natural Increase (NI) population was about 16,1%. In conclusion, the value of NI of swamp Buffalo in Malang Regency is still low. To increase buffalo productivity, buffalo breeding program is continuously based on reproduction control.

  2. Skin disease affecting the conservation of the western swamp tortoise (Pseudemydura umbrina)

    Science.gov (United States)

    Ladyman, J M; Kuchling, G; Burford, D; Boardman, W; Raidal, S R

    1998-11-01

    To review the present position of the western swamp tortoise (Pseudemydura umbrina) as an endangered species and significant health issues affecting efforts to save it from extinction. A retrospective analysis of the husbandry, hospital and pathology records of the western swamp tortoise captive breeding program at Perth Zoo. In 1987 a captive breeding project was developed to prevent the extinction of the western swamp tortoise but an outbreak of a necrotising dermatitis in 1989 threatened the survival of the captive bred hatchlings. Less severe outbreaks occurred in 1990 and 1993, with isolated cases in between. Of 283 tortoises that were born in captivity or came into captivity from the wild, 37 (13.1%) were affected, comprising 37% of all males, 26% of all females and 13% of animals of unknown gender. Of the affected animals, 70% were less than 2 years of age and 29% were older. Males were 1.6 times more likely to be infected than females but this difference was not statistically significant (P = 0.27). Culture of the lesions consistently yielded unidentified Pseudomonas sp. Improved husbandry, such as strict maintenance of water quality and temperature conditions similar to that of the animal's natural habitat, and monitoring the health of individual tortoises have successfully controlled skin disease in the captive breeding of the western swamp tortoise.

  3. Improved open-sun drying method for local swamp rice in Uganda ...

    African Journals Online (AJOL)

    “Kaiso” and “Supa” are the main local swamp-rice (Oryza Sativa) varieties currently grown in Uganda mainly by smallholder farmers on small gardens (0.5 – 2ha). Due to lack of mechanized drying equipment and owing to the low volumes of their harvests, these farmers use open-sun drying methods, where the paddy is ...

  4. Throughfall and stemflow dynamics in a riparian cedar swamp: possible ecohydrological feedbacks

    Science.gov (United States)

    Duval, T. P.

    2012-12-01

    Partitioning of rainfall through forest canopies as throughfall and stemflow have deservedly been the subject of much research in the past; however, very little is known about the fluxes of water and solutes through forested wetland communities. Temperate swamps are characterized by intermittent canopy coverage, with areas that are denser than upland forests of similar species, but also contain canopy gaps of meadow and marsh communities,. Understanding the role of vegetation on the distribution of precipitation in these ecosystems is necessary to effectively constrain water balance estimates and predict possible community responses to shifting climate regimes. This study examines throughfall, stemflow, and interception dynamics in a riparian cedar swamp in Alliston, Ontario, Canada over the 2012 growing season. Throughfall averaged 76 % of above-canopy rainfall; however, there were spatial-magnitude interaction variations within the swamp. For events less than 20 mm, between 17 and 75 % of the measured swamp floor received greater depth of rain than above the canopy, whereas for events greater than 20 mm only between 2 and 23 % of the sampled swamp floor received more water than the actual event. The observed spatial variability in throughfall was not related to leaf area index, suggesting remote sensing modelling efforts may not be an accurate method for quantification of wetland precipitation dynamics. Stemflow along the predominantly cedar trees averaged 5 %; therefore, net precipitation on a seasonal basis in this cedar swamp was 81 % of above canopy rainfall. Throughfall DOC and total nitrogen concentrations averaged 31 and 2.2 mg/L, respectively, with stemflow DOC and TN concentrations averaging 109 and 6.5 mg/L, respectively. These values are much higher than reported for upland forest species. In general, throughfall magnitudes increased and solute concentrations decreased with increasing distance from the existing forest boles. The delivery of high

  5. Factors involved in early polarization of the anterior-posterior axis in the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Ginzburg, Neta; Cohen, Mira; Chipman, Ariel D

    2017-05-01

    The axes of insect embryos are defined early in the blastoderm stage. Genes involved in this polarization are well known in Drosophila, but less so in other insects, such as the milkweed bug Oncopeltus fasciatus. Using quantitative PCR, we looked at differential expression of several candidate genes for early anterior-posterior patterning and found that none of them are expressed asymmetrically in the early blastoderm. We then used an RNA-Seq approach to identify novel candidate genes that might be involved in early polarization in Oncopeltus. We focused on transcription factors (TFs) as these are likely to be central players in developmental processes. Using both homology and domain based identification approaches, we were unable to find any TF encoding transcripts that are expressed asymmetrically along the anterior-posterior axis at early stages. Using a GO-term analysis of all asymmetrically expressed mRNAs, we found an enrichment of genes relating to mitochondrial function in the posterior at the earliest studied time-point. We also found a gradual enrichment of transcription related activities, giving us a putative time frame for the maternal to zygotic transition. Our dataset provides us with a list of new candidate genes in early development, which can be followed up experimentally. © 2017 Wiley Periodicals, Inc.

  6. Distribution and activity of a Dippu DH31-like peptide in the large milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Te Brugge, V A; Orchard, I

    2008-02-01

    The milkweed bug, Oncopeltus fasciatus, is a plant feeding hemipteran. While there has been much research done on the neurohormonal control of the post-feeding diuresis in the blood-feeding hemipteran, Rhodnius prolixus, little is known about the control of the post-feeding diuresis in O. fasciatus. One of the neurohormones that may play a role in this rapid diuresis belongs to the calcitonin-like diuretic hormone (DH31) family of insect peptides. In this study we demonstrate the presence of DH31-like immunoreactivity in the central nervous system (CNS) and gut of O. fasciatus 5th instars. As well, DH31-like material was quantified and partially purified from the CNS of 5th instar O. fasciatus using reversed-phase liquid chromatography (RPLC) and monitored with an enzyme-linked immunosorbent assay (ELISA). When tested on O. fasciatus 5th instar Malpighian tubules, DH31-like peptides significantly increased the rate of secretion over saline controls. The results suggest that there is a DH31-like peptide(s) present in the CNS of O. fasciatus and that this peptide may play a role in the control of Malpighian tubule secretion.

  7. The milkweed pod1 gene encodes a KANADI protein that is required for abaxial/adaxial patterning in maize leaves.

    Science.gov (United States)

    Candela, Héctor; Johnston, Robyn; Gerhold, Abigail; Foster, Toshi; Hake, Sarah

    2008-08-01

    Leaf primordia initiate from the shoot apical meristem with inherent polarity; the adaxial side faces the meristem, while the abaxial side faces away from the meristem. Adaxial/abaxial polarity is thought to be necessary for laminar growth of leaves, as mutants lacking either adaxial or abaxial cell types often develop radially symmetric lateral organs. The milkweed pod1 (mwp1) mutant of maize (Zea mays) has adaxialized sectors in the sheath, the proximal part of the leaf. Ectopic leaf flaps develop where adaxial and abaxial cell types juxtapose. Ectopic expression of the HD-ZIPIII gene rolled leaf1 (rld1) correlates with the adaxialized regions. Cloning of mwp1 showed that it encodes a KANADI transcription factor. Double mutants of mwp1-R with a microRNA-resistant allele of rld1, Rld1-N1990, show a synergistic phenotype with polarity defects in sheath and blade and a failure to differentiate vascular and photosynthetic cell types in the adaxialized sectors. The sectored phenotype and timing of the defect suggest that mwp1 is required late in leaf development to maintain abaxial cell fate. The phenotype of mwp1; Rld1 double mutants shows that both genes are also required early in leaf development to delineate leaf margins as well as to initiate vascular and photosynthetic tissues.

  8. Evading plant defence: Infestation of poisonous milkweed fruits (Asclepiadaceae) by the fruit fly Dacus siliqualactis (Diptera: Tephritidae).

    Science.gov (United States)

    Schneider, Michael; Wunder, Cora; Reuss, Esther; Toennes, Stefan W; Mebs, Dietrich

    2017-12-01

    To cope with toxic metabolites plants use for defence, herbivorous insects employ various adaptive strategies. For oviposition, the fruit fly Dacus siliqualactis (Tephritidae) uses milkweed plants of the genus Gomphocarpus (Asclepiadaceae) by circumventing the plant's physical (gluey latex) and chemical (toxic cadenolides) defence. With its long, telescope-like ovipositor, the fly penetrates the exo- and endocarp of the fruit and places the eggs on the unripe seeds located in the centre of the fruit. Whereas most plant parts contain high concentrations of cardenolides such as gomphoside, calotropin/calacatin and gomphogenin, only the seeds exhibit low cardenolide levels. By surmounting physical barriers (fruit membranes, latex), the fly secures a safe environment and a latex-free food source of low toxicity for the developing larvae. One amino acid substitution (Q111V) at the cardenolide binding site of the fly's Na + , K + -ATPase was detected, but the significance of that substitution: reducing cardenolide sensitivity or not, is unclear. However, poisoning of the larvae by low levels of cardenolides is assumed to be prevented by non-resorption and excretion of the polar cardenolides, which cannot passively permeate the midgut membrane. This example of an insect-plant interaction demonstrates that by morphological and behavioural adaptation, a fruit fly manages to overcome even highly effective defence mechanisms of its host plant. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Logged peat swamp forest supports greater macrofungal biodiversity than large-scale oil palm plantations and smallholdings.

    Science.gov (United States)

    Shuhada, Siti Noor; Salim, Sabiha; Nobilly, Frisco; Zubaid, Akbar; Azhar, Badrul

    2017-09-01

    Intensive land expansion of commercial oil palm agricultural lands results in reducing the size of peat swamp forests, particularly in Southeast Asia. The effect of this land conversion on macrofungal biodiversity is, however, understudied. We quantified macrofungal biodiversity by identifying mushroom sporocarps throughout four different habitats; logged peat swamp forest, large-scale oil palm plantation, monoculture, and polyculture smallholdings. We recorded a total of 757 clusters of macrofungi belonging to 127 morphospecies and found that substrates for growing macrofungi were abundant in peat swamp forest; hence, morphospecies richness and macrofungal clusters were significantly greater in logged peat swamp forest than converted oil palm agriculture lands. Environmental factors that influence macrofungi in logged peat swamp forests such as air temperature, humidity, wind speed, soil pH, and soil moisture were different from those in oil palm plantations and smallholdings. We conclude that peat swamp forests are irreplaceable with respect to macrofungal biodiversity. They host much greater macrofungal biodiversity than any of the oil palm agricultural lands. It is imperative that further expansion of oil palm plantation into remaining peat swamp forests should be prohibited in palm oil producing countries. These results imply that macrofungal distribution reflects changes in microclimate between habitats and reduced macrofungal biodiversity may adversely affect decomposition in human-modified landscapes.

  10. Changes in Species Composition in Alder Swamp Forest Following Forest Dieback

    Directory of Open Access Journals (Sweden)

    Remigiusz Pielech

    2018-06-01

    Full Text Available It is generally hypothesized that forest dieback is a characteristic of alder swamp forests (alder carrs, Alnion glutinosae alliance. Different internal and external factors may trigger this process, including human disturbance, changes in river discharge, unusually severe and prolonged flooding, terminal age of an even-aged alder forest (ca. 100–150 years and others. Although forest dieback in this type of forest may cause major changes in environmental conditions, the influence of this change on the floristic composition has not been well recognized. The study aimed to detect any possible changes in floristic variation in alder swamp forest following forest dieback. Vegetation plots in alder swamp forests affected by forest dieback were resurveyed 20 years after a previous study. PERMANOVA was used to test the significance of the compositional change and nonmetric multidimensional scaling (NMDS with passively fitted means of the Ellenberg’s Indicator Values were used to interpret its ecological meaning. In addition, different structural and diversity indices were compared, including species richness, percentage cover of vegetation layers, Shannon and Simpson diversity and evenness. Finally, we analyzed changes in the frequency of vascular plant species using Chi square tests. We recorded clear and significant compositional changes following alder swamp forest dieback. This change was most related to the gradient of moisture, followed by the gradients of light and temperature. The analysis of the individual species showed that the species of hummocks declined, while the species of hollows increased. Moreover, the current communities are dominated by some hydrophytes that were not recorded 20 years ago. Forest dieback resulted in profound changes in the hydrological regime. The observed changes are consistent with a model of cyclic succession as proposed for alder swamps. In addition, we conclude that the natural forest dynamics have to be

  11. Mapping swamp timothy (Cripsis schenoides) seed productivity using spectral values and vegetation indices in managed wetlands

    Energy Technology Data Exchange (ETDEWEB)

    Rahilly, P.J.A.; Li, D.; Guo, Q.; Zhu, J.; Ortega, R.; Quinn, N.W.T.; Harmon, T.C.

    2010-01-15

    This work examines the potential to predict the seed productivity of a key wetland plant species using spectral reflectance values and spectral vegetation indices. Specifically, the seed productivity of swamp timothy (Cripsis schenoides) was investigated in two wetland ponds, managed for waterfowl habitat, in California's San Joaquin Valley. Spectral reflectance values were obtained and associated spectral vegetation indices (SVI) calculated from two sets of high resolution aerial images (May 11, 2006 and June 9, 2006) and were compared to the collected vegetation data. Vegetation data were collected and analyzed from 156 plots for total aboveground biomass, total aboveground swamp timothy biomass, and total swamp timothy seed biomass. The SVI investigated included the Simple Ratio (SR), Normalized Difference Vegetation Index (NDVI), Soil Adjusted Vegetation Index (SAVI), Transformed Soil Adjusted Vegetation Index (TSAVI), Modified Soil Adjusted Vegetation Index (MSAVI), and Global Environment Monitoring Index (GEMI). We evaluated the correlation of the various SVI with in situ vegetation measurements for linear, quadratic, exponential and power functions. In all cases, the June image provided better predictive capacity relative to May, a result that underscores the importance of timing imagery to coincide with more favorable vegetation maturity. The north pond with the June image using SR and the exponential function (R{sup 2}=0.603) proved to be the best predictor of swamp timothy seed productivity. The June image for the south pond was less predictive, with TSAVI and the exponential function providing the best correlation (R{sup 2}=0.448). This result was attributed to insufficient vegetal cover in the south pond (or a higher percentage of bare soil) due to poor drainage conditions which resulted in a delay in swamp timothy germination. The results of this work suggest that spectral reflectance can be used to estimate seed productivity in managed seasonal

  12. RNAi analysis of Deformed, proboscipedia and Sex combs reduced in the milkweed bug Oncopeltus fasciatus: novel roles for Hox genes in the hemipteran head.

    Science.gov (United States)

    Hughes, C L; Kaufman, T C

    2000-09-01

    Insects have evolved a large variety of specialized feeding strategies, with a corresponding variability in mouthpart morphology. We have, however, little understanding of the developmental mechanisms that underlie this diversity. Until recently it was difficult to perform any analysis of gene function outside of the genetic model insects Drosophila melanogaster and Tribolium castaneum. In this paper, we report the use of dsRNA-mediated interference (RNAi) to dissect gene function in the development of the milkweed bug Oncopeltus fasciatus, which has specialized suctorial mouthparts. The Hox genes Deformed (Dfd), proboscipedia (pb) and Sex combs reduced (Scr) have previously been shown to be expressed in the gnathal appendages of this species. Strikingly, the milkweed bug was found to have an unusual expression pattern of pb. Here, by analyzing single and combination RNAi depletions, we find that Dfd, pb and Scr are used in the milkweed bug to specify the identity of the mouthparts. The exact roles of the genes, however, are different from what is known in the two genetic model insects. The maxillary appendages in the bug are determined by the activities of the genes Dfd and Scr, rather than Dfd and pb as in the fly and beetle. The mandibular appendages are specified by Dfd, but their unique morphology in Oncopeltus suggests that Dfd's target genes are different. As in flies and beetles, the labium is specified by the combined activities of pb and Scr, but again, the function of pb appears to be different. Additionally, the regulatory control of pb by the other two genes seems to be different in the bug than in either of the other species. These novelties in Hox function, expression pattern and regulatory relationships may have been important for the evolution of the unique Hemipteran head.

  13. Isolation of vibrio spp. In oysters (crassostrea rhizophorea) caught in the ‘de la virgen’ swamp

    OpenAIRE

    López Gutiérrez, Lercy; Autor; Manjarrez Pava, Ganiveth; Autor; Herrera Rodríguez, Lilibeth; Autor; Montes Payares, Ana Elena; Autor; Olascuaga Ruíz, Yuranis Paola; Autor; Ortega Quiroz, Rolando José; Autor

    2015-01-01

    Objective:  To establish contamination by Vibrio in oysters (Crassostrea rhizophorae) caught in De La Virgen Swamp, in order to alert entities in charge or protecting consumer health in Cartagena city. Methods: Between February and April 2006, 67 oysters from 5 strategic sites along De La Virgen Swamp, were analyzed. Insulation and identification of Vibrio was performed through a culture and biochemical tests.Results.  Predominant species were V. alginolyticus (23%),V fluvialis  (20%),V. para...

  14. [Amphibians and reptiles in the swamps dominated by the palm Raphia taedigera (Arecaceae) in northeastern Costa Rica].

    Science.gov (United States)

    Bonilla-Murillo, Fabian; Beneyto, Davinia; Sasa, Mahmood

    2013-09-01

    The herpetofauna that inhabits Caribbean Costa Rica has received considerable attention in the last two decades. This assemblage includes a total of 141 species of reptiles and 95 amphibians mostly distributed in tropical wet and moist lowland forests. While most information available came from primary and secondary forest sites, little is known about the amphibians and reptiles that inhabit more open habitats, such as wetlands and swamps. For instances, swaps dominated by the yolillo palm Raphia taedigera extend through much of the northeastern Caribbean coast of Costa Rica and eastern Nicaragua, but information about the herpetological community that uses such environments remains practically unknown. This situation reflects the little research conducted in such inhospitable environments. Here, we report the results of an intensive survey conducted to assess the herpetological community that inhabit R. taedigera palm-swamps. A total of 14 species of amphibians and 17 of reptiles have been recorded from these swamps. Amphibians and reptiles that inhabit yolillo swamps have wide distributions along much of Middle America and are considered common species throughout their range. In general, yolillo swamps are poor environments for herpetofauna: richness of reptiles and amphibians is almost two times higher in the adjacent forest than in the palm dominated swamps. Furthermore, most species observed in this swamps can be considered habitat generalists that are well adapted to the extreme conditions imposed by the changes in hydroperiods, reduce understory cover, low tree diversity and simple forest architecture of these environments. Despite similarities in the herpetofauna, it is clear that not all forest species use yolillo habitat, a characteristic that is discussed in terms of physical stress driven by the prolonged hydroperiod and reduced leaflitter in the ground, as these features drive habitat structure and herpetofaunal complexity. Our list of species using

  15. Imported Asian swamp eels (Synbranchidae: Monopterus) in North American live food markets: Potential vectors of non-native parasites

    Science.gov (United States)

    Nico, Leo G.; Sharp, Paul; Collins, Timothy M.

    2011-01-01

    Since the 1990s, possibly earlier, large numbers of Asian swamp eels (Synbranchidae: Monopterus spp.), some wild-caught, have been imported live from various countries in Asia and sold in ethnic food markets in cities throughout the USA and parts of Canada. Such markets are the likely introduction pathway of some, perhaps most, of the five known wild populations of Asian swamp eels present in the continental United States. This paper presents results of a pilot study intended to gather baseline data on the occurrence and abundance of internal macroparasites infecting swamp eels imported from Asia to North American retail food markets. These data are important in assessing the potential role that imported swamp eels may play as possible vectors of non-native parasites. Examination of the gastrointestinal tracts and associated tissues of 19 adult-sized swamp eels—identified as M. albus "Clade C"—imported from Vietnam and present in a U.S. retail food market revealed that 18 (95%) contained macroparasites. The 394 individual parasites recovered included a mix of nematodes, acanthocephalans, cestodes, digeneans, and pentastomes. The findings raise concern because of the likelihood that some parasites infecting market swamp eels imported from Asia are themselves Asian taxa, some possibly new to North America. The ecological risk is exacerbated because swamp eels sold in food markets are occasionally retained live by customers and a few reportedly released into the wild. For comparative purposes, M. albus "Clade C" swamp eels from a non-native population in Florida (USA) were also examined and most (84%) were found to be infected with internal macroparasites. The current level of analysis does not allow us to confirm whether these are non-native parasites.

  16. The hydrological function of upland swamps in eastern Australia: The role of geomorphic condition in regulating water storage and discharge

    Science.gov (United States)

    Cowley, Kirsten L.; Fryirs, Kirstie A.; Hose, Grant C.

    2018-06-01

    Temperate Highland Peat Swamps on Sandstone (THPSS) are a type of wetland found in low-order streams on the plateaus of eastern Australia. They are sediment and organic matter accumulation zones, which combined with a climate of high rainfall and low evaporation function as water storage systems. Changes to the geomorphic structure of these systems via incision and channelisation can have profound impacts on their hydrological function. The aim of this study was to develop an understanding of how changes to the geomorphic structure of these systems alter their hydrological function, measured as changes and variability in swamp water table levels and discharge. We monitored the water table levels and discharges of three intact and three channelised THPSS in the Blue Mountains between March 2015 and June 2016. We found that water levels in intact swamps were largely stable over the monitoring period. Water levels rose only in high rainfall events, returned quickly to antecedent levels after rain, and drawdown during dry periods was not significant. In contrast, the water table levels in channelised THPSS were highly variable. Water levels rose quickly after almost all rainfall events and declined significantly during dry periods. Discharge also showed marked differences with the channelised THPSS discharging 13 times more water than intact swamps, even during dry periods. Channelised THPSS also had flashier storm hydrographs than intact swamps. These results have profound implications for the capacity of these swamps to act as water storage reservoirs in the headwaters of catchments and for their ability to maintain base flow to downstream catchments during dry times. Changes to geomorphic structure and hydrological function also have important implications for a range of other swamp functions such as carbon storage, emission and exports, contaminant sorption, downstream water quality and biodiversity, as well as the overall fate of these swamps under a changing

  17. Absence of ribosomal DNA amplification in the meroistic (telotrophic) ovary of the large milkweed bug Oncopeltus fasciatus (Dallas) (Hemiptera: Lygaeidae)

    Science.gov (United States)

    1975-01-01

    In the typical meroistic insect ovary, the oocyte nucleus synthesizes little if any RNA. Nurse cells or trophocytes actively synthesize ribosomes which are transported to and accumulated by the oocyte. In the telotrophic ovary a morphological separation exists, the nurse cells being localized at the apical end of each ovariole and communicating with the ooocytes via nutritive cords. In order to determine whether the genes coding for ribosomal RNA (rRNA) are amplified in the telotrophic ovary of the milkweed bug Oncopeltus fasciatus, the percentages of the genome coding for ribosomal RNA in somatic cells, spermatogenic cells, ovarian follicles, and nurse cells were compared. The oocytes and most of the nurse cells of O. fasciatus are uninucleolate. DNA hybridizing with ribosomal RNA is localized in a satellite DNA, the density of which is 1.712 g/cm(-3). The density of main-band DNA is 1.694 g/cm(-3). The ribosomal DNA satellite accounts for approximately 0.2% of the DNA in somatic and gametogenic tissues of both males and females. RNA-DNA hybridization analysis demonstrates that approximately 0.03% of the DNA in somatic tissues, testis, ovarian follicles, and isolated nurse cells hybridizes with ribosomal RNA. The fact that the percentage of DNA hybridizing with rRNA is the same in somatic and in male and female gametogenic tissues indicates that amplification of ribosomal DNA does not occur in nurse cells and that if it occurs in oocytes, it represents less than a 50- fold increase in ribosomal DNA. An increase in total genome DNA accounted by polyploidization appears to provide for increasing the amount of ribosomal DNA in the nurse cells. PMID:1158969

  18. Behavioural and hormonal aspects of the oestrous cycle in swamp buffaloes reared under temperate conditions

    International Nuclear Information System (INIS)

    Kanai, Y.; Ishikawa, N.; Shimizu, H.

    1990-01-01

    A series of experiments was carried out using a small herd of swamp buffaloes raised in Japan under temperate conditions at 36 deg. N latitude, with a view to determining whether they exhibit peculiar characteristics in their oestrous cycles. The studies on the oestrous behaviour revealed that under adequate feeding and management conditions, buffaloes regularly display oestrous throughout the year, with the cycle length, duration of oestrous and time of ovulation all falling within ranges similar to those reported in cattle. External signs of oestrus were generally less evident, as previously reported. Hormonal analysis showed that there were no remarkable differences between swamp buffaloes and cattle in terms of the secretory patterns of pituitary gonadotrophins and ovarian steroids during the oestrous cycle. (author). 13 refs, 2 figs

  19. Polyancora globosa gen. sp. nov., an aeroaquatic fungus from Malaysian peat swamp forests.

    Science.gov (United States)

    Voglmayr, Hermann; Yule, Catherine M

    2006-10-01

    During an investigation of submerged leaves and twigs sampled from tropical peat swamp forests located in Peninsular Malaysia, an anamorphic fungus not attributable to a described genus was detected and isolated in pure culture. Conidial ontogeny was thoroughly studied and illustrated using both light and SEM, which revealed a unique conidial morphology. Analysis of partial nuLSU rDNA and ITS data revealed a phylogenetic position within the Xylariales (Ascomycota), but family affiliation remained unclear.

  20. Mapping Palm Swamp Wetland Ecosystems in the Peruvian Amazon: a Multi-Sensor Remote Sensing Approach

    Science.gov (United States)

    Podest, E.; McDonald, K. C.; Schroeder, R.; Pinto, N.; Zimmerman, R.; Horna, V.

    2012-12-01

    Wetland ecosystems are prevalent in the Amazon basin, especially in northern Peru. Of specific interest are palm swamp wetlands because they are characterized by constant surface inundation and moderate seasonal water level variation. This combination of constantly saturated soils and warm temperatures year-round can lead to considerable methane release to the atmosphere. Because of the widespread occurrence and expected sensitivity of these ecosystems to climate change, it is critical to develop methods to quantify their spatial extent and inundation state in order to assess their carbon dynamics. Spatio-temporal information on palm swamps is difficult to gather because of their remoteness and difficult accessibility. Spaceborne microwave remote sensing is an effective tool for characterizing these ecosystems since it is sensitive to surface water and vegetation structure and allows monitoring large inaccessible areas on a temporal basis regardless of atmospheric conditions or solar illumination. We developed a remote sensing methodology using multi-sensor remote sensing data from the Advanced Land Observing Satellite (ALOS) Phased Array L-Band Synthetic Aperture Radar (PALSAR), Shuttle Radar Topography Mission (SRTM) DEM, and Landsat to derive maps at 100 meter resolution of palm swamp extent and inundation based on ground data collections; and combined active and passive microwave data from AMSR-E and QuikSCAT to derive inundation extent at 25 kilometer resolution on a weekly basis. We then compared information content and accuracy of the coarse resolution products relative to the high-resolution datasets. The synergistic combination of high and low resolution datasets allowed for characterization of palm swamps and assessment of their flooding status. This work has been undertaken partly within the framework of the JAXA ALOS Kyoto & Carbon Initiative. PALSAR data have been provided by JAXA. Portions of this work were carried out at the Jet Propulsion Laboratory

  1. Proteomic analysis of three gonad types of swamp eel reveals genes differentially expressed during sex reversal

    OpenAIRE

    Sheng, Yue; Zhao, Wei; Song, Ying; Li, Zhigang; Luo, Majing; Lei, Quan; Cheng, Hanhua; Zhou, Rongjia

    2015-01-01

    A variety of mechanisms are engaged in sex determination in vertebrates. The teleost fish swamp eel undergoes sex reversal naturally and is an ideal model for vertebrate sexual development. However, the importance of proteome-wide scanning for gonad reversal was not previously determined. We report a 2-D electrophoresis analysis of three gonad types of proteomes during sex reversal. MS/MS analysis revealed a group of differentially expressed proteins during ovary to ovotestis to testis transf...

  2. Studies on algea of Da′erbin lake and its surrounding swamps in daxing anling mountain

    Directory of Open Access Journals (Sweden)

    LI Xiaofei

    2012-08-01

    Full Text Available The paper reports 234 taxa of algae (excluding diatomas and desmids in Da′erbin Lake and its surrounding swamps in the Great Xing′an Mountains.They were identified belong to 6 phylums 79 generas 197 species 31 varieties and 6 forms.Among them Characium ornithocephalum var.pringsheimii (A.Br. Kom.,Characium pluricoccum Kor.,Quadrigula korsikovii Kom.,Crucigeniella rectangularis (Ng. Kom.are newly reported in China.

  3. Substantial improvements not seen in health behaviors following corner store conversions in two Latino food swamps

    OpenAIRE

    Ortega, Alexander N.; Albert, Stephanie L.; Chan-Golston, Alec M.; Langellier, Brent A.; Glik, Deborah C.; Belin, Thomas R.; Garcia, Rosa Elena; Brookmeyer, Ron; Sharif, Mienah Z.; Prelip, Michael L.

    2016-01-01

    Background The effectiveness of food retail interventions is largely undetermined, yet substantial investments have been made to improve access to healthy foods in food deserts and swamps via grocery and corner store interventions. This study evaluated the effects of corner store conversions in East Los Angeles and Boyle Heights, California on perceived accessibility of healthy foods, perceptions of corner stores, store patronage, food purchasing, and eating behaviors. Methods Household data ...

  4. Nariva Swamp Ramsar Site, Trinidad and Tobago (West Indies) Wetland Habitat Restoration Initiative

    Science.gov (United States)

    Montserrat Carbonell; Nadra Nathai-Gyan

    2005-01-01

    Trinidad and Tobago, a twin island nation, is the most southerly of the Caribbean islands and lies just 11 km off the coast of Venezuela, near the Orinoco delta. Trinidad, the larger of the two islands, is approximately 5,000 km² and the Nariva Swamp is located on its eastern coast (fig. 1). In 1993, this site was designated as a wetland of international...

  5. Producer farmer’s sovereignty in dry land and swamps areas

    Science.gov (United States)

    Suhaeti, RN; Wahyuni, S.

    2018-01-01

    Farmers could perform their farming if they have sovereignty on their farming production inputs and marketing. Suboptimal land, such as dry land and swamps areas have good prospect if applying appropriate technologies. A research in 2015, on status of farmers’ sovereignty, had been conducted in Piani and North Candi Laras Subdistricts, Tapin District, South Borneo Province, representing swamp land and dry land respectively. Data and information were obtained through interviewing related agencies at provincial and district levels and 30 units of farmer’s households. The primary and secondary data were analyzed descriptively. The research results showed that farmers in swamps and dry land were categorized as large farmers and had sovereignty over the land and production. Water shortage and excessive in both land types could be overcome by giving access on appropriate technology such as programs making farmers improve their farming techniques and providing levees. In addition, land certification program, farming expansion and constructing new irrigated lowland were also some efforts to improve farmers’ sovereignty. It was crucial to identify and improve farmer’s sovereignty indicators through research in larger sites and samples.

  6. Reproductive responses to climatic heat induced by management systems in swamp buffaloes

    International Nuclear Information System (INIS)

    Dollah, M.A.; Ramakrishnan, N.; Nordin, Y.; Abdullah Sani, R.

    1990-01-01

    Climatic heat is one of the factors influencing the reproductive performance of swamp buffaloes. Any management system that imposes high climatic heat stress tends to reduce reproductive performance. Buffaloes grazing in an open hilly ranch system reached puberty later (at an age of 33 months) and at heavier body weight (365 kg) than animals raised in confinement (26 months and 289 kg). Physiological data (water metabolism and thyroid activity) indicated that grazing animals had to tolerate a higher heat load. High climatic temperatures were found to depress ovarian activity, especially during the dry season. The effect was observed only in cycling buffaloes denied wallow. Buffaloes having access to wallows were able to maintain their heat balance under various levels of heat load by adjusting their water requirements, mobilizing their body water and adjusting their metabolic rate (thyroid activity). It is concluded that stressful climatic temperatures can depress the reproductive performance of young heifers and adult swamp buffaloes, and that climatic heat stress directly depresses ovarian activity in swamp buffaloes. (author). 16 refs, 1 fig., 4 tabs

  7. Repeated drought alters resistance of seed bank regeneration in baldcypress swamps of North America

    Science.gov (United States)

    Lei, Ting; Middleton, Beth A.

    2018-01-01

    Recurring drying and wetting events are likely to increase in frequency and intensity in predicted future droughts in the central USA and alter the regeneration potential of species. We explored the resistance of seed banks to successive droughts in 53 sites across the nine locations in baldcypress swamps in the southeastern USA. Along the Mississippi River Alluvial Valley and northern Gulf of Mexico, we investigated the capacity of seed banks to retain viable seeds after successive periods of drying and wetting in a greenhouse study. Mean differences in species richness and seed density were compared to examine the interactions of successive droughts, geographical location and water regime. The results showed that both species richness and total density of germinating seedlings decreased over repeated drought trials. These responses were more pronounced in geographical areas with higher annual mean temperature. In seed banks across the southeastern swamp region, most species were exhausted after Trial 2 or 3, except for semiaquatic species in Illinois and Tennessee, and aquatic species in Texas. Distinct geographical trends in seed bank resistance to drought demonstrate that climate-induced drying of baldcypress swamps could influence the regeneration of species differently across their ranges. Despite the health of adult individuals, lack of regeneration may push ecosystems into a relict status. Seed bank depletion by germination without replenishment may be a major conservation threat in a future with recurring droughts far less severe than megadrought. Nevertheless, the protection of moist refugia might aid conservation.

  8. BIOCONTROL FOR RHIZOCTONIA STEM ROT DISEASE BY USING COMBINATION OF SPECIFIC ENDOPHYTE IN PADDY TIDAL SWAMP

    Directory of Open Access Journals (Sweden)

    Ismed Setya Budi

    2013-10-01

    Full Text Available The use of combination of specific endophytic in tidal swamps to control stem root disease as biological control agents has not been done. It is expected that this combination is able to continuously protect plants from pathogen interference. The research was carried out in type C tidal swamp in Banjar regency of South Kalimantan, from March to November 2011, temperature 29-32oC, and pH 4.0-5.5. The method used was Split Plot design. Biocontrol preparation for both types of endophytic was applied in seeds in 7 days after planting (DAP. Observation on high intensity and plant diseases of planting stage on tidal swamps (taradak, ampak and lacak was conducted. The results showed that there was a reduction of disease ranging from 58.70 to 87.29%. The application of combination of two biocontrol agents (T. viride PS-2.1 + P. fluorescent PS-4.8, (Fusarium non-pathogenic PS-1.5 + P. fluorescent PS-4.8 and (T. viride PS-2.1+ FNP PS-1.5 isolate gave the best inhibition result, reduced disease intensity, and increased plant height. The result of soil analysis before and after application of endophytic showed that there was an increase in soil fertility with the element addition of N, P, K and pH.

  9. Approaches for the environmental evaluation of two swamp complexes of the Momposina depression

    International Nuclear Information System (INIS)

    Caballero, Humberto; Durango, Consuelo

    1998-01-01

    The swamp complexes of the Momposina depression in the lower Magdalena River have been submitted to irrational exploitation, transformation and contamination mainly since the beginning of the century, process that has be en getting worse in the last decade. The most evident manifestation of the environmental deterioration is expressed by the drastic reduction of fishing, with important socio-economic effects to the population that lives from this source. The most notorious causes of the actual state of the ecosystem were detected, and some preliminary considerations for its management are presented. However, due to the modifications that the complexes have suffered (closure of the natural sewer, construction of jarillones, modifications of the internal water flows and sediments, over exploitation, of fish and herpetofauna), the deterioration of the limnologic conditions is moderated, which allows to begin recuperation plans. The major impacts were observed in the fauna of birds and reptiles associated to the swamps; the decrease of the ictics populations seems to be related to the strong impact generated by the fishing action used and the interruption of the natural cycles of fish. The possibility of rebuilding the communication swamp-river should be studied with care because it seems the system has arrived to new conditions. The re-opening of the sewers could mean a new unbalanced condition represented mainly by the contamination coming from the Magdalena River

  10. Relationships between Vacant Homes and Food Swamps: A Longitudinal Study of an Urban Food Environment.

    Science.gov (United States)

    Mui, Yeeli; Jones-Smith, Jessica C; Thornton, Rachel L J; Pollack Porter, Keshia; Gittelsohn, Joel

    2017-11-21

    Research indicates that living in neighborhoods with high concentrations of boarded-up vacant homes is associated with premature mortality due to cancer and diabetes, but the mechanism for this relationship is unclear. Boarded-up housing may indirectly impact residents' health by affecting their food environment. We evaluated the association between changes in vacancy rates and changes in the density of unhealthy food outlets as a proportion of all food outlets, termed the food swamp index, in Baltimore, MD (USA) from 2001 to 2012, using neighborhood fixed-effects linear regression models. Over the study period, the average food swamp index increased from 93.5 to 95.3 percentage points across all neighborhoods. Among non-African American neighborhoods, increases in the vacancy rate were associated with statistically significant decreases in the food swamp index (b = -0.38; 90% CI, -0.64 to -0.12; p -value: 0.015), after accounting for changes in neighborhood SES, racial diversity, and population size. A positive association was found among low-SES neighborhoods (b = 0.15; 90% CI, 0.037 to 0.27; p -value: 0.031). Vacant homes may influence the composition of food outlets in urban neighborhoods. Future research should further elucidate the mechanisms by which more distal, contextual factors, such as boarded-up vacant homes, may affect food choices and diet-related health outcomes.

  11. New 8,12;8,20-diepoxy-8,14-secopregnane hexa- and hepta-glycosides from the roots of Asclepias tuberosa.

    Science.gov (United States)

    Warashina, Tsutomu; Miyase, Toshio

    2018-01-01

    Previously, phytochemical investigation of the roots of Asclepias tuberosa (Asclepiadaceae) led to the isolation of some 8,12;8,20-diepoxy-8,14-secopregnane tri-, tetra-, and penta-glycosides. An additional eight new minor 8,12;8,20-diepoxy-8,14-secopregnane glycosides were afforded in the recent investigation of this plant. These glycosides consisted of six or seven 2,6-dideoxy-hexopyranoses together with the aglycone, tuberogenin. The structures of each of these compounds were established using NMR, mass spectroscopic analysis and chemical evidence. As 8,12;8,20-diepoxy-8,14-secopregnane-type glycosides were observed only in A. tuberosa, these compounds were considered to be characteristic phytochemicals of this plant.

  12. Insecticidal effect of Canavalia ensiformis major urease on nymphs of the milkweed bug Oncopeltus fasciatus and characterization of digestive peptidases.

    Science.gov (United States)

    Defferrari, Marina S; Demartini, Diogo R; Marcelino, Thiago B; Pinto, Paulo M; Carlini, Celia R

    2011-06-01

    Jackbean (Canavalia ensiformis) ureases are entomotoxic upon the release of internal peptides by insect's digestive enzymes. Here we studied the digestive peptidases of Oncopeltus fasciatus (milkweed bug) and its susceptibility to jackbean urease (JBU). O. fasciatus nymphs fed urease showed a mortality rate higher than 80% after two weeks. Homogenates of midguts dissected from fourth instars were used to perform proteolytic activity assays. The homogenates hydrolyzed JBU in vitro, yielding a fragment similar in size to known entomotoxic peptides. The major proteolytic activity at pH 4.0 upon protein substrates was blocked by specific inhibitors of aspartic and cysteine peptidases, but not significantly affected by inhibitors of metallopeptidases or serine peptidases. The optimal activity upon N-Cbz-Phe-Arg-MCA was at pH 5.0, with complete blockage by E-64 in all pH tested. Optimal activity upon Abz-AIAFFSRQ-EDDnp (a substrate for aspartic peptidases) was detected at pH 5.0, with partial inhibition by Pepstatin A in the pH range 2-8. Fluorogenic substrates corresponding to the N- and C-terminal regions flanking a known entomotoxic peptide within urease sequence were also tested. While the midgut homogenate did not hydrolyze the N-terminal peptide, it cleaved the C-terminal peptide maximally at pH 4.0-5.0, and this activity was inhibited by E-64 (10 μM). The midgut homogenate was submitted to ion-exchange chromatography followed by gel filtration. A 22 kDa active fraction was obtained, resolved in SDS-PAGE (12%), the corresponding band was in-gel digested by trypsin, the peptides were analyzed by mass spectrometry, retrieving a cathepsin L protein. The purified cathepsin L was shown to have at least two possible cleavage sites within the urease sequence, and might be able to release a known insecticidal peptide in a single or cascade event. The results suggest that susceptibility of O. fasciatus nymphs to jackbean urease is, like in other insect models, due mostly

  13. Effects of pregnane glycosides on food intake depend on stimulation of the melanocortin pathway and BDNF in an animal model.

    Science.gov (United States)

    Komarnytsky, Slavko; Esposito, Debora; Rathinasabapathy, Thirumurugan; Poulev, Alexander; Raskin, Ilya

    2013-02-27

    Pregnane glycosides appear to modulate food intake by possibly affecting the hypothalamic feeding circuits; however, the mechanisms of the appetite-regulating effect of pregnane glycosides remain obscure. Here, we show that pregnane glycoside-enriched extracts from swamp milkweed Asclepias incarnata at 25-100 mg/kg daily attenuated food intake (up to 47.1 ± 8.5% less than controls) and body weight gain in rats (10% for males and 9% for females, respectively) by activating melanocortin signaling and inhibiting gastric emptying. The major milkweed pregnane glycoside, ikemagenin, exerted its appetite-regulating effect by decreasing levels of agouti-related protein (0.6-fold) but not NPY satiety peptides. Ikemagenin treatment also increased secretion of brain-derived neurotropic factor (BDNF) downstream of melanocortin receptors in the hypothalamus (1.4-fold) and in the C6 rat glioma cell culture in vitro (up to 6-fold). These results support the multimodal effects of pregnane glycosides on feeding regulation, which depends on the activity of the melanocortin signaling pathway and BDNF.

  14. Food swamps and food deserts in Baltimore City, MD, USA: associations with dietary behaviours among urban adolescent girls.

    Science.gov (United States)

    Hager, Erin R; Cockerham, Alexandra; O'Reilly, Nicole; Harrington, Donna; Harding, James; Hurley, Kristen M; Black, Maureen M

    2017-10-01

    To determine whether living in a food swamp (≥4 corner stores within 0·40 km (0·25 miles) of home) or a food desert (generally, no supermarket or access to healthy foods) is associated with consumption of snacks/desserts or fruits/vegetables, and if neighbourhood-level socio-economic status (SES) confounds relationships. Cross-sectional. Assessments included diet (Youth/Adolescent FFQ, skewed dietary variables normalized) and measured height/weight (BMI-for-age percentiles/Z-scores calculated). A geographic information system geocoded home addresses and mapped food deserts/food swamps. Associations examined using multiple linear regression (MLR) models adjusting for age and BMI-for-age Z-score. Baltimore City, MD, USA. Early adolescent girls (6th/7th grade, n 634; mean age 12·1 years; 90·7 % African American; 52·4 % overweight/obese), recruited from twenty-two urban, low-income schools. Girls' consumption of fruit, vegetables and snacks/desserts: 1·2, 1·7 and 3·4 servings/d, respectively. Girls' food environment: 10·4 % food desert only, 19·1 % food swamp only, 16·1 % both food desert/swamp and 54·4 % neither food desert/swamp. Average median neighbourhood-level household income: $US 35 298. In MLR models, girls living in both food deserts/swamps consumed additional servings of snacks/desserts v. girls living in neither (β=0·13, P=0·029; 3·8 v. 3·2 servings/d). Specifically, girls living in food swamps consumed more snacks/desserts than girls who did not (β=0·16, P=0·003; 3·7 v. 3·1 servings/d), with no confounding effect of neighbourhood-level SES. No associations were identified with food deserts or consumption of fruits/vegetables. Early adolescent girls living in food swamps consumed more snacks/desserts than girls not living in food swamps. Dietary interventions should consider the built environment/food access when addressing adolescent dietary behaviours.

  15. Rich soil carbon and nitrogen but low atmospheric greenhouse gas fluxes from North Sulawesi mangrove swamps in Indonesia.

    Science.gov (United States)

    Chen, Guang C; Ulumuddin, Yaya I; Pramudji, Sastro; Chen, Shun Y; Chen, Bin; Ye, Yong; Ou, Dan Y; Ma, Zhi Y; Huang, Hao; Wang, Jing K

    2014-07-15

    The soil to atmosphere fluxes of greenhouse gases N2O, CH4 and CO2 and their relationships with soil characteristics were investigated in three tropical oceanic mangrove swamps (Teremaal, Likupang and Kema) in North Sulawesi, Indonesia. Mangrove soils in North Sulawesi were rich in organic carbon and nitrogen, but the greenhouse gas fluxes were low in these mangroves. The fluxes ranged -6.05-13.14 μmol m(-2)h(-1), -0.35-0.61 μmol m(-2)h(-1) and -1.34-3.88 mmol m(-2)h(-1) for N2O, CH4 and CO2, respectively. The differences in both N2O and CH4 fluxes among different mangrove swamps and among tidal positions in each mangrove swamp were insignificant. CO2 flux was influenced only by mangrove swamps and the value was higher in Kema mangrove. None of the measured soil parameters could explain the variation of CH4 fluxes among the sampling plots. N2O flux was negatively related to porewater salinity, while CO2 flux was negatively correlated with water content and organic carbon. This study suggested that the low gas emissions due to slow metabolisms would lead to the accumulations of organic matters in North Sulawesi mangrove swamps. Copyright © 2014 Elsevier B.V. All rights reserved.

  16. Operational restoration of the Pen Branch bottomland hardwood and swamp wetlands - the research setting

    International Nuclear Information System (INIS)

    Nelson, E.A.

    2000-01-01

    The Savannah River Swamp is a 3020 Ha forested wetland on the floodplain of the Savannah River and is located on the Department of Energy's Savannah River Site (SRS) near Aiken, SC. Historically the swamp consisted of approximately 50 percent bald cypress-water tupelo stands, 40 percent mixed bottomland hardwood stands, and 10 percent shrub, marsh, and open water. Creek corridors were typical of Southeastern bottomland hardwood forests. The hydrology was controlled by flooding of the Savannah River and by flow from four creeks that drain into the swamp prior to flow into the Savannah River. Upstream dams have caused some alteration of the water levels and timing of flooding within the floodplain. Major impacts to the swamp hydrology occurred with the completion of the production reactors and one coal-fired powerhouse at the SRS in the early 1950's. Water was pumped from the Savannah River, through secondary heat exchangers of the reactors, and discharged into three of the tributary streams that flow into the swamp. Flow in one of the tributaries, Pen Branch, was typically 0.3 m3 s-1 (10-20) cfs prior to reactor pumping and 11.0 m3 s-1 (400 cfs) during pumping. This continued from 1954 to 1988 at various levels. The sustained increases in water volume resulted in overflow of the original stream banks and the creation of additional floodplains. Accompanying this was considerable erosion of the original stream corridor and deposition of a deep silt layer on the newly formed delta. Heated water was discharged directly into Pen Branch and water temperature in the stream often exceeded 65 degrees C. The nearly continuous flooding of the swamp, the thermal load of the water, and the heavy silting resulted in complete mortality of the original vegetation in large areas of the floodplain. In the years since pumping was reduced, early succession has begun in some affected areas. Most of this has been herbs, grasses, and shrubs. Areas that have seedlings are generally willow

  17. Utilization of agro-industrial by-products by swamp buffalo

    International Nuclear Information System (INIS)

    Jelan, Z.A.; Jalaludin, S.; Vijchulata, P.

    1987-01-01

    A series of studies were conducted to determine the factors affecting the utilization of palm press fibre (PPF) by swamp buffaloes. The nutritive values, fermentation and rumen kinetics, intake and growth responses to a PPF based diet with or without protein and energy supplementation were studied. Palm press fibre was considered a poor quality feed as it is low in crude protein (about 6%) and high in lignin content (about 21%). Dry matter (DM) disappearance from nylon bags at 48 h was low (about 40%) as compared with grass (47%), oaten hay (49%) and lucerne (64%). Sodium hydroxide (8% solution) was most effective as a treating agent as the DM disappearance of PPF from the nylon bags at 48 h was increased by 14%. Dry matter loss from the bags was greater in swamp buffaloes than in cattle. Rumen fluid volume and flow rate were not significantly (P>0.05) increased with fish meal supplementation, but the total dry matter intake (DMI) increased significantly (P<0.05) when 360 g DM/d fish meal was supplemented. Total volatile fatty acid (VFA) concentrations were low in unsupplemented animals and the molar proportions of the VFAs were typical of those seen in the rumen fluid of ruminants fed a fibre based diet. Rumen ammonia-nitrogen was high (40-70 mg/L) in fish meal supplemented animals. When urea treated PPF was supplemented with fish meal and cassava, the animals showed significant increases (P<0.05) in average daily gain and in both total DMI and in the DMI of a basal diet. The study concludes that supplementation with rumen undegradable protein and an energy source are essential to a PPF based diet and that untreated PPF is not a suitable basal diet for swamp buffaloes. (author)

  18. Landscape-scale changes in forest canopy structure across a partially logged tropical peat swamp

    Science.gov (United States)

    Wedeux, B. M. M.; Coomes, D. A.

    2015-11-01

    Forest canopy structure is strongly influenced by environmental factors and disturbance, and in turn influences key ecosystem processes including productivity, evapotranspiration and habitat availability. In tropical forests increasingly modified by human activities, the interplay between environmental factors and disturbance legacies on forest canopy structure across landscapes is practically unexplored. We used airborne laser scanning (ALS) data to measure the canopy of old-growth and selectively logged peat swamp forest across a peat dome in Central Kalimantan, Indonesia, and quantified how canopy structure metrics varied with peat depth and under logging. Several million canopy gaps in different height cross-sections of the canopy were measured in 100 plots of 1 km2 spanning the peat dome, allowing us to describe canopy structure with seven metrics. Old-growth forest became shorter and had simpler vertical canopy profiles on deeper peat, consistent with previous work linking deep peat to stunted tree growth. Gap size frequency distributions (GSFDs) indicated fewer and smaller canopy gaps on the deeper peat (i.e. the scaling exponent of Pareto functions increased from 1.76 to 3.76 with peat depth). Areas subjected to concessionary logging until 2000, and illegal logging since then, had the same canopy top height as old-growth forest, indicating the persistence of some large trees, but mean canopy height was significantly reduced. With logging, the total area of canopy gaps increased and the GSFD scaling exponent was reduced. Logging effects were most evident on the deepest peat, where nutrient depletion and waterlogged conditions restrain tree growth and recovery. A tight relationship exists between canopy structure and peat depth gradient within the old-growth tropical peat swamp forest. This relationship breaks down after selective logging, with canopy structural recovery, as observed by ALS, modulated by environmental conditions. These findings improve our

  19. Galling arthropod diversity in adjacent swamp forests and restinga vegetation in Rio Grande do Sul, Brazil.

    Science.gov (United States)

    Mendonça, Milton De S; Piccardi, Hosana M F; Jahnke, Simone M; Dalbem, Ricardo V

    2010-01-01

    Galling arthropods create plant structures inside which they find shelter. Factors acting on galler diversity are still being discussed, with this fauna considered more diverse in xeric than mesic environments (higrothermic stress hypothesis, HSH), and also in more plant diverse sites. Here we compare galler abundance (N), equitability (E), species richness (S) and composition between adjacent restinga (xeric) and swamp forests (mesic) in Parque Estadual de Itapeva (29°21' S, 49°45' W), Rio Grande do Sul, southern Brazil. Five trails, two in swamp forest and three in restingas, were sampled four times each (January/December 2005). After an effort of 60h/person, 621 galled plant individuals belonging to 104 gall morphotypes were recorded. This suggests a high galler diversity for the Park, comparable to the richest places known. No differences were found for N, E or S between restingas and swamp forests. However, faunal composition differs significantly between the vegetation types. The dominant (most abundant) species are different in either vegetation type, and are rare or absent on the other vegetation type. Such species composition analysis is still largely ignored for gallers, and stresses the fact that the HSH cannot explain this pattern, since the latter is based on preferences by the ovipositing galler for xeric sites instead of mesic ones. The two habitats differ in microclimate, but species richness, as would be predicted by the HSH, does not differ. This small scale pattern can perhaps be attributed to biogeographic processes on larger scales, as suggested by the resource synchronisation hypothesis.

  20. Mapping Upper Amazon Palm Swamps with Spaceborne L-band Synthetic Aperture Radar

    Science.gov (United States)

    Pinto, N.; McDonald, K. C.; Podest, E.; Schroeder, R.; Zimmermann, R.; Horna, V.

    2010-12-01

    Palm swamp ecosystems are widespread in the Amazon basin, forming where seasonal flooding is moderate and surface inundation persists. Recent studies suggest that palm swamps have a disproportional role on tropical biogeochemistry: the combination of persistently saturated soils, warm temperatures, and low oxygen soils can support significant land-atmosphere methane flux. Potential impacts of climate change on these ecosystems include changes in temperature and precipitation regimes that influence primary productivity and flood extent significantly, potentially reversing net land-atmosphere carbon exchanges regionally. Data acquired from Earth-orbiting satellites provides the opportunity to characterize vegetation structure and monitor surface inundation independently of cloud cover. Building on efforts under our NASA MEaSUREs project for assembly of a global-scale Earth System Data Record (ESDR) of inundated wetlands, we develop and evaluate a systematic approach to map the distribution and composition of palm swamps in the upper Amazon using data sets from JAXA’s Advanced Land Observing Satellite (ALOS) Phased Array L-Band SAR (PALSAR). Our input dataset consists of HH backscatter images acquired in 2007 and 2009. Ground measurements for training were obtained from a study site near Loreto, Peru (4.43S 75.34W) containing the palm species Mauritia flexuosa. The ALOS PALSAR images are first averaged temporally and spatially. We then develop ancillary data layers of flood extent, distance from open water, and SAR image texture. The PALSAR data and derived ancillary layers are combined with MODIS Vegetation Indices and SRTM elevation and input in a classification framework. Since palm swamps are found in persistently flooded areas, we evaluate the potential of identifying and mapping these ecosystems using multi-temporal SAR-based flood extent maps. We conclude by comparing the performance between a decision-tree supervised vs. unsupervised approach and by

  1. Greenhouse gas efflux from an impacted Malaysian tropical peat swamp (Invited)

    Science.gov (United States)

    Waldron, S.; Vihermaa, L. E.; Evers, S.; Garnett, M.; Newton, J.; Padfield, R.

    2013-12-01

    Tropical peatlands constitute ~11% of global peatland area and ~12% of the global peat C pool. Malaysia alone contains 10% of tropical peats. Due to rising global demands for food and biofuels, SE-Asia peat swamp forest ecosystems are threatened by increasing amounts of drainage, fire and conversion to plantation. These processes can change the GHG emissions and thus net ecosystem C balance. However, in comparison to temperate and boreal peatlands, there is a lack of data on terrestrial-aquatic-atmospheric carbon transfer from tropical peatlands, both those that are little disturbed and those facing anthropogenic pressures. Lateral transport of soil-respired carbon, and fluvial respiration or UV-oxidation of terrestrial DOC primes atmospheric carbon dioxide efflux. We now know that DOC lost from disturbed tropical peat swamp forests can be centuries to millennia old and originates deep within the peat column - this carbon may fuel efflux of old carbon dioxide and so anthropogenic land-use change renders the older, slower carbon cycles shorter and faster. Currently we have no knowledge of how significant ';older-slower' terrestrial-aquatic-atmospheric cycles are in disturbed tropical peatlands. Further, in some areas for commercial reasons, or by conservation bodies trying to minimise peat habitat loss, logged peats have been left to regenerate. Consequently, unpicking the legacy of multiple land uses on magnitude, age and source of GHG emissions is challenging but required to support land management decisions and projections of response to a changing climate. Here, we present the results of our first field campaign in July 2013 to the Raja Musa and Sungai Karang Peat Swamp Forest Reserves in North Selangor, Malaysia. This is one of Malaysia's largest oceanic peat swamps, and has been selectively logged and drained for 80 years, but is now subject to a 30 year logging ban to aid forest regeneration and build up wood stocks. From sites subject to different land use

  2. Spatial analysis of Carbon-14 dynamics in a wetland ecosystem (Duke Swamp, Chalk River Laboratories, Canada)

    International Nuclear Information System (INIS)

    Yankovich, T.L.; King-Sharp, K.J.; Carr, J.; Robertson, E.; Killey, R.W.D.; Beresford, N.A.; Wood, M.D.

    2014-01-01

    A detailed survey was conducted to quantify the spatial distribution of 14 C in Sphagnum moss and underlying soil collected in Duke Swamp. This wetland environment receives 14 C via groundwater pathways from a historic radioactive Waste Management Area (WMA) on Atomic Energy Canada Limited (AECL)'s Chalk River Laboratories (CRL) site. Trends in 14 C specific activities were evaluated with distance from the sampling location with the maximum 14 C specific activity (DSS-35), which was situated adjacent to the WMA and close to an area of groundwater discharge. Based on a spatial evaluation of the data, an east-to-west 14 C gradient was found, due to the influence of the WMA on 14 C specific activities in the swamp. In addition, it was possible to identify two groups of sites, each showing significant exponential declines with distance from the groundwater source area. One of the groups showed relatively more elevated 14 C specific activities at a given distance from source, likely due to their proximity to the WMA, the location of the sub-surface plume originating from the WMA, the presence of marsh and swamp habitat types, which facilitated 14 C transport to the atmosphere, and possibly, 14 C air dispersion patterns along the eastern edge of the swamp. The other group, which had lower 14 C specific activities at a given distance from the groundwater source area, included locations that were more distant from the WMA and the sub-surface plume, and contained fen habitat, which is known to act as barrier to groundwater flow. The findings suggest that proximity to source, groundwater flow patterns and habitat physical characteristics can play an important role in the dynamics of 14 C being carried by discharging groundwater into terrestrial and wetland environments. - Highlights: • Groundwater represents an important source of volatile radionuclides to wetlands. • Habitat type influenced 14 C transport from sub-surface to surface environments. • C-14 specific

  3. Migratory monarchs wintering in California experience low infection risk compared to monarchs breeding year-round on non-native milkweed.

    Science.gov (United States)

    Satterfield, Dara A; Villablanca, Francis X; Maerz, John C; Altizer, Sonia

    2016-08-01

    Long-distance migration can lower infection risk for animal populations by removing infected individuals during strenuous journeys, spatially separating susceptible age classes, or allowing migrants to periodically escape from contaminated habitats. Many seasonal migrations are changing due to human activities including climate change and habitat alteration. Moreover, for some migratory populations, sedentary behaviors are becoming more common as migrants abandon or shorten their journeys in response to supplemental feeding or warming temperatures. Exploring the consequences of reduced movement for host-parasite interactions is needed to predict future responses of animal pathogens to anthropogenic change. Monarch butterflies (Danaus plexippus) and their specialist protozoan parasite Ophryocystis elektroscirrha (OE) provide a model system for examining how long-distance migration affects infectious disease processes in a rapidly changing world. Annual monarch migration from eastern North America to Mexico is known to reduce protozoan infection prevalence, and more recent work suggests that monarchs that forego migration to breed year-round on non-native milkweeds in the southeastern and south central Unites States face extremely high risk of infection. Here, we examined the prevalence of OE infection from 2013 to 2016 in western North America, and compared monarchs exhibiting migratory behavior (overwintering annually along the California coast) with those that exhibit year-round breeding. Data from field collections and a joint citizen science program of Monarch Health and Monarch Alert showed that infection frequency was over nine times higher for monarchs sampled in gardens with year-round milkweed as compared to migratory monarchs sampled at overwintering sites. Results here underscore the importance of animal migrations for lowering infection risk and motivate future studies of pathogen transmission in migratory species affected by environmental change. © The

  4. Study, using stable isotopes, of flow distribution, surface-groundwater relations and evapotranspiration in the Okavango Swamp, Botswana

    International Nuclear Information System (INIS)

    Dincer, T.; Hutton, L.G.; Kupee, B.B.J.

    1979-01-01

    Stable isotope data collected in the Okavango Delta have confirmed that the central distributary system is more active at present than the peripheral systems. The data also show that there is no groundwater outflow at the western and southern margins of the delta. A salinity-isotope model of the deltaic swamp has been developed to study the relation between the salinity and isotopic composition of the swamp waters. An attempt has been made to separate the atmospheric losses from the swamp into its evapotranspiration components. The results indicate that in winter, when high water levels prevail, these losses are almost entirely due to evaporation whilst in summer, when the water levels are low, evaporation and transpiration contribute almost equally to the total atmospheric losses. (author)

  5. Residu Gula Glikokonjugat pada Lambung Depan Kerbau Rawa (Bubalus bubalis Kalimantan Selatan (SUGAR RESIDU OF GLYCOCONJUGATES IN FORESTOMACH OF SOUTH KALIMANTAN SWAMP BUFFALO (BUBALUS BUBALIS

    Directory of Open Access Journals (Sweden)

    Anni Nurliani

    2014-08-01

    Full Text Available The ability of swamp buffaloes to adapt with swamp environment was suggested to be supported bytheir digestive system efficiency. The research was done to obtain scientific explanation about digestiveefficiency of swamp buffalo by identification on kinds and distribution of glycoconjugates in swamp buffaloforestomach. Six male swamp buffaloes aged more than 2.5 year old and had body weight between 300-400kg were used in this study. Samples were obtained from Regency of Banjar slaughter house, SouthKalimantan. Every parts of the forestomach included rumen, reticulum, and omasum was taken andprocessed for microscopic observation with hematoxyline eosin (HE and alcian blue-periodic acid schiff(AB-PAS stainings. Sugar residues of glycoconjugates were localized with lectin histochemistry wheatgerm agglutinin (WGA, ulex europaeus agglutinin (UEA, ricinus communis agglutinin (RCA, concanavalinagglutinin (Con A, and soybean agglutinin (SBA. Every part of swamp buffalo forestomach had kinds ofspecific glycoconjugates with special distribution pattern which were different with other ruminant, andwere suitable for their functions in that part. The existence of D mannose/D glucose glycoconjugates thatwas dominant in forestomach estimated that had important role in supporting fermentative digestionfunction in swamp buffalo, through its function as receptor bacteria attachment. This is suggested as aspecial characteristic in digestive system of swamp buffalo which causes high digestive efficiency inswamp buffalo.

  6. Heavy Metals Uptake by Asian Swamp Eel, Monopterus albus from Paddy Fields of Kelantan, Peninsular Malaysia: Preliminary Study

    OpenAIRE

    Yin, Sow Ai; Ismail, Ahmad; Zulkifli, Syaizwan Zahmir

    2012-01-01

    Swamp eel, Monopterus albus is one of the common fish in paddy fields, thus it is suitable to be a bio-monitor for heavy metals pollution studies in paddy fields. This study was conducted to assess heavy metals levels in swamp eels collected from paddy fields in Kelantan, Malaysia. The results showed zinc [Zn (86.40 μg/g dry weight)] was the highest accumulated metal in the kidney, liver, bone, gill, muscle and skin. Among the selected organs, gill had the highest concentrations of lead (Pb),...

  7. Immunological responses of pregnant swamp and murrah buffalo cows and calves to Toxocara (Neoascaris) vitulorum infection

    International Nuclear Information System (INIS)

    Amerasinghe, P.; Masoodi, M.A.; Samarasinghe, B.; Sivanathan, S.; Gunawardana, V.K.; Fernando, S.T.

    1984-01-01

    Swamp buffalo cows from an area where T. vitulorum infection was heavy were examined for serum antibodies. Serum from all cows showed strongly positive precipitin reactions from the 4th to 6th months of pregnancy and after parturition using homologous larval, adult worm and adult excretory and secretory antigens; these precipitins were still being detected in the sera 4-6 months after calving. The sera of calves born to these cows were negative for T. vitulorum precipitins before feeding with colostrum but a precipitin reaction was evident from 24 hours of birth. Nevertheless, patent infections developed from 19-21 days after birth and one calf died with severe diarrhoea; the remainder revealed heavy faecal Toxocara egg counts. In six calves the infection was spontaneously eliminated between 40 and 60 days after birth suggesting a 'self-cure' reaction. In a similar study involving 30 Murrah cows sera precipitins were not observed during the first 4-6 months of pregnancy. In 14 calves born to these animals serum precipitins were never observed, but the animals had T. vitulorum egg counts comparable with those in swamp buffalo calves. After an initial natural infection a strong resistance to reinfection was acquired by most calves of both breeds in that larvae did not generally develop beyond the second stage. (author)

  8. Carcass Characteristics and Meat Quality of Swamp Buffaloes (Bubalus bubalis) Fattened at Different Feeding Intensities.

    Science.gov (United States)

    Lambertz, C; Panprasert, P; Holtz, W; Moors, E; Jaturasitha, S; Wicke, M; Gauly, M

    2014-04-01

    Twenty-four male 1-year old swamp buffaloes (Bubalus bubalis) were randomly allocated to 4 groups. One group grazed on guinea grass (GG) and another on guinea grass and the legume Stylosanthes guianensis (GL). The other two groups were kept in pens and fed freshly cut guinea grass and concentrate at an amount of 1.5% (GC1.5) and 2.0% (GC2.0) of body weight, respectively. The effect of the different feeding intensities on carcass characteristics and meat quality were assessed. The mean body weight at slaughter was 398 (±16) kg. Average daily gain was higher in concentrate-supplemented groups (570 and 540 g/d in GC1.5 and GC2.0, respectively) when compared to GG (316 g/d) and GL (354 g/d) (pbuffaloes. Results of the present study showed that the supplementation of pasture with concentrate enhances the growth and carcass characteristics of swamp buffaloes expressed in superior dressing percentage, better muscling, and redder meat with a higher content of protein and fat, whereas animals grazing only on pasture had a more favorable fatty acid profile and water holding capacity. In conclusion, the supplementation of concentrate at a rate of about 1.5% of body weight is recommended to improve the performance and carcass quality of buffaloes.

  9. AGRICULTURE PHENOMENA AND PERSPECTIVES OF LEBAK SWAMP IN JAKABARING SOUTH SUMATRA, INDONESIA

    Directory of Open Access Journals (Sweden)

    Elisa Wildayana

    2017-11-01

    Full Text Available The research aimed to analyze agriculture phenomena and perspectives of lebak swamp in Jakabaring South Sumatra Indonesia. The research used mix methods of quantitative and qualitative approaches. The description of the research area was assisted with interpretation of Landsat images in 1987 and 2015. The research resulted that farmer’s groups living in Jakabaring are divided into four group, namely indigenous people (people of Ogan, Komering, Musi, Enim, and Palembang, new comers (Javanese, spontaneous migration (Buginese, Banjarnese, Bataknese and outside spontaneous migration (Chinese, Arabic. The total area of Jakabaring is approximately 5,525 ha, around 2,700 ha (48.87 % was already landfilled by the Government in 1990, while the remaining 2,825 ha (51.13 % is still not reclaimed. The landfill materials were directly sucked from mud, sand, silt and stones of the Musi River. Each lebak swamp typology shows specific soil characters, but after landfills all soils became homogenous because of uniform materials of landfills. Patterns of land degradation after landfills are classified into three groups, namely making layers of water impermeability, changing vegetation types of land cover, and decreasing type and density of vegetation.

  10. STRUCTURE OF NATURAL REGENERATION IN RELATION TO SOIL PROPERTIES AND DISTURBANCE IN TWO SWAMP FORESTS

    Directory of Open Access Journals (Sweden)

    Marly Antonielle Ávila

    2016-03-01

    Full Text Available Veredas (palm swamps is a type of vegetation associated with watercourses, characterized by the presence of Mauritia flexuosa palm trees. These systems are not well understood and suffer from high anthropogenic pressure. The aims of this study were to describe the natural regeneration of two swamp forests in vereda systems with different anthropogenic impacts and investigate if the variation in these plant communities are associated to edaphic conditions. The study was performed in preserved and impacted sites located in the Environmental Protection Area of the Pandeiros River in northern Minas Gerais. At each site, one hundred 25 m2 plots were established for surveying regenerating shrubs and trees (≥1 cm diameter at the base of the stem and < 3 cm diameter at breast height. Vegetation structure was evaluated by phytosociological parameters, similarity index, and size distribution of individuals. Regenerating strata was correlated with chemical and physical soil analyses. The vegetation at the preserved site was characterized by a higher number of individuals and a lower diversity but contained species that were typical of flooded areas. The results also showed differences in soil nutrient availability between sites that influenced the distribution of species at the two study sites.

  11. Swamp Neighborhoods

    Science.gov (United States)

    Lowry, D. S.

    2017-12-01

    The fields of anthropology, evironmental science, and "planetary health" are all speaking about the need to properly assess the relationships between human health and anthropogenic environmental influences. Using ethnographic data gathered from an NSF-funded research project in the Lumbee Tribe of North Carolina after Hurricane Matthew, I will present the importance of specific, culturally-centered, historically contextualized studies of the environment as we are increasingly placed in highly important (but too general) global environmental discussions. I will focus on the importance of the Lumbee Tribe (one of the largest Native American communities in the U.S.) as a key research site to help us understand how to engage in global environmental debates. I will illustrate how we must take account particular communities as they fade into and out of one another in the past and present. As such, I will argue that "planetary health" and other environemental health discourses must be accountable through interdisciplinary/interprofessional/interclass relationships that place the power of academic work in the environment safely in the hands of the most vulnerable populations.

  12. Water quality study at the Congaree Swamp National monument of Myers Creek, Reeves Creek and Toms Creek. Technical report

    International Nuclear Information System (INIS)

    Rikard, M.

    1991-11-01

    The Congaree Swamp National Monument is one of the last significant near virgin tracts of bottom land hardwood forests in the Southeast United States. The study documents a water quality monitoring program on Myers Creek, Reeves Creek and Toms Creek. Basic water quality parameters were analyzed. High levels of aluminum and iron were found, and recommendations were made for further monitoring

  13. Sustainable management of peat swamp forest of Sarawak with special reference to ramin (Gonystylus bancanus); development of a monitoring system

    NARCIS (Netherlands)

    Wijdeven, S.M.J.; Meer, van der P.J.; Chai, F.Y.C.; Tan, S.; Mohizah, M.; Liam, D.

    2004-01-01

    Peat swamp forests in Sarawak are valuable in terms of timber and biodiversity, but heavily degraded. In order to assess the current status, potential developments and possible management interventions, an adequate monitoring system is necessary. In this study a new monitoring system is proposed,

  14. Species Turnover across Different Life Stages from Seedlings to Canopy Trees in Swamp Forests of Central Brazil

    Directory of Open Access Journals (Sweden)

    Clarissa G. Fontes

    2015-01-01

    Full Text Available Processes driving the assembly of swamp forest communities have been poorly explored. We analyzed natural regeneration and adult tree communities data of a swamp gallery forest in Central Brazil to discuss the role of ecological filters in shaping plant species turnover in a successional gradient. Species data of 120 plots were used to assess species turnover between natural regeneration and adult tree communities. Our analyses were based on 4995 individuals belonging to 72 species. Community patterns were discerned using ordination analyses. A clear floristic turnover among plant life stages was distinguished. Regeneration community of swamp forests was richer in species composition than the adult community. Tree species commonly found in nonflooded gallery forests were present in the regeneration plots but not in the adult community. Differences in the floristic composition of these two strata suggest that not all species in the seedling stage can stand permanent flooding conditions and only a few tolerant species survive to become adult trees. We propose that natural disturbances play an important role by altering limiting resources, allowing seeds of nonflooded forest species to germinate. This paper elucidates the turnover between plant life stages in swamp forests and suggests mechanisms that may shape these communities.

  15. Variation in flood tolerance of container-grown seedlings of swamp white oak, bur oak, and white oak

    Science.gov (United States)

    Michael P. Walsh; J.W. Van Sambeek; Mark V. Coggeshall

    2008-01-01

    How much variation in flood tolerance exists among seedlings within oak species, given the flood frequency of sites from which acorns are collected, has been largely unexplored. Our studies examined initial growth and flood tolerance for seedlings of swamp white oak (Quercus bicolor Willd.), bur oak (Q. macrocarpa L.), and white...

  16. Growth Response and Tolerance to Heavy Metals of two Swamp Species inoculated with a Plant Growth-Promoting Rhizobacteria

    International Nuclear Information System (INIS)

    Rodriguez-Dorantes, A.; Labra-Cardon, D.; Guerrero-Zuniga, A.; Montes-Villafan, S.

    2009-01-01

    Due to the sensitivity and the sequestration ability of the microbial communities to heavy metals, microbes have been used for bioremediation. Recently the application of plant growth-promoting rhizobacteria (PGPR) for the bioremediation of this kind of contaminants has been done. This study evaluated the growth response and the tolerance to heavy metals of two swamp species. (Author)

  17. [Distribution, surface and protected area of palm-swamps in Costa Rica and Nicaragua].

    Science.gov (United States)

    Serrano-Sandí, Juan; Bonilla-Murillo, Fabian; Sasa, Mahmood

    2013-09-01

    In Central America, palm swamps are known collectively as yolillales. These wetlands are usually dominated by the raffia palm Raphia taedigera, but also by the royal palm Manicaria saccifera and -in lower extensions- by the American oil palm Elaeis oleifera. The yolillales tend to be poor in woody species and are characteristic of regions with high rainfall and extensive hydroperiods, so they remain flooded most of the year. The dominance of large raffia palm leaves in the canopy, allow these environments to be distinguishable in aerial photographs, which consequently has helped to map them along most of their distribution. However, while maps depicting yolillales are available, the extent of their surface area, perimeter and connectivity remains poorly understood. This is particularly true for yolillales in Costa Rica and Nicaragua, countries that share a good proportion of palm dominated swaps in the Rio San Juan Basin. In addition, it is not known the actual area of these environments that is under any category of protection according to the conservation systems of both countries. As a first step to catalog yolillal wetlands in Costa Rica and Nicaragua, this paper evaluates cartographic maps to delineate yolillales in the region. A subsample of yolillales mapped in this study were visited and we geo-referenced them and evaluate the extent and condition of the swamp. A total of 110 883.2ha are classified as yolillales in Nicaragua, equivalent to 22% of wetland surface area recorded for that country (excluding the Cocibolca and Xolothn Lakes). In Costa Rica, 53 931.3ha are covered by these palm dominated swamps, which represent 16.24% of the total surface area covered by wetlands. About 47% of the area covered by yolillales in Nicaragua is under some category of protection, the largest extensions protected by Cerro Silva, Laguna Tale Sulumas and Indio Maiz Nature Reserves. In Costa Rica, 55.5% of the area covered by yolillal is located within protected areas

  18. Trait differences in responses to arbuscular mycorrhizal fungi are stronger and more consistent than fixed differences among populations of Asclepias speciosa.

    Science.gov (United States)

    Waller, Lauren P; Hahn, Philip G; Maron, John L; Lekberg, Ylva

    2018-02-01

    Arbuscular mycorrhizal (AM) fungi can promote plant growth and reproduction, but other plant physiological traits or traits that provide defense against herbivores can also be affected by AM fungi. However, whether responses of different traits to AM fungi are correlated and whether these relationships vary among plants from different populations are unresolved. In a common garden experiment, we grew Asclepias speciosa plants from seed collected from populations found along an environmental gradient with and without AM fungi to assess whether the responses of six growth and defense traits to AM fungi are correlated. Although there was strong genetic differentiation in mean trait values among populations, AM fungi consistently increased expression of most growth and defense traits across all populations. Responses of biomass and root to shoot ratio to AM fungi were positively correlated, suggesting that plants that are more responsive to AM fungi allocated more biomass belowground. Responses of biomass and trichome density to AM fungi were negatively correlated, indicating a trade-off in responsiveness between a growth and defensive trait. Our results suggest that while there is substantial population differentiation in many traits of A. speciosa, populations respond similarly to AM fungi, and both positive and negative correlations among trait responses occur. © 2018 Botanical Society of America.

  19. Spatial differences in hydrologic characteristics and water chemistry of a temperate coastal plain peatland: The Great Dismal Swamp, USA

    Science.gov (United States)

    Speiran, Gary K.; Wurster, Frederick C.

    2016-01-01

    Spatial differences in hydrologic processes and geochemistry across forested peatlands control the response of the wetland-community species and resiliency to natural and anthropogenic disturbances. Knowing these controls is essential to effectively managing peatlands as resilient wetland habitats. The Great Dismal Swamp is a 45,325 hectare peatland in the Atlantic Coastal Plain of Virginia and North Carolina, USA, managed by the U.S. Fish and Wildlife Service. The existing forest-species distribution is a product of timber harvesting, hydrologic alteration by canal and road construction, and wildfires. Since 2009, studies of hydrologic and geochemical controls have expanded knowledge of groundwater flow paths, water chemistry, response to precipitation events, and characteristics of the peat. Dominant hydrologic and geochemical controls include (1) the gradual slope in land surface, (2) vertical differences in the hydraulic characteristics of the peat, (3) the proximity of lateral groundwater and small stream inflows from uplands, (4) the presence of an extensive canal and road network, and (5) small, adjustable-height dams on the canals. Although upland sources provide some surface water and lateral groundwater inflow to western parts of the swamp, direct groundwater recharge by precipitation is the major source of water throughout the swamp and the only source in many areas. Additionally, the proximity and type of upland water sources affect water levels and nutrient concentrations in canal water and groundwater. Where streams are a dominant upland source, variations in groundwater levels and nutrient concentrations are greater than where recharge by precipitation is the primary water source. Where upland groundwater is a dominant source, water levels are more stable. Because the species distribution of forest communities in the Swamp is strongly influenced by these controls, swamp managers are beginning to incorporate this knowledge into forest, water, and fire

  20. Swamp plots for dynamic aperture studies of PEP-II lattices

    International Nuclear Information System (INIS)

    Yan, Y.T.; Irwin, J.; Cai, Y.; Chen, T.; Ritson, D.

    1995-01-01

    With a newly developed algorithm using resonance basis Lie generators and their evaluation with action-angle Poisson bracket maps (nPB tracking) the authors have been able to perform fast tracking for dynamic aperture studies of PEP-II lattices as well as incorporate lattice nonlinearities in beam-beam studies. They have been able to better understand the relationship between dynamic apertures and the tune shift and resonance coefficients in the generators of the one-turn maps. To obtain swamp plots (dynamic aperture vs. working point) of the PEP-II lattices, they first compute a one-turn resonance basis map for a nominal working point and then perform nPB tracking by switching the working point while holding fixed all other terms in the map. Results have been spot-checked by comparing with element-by-element tracking

  1. Three approaches to the classification of inland wetlands. [Dismal Swamp, Tennessee, and Florida

    Science.gov (United States)

    Gammon, P. T.; Malone, D.; Brooks, P. D.; Carter, V.

    1977-01-01

    In the Dismal Swamp project, seasonal, color-infrared aerial photographs and LANDSAT digital data were interpreted for a detailed analysis of the vegetative communities in a large, highly altered wetland. In Western Tennessee, seasonal high altitude color-infrared aerial photographs provided the hydrologic and vegetative information needed to map inland wetlands, using a classification system developed for the Tennessee Valley Region. In Florida, color-infrared aerial photographs were analyzed to produce wetland maps using three existing classification systems to evaluate the information content and mappability of each system. The methods used in each of the three projects can be extended or modified for use in the mapping of inland wetlands in other parts of the United States.

  2. Modeling Flood Plain Hydrology and Forest Productivity of Congaree Swamp, South Carolina

    Science.gov (United States)

    Doyle, Thomas W.

    2009-01-01

    An ecological field and modeling study was conducted to examine the flood relations of backswamp forests and park trails of the flood plain portion of Congaree National Park, S.C. Continuous water level gages were distributed across the length and width of the flood plain portion - referred to as 'Congaree Swamp' - to facilitate understanding of the lag and peak flood coupling with stage of the Congaree River. A severe and prolonged drought at study start in 2001 extended into late 2002 before backswamp zones circulated floodwaters. Water levels were monitored at 10 gaging stations over a 4-year period from 2002 to 2006. Historical water level stage and discharge data from the Congaree River were digitized from published sources and U.S. Geological Survey (USGS) archives to obtain long-term daily averages for an upstream gage at Columbia, S.C., dating back to 1892. Elevation of ground surface was surveyed for all park trails, water level gages, and additional circuits of roads and boundaries. Rectified elevation data were interpolated into a digital elevation model of the park trail system. Regression models were applied to establish time lags and stage relations between gages at Columbia, S.C., and gages in the upper, middle, and lower reaches of the river and backswamp within the park. Flood relations among backswamp gages exhibited different retention and recession behavior between flood plain reaches with greater hydroperiod in the lower reach than those in the upper and middle reaches of the Congaree Swamp. A flood plain inundation model was developed from gage relations to predict critical river stages and potential inundation of hiking trails on a real-time basis and to forecast the 24-hour flood In addition, tree-ring analysis was used to evaluate the effects of flood events and flooding history on forest resources at Congaree National Park. Tree cores were collected from populations of loblolly pine (Pinus taeda), baldcypress (Taxodium distichum), water

  3. Primary production in a shallow water lake with special reference to a reed swamp

    International Nuclear Information System (INIS)

    Andersen, F.Oe.

    1976-01-01

    Phytoplankton gross primary production ( 14 C method) in the shallow, eutrophic Danish Lake Arresoe in 1973 was 980 g C m -2 . Calculated net primary production was near zero. Macrophyte net primary production was measured by harvesting the maximum biomass, and above ground values were between 420 and 1325 g ash free dry wt m -2 , while below ground values were between 2480 and 8570 g ash free dry wt m -2 . The reed swamps were mapped on aerial photographs, and the composition of the macrophyte vegetation was determined. A comparison of macrophyte vegetation in 1944 and 1972 showed a reduction in species diversity, especially of submerged species. The seasonal variations in physical and chemical data indicated strong eutrophication in Arresoe. (author)

  4. Proteomic analysis of three gonad types of swamp eel reveals genes differentially expressed during sex reversal.

    Science.gov (United States)

    Sheng, Yue; Zhao, Wei; Song, Ying; Li, Zhigang; Luo, Majing; Lei, Quan; Cheng, Hanhua; Zhou, Rongjia

    2015-05-18

    A variety of mechanisms are engaged in sex determination in vertebrates. The teleost fish swamp eel undergoes sex reversal naturally and is an ideal model for vertebrate sexual development. However, the importance of proteome-wide scanning for gonad reversal was not previously determined. We report a 2-D electrophoresis analysis of three gonad types of proteomes during sex reversal. MS/MS analysis revealed a group of differentially expressed proteins during ovary to ovotestis to testis transformation. Cbx3 is up-regulated during gonad reversal and is likely to have a role in spermatogenesis. Rab37 is down-regulated during the reversal and is mainly associated with oogenesis. Both Cbx3 and Rab37 are linked up in a protein network. These datasets in gonadal proteomes provide a new resource for further studies in gonadal development.

  5. Autonomic control of the heart in the Asian swamp eel (Monopterus albus)

    DEFF Research Database (Denmark)

    Iversen, Nina Kerting; Huong, Do Thi Thanh; Bayley, Mark

    2011-01-01

    The Asian swamp eel (Monopterus albus) is an air-breathing teleost with very reduced gills that uses the buccal cavity for air-breathing. Here we characterise the cardiovascular changes associated with the intermittent breathing pattern in M. albus and we study the autonomic control of the heart.......3 cm H2O). The autonomic control of the heart during water- and air-breathing was revealed by infusion of the β-adrenergic antagonist propranolol and muscarinic antagonist atropine (3 mg kg− 1) in eels instrumented with an arterial catheter. Inhibition of the sympathetic and parasympathetic...... innervations of the heart revealed a strong vagal tone on the heart of water-breathing eels and that the tachycardia during air-breathing is primarily mediated by withdrawal of cholinergic tone....

  6. Reproductive biology of the swamp racer Mastigodryas bifossatus (Serpentes: Colubridae in subtropical Brazil

    Directory of Open Access Journals (Sweden)

    Pedro T. Leite

    2009-03-01

    Full Text Available The swamp racer Mastigodryas bifossatus (Raddi, 1820 is a large snake of Colubrinae. It is widely distributed in open areas throughout South America. Dissection of 224 specimens of this species housed in herpetological collections of the southern Brazilian states of Rio Grande do Sul, Santa Catarina and Paraná provided information on its sexual dimorphism, reproductive cycle and fecundity in subtropical Brazil. Adult specimens of M. bifossatus average approximately 1190 mm in snout-vent length and females are larger than males. The reproductive cycle of females is seasonal, with secondary vitellogenesis occurring from July to December. However, examination of male gonads did not reveal signs of reproductive seasonality in this sex. Egg laying was recorded from November to January. The estimated recruitment period extends from February to April. The mean number of individuals per clutch is 15, and there is a positive correlation between female length and clutch size.

  7. Ground survey of red lechwe in the Linyanti swamps and Chobe floodplains, northern Botswana

    Directory of Open Access Journals (Sweden)

    Phemelo Gadimang

    2017-05-01

    Full Text Available A ground survey of red lechwe was carried out in the Linyanti swamps and the Chobe floodplains of northern Botswana in the dry and wet seasons of 2012 and 2013, respectively. We documented numbers, sex ratio and age structure of red lechwe within the linear strips of 25 km × 300 m along the Linyanti swamps and the Chobe floodplains. Results indicated a significant difference in the numbers of red lechwe between sites and seasons. About 66 and 755 red lechwe were estimated for Chobe in the dry and wet season, respectively, with 343 and 261 of them estimated for Linyanti in the dry and wet season, respectively. In Chobe, the red lechwe densities varied widely between seasons (9 red lechwe/km2 – 101 red lechwe/km2 compared with Linyanti, where the densities did not vary much between seasons (35 red lechwe/km2 – 46 red lechwe/km2 . The lower densities of red lechwe in Chobe in the dry season when compared with the wet season suggest a possible seasonal shift in the distribution of red lechwe to the nearby Zambezi floodplains in Namibia. Conservation implications: The higher number of red lechwe in the Chobe floodplains in the wet season indicates the potential of the floodplains as a habitat for this species in that season. The dry season shift in the distribution of red lechwe in Chobe presents an opportunity for local communities in Namibia to engage in tourism, whereas the return of the red lechwe to the floodplains in the wet season ensures protection of the animals as well as boosts the tourism potential of the Chobe National Park.

  8. Effect of day or night grazing on behaviour of swamp buffalo heifers

    Directory of Open Access Journals (Sweden)

    Somparn, P.

    2007-03-01

    Full Text Available An experiment was conducted to examine the effect of day or night grazing on behaviour by swamp buffaloes. A grazing trial was conducted over 42 days in the late rainy season, during September to November2005 at Surin Livestock Research and Breeding Center, Surin province. The experimental period was divided into two 21-day periods. Twelve 2-year-old swamp buffalo heifers were allocated to four groups, eachcontaining three heifers, with the mean group weights being as similar as possible. Each group was allowed to graze either from 06:20 to 18:00 h (daytime treatment or from 18:20 to 06:00 h (nighttime treatment infour separate paddocks, each of 5 rai, using a cross-over design. When not at pasture the animals in each group were kept in the common corral with free access to fresh drinking water and mineral blocks. Individualanimal activity was recorded by visual observation at 1-min intervals during the period at pasture. Individual groups within each period were treated as replicates. Differences between group means weretested using MIXED procedure of SAS.The buffaloes on daytime treatment spent longer (P<0.05 grazing than those on nighttime treatment (423 vs 332 min. The number of meals differed (P<0.05 between treatments, but overall mean meal durationswere similar (73 min. Buffaloes allowed to graze during daylight had a tendency (P<0.10 toward a higher bite and step rates than those grazing during the night. With the reduction in grazing activity duringthe night on nighttime treatment, the animals ruminated for longer during the period at pasture (327 and 191 min, P<0.001. Live-weight change over periods of 20 days did not differ significantly. The difference intemporal behaviour patterns between treatments indicated that animals have to adapt foraging strategies appropriate for different situations in order to maintain feed intake and subsequently production.

  9. Improvement of the productivity of the swamp buffalo of S.E. Asia

    International Nuclear Information System (INIS)

    Frisch, J.E.; Vercoe, J.E.

    1984-01-01

    The needs of an expanding human population necessitate an increase in numbers and efficiency of output if the swamp buffalo is to remain as a significant component of S.E. Asian agriculture. Biological constraints to an increase in numbers are associated mainly with high calf mortality and low reproductive rate. A combination of vaccination and deworming markedly increases calf survival and provides the simplest means for increasing buffalo numbers. However, methods for improvement of the low inherent fertility of buffaloes remain to be devised. A first step towards a genetic solution is to obtain accurate comparative data for reproductive rates of different buffalo breeds and measures of the magnitude of heterosis for reproductive rate. However, facilities to do this in the near future do not exist. Milk yield or draft power could be most rapidly increased by crossing to river breeds with the optimum proportion of river breed in the cross determined by that level of milk yield and size commensurate with the locally available feed. This is the only method currently available that allows genetic improvement to initially equal or exceed the rate of human population growth. The lack of both large, well-documented herds and efficient AI schemes at present rules against within-breed selection as a method of improvement for any productive trait. It is unrealistic to expect large amounts of high-quality feeds to ever become available for rearing swamp buffaloes and there is a need to develop the facilities and expertise to allow comparative evaluation of buffalo breeds, the exploitation of heterosis in crosses and ultimately, within-breed selection for higher productivity, on straw-based diets. (author)

  10. Clonal growth strategy, diversity and structure: A spatiotemporal response to sedimentation in tropical Cyperus papyrus swamps.

    Science.gov (United States)

    Geremew, Addisie; Stiers, Iris; Sierens, Tim; Kefalew, Alemayehu; Triest, Ludwig

    2018-01-01

    Land degradation and soil erosion in the upper catchments of tropical lakes fringed by papyrus vegetation can result in a sediment load gradient from land to lakeward. Understanding the dynamics of clonal modules (ramets and genets) and growth strategies of plants on such a gradient in both space and time is critical for exploring a species adaptation and processes regulating population structure and differentiation. We assessed the spatial and temporal dynamics in clonal growth, diversity, and structure of an emergent macrophyte, Cyperus papyrus (papyrus), in response to two contrasting sedimentation regimes by combining morphological traits and genotype data using 20 microsatellite markers. A total of 636 ramets from six permanent plots (18 x 30 m) in three Ethiopian papyrus swamps, each with discrete sedimentation regimes (high vs. low) were sampled for two years. We found that ramets under the high sedimentation regime (HSR) were significantly clumped and denser than the sparse and spreading ramets under the low sedimentation regime (LSR). The HSR resulted in significantly different ramets with short culm height and girth diameter as compared to the LSR. These results indicated that C. papyrus ameliorates the effect of sedimentation by shifting clonal growth strategy from guerrilla (in LSR) to phalanx (in HSR). Clonal richness, size, dominance, and clonal subrange differed significantly between sediment regimes and studied time periods. Each swamp under HSR revealed a significantly high clonal richness (R = 0.80) as compared to the LSR (R = 0.48). Such discrepancy in clonal richness reflected the occurrence of initial and repeated seedling recruitment strategies as a response to different sedimentation regimes. Overall, our spatial and short-term temporal observations highlighted that HSR enhances clonal richness and decreases clonal subrange owing to repeated seedling recruitment and genets turnover.

  11. Dissolved Oxygen Dynamics in Backwaters of North America's Largest River Swamp

    Science.gov (United States)

    Bueche, S. M.; Xu, Y. J.; Reiman, J. H.

    2017-12-01

    The Atchafalaya River (AR) is the largest distributary of the Mississippi River flowing through south-central Louisiana, creating North America's largest river swamp basin - the Atchafalaya River Basin (ARB). Prior to human settlement, the AR's main channel was highly connected to this large wetland ecosystem. However, due to constructed levee systems and other human modifications, much of the ARB is now hydrologically disconnected from the AR's main channel except during high flow events. This lack of regular inputs of fresh, oxygenated water to these wetlands, paired with high levels of organic matter decomposition in wetlands, has caused low oxygen-deprived hypoxic conditions in the ARB's back waters. In addition, due to the incredibly nutrient-rich and warm nature of the ARB, microbial decomposition in backwater areas with limited flow often results in potentially stressful, if not lethal, levels of DO for organisms during and after flood pulses. This study aims to investigate dynamics of dissolved oxygen in backwaters of the Atchafalaya River Basin, intending to answer a crucial question about hydrological and water quality connectivity between the river's mainstem and its floodplain. Specifically, the study will 1) conduct field water quality measurements, 2) collect composite water samples for chemical analysis of nutrients and carbon, 3) investigate DO dynamics over different seasons for one year, and 4) determine the major factors that affect DO dynamics in this unique swamp ecosystem. The study is currently underway; therefore, in this presentation we will share the major findings gained in the past several months and discuss backwater effects on river chemistry.

  12. Plant genotype shapes ant-aphid interactions: implications for community structure and indirect plant defense.

    Science.gov (United States)

    Mooney, Kailen A; Agrawal, Anurag A

    2008-06-01

    Little is known about the mechanisms by which plant genotype shapes arthropod community structure. In a field experiment, we measured the effects of milkweed (Asclepias syriaca) genotype and ants on milkweed arthropods. Populations of the ant-tended aphid Aphis asclepiadis and the untended aphid Myzocallis asclepiadis varied eight- to 18-fold among milkweed genotypes, depending on aphid species and whether ants were present. There was no milkweed effect on predatory arthropods. Ants increased Aphis abundance 59%, decreased Myzocallis abundance 52%, and decreased predator abundance 56%. Milkweed genotype indirectly influenced ants via direct effects on Aphis and Myzocallis abundance. Milkweed genotype also modified ant-aphid interactions, influencing the number of ants attracted per Aphis and Myzocallis. While ant effects on Myzocallis were consistently negative, effects on Aphis ranged from antagonistic to mutualistic among milkweed genotypes. As a consequence of milkweed effects on ant-aphid interactions, ant abundance varied 13-fold among milkweed genotypes, and monarch caterpillar survival was negatively correlated with genetic variation in ant abundance. We speculate that heritable variation in milkweed phloem sap drives these effects on aphids, ants, and caterpillars. In summary, milkweed exerts genetic control over the interactions between aphids and an ant that provides defense against foliage-feeding caterpillars.

  13. The milkweed pod1 Gene Encodes a KANADI Protein That Is Required for Abaxial/Adaxial Patterning in Maize Leaves[W

    Science.gov (United States)

    Candela, Héctor; Johnston, Robyn; Gerhold, Abigail; Foster, Toshi; Hake, Sarah

    2008-01-01

    Leaf primordia initiate from the shoot apical meristem with inherent polarity; the adaxial side faces the meristem, while the abaxial side faces away from the meristem. Adaxial/abaxial polarity is thought to be necessary for laminar growth of leaves, as mutants lacking either adaxial or abaxial cell types often develop radially symmetric lateral organs. The milkweed pod1 (mwp1) mutant of maize (Zea mays) has adaxialized sectors in the sheath, the proximal part of the leaf. Ectopic leaf flaps develop where adaxial and abaxial cell types juxtapose. Ectopic expression of the HD-ZIPIII gene rolled leaf1 (rld1) correlates with the adaxialized regions. Cloning of mwp1 showed that it encodes a KANADI transcription factor. Double mutants of mwp1-R with a microRNA-resistant allele of rld1, Rld1-N1990, show a synergistic phenotype with polarity defects in sheath and blade and a failure to differentiate vascular and photosynthetic cell types in the adaxialized sectors. The sectored phenotype and timing of the defect suggest that mwp1 is required late in leaf development to maintain abaxial cell fate. The phenotype of mwp1; Rld1 double mutants shows that both genes are also required early in leaf development to delineate leaf margins as well as to initiate vascular and photosynthetic tissues. PMID:18757553

  14. The distribution and function of serotonin in the large milkweed bug, Oncopeltus fasciatus. a comparative study with the blood-feeding bug, Rhodnius prolixus.

    Science.gov (United States)

    Miggiani, L; Orchard, I; TeBrugge, V

    1999-11-01

    The blood-feeding hemipteran, Rhodnius prolixus, ingests a large blood meal at the end of each larval stage. To accommodate and process this meal, its cuticle undergoes plasticisation, and its gut and Malpighian tubules respectively absorb and secrete a large volume of water and salts for rapid diuresis. Serotonin has been found to be integral to the feeding process in this animal, along with a diuretic peptide(s). The large milkweed bug, Oncopeltus fasciatus, tends to feed in a more continuous and abstemious manner, and therefore may have different physiological requirements than the blood feeder. Unlike R. prolixus, O. fasciatus is lacking serotonin-like immunoreactive dorsal unpaired median neurons in the mesothoracic ganglionic mass, and lacks serotonin-like immunoreactive neurohaemal areas and processes on the abdominal nerves, integument, salivary glands, and anterior junction of the foregut and crop. The salivary glands and crop do, however, respond to serotonin with increased levels of cAMP, while the integument and Malpighian tubules do not. In addition, O. fasciatus Malpighian tubules respond to both O. fasciatus and R. prolixus partially purified CNS extracts, which are likely to contain any native diuretic peptides. Thus, while serotonin and diuretic peptides may be involved in tubule control in R. prolixus, the latter may be of greater importance in O. fasciatus.

  15. A conserved function of the zinc finger transcription factor Sp8/9 in allometric appendage growth in the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Schaeper, Nina D; Prpic, Nikola-Michael; Wimmer, Ernst A

    2009-08-01

    The genes encoding the closely related zinc finger transcription factors Buttonhead (Btd) and D-Sp1 are expressed in the developing limb primordia of Drosophila melanogaster and are required for normal growth of the legs. The D-Sp1 homolog of the red flour beetle Tribolium castaneum, Sp8 (appropriately termed Sp8/9), is also required for the proper growth of the leg segments. Here we report on the isolation and functional study of the Sp8/9 gene from the milkweed bug Oncopeltus fasciatus. We show that Sp8/9 is expressed in the developing appendages throughout development and that the downregulation of Sp8/9 via RNAi leads to antennae, rostrum, and legs with shortened and fused segments. This supports a conserved role of Sp8/9 in allometric leg segment growth. However, all leg segments including the claws are present and the expression of the leg genes Distal-less, dachshund, and homothorax are proportionally normal, thus providing no evidence for a role of Sp8/9 in appendage specification.

  16. Functional analyses in the milkweed bug Oncopeltus fasciatus (Hemiptera) support a role for Wnt signaling in body segmentation but not appendage development.

    Science.gov (United States)

    Angelini, David R; Kaufman, Thomas C

    2005-07-15

    Specification of the proximal-distal (PD) axis of insect appendages is best understood in Drosophila melanogaster, where conserved signaling molecules encoded by the genes decapentaplegic (dpp) and wingless (wg) play key roles. However, the development of appendages from imaginal discs as in Drosophila is a derived state, while more basal insects produce appendages from embryonic limb buds. Therefore, the universality of the Drosophila limb PD axis specification mechanism has been debated since dpp expression in more basal insect species differs dramatically from Drosophila. Here, we test the function of Wnt signaling in the development of the milkweed bug Oncopeltus fasciatus, a species with the basal state of appendage development from limb buds. RNA interference of wg and pangolin (pan) produce defects in the germband and eyes, but not in the appendages. Distal-less and dachshund, two genes regulated by Wg signaling in Drosophila and expressed in specific PD domains along the limbs of both species, are expressed normally in the limbs of pan-depleted Oncopeltus embryos. Despite these apparently paradoxical results, Armadillo protein, the transducer of Wnt signaling, does not accumulate properly in the nuclei of cells in the legs of pan-depleted embryos. In contrast, engrailed RNAi in Oncopeltus produces cuticular and appendage defects similar to Drosophila. Therefore, our data suggest that Wg signaling is functionally conserved in the development of the germband, while it is not essential in the specification of the limb PD axis in Oncopeltus and perhaps basal insects.

  17. Identifying the best season for mapping evergreen swamp and mangrove species using leaf-level spectra in an estuarine system in KwaZulu-Natal, South Africa

    CSIR Research Space (South Africa)

    Van Deventer, Heidi

    2014-10-01

    Full Text Available would provide the best discrimination of six evergreen tree species, associated with swamp (Ficus Trichopoda), mangrove (Avicennia marina, Bruguiera gymnorrhiza, Hibiscus tiliaceus), wetlands in adjacent woodlands (Syzygium cordatum) and coastal...

  18. Hydrography - HYDROGRAPHY_HIGHRES_WATERBODYDISCRETE_NHD_USGS: Lakes, Ponds, Reservoirs, Swamps, and Marshes in Watersheds of Indiana (U. S. Geological Survey, 1:24,000, Polygon Shapefile)

    Data.gov (United States)

    NSGIC State | GIS Inventory — HYDROGRAPHY_HIGHRES_WATERBODYDISCRETE_NHD_USGS.SHP is a polygon shapefile that contains features of lakes, ponds, reservoirs, swamps and marshes in watersheds in and...

  19. TALL HERB SPRUCE FORESTS AS CLIMAX COMMUNITIES ON LOWLAND SWAMPS OF BRYANSK POLESIE

    Directory of Open Access Journals (Sweden)

    O. I. Evstigneev

    2017-09-01

    Full Text Available Nettle grey alder forests are a dominant forest type on lowland swamps in the Bryansk Polesie. They are formed as a result of repeated cuttings in the place of tall herb spruce forests. Tall herb spruce forests are very rare communities in the vegetation cover in this area due to clear cutting, melioration and peat extraction. An assessment of the succession status of tall herb spruce forests and nettle grey alder forests was carried out in this paper. The criteria of climax state and succession state of communities, developed for Eastern European forests, were used. These criteria are based on the degree of intensity of the following signs in the community: 1 the completeness of species composition of tree synusia; 2 the ontogenetic structure of tree species cenopopulation; 3 the gap-mosaic stand structure; 4 the diversity of microsites in soil cover; 5 the completeness of species composition and ecological-coenotic diversity of vascular species. We showed that tall herb spruce forest, as opposed to black alder forest, is close to communities of the climax type. This is evidenced by the following features of cenosis: firstly, all tree species in the area that covers the Bryansk Polesie and that are able to grow on lowland swamps are represented in the spruce forest (Alnus glutinosa, Betula pubescens, Fraxinus excelsior, Padus avium, Picea abies, Salix pentandra, Sorbus aucuparia, Ulmus glabra. Secondly, a steady turnover of generations is carried out in the cenopopulations of main edificators (Picea abies and Alnus glutinosa. This is evidenced by the complete and left-sided structure of their ontogenetic spectrum. Thirdly, a system of asynchronously developing gaps (parcels, which are formed on the site of old tree falls, is formed in the community. This ensures the continuous renewal of spruce and alder populations and creates conditions for the regeneration of other tree species. Fourthly, the structure of biogenic microsites has been formed

  20. CONSIDERATIONS ON THE ANTHROPIC IMPACT IN THE AREA OF THE ORNITHOLOGIC RESERVATION “THE SWAMPS FROM SATCHINEZ” (TIMIŞ COUNTY

    Directory of Open Access Journals (Sweden)

    Rodica Török-Oance

    2005-01-01

    Full Text Available The estimate of the anthropic impact within the Ornithologic Reservation Swamps from Satchinez is based on the field notes in the period 2003-2005, the air photos taken in 2004 and the reconstitution of past situations (1963-1973 using the photoplans from that period. Within the reservation and the buffer area a series of anthropic activities are taking place, allowed or not, which have a negative impact on the protected area: agricultural works (including agro-chemical treatments, grazing, mowing, hydrotechnical arrangements, illegal tree felling, cutting and burning the reed, poaching, hunting and fishing, collecting biological material, transport, tourism and petrol exploitation. All these lead to the deterioration of the habitat, affect the life of the birds, the water, the clogging of the swamp and cause the disappearance of the clean water spots thus endangering the reservation itself.

  1. Seed germination studies on Gymnacranthera canarica (King Warb. - a Vulnerable tree species of a highly threatened Myristica swamp ecosystem

    Directory of Open Access Journals (Sweden)

    K. Keshavachandra

    2016-07-01

    Full Text Available Gymnacranthera canarica (King Warb. is an exclusive Myristica swamp species endemic to the Western Ghats.  The Myristica swamp is a Critically Endangered ecosystem.  Studies were carried out to assess the viability, germination and storage behaviour of Gymnacranthera canarica seeds.  In the present study, it was observed that seeds have shown an initiation of germination after two weeks.  A maximum of 90% germination was recorded when the initial moisture content was 38.04 ± 1.75 %.  A decreased percentage (3% was observed when the moisture content reached 14.26 ± 2.3 after 70 days of storage.  Seeds failed to germinate beyond this moisture level.  A desiccation study showed recalcitrant behaviour and seeds can be stored in lab conditions for up to two and half months.

  2. Stable carbon isotope composition of organic material and carbonate in sediment of a swamp and lakes in Honshu island, Japan

    International Nuclear Information System (INIS)

    Ishizuka, Toshio

    1978-01-01

    Recent sediments from a swamp and lakes in Honshu were analyzed for organic carbon and carbonate contents, and stable isotope ratios of carbon in the organic materials and carbonate. delta C 13 values of the carbonate tend to be distinctly larger than those of organic carbon in reducing condition as natural gas field, whereas in oxidizing SO 4 -reducing conditions, they are slightly larger than those of organic carbon within the limited range of a few per mil. Carbon isotopic compositions of organic carbon in sediment of the swamp, Obuchi-numa, were analyzed and compared with habitat analysis of associated fossil diatoms. deltaC 13 values of organic carbon in the sediment vary in correlation with the species abundance in habitat of the associated fossil diatoms, ranging from fresh-water (-0.0282) to coastal marine (-0.0236) via brackish. (auth.)

  3. Vesicular-arbuscular mycorrhizal status of plant species in the peat swamp forest of Setia Alam Jaya, Sebangau, Central Kalimantan

    Directory of Open Access Journals (Sweden)

    Suciatmih Suciatmih

    2003-06-01

    Full Text Available In order to describe the vesicular-arbuscular mycorrhizal (VAM status of plants growing on peat soil, a study was carried out inthe peat swamp forest of Setia Alam Jaya in Sebangau, Central Kalimantan. Out of 146 plant root samples belonging to 48 plantspecies from 25 families examined, all plants colonized by VAM fungi namely 14 (29.2% high level, 32 (66.7% medium level, and 2(4.1% low level respectively.

  4. Vesicular-arbuscular mycorrhizal status of plant species in the peat swamp forest of Setia Alam Jaya, Sebangau, Central Kalimantan

    OpenAIRE

    Suciatmih Suciatmih

    2003-01-01

    In order to describe the vesicular-arbuscular mycorrhizal (VAM) status of plants growing on peat soil, a study was carried out inthe peat swamp forest of Setia Alam Jaya in Sebangau, Central Kalimantan. Out of 146 plant root samples belonging to 48 plantspecies from 25 families examined, all plants colonized by VAM fungi namely 14 (29.2%) high level, 32 (66.7%) medium level, and 2(4.1%) low level respectively.

  5. The Munchausen paradigm for deprived neighbourhoods: pulling yourself out of the swamp of deprivation

    Directory of Open Access Journals (Sweden)

    Jeannette Nijkamp

    2017-06-01

    Full Text Available The Munchausen paradigm for deprived neighbourhoods: pulling yourself out of the swamp of deprivation Since the 1980s, many initiatives have attempted to tackle the deprivation currently experienced in South Rotterdam. Efforts have been made to attract creative workers and, in a counter-reaction, other initiatives have aimed to encourage the creative talents of poorer residents to strengthen their economic position. One example of this is Freehouse, which has established projects in the Afrikaanderwijk, including a neighbourhood cooperative. Our article addresses two questions: 1 What are the effects of the Freehouse projects on the economic position of residents of the Afrikaanderwijk? and 2 Which insights do our results provide into the possible effects of local government policies that rely on citizens playing an active role? Although the economic effects of the projects were limited, our study reveals that citizens’ initiatives, such as the Afrikaander Cooperative, can help residents gain employment. In order to succeed, these initiatives should not be hindered by obstructive regulations, and they should include input from the residents who function as staff. However, in deprived neighbourhoods, many residents require support to be able to contribute to citizens’ initiatives, and cannot be expected to act like Baron Münchausen and pull themselves out of the swamp of deprivation by their own hair. Het Münchausen paradigma voor achterstandswijken: jezelf uit het moeras van achterstand trekken Sinds de jaren 80 hebben veel initiatieven geprobeerd het achterstandsniveau in Rotterdam Zuid te verminderen. Verschillende initiatieven waren gericht op het aantrekken van creatieve professionals. Als tegenreactie stimuleerden andere initiatieven de creatieve talenten van arme wijkbewoners teneinde hun economische positie te versterken. Een voorbeeld hiervan is Freehouse, dat projecten in de Afrikaanderwijk startte, waaronder de oprichting van

  6. American black bears and bee yard depredation at Okefenokee Swamp, Georgia

    Science.gov (United States)

    Clark, J.D.; Dobey, S.; Masters, D.V.; Scheick, B.K.; Pelton, M.R.; Sunquist, M.E.

    2005-01-01

    We studied American black bears (Ursus americanus), on the northwest periphery of Okefenokee Swamp in southeast Georgia, to assess landowner attitudes toward bears, estimate the extent of damage to commercial honey bee operations by bears, and evaluate methods to reduce bear depredations to apiaries. We collected 8,351 black bear radiolocations and identified 51 bee yards on our study area. Twenty-seven of 43 home ranges contained ≥1 bee yard, averaging 11.3 and 5.1 bee yards/home range of males (n = 7) and females (n = 20), respectively. From 1996 to 1998, we documented 7 instances of bears raiding bee yards within our study area and 6 instances in adjacent areas. All but 1 of the 13 raided yards were enclosed by electric fencing. In the 12 cases of damage to electrically fenced yards, however, the fences were not active because of depleted batteries. Based on compositional analysis, bear use of areas 800–1,400 m from bee yards was disproportionately greater than use 0–800 m from bee yards. Bears disproportionately used bay (red bay: Persea borbonia, loblolly bay: Gordonia lasianthus, and southern magnolia: Magnolia virginia), gum (water tupelo: Nyssa aquatic and black gum: N. sylvatica), and cypress (Taxodium spp.) and loblolly bay habitats, however, compared with slash pine (Pinus elliottii) or pine–oak (Quercus spp.), where bee yards usually were placed. The distribution of bear radiolocations likely reflected the use of those swamp and riparian areas, rather than avoidance of bee yards. Distances to streams from damaged bee yards (x̄ = 1,750 m) were less than from undamaged yards (x̄ = 4,442 m), and damaged bee yards were closer to unimproved roads (x̄ = 134 m) than were undamaged bee yards (x̄ = 802 m). Our analysis suggests that bee yard placement away from bear travel routes (such as streams and unimproved roads) can reduce bear depredation problems. Our results strongly indicate that working electric fences are effective deterrents to bear

  7. Structure of the tree stratum of three swamp forest communities in southern Brazil under different soil conditions

    Directory of Open Access Journals (Sweden)

    Luciana Carla Mancino

    2015-03-01

    Full Text Available Restinga forests are commonly known to be plant communities rather poor in tree species. This study aimed to describe and explain the association between the floristic-structural similarities and the environmental conditions in three Swamp Restinga Forest communities in southern Brazil. In 13 plots of 100 m2 each, we sampled all individual trees (circumference at breast height >12 cm and height ≥3 m. We collected soil samples in each plot for chemical and textural analyses. Phytosociological parameters were calculated and different structural variables were compared between areas. The density of individuals did not differ between areas; however, the maximum height and abundance of species differed between the site with Histosols and the other two sites with Gleysols. Further, a canonical correspondence analysis based on a matrix of vegetation and that of environmental characteristics explained 31.5% of the total variation. The high floristic and environmental heterogeneity indicate that swamp-forests can shelter many species with low frequency. Most species were generalists that were not exclusive to this type of forest. Overall, our study showed that swamp-forests within the same region can show considerable differences in composition and structure and can include species-rich communities, mostly due to the presence of species with a broader distribution in the Atlantic Rainforest domain on sites with less stressful environmental conditions and without waterlogged conditions.

  8. Prevalence and intensity of third stage Gnathostoma spinigerum larvae in swamp eels sold in three large markets in Bangkok, Thailand.

    Science.gov (United States)

    Saksirisampant, Wilai; Nuchprayoon, Surang; Wiwanitkit, Viroj; Kraivichian, Kanyarat; Suwansaksri, Jamsai

    2002-01-01

    Gnathostoma spinigerum is a common human tissue parasite in Thailand. The swamp eel is the major intermediate or paratenic host for this parasite. The high prevalence of the infective third stage larvae (L3) of this parasite in the rainy season has been noted in previous studies. During June 1999 (rainy season), we performed a cross-sectional survey of the prevalence and the intensity of G. spinigerum L3s in the livers of swamp eels that were obtained from three large Bangkok markets (Klong Toey, Pran Nok, and Tevej). Of a total of 785 livers, G. spinigerum L3s were found in 97: an infection rate of 12%. The prevalence rates in Klong Toey, Pran Nok, and Tevej markets were 13%, 10% and 14% respectively. There was no significant difference in the proportion of infected eels between the markets (p > 0.05). The intensity of L3 burden in the livers ranged from 1-17 larvae, with an average of 2.60 +/- 0.24 larvae (mean +/- SE). In this study a high prevalence of G. spinigerum L3s was found; there was no significant difference in the intensity of larvae in swamp eels between markets. These findings emphasize the importance of public health education: people need to be aware of the dangers of consuming raw or undercooked food.

  9. Assessment of semen quality in Swamp Buffalo AI Bulls in Thailand

    Directory of Open Access Journals (Sweden)

    S. Koonjaenak

    2010-02-01

    Full Text Available Characteristic of Thai swamp buffalo bulls semen used for artificial insemination (AI in Thailand, aspects relevance in freezing and thawing of semen are review. Semen and sperm characteristics were evaluated included sperm count, motility (assessed subjectively and by CASA, morphology (using phase-contrast light microscopy and SEM, plasma membrane integrity (PMI (using a hypo-osmotic swelling test [HOST] and SYBR- 14/propidium iodide [PI], plasma membrane stability (PMS (using Annexin-V/PI and deoxyribonucleic acid (DNA integrity (using SCSA and flow cytometry [FCM]. The average ejaculate volume was about 3.0–4.0 mL, with good viability (PMI measured by the HOST and motility (>65% and >70%, respectively. Sperm concentration ranged from 1.1 to 1.2 billion/mL, being also affected by bull age. Whereas semen quality (including sperm output, pH and initial sperm motility did not differ between the seasons. Few spermatozoa (<15%/ ejaculate had abnormal morphology with abnormalities resembling those in other bovidae. In FT semen, PMI (using SYBR-14/PI and PMS were highest in winter. Across seasons, ~50% of post-thaw spermatozoa depicted linear motility, a proportion that decreased to ~35% during incubation (38oC for 60 minutes, without marking any seasonal difference. The sperm DNA was hardly damaged (with <3% fragmentation, expressed as DNA fragmentation index [DFI], among seasons.

  10. Waste drilling-fluid-utilising microorganisms in a tropical mangrove swamp oilfield location

    International Nuclear Information System (INIS)

    Benka-Coker, M.O.; Olumagin, A.

    1995-01-01

    Waste drilling-fluid-utilising microorganisms were isolated from drilling-mud cuttings, soil and creek water from a mangrove swamp oilfield location in the Delta area of Nigeria using waste drilling-fluid as the substrate. Eighteen bacterial isolates obtained were identified as species of Staphylococcus, Acinetobacter, Alcaligenes, Serratia, Clostridium, Enterobacter, Klebsiella, Nocardia, Bacillus, Actinomyces, Micrococcus and Pseudomonas, while the genera of fungi isolated were Penicillium, Cladosporium and Fusarium. Even though drilling-fluid-utilising genera were in higher numbers in the soil than in the two other sources examined, the percentages of the total heterotrophic bacteria that utilised waste drilling-fluid were 6.02 in the drilling-mud cuttings, 0.83 in creek water and 0.42 in soil. The screen tests for biodegradation potential of the bacterial isolates showed that, even though all the isolates were able to degrade and utilise the waste fluid for growth, species of Alcaligenes and Micrococcus were more active degraders of the waste. The significance of the results in environmental management in oil-producing areas of Nigeria is discussed. (Author)

  11. Substantial improvements not seen in health behaviors following corner store conversions in two Latino food swamps

    Directory of Open Access Journals (Sweden)

    Alexander N. Ortega

    2016-05-01

    Full Text Available Abstract Background The effectiveness of food retail interventions is largely undetermined, yet substantial investments have been made to improve access to healthy foods in food deserts and swamps via grocery and corner store interventions. This study evaluated the effects of corner store conversions in East Los Angeles and Boyle Heights, California on perceived accessibility of healthy foods, perceptions of corner stores, store patronage, food purchasing, and eating behaviors. Methods Household data (n = 1686 were collected at baseline and 12- to 24-months post-intervention among residents surrounding eight stores, three of which implemented a multi-faceted intervention and five of which were comparisons. Bivariate analyses and logistic and linear regressions were employed to assess differences in time, treatment, and the interaction between time and treatment to determine the effectiveness of this intervention. Results Improvements were found in perceived healthy food accessibility and perceptions of corner stores. No changes were found, however, in store patronage, purchasing, or consumption of fruits and vegetables. Conclusions Results suggest limited effectiveness of food retail interventions on improving health behaviors. Future research should focus on other strategies to reduce community-level obesity.

  12. Characterization of Population Genetic Structure of red swamp crayfish, Procambarus clarkii, in China.

    Science.gov (United States)

    Yi, Shaokui; Li, Yanhe; Shi, Linlin; Zhang, Long; Li, Qingbin; Chen, Jing

    2018-04-03

    The red swamp crayfish (Procambarus clarkii) is one of the most economically important farmed aquatic species in China. However, it is also a famous invasive species in the world. This invasive species was dispersed most via human activities including intentional or unintentional carry in China. Thus, P. clarkii naturally distributed in China provides us a desirable mode to investigate the genetic structure of an invasive species dispersed mainly by human-mediated factors. To reveal the impact of human-mediated dispersal on genetic structure of P. clarkii in China, a total of 22,043 genome-wide SNPs were obtained from approximately 7.4 billion raw reads using 2b-RAD technique in this study. An evident pattern of population genetic structure and the asymmetrical migrational rates between different regions were observed with 22 populations based on these SNPs. This study provide a better understanding of the population genetic structure and demographic history of P. clarkii populations in China, inferring that anthropogenic factors (aquaculture or by accident) and ecological factors (e.g., complicated topography and climatic environment), as well as its special biological traits could account for the current population structure pattern and dispersal history of P. clarkii.

  13. Determination of endocrine patterns and their applications in the swamp buffalo

    International Nuclear Information System (INIS)

    Kamonpatana, M.

    1984-01-01

    The introduction of AI in swamp buffalo breeding has made hormonal measurement and treatment an important area of research. Hormonal regulation of buffalo reproduction is becoming an increasingly important tool for monitoring genetic progress and productivity. The development of immunoassay techniques for measuring progesterone was quickly identified as a suitable tool for monitoring the reproductive status of the water buffalo. Progesterone profiles during the oestrous cycle, pregnancy, parturition and post partum have been established. A knowledge of progesterone levels has helped to improve clinical skills in determining reproductive status. Attempts have been made to understand the role of gonadotrophins during these reproductive stages, to advance the onset of postpartum cyclicity, and to characterize the weak signs of oestrus. Peripartal changes of oestrone and prostaglandin have been monitored. Endocrinological methods for oestrus synchronization have been developed and applied and oestrone sulphate and progesterone have been used to assess pregnancy status and a rapid pregnancy test has been utilized to maximize reproductive efficiency in ranch-type breeding herds. In the male attempts have been made to clarify the testicular testosterone secretory capacity and the possible relationships between testosterone secretion, libido, semen characteristics and the influence of season. Within the context of long-term improvement, these studies should help to decrease calving intervals, improve heat and non-pregnancy detection, and allow for subfertility discrimination and sire selection with consequent increases in milk and meat production and draught power. (author)

  14. Firing Room Remote Application Software Development & Swamp Works Laboratory Robot Software Development

    Science.gov (United States)

    Garcia, Janette

    2016-01-01

    The National Aeronautics and Space Administration (NASA) is creating a way to send humans beyond low Earth orbit, and later to Mars. Kennedy Space Center (KSC) is working to make this possible by developing a Spaceport Command and Control System (SCCS) which will allow the launch of Space Launch System (SLS). This paper's focus is on the work performed by the author in her first and second part of the internship as a remote application software developer. During the first part of her internship, the author worked on the SCCS's software application layer by assisting multiple ground subsystems teams including Launch Accessories (LACC) and Environmental Control System (ECS) on the design, development, integration, and testing of remote control software applications. Then, on the second part of the internship, the author worked on the development of robot software at the Swamp Works Laboratory which is a research and technology development group which focuses on inventing new technology to help future In-Situ Resource Utilization (ISRU) missions.

  15. High methane emissions from restored Norway spruce swamps in southern Finland over one growing season

    Directory of Open Access Journals (Sweden)

    M. Koskinen

    2016-02-01

    Full Text Available Forestry-drained peatlands in the boreal region are currently undergoing restoration in order to bring these ecosystems closer to their natural (undrained state. Drainage affects the methane (CH4 dynamics of a peatland, often changing sites from CH4 sources to sinks. Successful restoration of a peatland would include restoration of not only the surface vegetation and hydrology, but also the microbial populations and thus CH4 dynamics. As a pilot study, CH4 emissions were measured on two pristine, two drained and three restored boreal spruce swamps in southern Finland for one growing season. Restoration was successful in the sense that the water table level in the restored sites was significantly higher than in the drained sites, but it was also slightly higher than in the pristine sites. The restored sites were surprisingly large sources of CH4 (mean emissions of 52.84 mg CH4 m-2 d-1, contrasting with both the pristine (1.51 mg CH4 m-2 d-1 and the drained sites (2.09 mg CH4 m-2 d-1. More research is needed to assess whether the high CH4 emissions observed in this study are representative of restored spruce mires in general.

  16. Is the herb-shrub composition of veredas (Brazilian palm swamps distinguishable?

    Directory of Open Access Journals (Sweden)

    Diogo Pereira da Silva

    2017-11-01

    Full Text Available ABSTRACT Vereda (Brazilian palm swamp is a poorly known savannic phytophysiognomy that occurs on moist soils with high herb-shrub floristic richness. This study aimed to document the herb-shrub species of veredas of the Estação Ecológica Serra Geral do Tocantins - EESGTO, and compare this flora with other veredas in Brazil. Furthermore, we assessed the similarity of the herb-shrub flora of the studied veredas with that of inventories of other savannas and grasslands in order to evaluate whether veredas possess an exclusive flora. Ordination analysis was performed to understand the floristic relationship among these areas. We recorded 213 species, 105 genera and 49 families at EESGTO, including five new floral records for the Cerrado and 78 for the state of Tocantins. The floristic similarity among veredas at EESGTO and the other sites was low. For all sites, a total of 1,324 species were recorded, of which 342 were unique to veredas and 187 unique to moist grasslands (campos limpos úmidos. After reviewing databases, 14.3 % of these species remained exclusive to veredas and moist grasslands. The ordination analysis indicated a gradient in floristic composition from wet to dry phytophysiognomies. In conclusion, we recognize a flora that distinguishes veredas from other Cerrado phytophysiognomies.

  17. Comparative Proteomic Analysis of Mature and Immature Oocytes of the Swamp Buffalo (Bubalus bubalis

    Directory of Open Access Journals (Sweden)

    Qiang Fu

    2016-01-01

    Full Text Available Maternal protein components change markedly during mammalian oogenesis. Many of these proteins have yet to be characterized and verified. In this study, a proteomics approach was used to evaluate changes in proteins during oogenesis in the Swamp Buffalo (Bubalus bubalis. Proteins from 500 immature oocytes and 500 in vitro matured oocytes were subjected to two-dimensional electrophoresis, and more than 400 spots were detected. Image analysis indicated that 17 proteins were differentially expressed between the two groups. Eight proteins were identified by mass spectrometry. In mature oocytes, three proteins were down-regulated: major vault protein (MVP, N-acetyllactosaminide β-1,6-N-acetylglucosaminyl-transferase (GCNT-2, and gem-associated protein (GEMIN8, whereas five other proteins, heat shock protein (HSP60, Ras-responsive element-binding protein 1 (RREB-1, heat shock cognate 71 kDa protein (HSC71, hemoglobin subunit α (HBA, and BMP-2-inducible protein kinase (BMP-2K, were up-regulated. The expression profiles of HSP60 and GEMIN8 were further verified by Western blotting. The changes in HSP60 protein expression demonstrate the increasing need for mitochondrial protein importation to facilitate macromolecular assembly during oocyte maturation. The down-regulation of GEMIN8 production implies that RNA splicing is impaired in mature oocytes.

  18. A pilot village study to improve Philippine swamp buffalo production using nuclear techniques

    International Nuclear Information System (INIS)

    Alejandrino, A.L.; Alcantara, J.; Eduardo, S.

    1990-01-01

    An integrated Philippine village study on carabao (swamp buffalo) production was conducted in a pilot village. The quasi-experimental design was adopted in two areas designated 'with project' (W/P) and 'without project' (W/OP). The farmers' demographic and socio-economic characteristics, livestock management practices and carabao production were monitored during the baseline phase (18 months) and the intervention phase (24 months). The progesterone levels in milk and serum were measured by radioimmunoassay to assess the reproductive status of the carabaos. The improved management scheme for the intervention period consisted of urea + molasses in drinking water, a routine health programme of deworming and vaccination, and breeding by artificial insemination or natural mating. The level of parasitism was low and was mainly caused by infection with Fasciola sp. and amphistomes. Intermediate snail hosts infected with these parasites were found in the study area. Coccidial oocysts and eggs of Mecistocirrus digitatus were occasionally present in the faecal samples. Reproductive traits were improved in both areas during the intervention phase, with the animals in the W/OP area showing a higher increase in pregnancy rate (57.6%) than those in the W/P area (53.7%); however, the increase in the calving rate and calf survival were greater in the W/P area (45.5% and 100%, respectively) than those in the W/OP area (37% and 94.1%, respectively). (author). 10 refs, 3 figs

  19. Nitrogen fate in a subtropical mangrove swamp: Potential association with seawater-groundwater exchange.

    Science.gov (United States)

    Xiao, Kai; Wu, Jiapeng; Li, Hailong; Hong, Yiguo; Wilson, Alicia M; Jiao, Jiu Jimmy; Shananan, Meghan

    2018-04-18

    Coastal mangrove swamps play an important role in nutrient cycling at the land-ocean boundary. However, little is known about the role of periodic seawater-groundwater exchange in the nitrogen cycling processes. Seawater-groundwater exchange rates and inorganic nitrogen concentrations were investigated along a shore-perpendicular intertidal transect in Daya Bay, China. The intertidal transect comprises three hydrologic subzones (tidal creek, mangrove and bare mudflat zones), each with different physicochemical characteristics. Salinity and hydraulic head measurements taken along the transect were used to estimate the exchange rates between seawater and groundwater over a spring-neap tidal cycle. Results showed that the maximum seawater-groundwater exchange occurred within the tidal creek zone, which facilitated high-oxygen seawater infiltration and subsequent nitrification. In contrast, the lowest exchange rate found in the mangrove zone caused over-loading of organic matter and longer groundwater residence times. This created an anoxic environment conducive to nitrogen loss through the anammox and denitrification processes. Potential oxidation rates of ammonia and nitrite were measured by the rapid and high-throughput method and rates of denitrification and anammox were measured by the modified membrane inlet mass spectrometry (MIMS) with isotope pairing, respectively. In the whole transect, denitrification accounted for 90% of the total nitrogen loss, and anammox accounted for the remaining 10%. The average nitrogen removal rate was about 2.07g per day per cubic meter of mangrove sediments. Copyright © 2018 Elsevier B.V. All rights reserved.

  20. Waste drilling-fluid-utilising microorganisms in a tropical mangrove swamp oilfield location

    Energy Technology Data Exchange (ETDEWEB)

    Benka-Coker, M.O.; Olumagin, A. [Benin Univ. (Nigeria). Dept. of Microbiology

    1995-12-31

    Waste drilling-fluid-utilising microorganisms were isolated from drilling-mud cuttings, soil and creek water from a mangrove swamp oilfield location in the Delta area of Nigeria using waste drilling-fluid as the substrate. Eighteen bacterial isolates obtained were identified as species of Staphylococcus, Acinetobacter, Alcaligenes, Serratia, Clostridium, Enterobacter, Klebsiella, Nocardia, Bacillus, Actinomyces, Micrococcus and Pseudomonas, while the genera of fungi isolated were Penicillium, Cladosporium and Fusarium. Even though drilling-fluid-utilising genera were in higher numbers in the soil than in the two other sources examined, the percentages of the total heterotrophic bacteria that utilised waste drilling-fluid were 6.02 in the drilling-mud cuttings, 0.83 in creek water and 0.42 in soil. The screen tests for biodegradation potential of the bacterial isolates showed that, even though all the isolates were able to degrade and utilise the waste fluid for growth, species of Alcaligenes and Micrococcus were more active degraders of the waste. The significance of the results in environmental management in oil-producing areas of Nigeria is discussed. (Author)

  1. EXPERIMENTAL EVIDENCE FOR HOMING IN THE RED SWAMP CRAYFISH, PROCAMBARUS CLARKII

    Directory of Open Access Journals (Sweden)

    BARBARESI S.

    2006-01-01

    Full Text Available The red swamp crayfish, Procambarus clarkii, is an efficient burrower, but its burrow fidelity has been recently questioned. In this study, we aimed at investigating whether individuals of this species are capable to learn the position of a goal (a wet burrow hidden to their sight in experimental tanks and to make more efficient with time their oriented movement towards it. We also analyzed crayfish behavior after having closed one of the two accesses to the goal. Indeed, in successive trials we recorded the crayfish tendency to reduce the distance covered to reach the goal and the time taken, except when they were already familiar to the experimental setting. Memory of the spatial configuration lasted for 16 hours at least and crayfish learned and maintained individual trajectories. The interruption of their usual path always caused a drastic increase of distance and time that however decreased in the successive trials. This study provided also some information of the sensory channels used by P. clarkii to orient. This crayfish, which can be active also during daytime, seemed to adopt a combination of tactile and visual information, together with the possible use of cues (i.e. humidity cues emitted by the goal. Future studies should clarify the paradox of a crayfish species whose individuals, although being physiologically capable to home, seem not to return to the previously occupied burrows at the end of their foraging excursions, notwithstanding the time and energy expended to excavate them.

  2. Impact of logging on a mangrove swamp in South Mexico: cost / benefit analysis

    Directory of Open Access Journals (Sweden)

    Cristian Tovilla Hernández

    2001-06-01

    Full Text Available Environmental changes caused by logging in a mangrove swamp were studied in Barra de Tecoanapa, Guerrero, Mexico. Original forest included Rhizophora mangle, Laguncularia racemosa, Avicennia germinans and halophytic vegetation, and produced wood (164.03 m3/ha and organic matter (3.9 g/m2/day. A total of 3.5 tons of wood per year were harvested from this area. Later, an average of 2 555 kg of maize per planting cycle were obtained (market value of 88 USD. Succession when the area was abandoned included strictly facultative and glycophyte halophytes (16 families, Cyperaceae and Poaceae were the best represented. After logging, temperatures increased 13 °C in the soil and 11°C in the air, whereas salinity reached 52 psu in the dry season. These modified soil color and sand content increased from 42.6 to 63.4%. Logging was deleterious to species, habitat, biogeochemical and biological cycles, organic matter production, seeds, young plants, genetic exchange conservation of soil and its fertility, coastal protection, and aesthetic value; 3 000 m2 had eroded as the river advanced towards the deforested area (the cost/benefit analysis showed a ratio of 246: 1. There was long-term economic loss for the community and only 30% of the site has recovered after five years.

  3. Draining the swamp while making America great: senior dissonance in the age of Trump.

    Science.gov (United States)

    Hudson, Robert B

    2018-04-13

    In his surprise election as President, Donald Trump enjoyed disproportionate electoral support from older voters, many of whom saw in Trump a person who would work to reverse demographic, economic, and cultural forces that had transformed American life as they had long seen it. Yet, Trump's campaign and incumbency has also been very much about gutting the Washington policy establishment of officials, bureaucrats, and lobbyists (aka, the Swamp) which, for over half a century, has been instrumental in enacting and expanding legislation that has benefitted older Americans, far more than any other social policy constituency in the country. This article contrasts the value-oriented electoral support Trump enjoyed from older Americans with their interest concerns centered on policies such as the Affordable Care Act, Medicaid, and a host of smaller grant-in-aid programs. It then reviews the strong institutional base seniors and their advocates have in Washington, posing whether interest-oriented concerns may outweigh ideological ones as policy options emerge from a Republican-controlled government prior to the 2018 elections.

  4. Monticellia ophisterni n. sp. (Cestoda: Monticelliidae) from the swamp-eel Ophisternon aenigmaticum (Synbranchiformes) from Mexico.

    Science.gov (United States)

    Scholz, T; de Chambrier, A; Salgado-Maldonado, G

    2001-12-01

    Monticellia ophisterni n. sp. is described from the swamp-eel Ophisternon aenigmaticum Rosen and Greenwood (Synbranchiformes: Synbranchidae) from Lake Catemaco, Veracruz, Mexico. The new species is placed into Monticellia because of the cortical position of the testes, ovary, and uterus. It differs from other Monticellia species (with the exception of Monticellia magna (Rego, Santos and Silva, 1974)) in the position of longitudinal musculature that crosses the vitelline follicles, making them paramuscular. The new species can be distinguished from M. magna--which possesses a similar number of testes (107-139), paramuscular vitelline follicles, and numerous gland cells distributed between the apex of the scolex and suckers--in the position of the genital pore (8-21% vs. 19-27%), in the presence of a weak internal longitudinal musculature, in the arrangement of the testes in the median field, and in the absence of a vaginal sphincter. This is the first proteocephalidean tapeworm reported from a synbranchid fish and the first species of Monticellia found in North America.

  5. Palm Swamp Wetland Ecosystems of the Upper Amazon: Characterizing their Distribution and Inundation State Using Multiple Resolution Microwave Remote Sensing

    Science.gov (United States)

    Podest, E.; McDonald, K. C.; Schröder, R.; Pinto, N.; Zimmermann, R.; Horna, V.

    2011-12-01

    Palm swamp wetlands are prevalent in the Amazon basin, including extensive regions in northern Peru. These ecosystems are characterized by constant surface inundation and moderate seasonal water level variation. The combination of constantly saturated soils, giving rise to low oxygen conditions, and warm temperatures year-round can lead to considerable methane release to the atmosphere. Because of the widespread occurrence and expected sensitivity of these ecosystems to climate change, knowledge of their spatial extent and inundation state is crucial for assessing the associated land-atmosphere carbon exchange. Precise spatio-temporal information on palm swamps is difficult to gather because of their remoteness and difficult accessibility. Spaceborne microwave remote sensing is an effective tool for characterizing these ecosystems since it is sensitive to surface water and vegetation structure and allows monitoring large inaccessible areas on a temporal basis regardless of atmospheric conditions or solar illumination. We are developing a remote sensing methodology using multiple resolution microwave remote sensing data to determine palm swamp distribution and inundation state over focus regions in the Amazon basin in northern Peru. For this purpose, two types of multi-temporal microwave data are used: 1) high-resolution (100 m) data from the Advanced Land Observing Satellite (ALOS) Phased Array L-Band Synthetic Aperture Radar (PALSAR) to derive maps of palm swamp extent and inundation from dual-polarization fine-beam and multi-temporal HH-polarized ScanSAR, and 2) coarse resolution (25 km) combined active and passive microwave data from QuikSCAT and AMSR-E to derive inundated area fraction on a weekly basis. We compare information content and accuracy of the coarse resolution products to the PALSAR-based datasets to ensure information harmonization. The synergistic combination of high and low resolution datasets will allow for characterization of palm swamps and

  6. TEMPORAL VEGETATION DYNAMICS IN PEAT SWAMP AREA USING MODIS TIME-SERIES IMAGERY: A MONITORING APPROACH OF HIGH-SENSITIVE ECOSYSTEM IN REGIONAL SCALE

    Directory of Open Access Journals (Sweden)

    Yudi Setiawan

    2016-10-01

    Full Text Available Peat swamp area is an essential ecosystem due to high vulnerability of functions and services. As the change of forest cover in peat swamp area has increased considerably, many studies on peat swamp have focused on forest conversion or forest degradation. Meanwhile, in the context of changes in the forestlands are the sum of several processes such as deforestation, reforestation/afforestation, regeneration of previously deforested areas, and the changing spatial location of the forest boundary. Remote sensing technology seems to be a powerful tool to provide information required following that concerns. A comparison imagery taken at the different dates over the same locations for assessing those changes tends to be limited by the vegetation phenology and land-management practices. Consequently, the simultaneous analysis seems to be a way to deal with the issues above, as a means for better understanding of the dynamics changes in peat swamp area. In this study, we examined the feasibility of using MODIS images during the last 14 years for detecting and monitoring the changes in peat swamp area. We identified several significant patterns that have been assigned as the specific peat swamp ecosystem. The results indicate that a different type of ecosystem and its response to the environmental changes can be portrayed well by the significant patterns. In understanding the complex situations of each pattern, several vegetation dynamics patterns were characterized by physical land characteristics, such as peat depth, land use, concessions and others. Characterizing the pathways of dynamics change in peat swamp area will allow further identification for the range of proximate and underlying factors of the forest cover change that can help to develop useful policy interventions in peatland management.

  7. Characterizing the Status (Disturbed, Hybrid or Novel) of Swamp Forest Fragments in a Caribbean Ramsar Wetland: The Impact of Anthropogenic Degradation and Invasive Plant Species.

    Science.gov (United States)

    Prospere, Kurt; McLaren, Kurt P; Wilson, Byron

    2016-10-01

    The last remaining Amazonian-type swamp forest fragments in Black River Lower Morass, Jamaica, have been subjected to a myriad of anthropogenic disturbances, compounded by the establishment and spread of several invasive plant species. We established 44 permanent sample plots (covering 3.92 ha) across 10 of these swamp forest fragments and sampled all non-woody plants and all trees ≥2 cm DBH found in the plots. These data were used to (1) identify thresholds of hybridity and novelty, (2) derive several diversity and structural descriptors used to characterize the swamp forest fragments and (3) identify possible indicators of anthropogenic degradation. These were incorporated into a framework and used to determine the status of the swamp forest fragments so that appropriate management and conservation measures can be implemented. We recorded 43 woody plant species (9 endemic, 28 native and 4 non-native) and 21 non-tree species. The composition and structure of all the patches differed significantly due to the impact of the herbaceous invasive plant Alpinia allughas, the presence and diversity of other non-native plants, and differing intensities of anthropogenic disturbance (e.g., burning, cutting and harvesting of non-timber forest products). We ranked forest patches along a continuum representing deviations from a historical proxy (least disturbed) swamp forest to those with dramatically altered structural and floristic attributes (=novel swamp forests). Only one fragment overrun with A. allughas was classified as novel. If effective conservation and management does not come to the BRLM, the remaining swamp forest fragments appear doomed to further degradation and will soon disappear altogether.

  8. Microwave-assisted enhancement of milkweed (Calotropis procera L.) leaves as an eco-friendly source of natural colorants for textile.

    Science.gov (United States)

    Hussaan, Muhammad; Iqbal, Naeem; Adeel, Shahid; Azeem, Muhammad; Tariq Javed, M; Raza, Ali

    2017-02-01

    Application of natural colorants to textile fabrics has gained worldwide public acceptance due to the hazardous nature of synthetic dyes. Present study investigated the microwave's mediated extraction of natural colorants from leaves of milkweed (Calotropis procera L.) as well as their application to cotton fabrics assisted with biochemical mordants. Dye extraction from C. procera leaves was carried out in various mediums (alkali and aqueous), and the extracted dye as well as cotton fabrics was irradiated with microwaves for 2, 4, 6, 8, or 10 min. Effect of various temperature regimes and sodium chloride (NaCl) concentrations was also evaluated on the color strength of dyed cotton fabrics. The results revealed that extraction of natural colorants was enhanced when microwave radiations were applied for 4 min by using alkali as an extraction medium as compared to aqueous one. Optimum dyeing of cotton fabrics was achieved by using NaCl at a temperature of 55 °C. Among the chemical mordants, iron was effective for better color strength when used as pre- and post-mordant. Among the studied bio-mordants, extract of Acacia nilotica bark significantly improved the color strength and fastness properties as pre-mordant and Curcuma longa tuber as post-mordant. It was concluded that extract of C. procera leaves was a potential source of natural colorants and a high level of dye was obtained upon irradiation of alkali-solubilized extract for 4 min. Application of NaCl at concentration of 3 g/100 mL and temperature treatment of 55 °C significantly improved the color strength of dyed cotton fabrics.

  9. Study of the sediment contamination levels in a mangrove swamp polluted by a marine oil spill

    International Nuclear Information System (INIS)

    Wong, T.W.Y.; Ke, L.; Wong, Y.S.; Tam, N.F.Y.

    2002-01-01

    The pattern of oil retention in mangrove sediments was studied in an effort to determine the temporal changes of petroleum hydrocarbon concentrations and composition several months after oil spills occur. Mangroves are inter-tidal wetlands in tropical and subtropical coastlines. Due to the anoxic and water logging characteristics of mangrove sediments, oil residues linger much longer in these wetlands compared to other coastal habitats. In November 2000, an accidental oil spill occurred in the Pearl River Estuary in which approximately 230,000 litres of crude oil was leaked from an oil tanker. The spilled oil migrated to the YiO, a typical mangrove swamp in Hong Kong Special Administrative Region. The degree of oil contamination in the sediments depended on the sediment texture and topography of the mangrove. The total petroleum hydrocarbon (TPH) concentration of the sediments in the most affected area near a freshwater creek flowing into the sea was 130 times higher than normal, one month after the accident. The mean TPH concentration was 2862 ug/g of dry sediment while the mean carbon preference index was 1.22 compared to the background value of 3.97. The temporal changes of the petroleum hydrocarbon level in 5 defined areas were examined for 7 months after the spill. The most polluted area next to the creek was determined to have very high TPH levels in the muddy sediments even 7 months after the spill. Oil residues infiltrated as deep as 20 cm into the sediments, making it more difficult to degrade than surface pollution and posing long-term adverse effects on trees in the area. It was determined that with growing industrialization and increasing demands for fuel and energy supply, mangroves in South China should be ranked as top priority for protection from oil spills. 19 refs., 6 tabs., 6 figs

  10. Dispositions of enrofloxacin and its major metabolite ciprofloxacin in Thai swamp buffaloes

    Science.gov (United States)

    RUENNARONG, Nitwarat; WONGPANIT, Kannika; SAKULTHAEW, Chainarong; GIORGI, Mario; KUMAGAI, Susumu; POAPOLATHEP, Amnart; POAPOLATHEP, Saranya

    2015-01-01

    Given the limited information available in this species, the aim of this study was to investigate the pharmacokinetic characteristics of enrofloxacin (ER) and its major metabolite ciprofloxacin (CP) in buffaloes, Bubalus bubalis. ER was administered intravenously (i.v.) or subcutaneously (s.c.) to buffaloes at doses of 5.0 and 7.5 mg/kg BW, and plasma, urine and fecal samples were collected until 48 hr post-administration. The concentrations of ER and CP in the plasma, urine and feces were analyzed using high-performance liquid chromatography equipped with a fluorescence detector. The plasma concentrations of ER and CP could be determined up to 24 hr and 32 hr after i.v. and s.c. administrations at doses of 5.0 and 7.5 mg/kg BW, respectively. CP concentrations were always lower than those of parental drug. The s.c. bioavailability of ER was 52.36 ± 4.24% and 72.12 ± 5.39% at doses of 5.0 and 7.5 mg/kg BW, respectively. Both ER and CP were detectable in urine and feces up to 24 hr. ER and CP were mainly excreted via the urine. Based on the pharmacokinetic data and PK-PD indices, s.c. administration of ER at doses of 5.0 and 7.5 mg/kg BW might be appropriate for the treatment of susceptible bacterial diseases in Thai swamp buffaloes. PMID:26596287

  11. A case study on fuel oil contamination in a mangrove swamp in Hong Kong

    Energy Technology Data Exchange (ETDEWEB)

    Tam, N.F.Y.; Wong, T.W.Y.; Wong, Y.S. [City University of Hong Kong, Kowloon (Hong Kong). Department of Biology

    2005-07-01

    Mangroves commonly found along tropical and subtropical coastlines are susceptible to oil pollution. In December 2000, around 500 1 m tall Kandelia candel saplings at the age of 3-5 years old located at the foreshore region of Sheung Pak Nai swamp, Hong Kong SAR, were found to be damaged by oil pollution. More than 80% of the saplings were either dead or washed away and leaving less than 5% healthy saplings with dense green leaves. Elevated concentrations of light n-alkanes (ranging from n-C{sub 14} to n-C{sub 20}), pristane and phytane were recorded in surface sediments collected in December 2000. The ratio between light and total n-alkanes was 0.4. The total petroleum hydrocarbons (60-80 {mu}g g{sup -1} TPH) and unresolved complex mixtures (60-70 {mu}g g{sup -1} UCM) were higher than the background values of other mangrove sediments in Hong Kong, which were 40 and 20 {mu}g g{sup -1}, respectively. In certain root zone sediments, TPH concentrations were above 1000 {mu}g g{sup -1}. These results suggest that surface sediments in Sheung Pak Nai were contaminated by petroleum oil, most likely by illegal discharge of fuel oil which occurred between 1998 and 2002. One year later, in December 2001, unhealthy saplings had recovered and re-grown. The concentrations of TPH and UCM in sediments declined to around 40 {mu}g g{sup -1}, pristane and phytane dropped by 80%, and the ratio of light to total n-alkanes was 0.15, suggesting that residual oil in sediments was weathered leading to a remarkable recovery of the unhealthy saplings. (author)

  12. Study of the sediment contamination levels in a mangrove swamp polluted by a marine oil spill

    Energy Technology Data Exchange (ETDEWEB)

    Wong, T.W.Y.; Ke, L.; Wong, Y.S.; Tam, N.F.Y. [City University of Hong Kong, Hong Kong SAR (China)

    2002-07-01

    The pattern of oil retention in mangrove sediments was studied in an effort to determine the temporal changes of petroleum hydrocarbon concentrations and composition several months after oil spills occur. Mangroves are inter-tidal wetlands in tropical and subtropical coastlines. Due to the anoxic and water logging characteristics of mangrove sediments, oil residues linger much longer in these wetlands compared to other coastal habitats. In November 2000, an accidental oil spill occurred in the Pearl River Estuary in which approximately 230,000 litres of crude oil was leaked from an oil tanker. The spilled oil migrated to the YiO, a typical mangrove swamp in Hong Kong Special Administrative Region. The degree of oil contamination in the sediments depended on the sediment texture and topography of the mangrove. The total petroleum hydrocarbon (TPH) concentration of the sediments in the most affected area near a freshwater creek flowing into the sea was 130 times higher than normal, one month after the accident. The mean TPH concentration was 2862 ug/g of dry sediment while the mean carbon preference index was 1.22 compared to the background value of 3.97. The temporal changes of the petroleum hydrocarbon level in 5 defined areas were examined for 7 months after the spill. The most polluted area next to the creek was determined to have very high TPH levels in the muddy sediments even 7 months after the spill. Oil residues infiltrated as deep as 20 cm into the sediments, making it more difficult to degrade than surface pollution and posing long-term adverse effects on trees in the area. It was determined that with growing industrialization and increasing demands for fuel and energy supply, mangroves in South China should be ranked as top priority for protection from oil spills. 19 refs., 6 tabs., 6 figs.

  13. High blood oxygen affinity in the air-breathing swamp eel Monopterus albus.

    Science.gov (United States)

    Damsgaard, Christian; Findorf, Inge; Helbo, Signe; Kocagoz, Yigit; Buchanan, Rasmus; Huong, Do Thi Thanh; Weber, Roy E; Fago, Angela; Bayley, Mark; Wang, Tobias

    2014-12-01

    The Asian swamp eel (Monopterus albus, Zuiew 1793) is a facultative air-breathing fish with reduced gills. Previous studies have shown that gas exchange seems to occur across the epithelium of the buccopharyngeal cavity, the esophagus and the integument, resulting in substantial diffusion limitations that must be compensated by adaptations in others steps of the O₂ transport system to secure adequate O₂ delivery to the respiring tissues. We therefore investigated O₂ binding properties of whole blood, stripped hemoglobin (Hb), two major isoHb components and the myoglobin (Mb) from M. albus. Whole blood was sampled using indwelling catheters for blood gas analysis and determination of O₂ equilibrium curves. Hb was purified to assess the effects of endogenous allosteric effectors, and Mb was isolated from heart and skeletal muscle to determine its O₂ binding properties. The blood of M. albus has a high O₂ carrying capacity [hematocrit (Hct) of 42.4±4.5%] and binds O₂ with an unusually high affinity (P₅₀=2.8±0.4mmHg at 27°C and pH7.7), correlating with insensitivity of the Hb to the anionic allosteric effectors that normally decrease Hb-O₂ affinity. In addition, Mb is present at high concentrations in both heart and muscle (5.16±0.99 and 1.08±0.19mg ∙ g wet tissue⁻¹, respectively). We suggest that the high Hct and high blood O₂ affinity serve to overcome the low diffusion capacity in the relatively inefficient respiratory surfaces, while high Hct and Mb concentration aid in increasing the O₂ flux from the blood to the muscles. Copyright © 2014 Elsevier Inc. All rights reserved.

  14. Sedimentology and ichnology of Neogene Coastal Swamp deposits in the Niger Delta Basin, Nigeria

    Directory of Open Access Journals (Sweden)

    Ezeh Sunny C.

    2016-09-01

    Full Text Available Often analyses of depositional environments from sparse data result in poor interpretation, especially in multipartite depositional settings such as the Niger Delta. For instance, differentiating channel sandstones, heteroliths and mudstones within proximal environments from those of distal facies is difficult if interpretations rely solely on well log signatures. Therefore, in order to achieve an effective and efficient interpretation of the depositional conditions of a given unit, integrated tools must be applied such as matching core descriptions with wireline log signature. In the present paper cores of three wells from the Coastal Swamp depositional belt of the Niger Delta are examined in order to achieve full understanding of the depositional environments. The well sections comprise cross-bedded sandstones, heteroliths (coastal and lower shoreface and mudstones that were laid down in wave, river and tidal processes. Interpretations were made from each data set comprising gamma ray logs, described sedimentological cores showing sedimentary features and ichnological characteristics; these were integrated to define the depositional settings. Some portions from one of the well sections reveal a blocky gamma ray well log signature instead of a coarsening-upward trend that characterises a shoreface setting while in other wells the signatures for heteroliths at some sections are bell blocky in shaped rather than serrated. Besides, heteroliths and mudstones within the proximal facies and those of distal facies were difficult to distinguish solely on well log signatures. However, interpretation based on sedimentology and ichnology of cores from these facies was used to correct these inconsistencies. It follows that depositional environment interpretation (especially in multifarious depositional environments such as the Niger Delta should ideally be made together with other raw data for accuracy and those based solely on well log signatures should

  15. How could a freshwater swamp produce a chemical signature characteristic of a saltmarsh?

    Science.gov (United States)

    McCloskey, Terrence; Smith, Christopher G.; Liu, Kam-biu; Marot, Marci E.; Haller, Christian

    2018-01-01

    Reduction–oxidation (redox) reaction conditions, which are of great importance for the soil chemistry of coastal marshes, can be temporally dynamic. We present a transect of cores from northwest Florida wherein radical postdepositional changes in the redox regime has created atypical geochemical profiles at the bottom of the sedimentary column. The stratigraphy is consistent along the transect, consisting of, from the bottom upward, carbonate bedrock, a gray clay, an organic mud section, a dense clay layer, and an upper organic mud unit representing the current saltwater marsh. However, the geochemical signature of the lower organic mud unit suggests pervasive redox reactions, although the interval has been identified as representing a freshwater marsh, an unlikely environment for such conditions. Analyses indicate that this discrepancy results from postdepositional diagenesis driven by millennial-scale environmental parameters. Rising sea level that led to the deposition of the capping clay layer, created anaerobic conditions in the freshwater swamp interval, and isolated it hydrologically from the rest of the sediment column. The subsequent infiltration of marine water into this organic material led to sulfate reduction, the buildup of H2S and FeS, and anoxic conditions. Continued sulfidation eventually resulted in euxinic conditions, as evidenced by elevated levels of Fe, S, and especially Mo, the diagnostic marker of euxinia. Because this chemical transformation occurred long after the original deposition the geochemical signature does not reflect soil chemistry at the time of deposition and cannot be used to infer syn-depositional environmental conditions, emphasizing the importance of recognizing diagenetic processes in paleoenvironmental studies.

  16. Deforestation projections for carbon-rich peat swamp forests of Central Kalimantan, Indonesia.

    Science.gov (United States)

    Fuller, Douglas O; Hardiono, Martin; Meijaard, Erik

    2011-09-01

    We evaluated three spatially explicit land use and cover change (LUCC) models to project deforestation from 2005-2020 in the carbon-rich peat swamp forests (PSF) of Central Kalimantan, Indonesia. Such models are increasingly used to evaluate the impact of deforestation on carbon fluxes between the biosphere and the atmosphere. We considered both business-as-usual (BAU) and a forest protection scenario to evaluate each model's accuracy, sensitivity, and total projected deforestation and landscape-level fragmentation patterns. The three models, Dinamica EGO (DE), GEOMOD and the Land Change Modeler (LCM), projected similar total deforestation amounts by 2020 with a mean of 1.01 million ha (Mha) and standard deviation of 0.17 Mha. The inclusion of a 0.54 Mha strict protected area in the LCM simulations reduced projected loss to 0.77 Mha over 15 years. Calibrated parameterizations of the models using nearly identical input drivers produced very different landscape properties, as measured by the number of forest patches, mean patch area, contagion, and Euclidean nearest neighbor determined using Fragstats software. The average BAU outputs of the models suggests that Central Kalimantan may lose slightly less than half (45.1%) of its 2005 PSF by 2020 if measures are not taken to reduce deforestation there. The relatively small reduction of 0.24 Mha in deforestation found in the 0.54 Mha protection scenario suggests that these models can identify potential leakage effects in which deforestation is forced to occur elsewhere in response to a policy intervention.

  17. Comparing Avocado, Swamp Bay, and Camphortree as Hosts of Raffaelea lauricola Using a Green Fluorescent Protein (GFP)-Labeled Strain of the Pathogen.

    Science.gov (United States)

    Campbell, A S; Ploetz, R C; Rollins, J A

    2017-01-01

    Raffaelea lauricola, a fungal symbiont of the ambrosia beetle Xyleborus glabratus, causes laurel wilt in members of the Lauraceae plant family. North American species in the family, such as avocado (Persea americana) and swamp bay (P. palustris), are particularly susceptible to laurel wilt, whereas the Asian camphortree (Cinnamomum camphora) is relatively tolerant. To determine whether susceptibility is related to pathogen colonization, a green fluorescent protein-labeled strain of R. lauricola was generated and used to inoculate avocado, swamp bay, and camphortree. Trees were harvested 3, 10, and 30 days after inoculation (DAI), and disease severity was rated on a 1-to-10 scale. By 30 DAI, avocado and swamp bay developed significantly more severe disease than camphortree (mean severities of 6.8 and 5.5 versus 1.6, P < 0.003). The extent of xylem colonization was recorded as the percentage of lumena that were colonized by the pathogen. More xylem was colonized in avocado than camphortree (0.9% versus 0.1%, P < 0.03) but colonization in swamp bay (0.4%) did not differ significantly from either host. Although there were significant correlations between xylem colonization and laurel wilt severity in avocado (r = 0.74), swamp bay (r = 0.82), and camphortree (r = 0.87), even severely affected trees of all species were scarcely colonized by the pathogen.

  18. Identifying food deserts and swamps based on relative healthy food access: a spatio-temporal Bayesian approach.

    Science.gov (United States)

    Luan, Hui; Law, Jane; Quick, Matthew

    2015-12-30

    Obesity and other adverse health outcomes are influenced by individual- and neighbourhood-scale risk factors, including the food environment. At the small-area scale, past research has analysed spatial patterns of food environments for one time period, overlooking how food environments change over time. Further, past research has infrequently analysed relative healthy food access (RHFA), a measure that is more representative of food purchasing and consumption behaviours than absolute outlet density. This research applies a Bayesian hierarchical model to analyse the spatio-temporal patterns of RHFA in the Region of Waterloo, Canada, from 2011 to 2014 at the small-area level. RHFA is calculated as the proportion of healthy food outlets (healthy outlets/healthy + unhealthy outlets) within 4-km from each small-area. This model measures spatial autocorrelation of RHFA, temporal trend of RHFA for the study region, and spatio-temporal trends of RHFA for small-areas. For the study region, a significant decreasing trend in RHFA is observed (-0.024), suggesting that food swamps have become more prevalent during the study period. For small-areas, significant decreasing temporal trends in RHFA were observed for all small-areas. Specific small-areas located in south Waterloo, north Kitchener, and southeast Cambridge exhibited the steepest decreasing spatio-temporal trends and are classified as spatio-temporal food swamps. This research demonstrates a Bayesian spatio-temporal modelling approach to analyse RHFA at the small-area scale. Results suggest that food swamps are more prevalent than food deserts in the Region of Waterloo. Analysing spatio-temporal trends of RHFA improves understanding of local food environment, highlighting specific small-areas where policies should be targeted to increase RHFA and reduce risk factors of adverse health outcomes such as obesity.

  19. Differences in impacts of Hurricane Sandy on freshwater swamps on the Delmarva Peninsula, Mid−Atlantic Coast, USA

    Science.gov (United States)

    Middleton, Beth A.

    2016-01-01

    Hurricane wind and surge may have different influences on the subsequent composition of forests. During Hurricane Sandy, while damaging winds were highest near landfall in New Jersey, inundation occurred along the entire eastern seaboard from Georgia to Maine. In this study, a comparison of damage from salinity intrusion vs. wind/surge was recorded in swamps of the Delmarva Peninsula along the Pocomoke (MD) and Nanticoke (DE) Rivers, south of the most intense wind damage. Hickory Point Cypress Swamp (Hickory) was closest to the Chesapeake Bay and may have been subjected to a salinity surge as evidenced by elevated salinity levels at a gage upstream of this swamp (storm salinity = 13.1 ppt at Nassawango Creek, Snow Hill, Maryland). After Hurricane Sandy, 8% of the standing trees died at Hickory including Acer rubrum, Amelanchier laevis, Ilex spp., and Taxodium distichum. In Plot 2 of Hickory, 25% of the standing trees were dead, and soil salinity levels were the highest recorded in the study. The most important variables related to structural tree damage were soil salinity and proximity to the Atlantic coast as based on Stepwise Regression and NMDS procedures. Wind damage was mostly restricted to broken branches although tipped−up trees were found at Hickory, Whiton and Porter (species: Liquidamabar styraciflua, Pinus taeda, Populus deltoides, Quercus pagoda and Ilex spp.). These trees fell mostly in an east or east−southeast direction (88o−107o) in keeping with the wind direction of Hurricane Sandy on the Delmarva Peninsula. Coastal restoration and management can be informed by the specific differences in hurricane damage to vegetation by salt versus wind.

  20. Nitrogen Dynamics Along a Headwater Stream Draining a Fen, Swamp, and Marsh in a Fractured Dolomite Watershed

    Science.gov (United States)

    Duval, T. P.; Waddington, J. M.

    2009-05-01

    Stream-wetland interaction has been shown to have a significant effect on nutrient cycling and downstream water quality. Additionally, connection to regional groundwater systems can dilute or enrich stream water with a number of dissolved constituents. This study demonstrates the resultant downstream change in dissolved nitrogen species as a hardwater stream emerges from a calcareous aquifer and traverses a calcareous fen, a cedar swamp, and a cattail marsh over two growing seasons, a very dry 2006 and a very wet 2007. Upon emergence at a number of groundwater seeps, the water contained appreciable nitrate levels averaging 2.72±0.42 mg NO3-N L-1, minimal organic nitrogen, and ammonium below detectable levels. Through the gently sloping calcareous fen, with a stream residence time of ~ 5 hours, NO3-N concentration decreases of 0.35 mg L-1 were observed. Concomitantly, stream recharge into the dolomite bedrock depressed stream discharge values significantly, further removing nitrate from the stream system. This resulted in the fen-bedrock system acting as an estimated net sink of 432 kg of NO3-N in the early summer of 2007, for example. In contrast, the hydrological-biogeochemical systems became decoupled through the swamp during the same period, where concentrations increased from 2.58±0.34 mg L-1 entering the swamp to 2.65±0.58 mg L-1 exiting, but streamflow decreased in general by 5 L s- 1. This resulted in the swamp, with its large depression storage, acting as a small net sink of nitrate (75 kg through the early summer), which would not be detected simply from concentration changes. The concentration-discharge relation realigned through the marsh, where significant groundwater entered the wetland, increasing both concentration and discharge, yielding a small export of 93 kg over the same time period. A series of tracer injections in each wetland type will be presented to compare the streamflow- concentration patterns with the measured nutrient spiralling

  1. Food habitats of the Antillean manatees (Trichechus manatus manatus) in the Coswine Swamps (French Guiana, South America)

    OpenAIRE

    Spiegelberger, Thomas; Ganslosser, Udo

    2005-01-01

    A study was conducted to analyse the habitat of the Antillean manatee (Trichechus manatus manatus L. 1758) in the Coswine Swamps of northwest French Guiana, South America. Water parameters were similar to those described in other studies: water depth varied from 2.5 m to more than 20 m; water temperature was between 24.5 °C and 30.3 °C and pH varied between 5.5 and 6.9. Salinity was low (0.0‰ to 1.3‰) with 86.9% of all samples taken in fresh water. No submerged aquatic vegetation was found in...

  2. Productivity of Indonesian swamp buffaloes in relation to nutrition, reproduction and draught use in the wet tropics

    International Nuclear Information System (INIS)

    Bamualim, A.; Liem, C.; Ffoulkes, D.

    1990-01-01

    Buffaloes in Indonesian villages fulfil a valuable function in providing the major source of draught power for cultivation. However, in wet irrigated areas, the continuous work of buffaloes and the low to medium quality of the available feed result in low growth rates and low reproductive performance. Results from buffalo feeding trials using similar feeds to those given in the villages indicated that high usage for draught would ultimately reduce body weight gains and might reduce the ovarian activity of buffalo cows. Use of supplements is recommended to improve the growth rates and fertility of swamp buffalo cows subjected to high work loads. (author). 14 refs, 7 tabs

  3. Pseudocapillaria (Ichthyocapillaria) ophisterni sp. n. (Nematoda : Capillariidae) from the swamp-eel Ophisternon aenigmaticum (Pisces) in Mexico.

    Science.gov (United States)

    Moravec, F; Salgado-Maldonado, G; Jiménez-García, I

    2000-04-01

    A new nematode species, Pseudocapillaria ophisterni sp. n., is described from the intestine and rarely from the stomach of the swamp-eel, Ophisternon aenigmaticum Rosen et Greenwood, from Catemaco Lake, Veracruz, Mexico. In having both caudal lobes in the male interconnected by a distinct dorsal membrane, it belongs to the subgenus Ichthyocapillaria. It differs from the three species in this subgenus mainly in possessing either a distinctly longer spicule or a smaller length of oesophagus relative to body length. It also differs in host type and geographical distribution. P. ophisterni is the first capillariid species reported from synbranchiform fishes.

  4. The palynology and sedimentology of a coastal swamp at Awana, Great Barrier Island, New Zealand, from c. 7000 yr B.P. to present

    International Nuclear Information System (INIS)

    Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.

    1999-01-01

    Pollen and sediment analysis of two Holocene cores from Awana, Great Barrier Island, shows that at 7000 calibrated yr B.P. the local swamp was an estuarine salt marsh dominated by Restionaceae. By c. 6000 yr B.P. the water table was lower, and a fresh water swamp (Gleichenia-Leptospermum) had replaced the salt marsh. Regional conifer-hardwood forest c. 7000 yr B.P. was initially co-dominated by Libocedrus and Dacrydium cupressinum. Libocedrus declined from c. 6000 yr B.P. During the period c. 6000-c. 2500 yr B.P., relatively stable environmental conditions ensued with little change in local or regional vegetation. Around 2500 yr B.P., the swamp surface became drier and was invaded by Dacrycarpus and Laurelia swamp forest. This forest was subsequently repeatedly disturbed (not by fire), indicating climatic change to drier and windier conditions. Ascarina lucida was periodically a major component of swamp forest. Disturbance is also recorded in the clastic (mineral) sediments, where beds of sand within finer-grained sediment and peat are interpreted as wind blown material derived from partly devegetated dunes to seaward. The presence of the Kaharoa Tephra allows the timing of major Polynesian deforestation at Awana to be reliably dated to c. 600 calibrated yr B.P. In contrast, we see no evidence in the clastic sediment record of disturbance at Awana since Kaharoa time. We attribute this to the maintenance of stable dunes by a herb/scrub cover despite nearby fires, or to the presence of scrub or forest buffering the swamp from ablating dunes. (author). 45 refs., 4 figs., 1 tab

  5. Recent benthic foraminifera assemblages from mangrove swamp and channels of Abu Dhabi (UAE)

    Science.gov (United States)

    Fiorini, Flavia; Lokier, Stephen W.; Odeh, Weaam A. S. Al; Paul, Andreas; Song, Jianfeng; Freeman, Mark; Michel, Françoise

    2017-04-01

    Zonation of Recent mangrove environments can be defined using benthic foraminifera, however, little is known about foraminifera from mangrove environments of the Persian/Arabian Gulf. The objective of this study is to produce a detailed micropaleontological and sedimentological analysis to identify foraminiferal associations from mangrove swamps and channels located on the eastern side of Abu Dhabi Island (UAE). Detailed sediment sampling collection in mangal environments of Eastern Abu Dhabi was carried out to assess the distribution of benthic foraminifera in different sedimentary facies in the mangal and in the surrounding natural environments of the upper and lower intertidal area (mud flats and channels). A 100 m transect across a natural channel in a mangal on the eastern side of Abu Dhabi Island was sampled in detail for sedimentological and foraminiferal analysis. Forty-seven samples were collected at 2 meter intervals along the transect in a number of different sedimentary facies including; fine sediment in areas exposed during low tide and close to mangrove trees (Avicennia marina), fine sediment rich in leaf material, coarse sediment in channels, and coarse sediments with a shell lag. At each sampling location environmental parameters were recorded, including water depth, salinity, temperature and pH. Samples collected for foraminiferal analysis were stained in rose Bengal in order to identify living specimens. Samples collected on the mud flat at the margin of the channel show a living foraminiferal assemblage characterised by abundant foraminifera belonging to the genera Ammonia, Elphidium, Cribroelphidium, Triloculina, Quinqueloculina, Sigmoilinita, Spiroloculina, Peneroplis and Spirolina. Samples collected in the lower (wet) intertidal area close to Avicennia marina roots, presented a low-diversity assemblage mostly comprising small-sized opportunistic foraminifera of the genera Ammonia and Cribroelphidium along with rare Triloculina and

  6. Gnathostoma spinigerum in live Asian swamp eels (Monopterus spp.) from food markets and wild populations, United States

    Science.gov (United States)

    Cole, Rebecca A.; Choudhury, Anindo; Nico, Leo G.; Griffin, Kathryn M.

    2014-01-01

    In Southeast Asia, swamp eels (Synbranchidae: Monopterus spp.) are a common source of human gnathostomiasis, a foodborne zoonosis caused by advanced third-stage larvae (AL3) of Gnathostoma spp. nematodes. Live Asian swamp eels are imported to US ethnic food markets, and wild populations exist in several states. To determine whether these eels are infected, we examined 47 eels from markets and 67 wild-caught specimens. Nematodes were identified by morphologic features and ribosomal intergenic transcribed spacer–2 gene sequencing. Thirteen (27.7%) M. cuchia eels from markets were infected with 36 live G. spinigerum AL3: 21 (58.3%) in liver; 7 (19.4%) in muscle; 5 (13.8%) in gastrointestinal tract, and 3 (8.3%) in kidneys. Three (4.5%) wild-caught M. albus eels were infected with 5 G. turgidum AL3 in muscle, and 1 G. lamothei AL3 was found in a kidney (both North American spp.). Imported live eels are a potential source of human gnathostomiasis in the United States.

  7. Epiphytic ferns in swamp forest remnants of the coastal plain of southern Brazil: latitudinal effects on the plant community

    Directory of Open Access Journals (Sweden)

    Letícia S. Machado

    Full Text Available ABSTRACT Community structure and spatial distribution of epiphytic ferns in swamp forest remnants along the coastal plain of the state of Rio Grande do Sul were analyzed. A total of 440 trees were sampled in fifty-seven 10 x 10 m plots. Each phorophyte was divided into five ecological zones (strata, where all species of epiphytic ferns were recorded. A total of 34 species representing 18 genera in six families were recorded. Polypodiaceae was the most represented family with 17 species, and Microgramma vacciniifolia had the highest epiphytic importance value. Characteristic holoepiphyte was the predominant ecological category, representing 70 % of the species. Ordination analysis showed a gradual change in floristic composition between ecological zones with richness differing significantly between strata. We observed that with increasing latitude there was a decrease in mean temperature and total rainfall, but an increase in frosts. These climatic and phytogeography changes result in a reduction in species richness and a change in the structure of epiphytic fern communities in a north-to-south direction. The importance of swamp forest remnants of the coastal plain to the diversity of epiphytic ferns is discussed.

  8. Heavy Metals Uptake by Asian Swamp Eel, Monopterus albus from Paddy Fields of Kelantan, Peninsular Malaysia: Preliminary Study.

    Science.gov (United States)

    Yin, Sow Ai; Ismail, Ahmad; Zulkifli, Syaizwan Zahmir

    2012-12-01

    Swamp eel, Monopterus albus is one of the common fish in paddy fields, thus it is suitable to be a bio-monitor for heavy metals pollution studies in paddy fields. This study was conducted to assess heavy metals levels in swamp eels collected from paddy fields in Kelantan, Malaysia. The results showed zinc [Zn (86.40 μg/g dry weight)] was the highest accumulated metal in the kidney, liver, bone, gill, muscle and skin. Among the selected organs, gill had the highest concentrations of lead (Pb), cadmium (Cd) and nickel (Ni) whereas muscle showed the lowest total metal accumulation of Zn, Pb, copper (Cu), Cd and Ni. Based on the Malaysian Food Regulation, the levels of Zn and Cu in edible parts (muscle and skin) were within the safety limits. However, Cd, Pb and Ni exceeded the permissible limits. By comparing with the maximum level intake (MLI), Pb, Ni and Cd in edible parts can still be consumed. This investigation indicated that M. albus from paddy fields of Kelantan are safe for human consumption with little precaution.

  9. Chronological Reorganization of Microtubules, Actin Microfilaments, and Chromatin during the First Cell Cycle in Swamp Buffalo (Bubalus bubalis Embryos

    Directory of Open Access Journals (Sweden)

    Vibuntita Chankitisakul

    2010-01-01

    Full Text Available This paper aimed to study the dynamics of early embryonic development, in terms of redistribution of cytoskeleton (microtubules, actin microfilaments and chromatin configurations during the first cell cycle in swamp buffalo embryos. Oocytes were matured and fertilized in vitro, and they were fixed at various time points after IVF. At 6 h after IVF, 44.4% matured oocytes were penetrated by spermatozoa. Partial ZP digestion, however, did not improve fertilization rate compared to control (P>.05. At 12 h after IVF, the fertilized oocytes progressed to the second meiotic division and formed the female pronucleus simultaneously with the paternal chromatin continued to decondense. A sperm aster was observed radiating from the base of the decondensing sperm head. At 18 h after IVF, most presumptive zygotes had reached the pronuclear stage. The sperm aster was concurrently enlarged to assist the migration and apposition of pronuclei. Cell cleavage was facilitated by microfilaments and firstly observed by 30 h after IVF. In conclusion, the cytoskeleton actively involves with the process of fertilization and cleavage in swamp buffalo oocytes. The centrosomal material is paternally inherited. Fertilization failure is predominantly caused by poor sperm penetration. However, partial digestion of ZP did not improve fertilization rate.

  10. Hyb-Seq: combining target enrichment and genome skimming for plant phylogenomics

    Science.gov (United States)

    Kevin Weitemier; Shannon C.K. Straub; Richard C. Cronn; Mark Fishbein; Roswitha Schmickl; Angela McDonnell; Aaron. Liston

    2014-01-01

    • Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. • Methods and Results: Genome and transcriptome assemblies for milkweed ( Asclepias syriaca ) were used to design enrichment probes for 3385...

  11. Strong and stable geographic differentiation of swamp buffalo maternal and paternal lineages indicates domestication in the China/Indochina border region

    NARCIS (Netherlands)

    Zhang, Yi; Lu, Yongfang; Yindee, Marnoch; Li, Kuan-Yi; Kuo, Hsiao-Yun; Ju, Yu-Ten; Ye, Shaohui; Faruque, Md Omar; Li, Qiang; Wang, Yachun; Cuong, Vu Chi; Pham, Lan Doan; Bouahom, Bounthong; Yang, Bingzhuang; Liang, Xianwei; Cai, Zhihua; Vankan, Dianne; Manatchaiworakul, Wallaya; Kowlim, Nonglid; Duangchantrasiri, Somphot; Wajjwalku, Worawidh; Colenbrander, Ben; Zhang, Yuan; Beerli, Peter; Lenstra, Johannes A; Barker, J Stuart F

    The swamp type of the Asian water buffalo is assumed to have been domesticated by about 4000 years BP, following the introduction of rice cultivation. Previous localizations of the domestication site were based on mitochondrial DNA (mtDNA) variation within China, accounting only for the maternal

  12. Testate amoebae analysis in the peat deposits of the swamp Dolgon’koye in the south of Western Siberia and peatland paleohydrology for last 3100 years

    Science.gov (United States)

    Kurina, Irina V.; Blyakharchuk, Tatiana A.

    2018-03-01

    Our research is devoted to paleohydrological reconstruction in the swamp located in the river valley on the piedmont of the Altai Mountains in the south of Western Siberia. The reconstruction was carried out based on rhizopod analysis for the last 3100 cal yr. A large amount of different testate amoebae was found in the peat. Total 64 testate amoebae taxa were recorded in the peat core with the most abundant being: Trinema lineare, Centropyxis aculeata, C. aerophila, Euglypha rotunda, Cryptodifflugia sp. Decrease of surface wetness in the swamp are observed 2280, 2140, 1900–600 cal yr BP and increase – in 2700, 2500–1900, 230–215 cal yr BP. The results of our reconstruction of the swamp paleohydrology agrees well with the paleoclimatic data obtained earlier for the central area of the south of Western Siberia Plain. It indicates a high sensitivity of the swamp to climatic changes in the Holocene. The rhizopod analysis proved to be very effective when used for paleohydrology reconstruction in minerotrophic peat.

  13. Yeast communities in Sphagnum phyllosphere along the temperature-moisture ecocline in the boreal forest-swamp ecosystem and description of Candida sphagnicola sp. nov.

    Science.gov (United States)

    Kachalkin, Aleksey V; Yurkov, Andrey M

    2012-06-01

    The effects of the temperature-moisture factors on the phylloplane yeast communities inhabiting Sphagnum mosses were studied along the transition from a boreal forest to a swamp biotope at the Central Forest State Biosphere Reserve (Tver region, Russia). We tested the hypothesis that microclimatic parameters affect yeast community composition and structure even on a rather small spatial scale. Using a conventional plating technique we isolated and identified by molecular methods a total of 15 species of yeasts. Total yeast counts and species richness values did not depend on environmental factors, although yeast community composition and structure did. On average, Sphagnum in the swamp biotope supported a more evenly structured yeast community. Relative abundance of ascomycetous yeasts was significantly higher on swamp moss. Rhodotorula mucilaginosa dominated in the spruce forest and Cryptococcus magnus was more abundant in the swamp. Our study confirmed the low occurrence of tremellaceous yeasts in the Sphagnum phyllosphere. Of the few isolated ascomycetous yeast and yeast-like species, some were differentiated from hitherto known species in physiological tests and phylogenetic analyses. We describe one of them as Candida sphagnicola and designate KBP Y-3887(T) (=CBS 11774(T) = VKPM Y-3566(T) = MUCL 53590(T)) as the type strain. The new species was registered in MycoBank under MB 563443.

  14. Yellow perch larval survival in the Zekiah Swamp watershed (Wicomico River, Maryland) relative to the potential effects of a coal ash storage facility

    International Nuclear Information System (INIS)

    Burton, W.H.; Pinkney, A.E.

    1994-01-01

    A coordinated program of in situ and laboratory bioassays supported by water quality analyses was used to evaluate the potential effect of a coal ash storage facility on a yellow perch (Perca flavescens) spawning area. The facility is located in the Zekiah Swamp watershed, a tributary of the Wicomico River, MD. In situ bioassays were conducted in Zekiah Swamp Run and reference locations in 1989 and 1990. Larval mortality was high in non-tidal areas of Zekiah Swamp Run, both at a site upstream and beyond the influence of the facility, and at a site downstream of the facility. Mortality was significantly less at a nearby reference stream and at a station in the tidal area of Zekiah Swamp Run. Analysis of water samples for metals (including inorganic monomeric aluminum), organic contaminants, and pH, as well as measurements of stream flow, did not identify a specific cause for the mortality. The field and laboratory bioassays showed that, although leachate from the ash facility contributed to local contamination of ground water, the facility does not appear to be responsible for the poor survival of larval yellow perch. 16 refs., 4 figs., 6 tabs

  15. The Analysis of Management and Timber Trade System of Gelam (Melaleuca cajuputi From Peat Swamp Forest in South Kalimantan

    Directory of Open Access Journals (Sweden)

    Yudi Firmanul Ariffin

    2015-05-01

    Full Text Available Until now the raw material of wood especially Gelam (Melaleuca cajuputi available for supporting the construction of housing and other infrastructures is increasingly large in Indonesia. On the Island of Borneo that partly consists of swamps needs Gelam very large and continuous, particularly for residential development. However, areas of peat swamp forest habitat of this plant from year to year are degradation and shrinkage. This situation is a very big influence on the population of Gelam, while the management and timber trade systems are not well regulated. This study aims to analyze the management and timber trade systems of Gelam particularly in South Kalimantan to provide input to the policy holder in the preservation of Gelam. The method was used a field survey and interviews with traders and policy holders related regulations. The results showed in South Kalimantan the potency of Gelam is only 2,9-7,1 m3/ha and decreasing yearly. Normally Gelam with a diameter <4 cm have been cut down, as well as > 30 cm. These dimensions should not be cut because of <4 cm too young and > 30 cm can be used as seed sources. Gelam derived from peat swamp forest, which mostly comes from the Batola District and some came from Kapuas District of Central Kalimantan. Distributions of Gelam were starting gatherers logging in the forest then sold to small gatherers, next to the large gatherers and distributed to all districts/cities in South Kalimantan, wood processing industries, and some of them were sent to Java. The silviculture system of Gelam was using selective cutting. Classification of wood sizes traded by the diameter divided into 3-4cm, 5-6cm, 7-8cm, 9-10cm, 11-12cm, 13-14cm, 15-19cm and > 20cm to 4m long. Its use consists of a small diameter (3-10cm for foundry building and firewood, while the large diameter (10-20cm for the construction of houses in swampy areas, and waste as well as the stems are bent and deformed used for firewood. Until now Gelam

  16. Strong and stable geographic differentiation of swamp buffalo maternal and paternal lineages indicates domestication in the China/Indochina border region.

    Science.gov (United States)

    Zhang, Yi; Lu, Yongfang; Yindee, Marnoch; Li, Kuan-Yi; Kuo, Hsiao-Yun; Ju, Yu-Ten; Ye, Shaohui; Faruque, Md Omar; Li, Qiang; Wang, Yachun; Cuong, Vu Chi; Pham, Lan Doan; Bouahom, Bounthong; Yang, Bingzhuang; Liang, Xianwei; Cai, Zhihua; Vankan, Dianne; Manatchaiworakul, Wallaya; Kowlim, Nonglid; Duangchantrasiri, Somphot; Wajjwalku, Worawidh; Colenbrander, Ben; Zhang, Yuan; Beerli, Peter; Lenstra, Johannes A; Barker, J Stuart F

    2016-04-01

    The swamp type of the Asian water buffalo is assumed to have been domesticated by about 4000 years BP, following the introduction of rice cultivation. Previous localizations of the domestication site were based on mitochondrial DNA (mtDNA) variation within China, accounting only for the maternal lineage. We carried out a comprehensive sampling of China, Taiwan, Vietnam, Laos, Thailand, Nepal and Bangladesh and sequenced the mtDNA Cytochrome b gene and control region and the Y-chromosomal ZFY, SRY and DBY sequences. Swamp buffalo has a higher diversity of both maternal and paternal lineages than river buffalo, with also a remarkable contrast between a weak phylogeographic structure of river buffalo and a strong geographic differentiation of swamp buffalo. The highest diversity of the swamp buffalo maternal lineages was found in south China and north Indochina on both banks of the Mekong River, while the highest diversity in paternal lineages was in the China/Indochina border region. We propose that domestication in this region was later followed by introgressive capture of wild cows west of the Mekong. Migration to the north followed the Yangtze valley as well as a more eastern route, but also involved translocations of both cows and bulls over large distances with a minor influence of river buffaloes in recent decades. Bayesian analyses of various migration models also supported domestication in the China/Indochina border region. Coalescence analysis yielded consistent estimates for the expansion of the major swamp buffalo haplogroups with a credibility interval of 900 to 3900 years BP. The spatial differentiation of mtDNA and Y-chromosomal haplotype distributions indicates a lack of gene flow between established populations that is unprecedented in livestock. © 2015 John Wiley & Sons Ltd.

  17. Water-use dynamics of a peat swamp forest and a dune forest in Maputaland, South Africa

    Directory of Open Access Journals (Sweden)

    A. D. Clulow

    2013-05-01

    Full Text Available Peat swamp forests are the second rarest forest type found in South Africa while dune forests have been under severe threat through mining and agriculture. Both forest types exist in the conservation area, and World Heritage site, known as the iSimangaliso Wetland Park on the East coast of South Africa. The area is prone to severe droughts (Taylor et al., 2006 and recent attempts to understand the local water balance revealed that there was insufficient information on the water use of the indigenous forests of the area. The peat swamp forest and dune forest sites studied in this research were located within close proximity to each other, yet, are characterised by different landscape positions in terms of water availability. The coastal dune forest soil profile was generally dry and sandy and the tree roots did not have access to the water table. In contrast the peat swamp forest is located in an interdunal wetland where the trees have permanent access to water. The climate at both sites is subtropical with a mean annual precipitation of 1200 mm yr−1. However, over 20 months of measurement, the first summer (October 2009 to March 2010 was drier (424 versus 735 mm than the second summer (October 2010 to March 2011 emphasising the variability of the rainfall in the area and providing a wide range of conditions measured. The sap flow of an evergreen, overstory Syzygium cordatum and a semi-deciduous, understory Shirakiopsis elliptica were measured in the peat swamp forest using the heat ratio method. The Syzygium cordatum water use was not highly seasonal and the daily maximum water use ranged from approximately 30 L d−1 in winter to 45 L d−1 in summer whereas the extit{Shirakiopsis elliptica} water use was more seasonal at 2 L d−1 in winter and 12 L d−1 in summer. The water use of the Syzygium cordatum was not influenced by seasonal rainfall variations and was actually higher in the drier summer (October 2009 to March 2010. Three trees of

  18. Effects of fires on the chemical and petrographic composition of peat in the Snuggedy Swamp, South Carolina

    Energy Technology Data Exchange (ETDEWEB)

    Rollins, M S; Cohen, A D; Durig, J R [South Carolina University, Columbia, SC (USA). Dept. of Chemistry

    1993-04-01

    Charcoal-rich zones in a peat core from the Snuggedy Swamp in South Carolina were investigated to determine the chemical and physical changes associated with fires. Petrographic analyses of microtome thin sections revealed that three charcoal zones were present in the core and that the fires causing such zones were severe enough to penetrate into the subsurface and burn some of the peat. Despite these severe fires, only minor changes in the botanical composition occurred throughout the history of the study site, suggesting that these fires were not extensive enough to retard recolonization of the site from nearby unburned areas. Pyrolysis gas chromatography/Fourier transform infrared/flame ionization detection and pyrolysis gas chromatography/mass spectrometry studies reveal distinct organic chemical changes in the peat that can be related to the fires. Decreases in aliphatic and cellulose compounds mirrored increases in charcoal abundance; while aromatic, lignin-related compounds increased as charcoal increased. 44 refs., 8 figs., 1 tab.

  19. Late-Holocene Environmental Reconstruction and Depositional History from a Taxodium Swamp near Lake Pontchartrain in Southern Louisiana

    Science.gov (United States)

    Ryu, J.; Bianchette, T. A.; Liu, K. B.; Yao, Q.; Maiti, K.

    2017-12-01

    The hydrological and environmental history of estuarine wetlands in Louisiana is not well-documented. To better understand the depositional processes in coastal wetlands, this study aims to reconstruct the environmental changes and document the occurrence of event deposits found in a bald cypress (Taxodium distichum) swamp approximately 800 m west of Lake Pontchartrain, a site susceptible to wind-generated storm surges as well as inundation from other fluvial and lacustrine processes. 210Pb analysis of a 59 cm sediment core (WMA-1) suggests that it has a sedimentation rate of 0.39 cm/year, consistent with the detection of a 137Cs peak at 17 cm from the core top. Results of sedimentological, geochemical, and palynological analyses reveal that the core contains two distinct sediment facies: an organic-rich dark brown peat unit from 0 to 29 cm containing low concentrations of terrestrial elements (e.g., Ti, Fe, and K), and a clay unit from 30 to 59 cm with elevated concentrations of most elements. Two thin clay layers, at 3-5 cm and 14-19 cm, embedded in the upper peat section are probably attributed to two recent storm events, Hurricane Isaac (2012) and Hurricane Gustav (2008), because both hurricanes caused heavy rain and significant storm-surge flooding at the study site. The pollen assemblage in the clay section is dominated by TCT (mainly Taxodium), but it is replaced by Salix and wetland herbaceous taxa in the overlying peat section. The multi-proxy data suggest that a cypress swamp has been present at the site for at least several hundred years but Taxodium was being replaced by willow (Salix) and other bottomland hardwood trees and wetland herbs as the water level dropped. Human activities may have been an important factor causing the hydrological and ecological changes at the site during the past century.

  20. Effect of Ground Corn Cob Replacement for Cassava Chip on Feed Intake, Rumen Fermentation and Urinary Derivatives in Swamp Buffaloes

    Directory of Open Access Journals (Sweden)

    M. Wanapat

    2012-08-01

    Full Text Available Four Thai - rumen fistulated male swamp buffaloes (Bubalus bubalis, about four years old with 400±20 kg liveweight, were randomly assigned according to a 4×4 Latin square design to receive dietary treatments. The treatments were: ground corn cob (GCC replacement for cassava chip (CC in concentrate at 0% (T1; GCC replacement at 33% (T2; GCC replacement at 67% (T3; and GCC replacement at 100% (T4, respectively. During the experiment, concentrate was offered at 0.5% BW while 5% urea-treated rice straw was given at ad libitum. The result revealed that there was no effect of GCC replacement on DMI among treatments. In addition, digestibilities of DM, OM and CP were not different while aNDF linearly increased with an increasing level of GCC replacement. However, GCC replacement did not affect rumen fermentation such as ruminal pH, NH3-N and VFA concentration; except C3 proportion which was the highest at 33% replacement while the lowest was at 100% replacement. All replacements of GCC resulted in similar protozoal and bacterial populations and microbial protein synthesis (MPS. Purine derivatives (PD concentration in urine and PD to creatinine (PDC index were varied with time of urination and among treatments at 0 to 8 and 8 to 16 h post feeding and higher values were shown among the GCC replacement groups. However at 16 to 24 h-post feeding, it was untraceable. In addition, creatinine concentration was similar among all treatments at every sampling time. Based on the above results, GCC can be used as an energy source for swamp buffalo fed with rice straw. Spot sampling of urine can be used for purine derivatives determination.

  1. Insect emergence in relation to floods in wet meadows and swamps in the River Dalälven floodplain.

    Science.gov (United States)

    Vinnersten, T Z Persson; Östman, Ö; Schäfer, M L; Lundström, J O

    2014-08-01

    Annual variation in flood frequency and hydroperiod during the vegetation season has ecological impacts on the floodplain biota. Although many insect groups may have a lower emergence during a flood event, it is poorly known how annual emergence of insects in temporary wetlands is related to the variation in hydrology. Between May and September, we studied the weekly emergence of 18 insect taxa over six consecutive years, 2002-2007, in six temporary flooded wetlands (four wet meadows and two forest swamps) in the River Dalälven floodplains, Central Sweden. We used emergence traps to collect emerging insects from terrestrial and aquatic parts of wet meadows and swamp forests. In all wetlands, the insect fauna was numerically dominated by the orders Diptera, Hymenoptera, Coleoptera and Homoptera. On a weekly basis, 9 out of the 18 insect taxa had lower emergence in weeks with flood than in weeks with no flood, whereas no taxon had a higher emergence in weeks with flood. Over the seasons, we related insect emergence to seasonal flood frequency and length of hydroperiod. The emergence of most studied taxa decreased with increasing hydroperiod, which suggests that emergence after floods do not compensate for the reduced emergence during floods. Only Culicidae and the aquatic Chironomidae sub-families Tanypodinae and Chironominae showed an increase in emergence with increasing hydroperiod, whereas Staphylinidae peaked at intermediate hydroperiod. We conclude that a hydroperiod covering up to 40% of the vegetation season has a significant negative effect on the emergence of most taxa and that only a few taxa occurring in the temporary wetlands are actually favoured by a flood regime with recurrent and unpredictable floods.

  2. Laboratory Scale Bioremediation of Petroleum Hydrocarbon – Polluted Mangrove Swamps in the Niger Delta Using Cow Dung

    Directory of Open Access Journals (Sweden)

    Dike, E. N.

    2012-01-01

    Full Text Available Aims: The aim of the study was to carry-out laboratory–scale bioremediation of petroleum hydrocarbon polluted mangrove swamps using cow dung as source of limiting of nutrients.Methodology and Results: In a 70 days study, the cow dung treated polluted soil had its total culturable hydrocarbon utilising bacterial/fungi, heterotrophic bacterial and fungal counts increased progressively from the 28th day to the 70th day. The control set- up showed very slight increment in its microbial growth. Alkaline pH was observed in all the treatments and control during the study period. The conductivity values of cow dung decreased progressively. In the cow dung treatment option, the nitrate concentration decreased from 35.44 mg/kg to 14.28 mg/kg. Phosphate concentration of cow dung option decreased from 25.41 mg/kg to 9.31mg/kg. The control had the nitrate decreased from 8.42 mg/kg to 6.98 mg/kg. Percentage total organic carbon (% TOC in the cow dung option decreased from 4.06% to 0.96%. Control experiment had the % TOC decreased from 3.32% to 2.99%. Studies using Gas chromatographic analyses showed that 0%, 49.88%, and 69.85% of Total petroleum hydrocarbon (TPH were lost at zero hour, 28th day and 70th day respectively in the cow dung option. In addition, in the control experimental set-up, 0%, 7.14% and 13.42% of TPH were lost at zero hour, 28th day and 70th day respectively.Conclusion, significance and impact of study: The use of organic nutrient sources such as cow dung has shown good promises in bioremediation of crude oil impacted Mangrove Swamps in the Niger Delta. The next line of action is to transfer the technology to pilot scale study.

  3. On the relative roles of hydrology, salinity, temperature, and root productivity in controlling soil respiration from coastal swamps (freshwater)

    Science.gov (United States)

    Krauss, Ken W.; Whitbeck, Julie L.; Howard, Rebecca J.

    2012-01-01

    Background and aims Soil CO2 emissions can dominate gaseous carbon losses from forested wetlands (swamps), especially those positioned in coastal environments. Understanding the varied roles of hydroperiod, salinity, temperature, and root productivity on soil respiration is important in discerning how carbon balances may shift as freshwater swamps retreat inland with sea-level rise and salinity incursion, and convert to mixed communities with marsh plants. Methods We exposed soil mesocosms to combinations of permanent flooding, tide, and salinity, and tracked soil respiration over 2 1/2 growing seasons. We also related these measurements to rates from field sites along the lower Savannah River, Georgia, USA. Soil temperature and root productivity were assessed simultaneously for both experiments. Results Soil respiration from mesocosms (22.7-1678.2 mg CO2 m-2 h-1) differed significantly among treatments during four of the seven sampling intervals, where permanently flooded treatments contributed to low rates of soil respiration and tidally flooded treatments sometimes contributed to higher rates. Permanent flooding reduced the overall capacity for soil respiration as soils warmed. Salinity did reduce soil respiration at times in tidal treatments, indicating that salinity may affect the amount of CO2 respired with tide more strongly than under permanent flooding. However, soil respiration related greatest to root biomass (mesocosm) and standing root length (field); any stress reducing root productivity (incl. salinity and permanent flooding) therefore reduces soil respiration. Conclusions Overall, we hypothesized a stronger, direct role for salinity on soil respiration, and found that salinity effects were being masked by varied capacities for increases in respiration with soil warming as dictated by hydrology, and the indirect influence that salinity can have on plant productivity.

  4. Calculation method for determination of carbon in the peatand moss litter of forest swamps by ash content of plant substrates

    Directory of Open Access Journals (Sweden)

    T. T. Efremova

    2016-12-01

    Full Text Available Studies were carried out in the lowmountain part of the Kuznetsk Alatau. The spruce stands were studied in the peaty valley of river Tunguzhul and swamp near Agaskyr Lake (valley of river Pechische, basin of river Black Iyus. The objects belong to the group of high ash content flood plain peat lands of cryogenicseries. We have done the evaluation of organic carbon response to physical-chemical properties – decomposition degree, ash content, and bulk density, connected together (r – 0.5–0.7, that in contrast to carbon, is easy determined analytically. Received results according to stepwise regression analysis characterize the strong conditionality predictors of carbon: multiple determination index R2 – 0.86. The highest partial correlation coefficient with the response belongs to the ash content in range (5–68 %. Partial correlation coefficient values of bulk density and decomposition degree is not significant. The determination index (R2 – 0.93, constant and negative coefficient of pair regression analysis are highly significant and evidence of the strong bond of carbon and organic substrate ash content. The relative error of approximation is in the range of 2–8 % and characterizes the high accuracy of prognosis. Including only one indicator (ash content in the calculation formula makes it convenient and simple in practical application for the carbon content prediction on the forest litter, modern peat soils, buried peat and peat-mineral formations with ash content of 5–68 %. We are the first to present the geochemical characteristics of forest swamps peat mine for the KuznetskAlatau intermountain basins.

  5. Effect of redox conditions on bacterial and fungal biomass and carbon dioxide production in Louisiana coastal swamp forest sediment

    International Nuclear Information System (INIS)

    Seo, Dong Cheol; DeLaune, Ronald D.

    2010-01-01

    Fungal and bacterial carbon dioxide (CO 2 ) production/emission was determined under a range of redox conditions in sediment from a Louisiana swamp forest used for wastewater treatment. Sediment was incubated in microcosms at 6 Eh levels (-200, -100, 0, + 100, + 250 and + 400 mV) covering the anaerobic range found in wetland soil and sediment. Carbon dioxide production was determined by the substrate-induced respiration (SIR) inhibition method. Cycloheximide (C 15 H 23 NO 4 ) was used as the fungal inhibitor and streptomycin (C 21 H 39 N 7 O 12 ) as the bacterial inhibitor. Under moderately reducing conditions (Eh > + 250 mV), fungi contributed more than bacteria to the CO 2 production. Under highly reducing conditions (Eh ≤ 0 mV), bacteria contributed more than fungi to the total CO 2 production. The fungi/bacteria (F/B) ratios varied between 0.71-1.16 for microbial biomass C, and 0.54-0.94 for microbial biomass N. Under moderately reducing conditions (Eh ≥ + 100 mV), the F/B ratios for microbial biomass C and N were higher than that for highly reducing conditions (Eh ≤ 0 mV). In moderately reducing conditions (Eh ≥ + 100 mV), the C/N microbial biomass ratio for fungi (C/N: 13.54-14.26) was slightly higher than for bacteria (C/N: 9.61-12.07). Under highly reducing redox conditions (Eh ≤ 0 mV), the C/N microbial biomass ratio for fungi (C/N: 10.79-12.41) was higher than for bacteria (C/N: 8.21-9.14). For bacteria and fungi, the C/N microbial biomass ratios under moderately reducing conditions were higher than that in highly reducing conditions. Fungal CO 2 production from swamp forest could be of greater ecological significance under moderately reducing sediment conditions contributing to the greenhouse effect (GHE) and the global warming potential (GWP). However, increases in coastal submergence associated with global sea level rise and resultant decrease in sediment redox potential from increased flooding would likely shift CO 2 production to bacteria

  6. Physiological and morphological responses to permanent and intermittent waterlogging in seedlings of four evergreen trees of temperate swamp forests.

    Science.gov (United States)

    Zúñiga-Feest, Alejandra; Bustos-Salazar, Angela; Alves, Fernanda; Martinez, Vanessa; Smith-Ramírez, Cecilia

    2017-06-01

    Waterlogging decreases a plant's metabolism, stomatal conductance (gs) and photosynthetic rate (A); however, some evergreen species show acclimation to waterlogging. By studying both the physiological and morphological responses to waterlogging, the objective of this study was to assess the acclimation capacity of four swamp forest species that reside in different microhabitats. We proposed that species (Luma apiculata [D.C.] Burret. and Drimys winteri J.R. et G. Forster.) abundant in seasonally and intermittently waterlogged areas (SIWA) would have a higher acclimation capacity than species abundant in the inner swamp (Blepharocalyx cruckshanksii [H et A.] Mied. and Myrceugenia exsucca [D.C.] Berg.) where permanent waterlogging occurs (PWA); it was expected that the species from SIWA would maintain leaf expansion and gas exchange rates during intermittent waterlogging treatments. Conversely, we expected that PWA species would have higher constitutive waterlogging tolerance, and this would be reflected in the formation of lenticels and adventitious roots. Over the course of 2 months, we subjected seedlings to different waterlogging treatments: (i) permanent (sudden, SW), (ii) intermittent (gradual) or (iii) control (field capacity, C). Survival after waterlogging was high (≥80%) for all species and treatments, and only the growth rate of D. winteri subjected to SW was affected. Drimys winteri plants had low, but constant A and g during both waterlogging treatments. Conversely, L. apiculata had the highest A and g values, and g increased significantly during the first several days of waterlogging. In general, seedlings of all species subjected to waterlogging produced more adventitious roots and fully expanded leaves and had higher specific leaf area (SLA) and stomatal density (StD) than seedlings in the C treatment. From the results gathered here, we partially accept our hypothesis as all species showed high tolerance to waterlogging, maintained growth, and had

  7. Carbon Dioxide and Methane Flux Related to Forest Type and Managed and Unmanaged Conditions in the Great Dismal Swamp, USA

    Science.gov (United States)

    Gutenberg, L. W.; Krauss, K.; Qu, J. J.; Hogan, D. M.; Zhu, Z.; Xu, C.

    2017-12-01

    The Great Dismal Swamp in Virginia and North Carolina, USA, has been greatly impacted by human use and management for the last few hundred years through logging, ditching, and draining. Today, the once dominant cedar, cypress and pocosin forest types are fragmented due to logging and environmental change. Maple-gum forest has taken over more than half the remaining area of the swamp ecosystem, which is now a National Wildlife Refuge and State Park. The peat soils and biomass store a vast quantity of carbon compared with the size of the refuge, but this store is threatened by fire and drying. This study looks at three of the main forest types in the GDS— maple-sweet gum, tall pine pocosin, and Atlantic white cedar— in terms of their carbon dioxide and methane soil flux. Using static chambers to sample soil gas flux in locally representative sites, we found that cedar sites showed a higher carbon dioxide flux rate as the soil temperature increased than maple sites, and the rate of carbon dioxide flux decreased as soil moisture increased faster in cedar sites than in maple sites. Methane flux increased as temperature increased for pocosin, but decreased with temperature for cedar and maple. All of the methane fluxes increased as soil moisture increased. Cedar average carbon dioxide flux was statistically significantly different from both maple and pocosin. These results show that soil carbon gas flux depends on soil moisture and temperature, which are factors that are changing due to human actions, as well as on forest type, which is also the result of human activity. Some of these variables may be adjustable by the managers of the land. Variables other than forest type, temperature and soil moisture/inundation may also play a role in influencing soil flux, such as stand age, tree height, composition of the peat and nutrient availability, and source of moisture as some sites are more influenced by groundwater from ditches and some more by rainfall depending on the

  8. Comparative palynomorph signals of vegetation change preserved in an adjacent peat swamp and estuary in north-west Nelson, New Zealand

    International Nuclear Information System (INIS)

    Armour, R.K.; Kennedy, D.M.

    2005-01-01

    A history of vegetation for the mid-late Holocene was extracted from the southern margins of Whanganui Inlet and Mangarakau Swamp. These two sites represent very different pollen sinks with the estuary being dominated by fluvially transported material and the swamp by in situ pollen rain. They are, however, located very close to each other and therefore provide a unique study area to investigate how differing source environments affect pollen signals. A vegetation change from podocarps to beech forest is recorded in both settings at around 4000 years CalBP which is similar to that recorded at higher altitudes in the region. Robust palynomorphs were found in greater abundance in the inlet while the swamp contained a higher proportion of wetland species. Despite these differences both environments appeared to record a similar regional vegetation signal. This shows that estuarine environments, often characterised by material that has been transported, can provide accurate reconstructions of vegetation change. (author). 31 refs., 8 figs., 1 tab

  9. Effect of different concentration of fish oil in skim milk-egg yolk extenders on post- thawed semen qualities of Kalang swamp buffalo bull

    Directory of Open Access Journals (Sweden)

    Abdul Malik

    2018-01-01

    Full Text Available Objective: To explore the effect of fish oil at different concentrations on post-thawed semen of Kalang swamp buffalo. Methods: A total of 4 Kalang swamp buffalo bulls with 3-5 years of age and weighed about 340-360 kg were slected. Semen was regularly collected from these buffalo bulls once a week by an artificial vagina. Fish oil was supplementary at the dosages of 0 mg (control, 50 mg, 100 mg, 150 mg, and 200 mg to the extender (skim milk-egg yolk. Fresh, pre-freezing and frozen semen were thawed at 37 °C and evaluated for motility, viability, morphology, and plasma integrity of membrane. Results: The study results indicated that before freezing, supplementation of fish oil at the dose of 150 mg in the extender had significantly motility. And a significant (P<0.05 increase was observed in viability and motility of post-thawed semen at the dose of 150 mg fish oil, which was in difference with other treatment groups. Conclusions: Addition of 150 mg fish oil in the extender could be positive for the enhancement of the quality of post-thawed semen of Kalang swamp buffaloes.

  10. Effect of Carbohydrate Source and Cottonseed Meal Level in the Concentrate on Feed Intake, Nutrient Digestibility, Rumen Fermentation and Microbial Protein Synthesis in Swamp Buffaloes

    Directory of Open Access Journals (Sweden)

    M. Wanapat

    2013-07-01

    Full Text Available The objective of this study was to investigate the effect of carbohydrate source and cottonseed meal level in the concentrate on feed intake, nutrient digestibility, rumen fermentation and microbial protein synthesis in swamp buffaloes. Four, 4-yr old rumen fistulated swamp buffaloes were randomly assigned to receive four dietary treatments according to a 2×2 factorial arrangement in a 4×4 Latin square design. Factor A was carbohydrate source; cassava chip (CC and CC+rice bran at a ratio 3:1 (CR3:1, and factor B was level of cottonseed meal (CM; 109 g CP/kg (LCM and 328 g CP/kg (HCM in isonitrogenous diets (490 g CP/kg. Buffaloes received urea-treated rice straw ad libitum and supplemented with 5 g concentrate/kg BW. It was found that carbohydrate source did not affect feed intake, nutrient intake, digested nutrients, nutrient digestibility, ammonia nitrogen concentration, fungi and bacterial populations, or microbial protein synthesis (p>0.05. Ruminal pH at 6 h after feeding and the population of protozoa at 4 h after feeding were higher when buffalo were fed with CC than in the CR3:1 treatment (p0.05. Based on this experiment, concentrate with a low level of cottonseed meal could be fed with cassava chips as an energy source in swamp buffalo receiving rice straw.

  11. Acid base status in swamp buffaloes (Bubalus Bubalis fed rice straw and concentrate with addition of sodium

    Directory of Open Access Journals (Sweden)

    G Joseph

    2001-12-01

    Full Text Available An experiment was conducted to study the addition of NaHCO3 and Na2CO3 on acid-base status in swamp buffaloes, Three fistulated buffaloes were each introduced to dietary treatment control diett (50% rice straw + 50% concentrate, control + \\0% NaHCO3 and diet control + 10% Na2CO3 in two times Latin Square Design. The diets contained 9,7% crude protein and 53% TDN to achieve maintenance requirements of the animals. Parameters measured include (l Fed consumption, water consumption and urine volume. (2 pH in rumen fluid, saliva, bLood and urine, (3 natrium mineral content in rumen fluid, saliva, blood and urine. The results of the experiment showed higher pH in the rumen fluid, saliva, blood and urine of buffaloes due to supplementation of NaHCO3 and Na2CO3, Water consumption and urine volume was significanly increased as the effect of Na supplement. The acid-base status of buffaloes was apparently normal in all animals.

  12. Effects of waste drilling fluid on bacterial isolates from a mangrove swamp oilfield location in the Niger delta of Nigeria

    International Nuclear Information System (INIS)

    Benka-Coker, M.O.; Olumagin, A.

    1996-01-01

    Four bacteria strains isolated from a mangrove swamp oilfield location in the Niger Delta of Nigeria were cultured aerobically in the presence of 1.0% waste drilling fluid, to determine the effect of the waste on their growth. A 2-h lag phase of growth was produced by the waste in cultures of Micrococcus and Pseudomonas species, while the waste increased the lag phases of Alcaligenes and Staphylococcus species to 4 h. The exponential phase of growth of Pseudomonas sp. was depressed by the waste drilling fluid but fluid stimulated the exponential phases of Micrococcus and Alcaligenes spp. There was enhancement of the growth rate of Alcaligenes and Micrococcus spp. while those of Staphylococcus and Pseudonomas spp. were decreased. The depressed growth rates of Staphylococcus and Pseudonomas spp. in the presence of the waste drilling fluid might lead to a decrease in their contribution to the removal of the waste from the environment during spillage or disposal and, therefore, may result in an accumulation of the waste in the environment. (author)

  13. Antibacterial properties of extracts of Solidago canadensis and their potential use as dietary supplements in red swamp crayfish (Procambarus clarkii

    Directory of Open Access Journals (Sweden)

    Manhong YE,Lei ZHANG,Jiaqi GE,Haifeng SUN,Jingjing NI,Shengmei YANG,Wanhong WEI

    2015-12-01

    Full Text Available Canadian goldenrod (Solidago canadensis is one of the most destructive invasive weeds in South-eastern China. To evaluate its potential application as dietary supplement in red swamp crayfish (Procambarus clarkii, the antibacterial properties of aqueous and ethanol extracts of this plant against three major pathogenic bacteria in crayfish aquaculture were examined. Inhibition zone tests and determination of minimum inhibitory concentration revealed that the extracts had lower antibacterial activity than extracts from two traditional medicinal plants that possess antibacterial properties, garlic (Allium sativum and cortex phellodendri (Phellodendron chinense. However, they did exhibit greater antibacterial effects than extracts from another widely used medicinal plant, Sophora flavescens, and an aquatic weed, Alternanthera philoxeroides. Aqueous extracts of Canadian goldenrod gave greater inhibition than the ethanol extracts. Crayfish fed a diet with 2% these aqueous extracts exhibited significantly higher enzyme activity of alkaline phosphatase, catalase and phenoloxidase (P<0.05. Based on the results of this study, we conclude that aqueous extracts of Canadian goldenrod are highly promising for the development of new dietary supplement for use in crayfish aquaculture.

  14. Inferring Invasion History of Red Swamp Crayfish (Procambarus clarkii) in China from Mitochondrial Control Region and Nuclear Intron Sequences

    Science.gov (United States)

    Li, Yanhe; Guo, Xianwu; Chen, Liping; Bai, Xiaohui; Wei, Xinlan; Zhou, Xiaoyun; Huang, Songqian; Wang, Weimin

    2015-01-01

    Identifying the dispersal pathways of an invasive species is useful for adopting the appropriate strategies to prevent and control its spread. However, these processes are exceedingly complex. So, it is necessary to apply new technology and collect representative samples for analysis. This study used Approximate Bayesian Computation (ABC) in combination with traditional genetic tools to examine extensive sample data and historical records to infer the invasion history of the red swamp crayfish, Procambarus clarkii, in China. The sequences of the mitochondrial control region and the proPOx intron in the nuclear genome of samples from 37 sites (35 in China and one each in Japan and the USA) were analyzed. The results of combined scenarios testing and historical records revealed a much more complex invasion history in China than previously believed. P. clarkii was most likely originally introduced into China from Japan from an unsampled source, and the species then expanded its range primarily into the middle and lower reaches and, to a lesser extent, into the upper reaches of the Changjiang River in China. No transfer was observed from the upper reaches to the middle and lower reaches of the Changjiang River. Human-mediated jump dispersal was an important dispersal pathway for P. clarkii. The results provide a better understanding of the evolutionary scenarios involved in the rapid invasion of P. clarkii in China. PMID:26132567

  15. Inferring Invasion History of Red Swamp Crayfish (Procambarus clarkii in China from Mitochondrial Control Region and Nuclear Intron Sequences

    Directory of Open Access Journals (Sweden)

    Yanhe Li

    2015-06-01

    Full Text Available Identifying the dispersal pathways of an invasive species is useful for adopting the appropriate strategies to prevent and control its spread. However, these processes are exceedingly complex. So, it is necessary to apply new technology and collect representative samples for analysis. This study used Approximate Bayesian Computation (ABC in combination with traditional genetic tools to examine extensive sample data and historical records to infer the invasion history of the red swamp crayfish, Procambarus clarkii, in China. The sequences of the mitochondrial control region and the proPOx intron in the nuclear genome of samples from 37 sites (35 in China and one each in Japan and the USA were analyzed. The results of combined scenarios testing and historical records revealed a much more complex invasion history in China than previously believed. P. clarkii was most likely originally introduced into China from Japan from an unsampled source, and the species then expanded its range primarily into the middle and lower reaches and, to a lesser extent, into the upper reaches of the Changjiang River in China. No transfer was observed from the upper reaches to the middle and lower reaches of the Changjiang River. Human-mediated jump dispersal was an important dispersal pathway for P. clarkii. The results provide a better understanding of the evolutionary scenarios involved in the rapid invasion of P. clarkii in China.

  16. Evaluation of solid residues removed from a mangrove swamp in the São Vicente Estuary, SP, Brazil.

    Science.gov (United States)

    Cordeiro, C A M M; Costa, T M

    2010-10-01

    Mangrove swamps are found in estuaries along the coastal plains of tropical regions and have be subjected to heavy occupation and use pressure due to their privileged locations and abundance of biological resources. The present work evaluated the ecological characteristics and solid wastes accumulated in eight areas along the Santos - São Vicente Estuary Complex. The superficially deposited residues at each sampling site were collected and subsequently washed, drained, counted, weighed and separated into classes according to their composition and predominant use. The predominant litter type in terms of density was plastic (62.81%) and, by weight, wood (55.53%). The greatest deposition of residues was associated with areas that were less inclined and that had low plant density levels, indicating that the presence of obstacles was not critical for retaining floating residues in mangrove areas. The presence of the most frequently encountered types of solid waste residues could be explained by local activities. Copyright © 2010 Elsevier Ltd. All rights reserved.

  17. Effect of Lunar Phases, Tides, and Wind Speed on the Abundance of Diptera Calliphoridae in a Mangrove Swamp.

    Science.gov (United States)

    Batista-da-Silva, J A

    2014-02-01

    Abiotic factors, such as lunar phases and tides, have a significant effect on insect development. Reproduction and immature development are usually interlinked to these abiotic factors. The tide is at its highest levels at full moon or new moon, hindering the feeding of the immature or causing their drowning. The oviposition by adult females is also compromised on these days because much of the available food is submerged. Another important abiotic factor is the wind, which displaces odoriferous particles in the air. Wind speed and direction are important elements to indicate potential sources of food for insects. I report on the effects of lunar phases, tides, and wind speed on the Calliphoridae fauna in mangrove swamps. The different species collected were identified, and the predominant species in the area were quantified. A total of 1,710 flies were collected over a 1-year period. Six Calliphoridae flies, Chloroprocta idioidea (Robineau-Desvoidy), Chrysomya megacephala (Fabricius), Chrysomya albiceps (Wiedemann), Chrysomya putoria (Wiedemann), Cochliomyia macellaria (Fabricius), and Lucilia eximia (Wiedemann) were collected. Data indicated that lunar phases have a significant effect on the abundance of C. albiceps (r = 0.39, p tides also affected the abundance of C. putoria (r = 0.40, p < 0.00), C. macellaria (r = 0.41, p < 0.00), and C. idioidea (r = 0.31, p < 0.04). The wind speed, however, did not affect these species.

  18. Effects of waste drilling fluid on bacterial isolates from a mangrove swamp oilfield location in the Niger delta of Nigeria

    Energy Technology Data Exchange (ETDEWEB)

    Benka-Coker, M.O.; Olumagin, A. [Benin Univ. (Nigeria). Dept. of Microbiology

    1996-03-01

    Four bacteria strains isolated from a mangrove swamp oilfield location in the Niger Delta of Nigeria were cultured aerobically in the presence of 1.0% waste drilling fluid, to determine the effect of the waste on their growth. A 2-h lag phase of growth was produced by the waste in cultures of Micrococcus and Pseudomonas species, while the waste increased the lag phases of Alcaligenes and Staphylococcus species to 4 h. The exponential phase of growth of Pseudomonas sp. was depressed by the waste drilling fluid but fluid stimulated the exponential phases of Micrococcus and Alcaligenes spp. There was enhancement of the growth rate of Alcaligenes and Micrococcus spp. while those of Staphylococcus and Pseudonomas spp. were decreased. The depressed growth rates of Staphylococcus and Pseudonomas spp. in the presence of the waste drilling fluid might lead to a decrease in their contribution to the removal of the waste from the environment during spillage or disposal and, therefore, may result in an accumulation of the waste in the environment. (author)

  19. Vegetation change in the coastal-lowland rainforest at Avai'o'vuna Swamp, Vava'u, Kingdom of Tonga

    Science.gov (United States)

    Fall, Patricia L.

    2005-11-01

    Avai'o'vuna Swamp, a small coastal wetland in Vava'u, Kingdom of Tonga, produced a 4500-year pollen and sediment record. Results are: (1) a mid-Holocene sea level highstand is confirmed for Tonga between about 4500 and 2600 14C yr B.P.; marine clay contains pollen from mangroves ( Rhizophora mangle), coastal forest trees ( Barringtonia asiatica and Cocos nucifera), and rainforest trees ( Alphitonia, Rhus, Hedycarya and Calophyllum). (2) Microscopic charcoal first appeared at 2600 14C yr B.P., coincident with the arrival of Polynesians. (3) Cocos, Pandanus, Excoecaria, Macaranga, and Elaeocarpaceae pollen reflects the establishment of a mixed coastal-lowland rainforest in the last 2500 years. (4) The loss of Hedycarya, Elaeocarpus, Calophyllum, and Guettarda and the reduction of Terminalia and taxa in the Papilionaceae family by about 1000 years ago may be due to habitat destruction and the loss of dispersal capabilities of some species through the extinction of the two largest pigeons in Tonga.

  20. Benefits of the fire mitigation ecosystem service in the Great Dismal Swamp National Wildlife Refuge, Virginia, USA

    Science.gov (United States)

    Parthum, Bryan M.; Pindilli, Emily J.; Hogan, Dianna

    2017-01-01

     The Great Dismal Swamp (GDS) National Wildlife Refuge delivers multiple ecosystem services, including air quality and human health via fire mitigation. Our analysis estimates benefits of this service through its potential to reduce catastrophic wildfire related impacts on the health of nearby human populations. We used a combination of high-frequency satellite data, ground sensors, and air quality indices to determine periods of public exposure to dense emissions from a wildfire within the GDS. We examined emergency department (ED) visitation in seven Virginia counties during these periods, applied measures of cumulative Relative Risk to derive the effects of wildfire smoke exposure on ED visitation rates, and estimated economic losses using regional Cost of Illness values established within the US Environmental Protection Agency BenMAP framework. Our results estimated the value of one avoided catastrophic wildfire in the refuge to be \\$3.69 million (2015 USD), or \\$306 per hectare of burn. Reducing the frequency or severity of extensive, deep burning peatland wildfire events has additional benefits not included in this estimate, including avoided costs related to fire suppression during a burn, carbon dioxide emissions, impacts to wildlife, and negative outcomes associated with recreation and regional tourism. We suggest the societal value of the public health benefits alone provides a significant incentive for refuge mangers to implement strategies that will reduce the severity of catastrophic wildfires.

  1. The Effect of Seed Soaking with Rhizobacteria Pseudomonas alcaligenes on the Growth of Swamp Cabbage (Ipomoea reptans Poir)

    Science.gov (United States)

    Widnyana, I. K.; Ngga, M.; Sapanca, P. L. Y.

    2018-01-01

    The research was conducted to determine the effect of seed soaking with suspense of P. alcaligenes isolate KtSl, TrN2, and TmAl to the growth of swamp cabbage. The research has been initially developed on tomatoes. In this research, Randomized Block Design was chosen as its model while the data analysis was performed by using SPSS v.17 for Windows. Three types of treatment were administered towards P. alcaligenes, namely isolating, soaking, and growing the medium. Some observed parameters were germination and growth. The results showed that seed soaking treatments with suspense P. alcaligenes fostered the germination 25% faster, enhanced the crop up to 24.4%, increased the number of leaves up until 23.15%, lengthen stems to 25%, lengthen the roots up to 46.90%, and increase the fresh weight of stems up until 67.07% and oven-dry weight of stem up to 84.21% compared to the control treatment. The best response of treatment for germination speed was soaking seeds with P. alcaligenes TrN2 for 20 minutes on both NB (Natrium Broth) and PDB (Potato Dextrose Broth) media.

  2. A Late Quaternary palynological and sedimentological record from two coastal swamps at southern Kaitoke, Great Barrier Island, New Zealand

    International Nuclear Information System (INIS)

    Horrocks, M.; Ogden, J.; Nichol, S.L.; Alloway, B.V.; Sutton, D.G.

    2000-01-01

    Pollen and sediment analyses of two cores from southern Kaitoke (Forsythes' Paddock and Blackwells' Bush), Great Barrier Island, show that at c. 7500 cal. yr BP, the area was an estuary with tidal flats and Avicennia. By c. 3000 cal. yr BP, a Restionaceae (Leptocarpus) salt marsh had developed in the estuary as marine influences lessened. By c. cal. 2550 yr BP, fresh water swamp (Cyperacceae-Gleichenia-Leptspermum) had replaced the salt marsh. Conifer-hardwood forest surrounding the southern Kaitoke sites from c. 7500-c. 2800 cal. yr BP was dominated by Daceydium, Metrosideros and Libocedrus. After c. 2800 cal. yr BP Metrosideros was replaced by Agathis, Phyllocladus and Prumnopitys taxifolia, suggesting climatic change to more variable conditions. The presence of the Kaharoa Tephra suggests that major Polynesian deforestation at southern Kaitoke began c. 600 cal. yr BP Minor pre-Kaharoa fire disturbance is evident c. 1750 cal. yr BP and c. 1290-970 cal. yr BP (author). 52 refs., 4 figs., 2 tabs

  3. Reproductive status and synchronization of oestrus for predetermined insemination of Philippine carabaos (swamp buffalo) raised by smallholder farmers

    International Nuclear Information System (INIS)

    Momongan, V.G.; Palad, O.A.; Singh, M.; Sarabia, A.S.; Chiong, R.D.; Nava, Z.M.; Obsioma, A.R.; Del Barrio, A.N.

    1984-01-01

    There is an urgent need to improve size, and meat and milk productivity of the Philippine carabao, a swamp type of water buffalo (Bubalus bubalis), through crossbreeding with the riverine type. Studies were conducted to assess the reproductive status of carabaos raised by smallholder farmers, determine conception rates of buffaloes to artificial insemination (AI) through oestrus synchronization, and examine the patterns of plasma progesterone in cyclic and acyclic carabao heifers. Approximately 20% of carabaos raised by smallholder farmers were diagnosed pregnant by rectal palpation. This low pregnancy rate may be due to a combination of factors such as the failure to submit for examination carabaos exhibiting external signs of pregnancy, the deliberate postponement of breeding for working females, the inability of bulls to gain access to carabaos in oestrus which are tethered at night, or the high incidence of anoestrus or suboestrus. The reproductive problems in non-pregnant animals were cystic (19.5%), infantile (25.7%), and dormant ovaries (51.3%), and pathology of the uterus and cervix (3.5%). Both feeding and management practices in different locations influenced the nutritional status of female carabaos examined. Animals in good body condition were either cycling or pregnant. A 30-40% conception rate was achieved by synchronization of oestrus and insemination with frozen semen at 72 and 96 h later. Based on progesterone radioimmunoassay and rectal palpation of the ovaries, anoestrus in carabao heifers was due either to a failure of cycling animals to exhibit oestrus or those with inactive ovaries. (author)

  4. Anthropogenic Impacts on Mortality and Population Viability of the Monarch Butterfly.

    Science.gov (United States)

    Malcolm, Stephen B

    2018-01-07

    Monarch butterflies (Danaus plexippus) are familiar herbivores of milkweeds of the genus Asclepias, and most monarchs migrate each year to locate these host plants across North American ecosystems now dominated by agriculture. Eastern migrants overwinter in high-elevation forests in Mexico, and western monarchs overwinter in trees on the coast of California. Both populations face three primary threats to their viability: (a) loss of milkweed resources for larvae due to genetically modified crops, pesticides, and fertilizers; (b) loss of nectar resources from flowering plants; and (c) degraded overwintering forest habitats due to commercially motivated deforestation and other economic activities. Secondary threats to population viability include (d) climate change effects on milkweed host plants and the dynamics of breeding, overwintering, and migration; (e) the influence of invasive plants and natural enemies; (f) habitat fragmentation and coalescence that promote homogeneous, species-depleted landscapes; and (g) deliberate culture and release of monarchs and invasive milkweeds.

  5. Indigenous Knowledge of Dayaks Bakumpai in Barito Kuala District on the Management of Plant Diversity Growing at Streams and Swamps

    Directory of Open Access Journals (Sweden)

    Darmono Darmono

    2016-06-01

    Full Text Available Research aimed at describing profile of indigenous knowldge owned by the Dayaks Bakumpai in Batola district on managing the diversity of herbs growing at the river flow and swamp. Data on herb used by the tribe were grouped based on the etnobotanic study, covering study botany, etnofarmacology, etnoantrophology, etnolinguistik and etnoekologi. We also observed how the Dayaks Bakumpai in Batola district preserve the diversity of plant in around them, and how their efforts in bequeathing or teaching the traditional knowledge of an old breed generation to his young daam in managing diversity of herbs around them.  The study was carried out at three vellages, namely Simpang Arja, Pengulu and Ulu Benteng. The results showed that 52 plant species living along the river and 67 species that live in the marsh. Based on the interview we found that (1 the profile of indigenous knowldge dayaks bakumpai district batola in making use of the diversity of plant in surrounding shown through etno-linguistic, etno-economy, etno-anthropology, etno-farmacology and etno-ecology against 44 tufted herbs of 67 of herbs found, (2 Dayaks Bakumpai in Batola district, to preserve the diversity of plant surrounding them, have done without planting, but by making use of herbs without a certain rule, making use of herbs by a certain rule, making use of herbs let plant grown in nature, and destroy plants that exist or cultivated, and (3 efforts for the inheriting the indigenous knowldge to its young generation have been done by women and quite alarming that many young ages of Dayaks Bakumpai do not know the name of herbs around them.

  6. Gene cloning and induced expression pattern of IRF4 and IRF10 in the Asian swamp eel (Monopterus albus)

    Science.gov (United States)

    XU, Qiao-Qing; YANG, Dai-Qin; TUO, Rui; WAN, Jing; CHANG, Ming-Xian; NIE, Pin

    2014-01-01

    The Asian swamp eel (Monopterus albus) is one of the most economically important freshwater fish in East Asia, but data on the immune genes of M. albus are scarce compared to other commercially important fish. A better understanding of the eel’s immune responses may help in developing strategies for disease management, potentially improving yields and mitigating losses. In mammals, interferon regulatory factors (IRFs) play a vital role in both the innate and adaptive immune system; though among teleosts IRF4 and IRF10 have seldom been studied. In this study, we characterized IRF4 and IRF10 from M. albus (maIRF4 and maIRF10) and found that maIRF4 cDNA consists of 1 716 nucleotides encoding a 451 amino acid (aa) protein, while maIRF10 consists of 1 744 nucleotides including an open reading frame (ORF) of 1 236 nt encoding 411 aa. The maIRF10 gene was constitutively expressed at high levels in a variety of tissues, while maIRF4 showed a very limited expression pattern. Expression of maIRF4 and maIRF10 in head kidney, and spleen tissues was significantly up-regulated from 12 h to 48 h post-stimulation with polyinosinic: polycytidylic acid (poly I:C), lipopolysaccharide (LPS) and a common pathogenic bacteria Aeromonas hydrophila. These results suggest that IRF4 and IRF10 play roles in immune responses to both viral and bacterial infections in M. albus. PMID:25297077

  7. Heavy metals bioaccumulation in selected tissues of red swamp crayfish: An easy tool for monitoring environmental contamination levels.

    Science.gov (United States)

    Goretti, E; Pallottini, M; Ricciarini, M I; Selvaggi, R; Cappelletti, D

    2016-07-15

    In this paper we explored the heavy metal bioaccumulation (Cd, Cu, Pb and Zn) in Procambarus clarkii, a crayfish recently suggested as a potential bioindicator for metals pollution in freshwater systems. The present study is focused on crayfishes populations caught in a heavily polluted industrial and in a reference sites (Central Italy), though the results are generalized with a thorough analysis of literature metadata. In agreement with the literature, the hepatopancreas (Hep, detoxification tissues) of the red swamp crayfish showed a higher concentration of heavy metals in comparison to the abdominal muscle (AbM, not detoxification tissues) in the sites under scrutiny. Hep/AbM concentration ratio was dependent on the specific metal investigated and on its sediment contamination level. Specifically we found that Hep/AbM ratio decreases as follows: Cd (11.7)>Cu (5.5)>Pb (3.6)>Zn (1.0) and Pb (4.34)>Cd (3.66)>Zn (1.69)>Cu (0.87) for the industrial and reference sites, respectively. The analysis of our bioaccumulation data as well as of literature metadata allowed to elaborate a specific contamination index (Toxic Contamination Index, TCI), dependent only on the bioaccumulation data of hepatopancreas and abdominal muscle. In the industrial site, TCI expressed values much higher than the unit for Cd and Cu, confirming that these metals were the main contaminants; in contrast for lower levels of heavy metals, as those observed in the reference site for Cu, Zn and Pb, the index provided values below unit. TCI is proposed as a useful and easy tool to assess the toxicity level of contaminated sites by heavy metals in the environmental management. Copyright © 2016. Published by Elsevier B.V.

  8. Organic and Inorganic Fertilizers Application on NPK Uptake and Production of Sweet Corn in Inceptisol Soil of Lowland Swamp Area

    Directory of Open Access Journals (Sweden)

    Marlina Neni

    2017-01-01

    Full Text Available This study objective was to determine the dose of organic and inorganic fertilizers which can increase N, P and K nutrients uptake as well as the growth and yield of sweet corn on inceptisol soil of lowland swamp. Inceptisol soil has low soil fertility and relatively low to moderate levels of organic matter content. Application of organic fertilizer on inceptisol soil of lowland swampis expected capable to increase N, P and K nutrients as well as yield of sweet corn. This research was conducted from April to July 2014 at Experimental Farm Area of Pulau Semambu Village, Indralaya Utara Subdistrict, Ogan Ilir District, South Sumatra Province. The method used in this research was randomized block design consisting treatments as follows: 75% inorganic fertilizer + 5 ton.ha−1organic fertilizer, 50% inorganic fertilizer + 5 ton.ha−1organic fertilizer, 25% inorganic fertilizer + 5 ton.ha−1 organic fertilizer, 0% inorganic fertilizer + 5 ton.ha−1organic fertilizer with six replications. The recommended dose of inorganic fertilizerswas 200 kg.ha−1 urea, 100 kg.ha−1 SP-36 and 100 kg. ha−1 KCl. The results showed that treatment of 75% of inorganic fertilizer + 5 ton.ha−1organic fertilizer had produced N, P and K nutrients uptake with magnitude of 1.850, 0.418 and 2.374 g.plant−1 respectively as well as good growth and yield of sweet corn with magnitude of 356.36 g. plant−1or 15.21 ton ha−1.

  9. Effects of Supplementation of Eucalyptus ( Leaf Meal on Feed Intake and Rumen Fermentation Efficiency in Swamp Buffaloes

    Directory of Open Access Journals (Sweden)

    N. T. Thao

    2015-07-01

    Full Text Available Four rumen fistulated swamp buffaloes were randomly assigned according to a 4×4 Latin square design to investigate the effects of Eucalyptus (E. Camaldulensis leaf meal (ELM supplementation as a rumen enhancer on feed intake and rumen fermentation characteristics. The dietary treatments were as follows: T1 = 0 g ELM/hd/d; T2 = 40 g ELM/hd/d; T3 = 80 g ELM/hd/d; T4 = 120 g ELM/hd/d, respectively. Experimental animals were kept in individual pens and concentrate was offered at 0.3% BW while rice straw was fed ad libitum. The results revealed that voluntary feed intake and digestion coefficients of nutrients were similar among treatments. Ruminal pH, temperature and blood urea nitrogen concentrations were not affected by ELM supplementation; however, ELM supplementation resulted in lower concentration of ruminal ammonia nitrogen. Total volatile fatty acids, propionate concentration increased with the increasing level of EML (p<0.05 while the proportion of acetate was decreased (p<0.05. Methane production was linearly decreased (p<0.05 with the increasing level of ELM supplementation. Protozoa count and proteolytic bacteria population were reduced (p<0.05 while fungal zoospores and total viable bacteria, amylolytic, cellulolytic bacteria were unchanged. In addition, nitrogen utilization and microbial protein synthesis tended to increase by the dietary treatments. Based on the present findings, it is suggested that ELM could modify the rumen fermentation and is potentially used as a rumen enhancer in methane mitigation and rumen fermentation efficiency.

  10. Concentrations, loads and yields of organic carbon from two tropical peat swamp forest streams in Riau Province, Sumatra, Indonesia

    Directory of Open Access Journals (Sweden)

    H.M. Yupi

    2016-06-01

    Full Text Available Tropical peat swamp forest (PSF stores large quantities of carbon. To estimate how much organic C is released from this type of landscape we determined organic carbon (C concentrations, loads and yields in two contrasting watercourses draining from PSF in Riau Province, Sumatra (Indonesia. Meranti Ditch (MD is an artificial watercourse whose small catchment (estimated area 4.8 km2 is in semi-intact condition, whereas Turip River (TR has a large natural catchment (estimated area 458 km2 covered with fairly intact PSF where > 75 % of the original canopy trees remain. The organic C load (Gg C yr-1 of each watercourse was calculated by combining TOC concentration with water discharge rate to give organic C yield (g C m-2 yr-1. Dissolved organic carbon (DOC was the dominant (95.0–99.8 % component of total organic carbon (TOC in the water. TOC concentration was 85–94 mg C L-1 in MD and 50–58 mg C L-1 in TR. The high concentration in MD was not surprising because this catchment had been disturbed by repeated phases of logging and a dense network of ditches was excavated ten years ago. The TOC loads were 0.23 Gg C yr-1 in MD and 14.0 Gg C yr-1 in TR. TOC yields (i.e. TOC fluxes through the fluvial system were 41.6–55.5 g C m-2 yr-1 in MD and 26.2–34.9 g C m-2 yr-1 in TR.

  11. How does conversion from peat swamp forest to oil palm plantation affect emissions of nitrous oxide from the soil? A case study in Jambi, Indonesia

    Science.gov (United States)

    Hartill, Jodie; Hergoualc'h, Kristell; Comeau, Louis-Pierre; Jo, Smith; Lou, Verchot

    2017-04-01

    Half of the peatlands across Peninsular Malaysia, Borneo and Sumatra are 'managed'. Conversion of peat swamp forest to workable oil palm plantation requires a drastic, potentially irreversible, change to the landscape, to which fertilizers are then routinely applied. A combination of these factors is now widely thought to increase soil nitrous oxide (N2O) emissions, although there is high uncertainty due to gaps in the knowledge, both regionally and nationally. Despite the widespread use of fertilizers in plantations on peats, studies observing their effects remain very limited. Therefore, there is a need for in situ studies to evaluate how environmental parameters (edaphic properties, climate, soil moisture and N availability indicators) influence soil emissions. This 18 month study was located in plots local to each other, representing the start, intermediate and end of the land conversion process; namely mixed peat swamp forest, drained and logged forest and industrial oil palm plantation. Spatial variability was taken into account by differentiating the hollows and hummocks in the mixed peat swamp forest, and the fertilized zone and the zone without fertilizer addition in the oil palm plantation. Gas samples were collected each month from static chambers at the same time as key environmental parameters were measured. Intensive sampling was performed during a 35 day period following two fertilizer applications, in which urea was applied to palms at rates of 0.5 and 1 kg urea palm-1. Soil N2O emissions (kg N ha-1 y-1 ± SE) were low overall, but they were greater in the oil palm plantation (0.8 ± 0.1) than in the mixed peat swamp forest (0.3 ± 0.0) and the drained/logged forest (0.2 ± 0.0). In the mixed peat swamp forest, monthly average fluxes of N2O (g N ha-1 d-1 ± SE) were similar in the hollows (0.6 ± 0.2) and the hummocks (0.3 ± 0.1), whereas in the oil palm plantation they were consistently higher in the zone without fertilizer (2.5 ± 0.4) than in

  12. EFFECT OF ARBUSCULAR MYCORRHIZAL COLONIZATION ON EARLY GROWTH AND NUTRIENT CONTENT OF TWO PEAT­ SWAMP FOREST TREE SPECIES SEEDLINGS, Calophyllum hosei AND Ploiarium alternifolium

    Directory of Open Access Journals (Sweden)

    Maman Turjaman

    2006-03-01

    Full Text Available Tropical peat-swamp forests are one of  the largest near-surface reserves of terrestrial organic carbon,  but rnany peat-swamp forest tree species decreased due over-exploitation, forest fire and conversion of natural forests into agricultural lands. Among those species are slow-growing Calophyllum  hoseiand Ploiarium  alternifolium, two species are good for construction of boats, furniture, house building and considerable attention from pharmacological viewpoint for human healthly. This study was aimed at understanding the effects of arbuscular mycorrhizal (AM fungi on early growth of  C. hosei and P.alternifoliumunder greenhouse condition. Seedlings of C. hosei and P.alternifoliumwere inoculated with AM fungi: Glomus clarum and Glomus aggregatum ,or uninoculated under greenhouse condition during 6 months. AM colonization,   plant growth,  survival rate and  nutrient  content  (P, Zn  and B were measured. The percentage of C. hoseiand P.alternifolium ranged from 27-32% and 18-19%,  respectively. Both inoculated seedling species had greater plant  height, diameter, leaf number, shoot and root dry weight than control  seedlings.   Nutrient  content  of  inoculated  plants  were increased with AM colonization- Survival rates of  inoculated plants were higher (100%  than those of  control plants (67%. The results suggested that inoculation of AM fungi could improve the early growth of C. hoseiand P.alternifolium grown in tropical peat-swamp forest therefore  this finding has greater potential impact if this innovative technology applied in field scales which are socially acceptable, commercially profitable and environmentally friendly.

  13. DNA-based hair sampling to identify road crossings and estimate population size of black bears in Great Dismal Swamp National Wildlife Refuge, Virginia

    OpenAIRE

    Wills, Johnny

    2008-01-01

    The planned widening of U.S. Highway 17 along the east boundary of Great Dismal Swamp National Wildlife Refuge (GDSNWR) and a lack of knowledge about the refugeâ s bear population created the need to identify potential sites for wildlife crossings and estimate the size of the refugeâ s bear population. I collected black bear hair in order to collect DNA samples to estimate population size, density, and sex ratio, and determine road crossing locations for black bears (Ursus americanus) in G...

  14. POTENCY OF RAMIN (Gonystylus bancanus Kurtz. AND OTHER COMMERCIAL SPECIES IN PEAT SWAMP FOREST MANAGED WITH TPTI SILVICULTURAL SYSTEM IN BAGAN, RIAU

    Directory of Open Access Journals (Sweden)

    Hendromono Hendromono

    2005-07-01

    Full Text Available Ramin  (Gonystylus bancanus Kurtz.  is one  of  the  tree  species in  peat-swamp  forest  that  is endangered due to excessive exploitation. The objective of this research was to assess the potency of rarnin and other commercial tree species in primary and logged over peat-swamp forests at Bagan, Riau. The tree stands were inventoried in primary forest of the 2004 and 2006 Annual Work Plan (RKTs and in  the  1997  and  2001  RKTs  managed  with  Indonesian  Selective Cutting  and  Planting  (TPTI silvicultural system.  The  result  showed  that  rarnin in  Bagan peat-swamp  forest  was not  evenly distributed. The total number of ramin  in tree stage in primary forests was fewer than that in  logged over forests.  The total number of ramin species at tree stage in primary forest was between 4.5  and 5 trees ha·' with the important value index (IVI of 10.3  to 12.0%,  whereas the one at logged over forest were between 2.5 and 15  trees ha·' with theM    indices of 7.9 to 20.4%.  Commercial species of swamp meranti (Shorea uliginosaand S. teysmaniana and balam/ suntai or (Palaqqiumspp. were dominant at tree stage both in the primary and the logged over forests. Enrichment in logged over forests is not needed since the total number of seedlings and saplings  is enough. The total number of potential core trees in logged over forests was enough for the next cutting cycle. The effort that must be done in logged over forests is to protect them from illegal logging.

  15. Genetic variation in plant volatile emission does not result in differential attraction of natural enemies in the field.

    Science.gov (United States)

    Wason, Elizabeth L; Hunter, Mark D

    2014-02-01

    Volatile organic chemical (VOC) emission by plants may serve as an adaptive plant defense by attracting the natural enemies of herbivores. For plant VOC emission to evolve as an adaptive defense, plants must show genetic variability for the trait. To date, such variability has been investigated primarily in agricultural systems, yet relatively little is known about genetic variation in VOCs emitted by natural populations of native plants. Here, we investigate intraspecific variation in constitutive and herbivore-induced plant VOC emission using the native common milkweed plant (Asclepias syriaca) and its monarch caterpillar herbivore (Danaus plexippus) in complementary field and common garden greenhouse experiments. In addition, we used a common garden field experiment to gauge natural enemy attraction to milkweed VOCs induced by monarch damage. We found evidence of genetic variation in the total constitutive and induced concentrations of VOCs and the composition of VOC blends emitted by milkweed plants. However, all milkweed genotypes responded similarly to induction by monarchs in terms of their relative change in VOC concentration and blend. Natural enemies attacked decoy caterpillars more frequently on damaged than on undamaged milkweed, and natural enemy visitation was associated with higher total VOC concentrations and with VOC blend. Thus, we present evidence that induced VOCs emitted by milkweed may function as a defense against herbivores. However, plant genotypes were equally attractive to natural enemies. Although milkweed genotypes diverge phenotypically in their VOC concentrations and blends, they converge into similar phenotypes with regard to magnitude of induction and enemy attraction.

  16. Recent benthic foraminifera and sedimentary facies from mangrove swamps and channels of Abu Dhabi (United Arab Emirates)

    Science.gov (United States)

    Fiorini, Flavia; Odeh, Weaam A. S. Al; Lokier, Stephen W.; Paul, Andreas

    2016-04-01

    Zonation of Recent mangrove environments can be defined using benthic foraminifera, however, little is known about foraminifera from mangrove environments of the Arabian Gulf. The objective of this study is to produce a detailed micropaleontological and sedimentological analysis to identify foraminiferal associations in several coastline environments (mangrove swamps and channels) located on the eastern side of Abu Dhabi Island (UAE). Detailed sediment sampling collection in mangal environments of Eastern Abu Dhabi was carried out to assess the distribution of living and dead benthic foraminifera in different sedimentary facies in the mangal and in the surrounding area comprising natural environments of the upper and lower intertidal area (mud flats and channels) and areas modified by anthropogenic activities (dredged channels). The fine-grain sediments collected near mangrove (Avicenna marina) roots presented a high abundance of living and dead foraminifera tests. The assemblages in these samples show very low diversity and are almost entirely constituted of small-sized opportunistic species belonging to the genera Ammonia and Elphidium. In particular: • Samples collected on the mud flat and in ponds at the margin of the channel show a foraminiferal assemblage characterised by abundant foraminifera belonging to the genera Ammonia, Elphidium, Triloculina, Quinqueloculina, Peneroplis and Spirolina. • Samples collected in the lower (wet) intertidal area close to Avicenna marina roots, presented a low-diversity assemblage mostly comprising opportunistic foraminifera of the genera Ammonia and Elphidium along with rare miliolidae. • Samples from the upper intertidal area (dry) close to Avicenna marina roots, produced an assemblage exclusively composed of small-sized opportunistic Ammonia and Elphidium, together with abundant specimens belonging to the genera Trochammina. Throchammina specimens have not been previously recorded from Recent sedimentary samples of

  17. Tracking the invasion of the red swamp crayfish Procambarus clarkii (Girard, 1852 (Decapoda Cambaridae in Sicily: a “citizen science” approach

    Directory of Open Access Journals (Sweden)

    Francesco Paolo Faraone

    2017-11-01

    Full Text Available The first record of the red swamp crayfish in Sicily dates back to 2003 and, since then, the species seemed to be confined to a few localities in western Sicily. A small “citizen science” project carried out from November 2016 onwards led to the creation of the “Sicilian Procambarus working group” (SPwg, which aims at monitoring the distribution and impact of the species in Sicily. To date, the SPwg found the red swamp crayfish in five new sites on the island, thus doubling the number of local sites of occurrence. The new Procambarus clarkii sites lie in different river basins, some of them located several hundred kilometres from the invaded areas known to date, suggesting the existence of multiple independent releases of the species in the wild. The need of better informing the local population on the risks exerted by invasive species on biological diversity, and of carefully monitoring the impact of P. clarkii on the Sicilian inland water biota is briefly stressed.

  18. IMPROVEMENT OF RICE GROWTH AND PRODUCTIVITY THROUGH BALANCE APPLICATION OF INORGANIC FERTILIZER AND BIOFERTILIZER IN INCEPTISOL SOIL OF LOWLAND SWAMP AREA

    Directory of Open Access Journals (Sweden)

    Neni Marlina

    2014-02-01

    Full Text Available The objective of this study was to obtain a proper balance dose between biofertilizer and inorganic fertilizer in order to increase the growth and yield of rice in Inceptisol soil of lowland swamp origin. Biofertilizer was made by enriching straw compost with N2 interceptor bacteria, phosphate solvent bacteria and growth stimulator bacteria isolated from swamp lowland in South Sumatra. This study was conducted from November 2012 to March 2013 in a greenhouse. The design used was completely randomized design (CRD factorial, with two treatment factors consisting of inorganic fertilizer (0,25, 50, 75 and 100% recommended dosage and biofertilizer (0, 100, 200, 300, 400 and 500 kg.ha-1. The results showed that the best treatment in term of plant height at 8 weeks after planting (WAP, the maximum number of tillers, number of productive tillers, number of grains per panicle and weight of milled dry rice were obtained in combination of 75% inorganic fertilizer and 300 - 400 kg.ha-1biofertilizer.

  19. A palynological study of Polynesian and European effects on vegetation in Coromandel, New Zealand, showing the variability between four records from a single swamp

    International Nuclear Information System (INIS)

    Byrami, M.; Ogden, J.; Horrocks, M.; Deng, Y.; Shane, P.; Palmer, J.

    2002-01-01

    Seven cores were extracted from a river terrace swamp in the forested Kauaeranga valley, Coromandel Peninsula, New Zealand. High-resolution (c. 36-73 yr interval) pollen records were obtained from four of the cores and aged by radiocarbon dating and with stratigraphic reference to the 665 ± 15 14 C yr BP Kaharoa Tephra. The records span the last c. 1800 yr and show that the vegetation consisted of lowland podocarp-hardwood forest before deforestation by burning occurred. The pattern of deforestation at Kauaeranga, indicated by the abrupt dominance of Pteridium with concurrent increased charcoal, is typical of pollen records associated with early Polynesian settlement in New Zealand. Peaks of Pteridium and charcoal were also found in sediments deposited after European settlement. Different cores show marked palynological and stratigraphic differences relative to the Kaharoa Tephra, most importantly with regard to the timing of deforestation. Deforestation occurred close to the Kaharoa, at a calculated age of c. 750 BP in one core but well above the Kaharoa (c. 480 BP) in another. The stratigraphic unconformities between cores are attributed to variable fluvial processes causing an uneven deposition of sediments within the swamp. (author). 32 refs., 8 figs., 4 tabs

  20. Habitat use and population structure of the invasive red swamp crayfish Procambarus clarkii (Girard, 1852 in a protected area in northern Italy

    Directory of Open Access Journals (Sweden)

    Donato Roberta

    2018-01-01

    Full Text Available The red swamp crayfish Procambarus clarkii is one of the most invasive alien species in Europe and included in the list of invasive species of Union concern. We describe for the first time some life-history traits of a red swamp crayfish population in the Nature Reserve of the Lago di Candia (Italy. We investigated (1 preferences of this species for specific environmental features on the banks of the lake, and (2 differences in size, sex ratio, and condition index between individuals caught in lake and marsh. Moreover, we compared sampling effort and the features of individuals caught in the lake, for two sampling seasons in 2014 and 2015. Findings indicated that the population was well established, and the marsh seemed to have better conditions for growth of individuals than the lake. Accordingly, continuity of riparian vegetation, opportunity to dig burrows, and trophic resource availability seems to facilitate the proliferation of the crayfish in the lake. Our study demonstrated that massive removal efforts over the whole active period of the species and more than one year of trapping are necessary to increase the controlling activities' success. This study could have important implications for further population management projects directed at biodiversity conservation in the area.

  1. From one marsh to another, changing swamps - Exercise of reflexivity within the water and territories system: wetland renaturation / restoration

    Science.gov (United States)

    Sandoz, Alain; Chauvelon, Philippe; Boutron, Olivier

    2013-04-01

    In relation to the"Plan National en faveur des Zones Humides", the project aims to provide food for thought, from the interdisciplinary articulation , for the development, organizational arrangements and the level of water governance. The methods that will permit to better understand how work studied ecosystems and to measure the anthropogenic and natural part of the functioning of these territories. The methods will be based on a landscape approach and facilitated by the techniques used in landscape ecology making wide use of the techniques from geomatic (GIS, digital photogrammetry, satellite remote sensing...). Additional studies from data collected in the field will also be made in particular to improve our understanding of hydrology, water quality... . The two sites selected by this proposal covers two wetlands of national and international interests. Both are located in natural regional parks (NRP): Alpilles and Camargue, the NRP of Camargue is furthermore included in the "Man and Biosphere Reserve" of the Rhone delta. The first concerns the "Vallée des marais des Baux", the second, the "Salins de Giraud". The complexity of natural and human issues make such territories privileged study sites. Located both in the west of the "Bouches du Rhône" department, these territories have very different human and physical characteristics. We develop in this presentation only the first, the "Vallée des marais des Baux". Under the initiative of several private owners, voluntary marshes restoration experiments are conducted. This area covering about 1300 hectares was originally swamp. Since the Romans, many attempts have succeeded in drying up the area but it's not until 1950-1960 that the technical development allowed to realize so - exception of small areas of relict marsh - implementing development centred on agriculture. Following to major floods in 2003, the sector is defined (Rhône river master plan) as an flood expansion area. Moreover, there is some decline of

  2. Swamp Works: A New Approach to Develop Space Mining and Resource Extraction Technologies at the National Aeronautics Space Administration (NASA) Kennedy Space Center (KSC)

    Science.gov (United States)

    Mueller, R. P.; Sibille, L.; Leucht, K.; Smith, J. D.; Townsend, I. I.; Nick, A. J.; Schuler, J. M.

    2015-01-01

    The first steps for In Situ Resource Utilization (ISRU) on target bodies such as the Moon, Mars and Near Earth Asteroids (NEA), and even comets, involve the same sequence of steps as in the terrestrial mining of resources. First exploration including prospecting must occur, and then the resource must be acquired through excavation methods if it is of value. Subsequently a load, haul and dump sequence of events occurs, followed by processing of the resource in an ISRU plant, to produce useful commodities. While these technologies and related supporting operations are mature in terrestrial applications, they will be different in space since the environment and indigenous materials are different than on Earth. In addition, the equipment must be highly automated, since for the majority of the production cycle time, there will be no humans present to assist or intervene. This space mining equipment must withstand a harsh environment which includes vacuum, radical temperature swing cycles, highly abrasive lofted dust, electrostatic effects, van der Waals forces effects, galactic cosmic radiation, solar particle events, high thermal gradients when spanning sunlight terminators, steep slopes into craters / lava tubes and cryogenic temperatures as low as 40 K in permanently shadowed regions. In addition the equipment must be tele-operated from Earth or a local base where the crew is sheltered. If the tele-operation occurs from Earth then significant communications latency effects mandate the use of autonomous control systems in the mining equipment. While this is an extremely challenging engineering design scenario, it is also an opportunity, since the technologies developed in this endeavor could be used in the next generations of terrestrial mining equipment, in order to mine deeper, safer, more economical and with a higher degree of flexibility. New space technologies could precipitate new mining solutions here on Earth. The NASA KSC Swamp Works is an innovation

  3. NILAI EKONOMI KARBON HUTAN RAWA GAMBUT MERANG KEPAYANG, PROVINSI SUMATERA SELATAN (Economic Value of Carbon of Merang Kepayang Peat Swamp Forest, South Sumatera Province

    Directory of Open Access Journals (Sweden)

    Nur Arifatul Ulya

    2015-03-01

    Full Text Available ABSTRAK Hutan rawa gambut menyimpan cadangan karbon baik di tanah maupun di atas tanah. Hutan Rawa Gambut Merang Kepayang (HRGMK merupakan kawasan hutan yang berada di kubah gambut terbesar di Sumatera Selatan, yaitu Kubah Gambut Merang (KGM, yang didalamnya terdapat gambut dengan ketebalan lebih dari 3 meter. Meskipun menurut aturan KGM seharusnya dikonservasi, pada kenyataannya kawasan HRGMK dihadapkan pada konversi. Konversi HRGMK diduga akan mengakibatkan terganggunya fungsi hutan rawa gambut sebagai cadangan karbon dunia sehingga akan menyebabkan terjadinya emisi karbon ke atmosfer dalam jumlah besar. Penelitian ini bertujuan untuk mengetahui nilai ekonomi kawasan HRGMK sebagai penyimpan cadangan karbon. Hasil penelitian diharapkan menjadi acuan pelestarian HRGMK sebagai stabilisator iklim dunia. Nilai ekonomi karbon HRGMK ditaksir dengan menggunakan harga bayangan. Harga karbon yang digunakan untuk menaksir nilai ekonomi karbon diperoleh dengan metode benefit transfer. Hasil penelitian menunjukkan bahwa nilai total karbon HRGMK adalah US$ 1.591.878.378,00 atau Rp. 14.002.162.211.645,00. Nilai tersebut sebagian besar berasal dari cadangan karbon di bawah tanah. ABSTRACT Peat swamp forests store aboveground and belowground carbon. Merang Kepayang Peat Swamp Forest (MKPSF is a forest area which is located in Merang Peat Dome (MPD, the largest peat dome in South Sumatra, with peat thickness more than 3 meters. Although the order should be conserved MPD, in fact MKPSF area exposed to the conversion. MKPSF conversion would presumably result in impaired function of peat swamp forest as world's carbon storage that will be caused carbon emissions into the atmosphere in large quantities. This study aimed to determine the economic value of the HRGMK as carbon storage. The results are expected to be justifications for conservation of MKPSF as climate stabilizers. The economic value of carbon HRGMK assessed using shadow pricing method. The carbon price

  4. Environmental Impact Statement. Deactivation of the Minuteman II Missile Wing at Whiteman Air Force Base, Missouri

    Science.gov (United States)

    1992-08-01

    holidays would cause the missile removal and transport rate to vary. i Under existing operations, approximately 1 day is required to remove the RV and...flying. A similar reaction would occur if a predator or competitor entered an individual’s habitat area. I Reactions to sudden noise, such as blasting...Cos. outcrops, saline- soil prairies Mead’s milkweed T Barton, Ben- Virgin blue- (Asclepias meadii) ton, Cass, stem Dade, Pettis, prairies Polk, St

  5. The effect of mixed liming and NPK fertilizer to yield of some rice varieties on new openings of acid sulfate tidal swamp land

    Science.gov (United States)

    Akhmad, A.; Dewi, W. S.; Sagiman, S.; Suntoro

    2018-03-01

    The strategies to meet the staple food needs in Indonesia is to open new paddy fields in the sub-optimal land. The research aims to get adaptive rice varieties with the highest yield on new openings of the acid sulfate tidal swamp applying mixed liming and NPK fertilizer. The experiment was conducted in a greenhouse at the Faculty of Agriculture, Tanjungpura University, Pontianak. The trials used a factorial completely randomized block design consisting of two factors. The first factor is a mixture of dolomite with NPK fertilizer, consisting of 3 levels (1 ton/ha dolomite and 60 kg/ha NPK; 2 ton/ha dolomite and 90 kg/ha of NPK, and 3 ton/ha dolomite and 120 kg/ha NPK). The second factor is rice varieties, consisting of 6 levels (Ciherang, Situ Bagendit, Inpara, Mira, Si Randah and Ringkak Janggut). Each treatment replicated four times. The results showed that the application of a mixture of 3 ton/ha dolomite and 120 kg/ha of NPK fertilizer showed the best results to improve rice yield on new opening of the acid sulfate tidal swap. Local rice varieties, Ringkak Janggut, applied 3 ton/ha dolomite and 120 kg/ha NPK fertilizer showed the best result of 1000 seed weight, i.e., 28.19 g, and total grain amount per panicle is 110.75 grains, with the lowest number of empty grains. Local rice varieties Ringkak Janggut potential to be developed as superior varieties on new opening acid sulfate tidal swamps by applying liming and fertilizer.

  6. Fitossociologia de dois trechos inundáveis de Matas de Galeria no Distrito Federal, Brasil Phytosociology of two swamped portions of gallery forests in Distrito Federal, Brazil

    Directory of Open Access Journals (Sweden)

    Ernestino de Souza Gomes Guarino

    2005-09-01

    Full Text Available As Matas de Galeria do bioma Cerrado possuem peculiaridades fisionômicas e florísticas que permitem separá-las em dois subtipos: "não-inundável", quando em solos bem drenados; e "inundável", o subtipo menos estudado, em solos mal drenados. O presente trabalho objetivou caracterizar estrutural e floristicamente dois trechos inundáveis das matas dos córregos Acampamento (15°35'S; 48°10'W e Riacho Fundo (15°55'S; 48°02'W no Distrito Federal (DF. Para isso foi alocada em cada Mata uma grade de 160×50 m (0,8 ha, composta por 40 parcelas de 10×20 m (200 m². Todos os indivíduos com diâmetro a 1,30 m da altura do solo (DAP > 3,0 cm foram amostrados, incluindo aqueles mortos ainda em pé. Foram amostrados 6.078 indivíduos, sendo 3.030 no trecho do Acampamento (33 famílias, 49 gêneros e 60 espécies e 3.048 no Riacho Fundo (30 famílias, 41 gêneros, 53 espécies. A área basal e a diversidade (H' calculada para os trechos foram de 47,96 m²/ha e 2,99 nats/ind. (Acampamento, e 41,28 m²/ha e 2,84 nats/ind. (Riacho Fundo, respectivamente. Se comparados com matas anteriormente estudadas no DF os valores de diversidade são baixos, estando na mesma magnitude indicada para as Matas de Brejo (Higrófilas do sudeste brasileiro. Os índices de similaridade indicaram alta semelhança qualitativa (Sørensen 58,0% e quantitativa (Morisita 70,6% entre os trechos estudados, embora uma classificação por TWINSPAN tenha gerado dois grupos distintos, cada qual vinculado a um dos trechos. Os resultados reforçam indicações anteriores de que as Matas de Galeria do DF, ou trechos similares destas, inundáveis ou não, possuem comunidades arbóreas particulares, as quais estão relacionadas à bacia hidrográfica na qual a Mata esta inserida e ao padrão determinante da drenagem do solo.Gallery forests in the Cerrado biome possess physiognomic and floristic peculiarities that allow its division in two subtypes: "non-swamp" located in well drained

  7. Efeito da densidade e da distância de caruru-de-mancha e amendoim-bravo na cultura do feijoeiro Effect of the density and distance of slender amaranth and milkweed on the common bean (Phaseolus vulgari

    Directory of Open Access Journals (Sweden)

    A.A.M. Barroso

    2012-03-01

    Full Text Available O objetivo deste trabalho foi avaliar a interferência causada pelo caruru-demancha (Amaranthus viridis e amendoim-bravo (Euphorbia heterophylla, em função das densidades e distâncias, no feijoeiro (Phaseolus vulgaris cultivar Pérola. Como recipientes, foram utilizadas caixas de cimento-amianto, com capacidade para 50 litros, preenchidas com LatossoloVermelho-Escuro. As mudas foram formadas em bandejas de 128 células preenchidas com substrato hortícola; quando as plântulas atingiram o estádio V2, foram transplantadas para as caixas, sendo as de feijoeiro numa linha central, reproduzindo a semeadura em campo, e as das plantas daninhas nas densidades de 8, 16 e 32 plantas m-2, distanciadas de 0, 12 e 24 cm das plantas de feijão e igualmente entre si. O experimento foi conduzido no delineamento experimental de blocos casualizados, com os tratamentos dispostos em esquema fatorial 3x3+2T, com quatro repetições, constituindo as parcelas experimentais. Foram avaliadas características de crescimento e de produtividade da cultura e das plantas daninhas. Os dados obtidos foram submetidos à análise de variância pelo teste F, e as médias, comparadas pelo teste de Tukey. Observou-se que as plantas daninhas obtiveram maior desenvolvimento quando em maior distância da cultura. O caruru-de-mancha causou reduções no número de vagens e na produtividade estimada do feijoeiro. Para o caruru-de-mancha, o aumento da densidade só causou redução na produtividade da cultura quando as plantas estavam distanciadas em pelo menos 12 cm. A 0 cm, o feijoeiro tornou-se mais competitivo e não sofreu interferência das plantas daninhas, independentemente da densidade destas.The aim of this study was to evaluate the interference caused by Slender amaranth (Amaranthus viridis and Milkweed (Euphorbia heterophylla at different densities and distances in the common bean (Phaseolus vulgaris cv. Pérola. The experiment was carried out using asbestos cement boxes

  8. High Throughput Sequencing to Detect Differences in Methanotrophic Methylococcaceae and Methylocystaceae in Surface Peat, Forest Soil, and Sphagnum Moss in Cranesville Swamp Preserve, West Virginia, USA

    Science.gov (United States)

    Lau, Evan; Nolan, Edward J.; Dillard, Zachary W.; Dague, Ryan D.; Semple, Amanda L.; Wentzell, Wendi L.

    2015-01-01

    Northern temperate forest soils and Sphagnum-dominated peatlands are a major source and sink of methane. In these ecosystems, methane is mainly oxidized by aerobic methanotrophic bacteria, which are typically found in aerated forest soils, surface peat, and Sphagnum moss. We contrasted methanotrophic bacterial diversity and abundances from the (i) organic horizon of forest soil; (ii) surface peat; and (iii) submerged Sphagnum moss from Cranesville Swamp Preserve, West Virginia, using multiplex sequencing of bacterial 16S rRNA (V3 region) gene amplicons. From ~1 million reads, >50,000 unique OTUs (Operational Taxonomic Units), 29 and 34 unique sequences were detected in the Methylococcaceae and Methylocystaceae, respectively, and 24 potential methanotrophs in the Beijerinckiaceae were also identified. Methylacidiphilum-like methanotrophs were not detected. Proteobacterial methanotrophic bacteria constitute Sphagnum moss) or co-occurred in both Sphagnum moss and peat. This study provides insights into the structure of methanotrophic communities in relationship to habitat type, and suggests that peat and Sphagnum moss can influence methanotroph community structure and biogeography. PMID:27682082

  9. Gonad development and size at maturity of the male mud crab Scylla paramamosain (Forsskål, 1755 in a tropical mangrove swamp

    Directory of Open Access Journals (Sweden)

    Md. Sherazul Islam

    2013-12-01

    Full Text Available The reproductive traits and size at sexual maturity of the male mud crab Scylla paramamosain were investigated in Pak Phanang mangrove swamps, Thailand. Samples were taken seven times from the local middlemen mud crab traders during June 2006 to January 2008. Gonad development was determined based on histological appearance that was classified into three stages: 1 Immature (Spermatogonia, 2 Maturing (Spermatocytes and 3 Mature (Spermatids and Spermatozoa. Among the sample population, the highest 72% was under gonad development stage I, whereas mature stage III was only 12%. The size at first maturity was estimated by the external allometric growth and histological observation of gonad. The size at which 50% of individuals attain sexual maturity was estimated by the two mathematical models such as probit analysis and logistic curve. The mean size at first sexual maturity and 50% maturation of male S. paramamosain were 96 mm and 109 mm internal carapace width (ICW which revealed that 88% individuals were immature. The present result suggested that the minimum legal size of male S. paramamosain capture should be >110 mm ICW.

  10. Transport and Retention of Nitrogen, Phosphorus and Carbon in North America’s Largest River Swamp Basin, the Atchafalaya River Basin

    Directory of Open Access Journals (Sweden)

    Y. Jun Xu

    2013-04-01

    Full Text Available Floodplains and river corridor wetlands may be effectively managed for reducing nutrients and carbon. However, our understanding is limited to the reduction potential of these natural riverine systems. This study utilized the long-term (1978–2004 river discharge and water quality records from an upriver and a downriver location of the Atchafalaya River to quantify the inflow, outflow, and inflow–outflow mass balance of total Kjeldahl nitrogen (TKN = organic nitrogen + ammonia nitrogen, nitrate + nitrite nitrogen (NO3 + NO2, total phosphorous (TP, and total organic carbon (TOC through the largest river swamp basin in North America. The study found that, over the past 27 years, the Atchafalaya River Basin (ARB acted as a significant sink for TKN (annual retention: 24%, TP (41%, and TOC (12%, but a source for NO3 + NO2 nitrogen (6%. On an annual basis, ARB retained 48,500 t TKN, 16,900 t TP, and 167,100 t TOC from the river water. The retention rates were closely and positively related to the river discharge with highs during the winter and spring and lows in the late summer. The higher NO3 + NO2 mass outflow occurred throughout spring and summer, indicating an active role of biological processes on nitrogen as water and air temperatures in the basin rise.

  11. Bringing Healthy Retail to Urban "Food Swamps": a Case Study of CBPR-Informed Policy and Neighborhood Change in San Francisco.

    Science.gov (United States)

    Minkler, Meredith; Estrada, Jessica; Thayer, Ryan; Juachon, Lisa; Wakimoto, Patricia; Falbe, Jennifer

    2018-04-09

    In urban "food swamps" like San Francisco's Tenderloin, the absence of full-service grocery stores and plethora of corner stores saturated with tobacco, alcohol, and processed food contribute to high rates of chronic disease. We explore the genesis of the Tenderloin Healthy Corner Store Coalition, its relationship with health department and academic partners, and its contributions to the passage and implementation of a healthy retail ordinance through community-based participatory research (CBPR), capacity building, and advocacy. The healthy retail ordinance incentivizes small stores to increase space for healthy foods and decrease tobacco and alcohol availability. Through Yin's multi-method case study analysis, we examined the partnership's processes and contributions to the ordinance within the framework of Kingdon's three-stage policymaking model. We also assessed preliminary outcomes of the ordinance, including a 35% increase in produce sales and moderate declines in tobacco sales in the first four stores participating in the Tenderloin, as well as a "ripple effect," through which non-participating stores also improved their retail environments. Despite challenges, CBPR partnerships led by a strong community coalition concerned with bedrock issues like food justice and neighborhood inequities in tobacco exposure may represent an important avenue for health equity-focused research and its translation into practice.

  12. Importance of body-water circulation for body-heat dissipation in hot-humid climates: a distinctive body-water circulation in swamp buffaloes

    Directory of Open Access Journals (Sweden)

    S. Chanpongsang

    2010-02-01

    Full Text Available Thermo-regulation in swamp buffaloes has been investigated as an adaptive system to hot-humid climates, and several distinctive physiological responses were noted. When rectal temperature increased in hot conditions, blood volume, blood flow to the skin surface and skin temperature markedly increased in buffaloes relatively to cattle. On the other hand, the correlation between blood volume and plasma concentration of arginine vasopressin (AVP was compared between buffaloes and cattle under dehydration. Although plasma AVP in cattle increased immediately for reducing urine volume against a decrease in blood volume as well as the response observed in most animal species, the increase in plasma AVP was delayed in buffaloes, even after a large decrease in blood volume. In buffaloes, a marked increase in blood volume facilitated the dissipation of excess heat from the skin surface during wallowing. In addition, the change in plasma AVP observed in buffaloes was consistent with that of other animals living in habitats with the high availability of water. These results suggest that the thermo-regulatory system in buffaloes accelerates body-water circulation internally and externally. This system may be adaptive for heat dissipation in hot-humid climates, where an abundance of water is common.

  13. Traffic-emitted metal status and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in roadside turfy swamp in the Changbai Mountain area, China.

    Science.gov (United States)

    Wang, Hong; Nie, Lei; Xu, Yan; Li, Miao; Lv, Yan

    2018-04-26

    Six traffic-emitted metals (Cr, Zn, Cu, Cd, Pb, and Ni) were determined in soil and plants for below- and aboveground parts along different distances from highway to evaluate their behavior and uptake by Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald growing in turfy swamps. The results indicated that the different plant tissues showed significantly different levels of metal content. Nonlinear regression analysis indicated that metal contents leveled off at constant values before they decreased as the distance from the roadside increased. The high R 2 values of the regression model indicated good fit of the exponential function applied to depict the distribution pattern of the metal elements. It was deduced that Cr, Cu, and Cd in Thelypteris palustris var. pubescens Fernald were mainly derived from the soil; Carex meyeriana Kunth and Thelypteris palustris var. pubescens Fernald absorbed Pb mainly through the stomata from atmospheric depositions; Cr, Cu, and Cd in Carex meyeriana Kunth and Zn in Thelypteris palustris var. pubescens Fernald were mainly affected by soil and atmospheric depositions. After excluding the effects of traffic, only the bioaccumulation factor of Cd (1.34) in Carex meyeriana Kunth and the translocation factor of Zn (1.13) in Thelypteris palustris var. pubescens Fernald were greater than 1, suggesting that Carex meyeriana Kunth could be a good candidate for assimilating Cd from soils and Thelypteris palustris var. pubescens Fernald could be suitable for the phytoextraction of Zn.

  14. Milkweed, stink bugs, and Georgia cotton

    Science.gov (United States)

    In peanut-cotton farmscapes in Georgia, stink bugs, i.e., Nezara viridula (L.)(Say) and Chinavia hilaris (Say), develop in peanut and then disperse at the crop-to-crop interface to feed on fruit in cotton. The main objective of this study was to examine the influence of a habitat of tropical milkwe...

  15. A Study on Remote Probing Method for Drawing Ecology/Nature Map and the Application (III) - Drawing the Swamp Classification Map around River

    Energy Technology Data Exchange (ETDEWEB)

    Jeon, Seong Woo; Cho, Jeong Keon; Jeong, Hwi Chol [Korea Environment Institute, Seoul (Korea)

    2000-12-01

    The map of ecology/nature in the amended Natural Environment Conservation Act is the necessary data, which is drawn through assessing the national land with ecological factors, to execute the Korea's environmental policy. Such important ecology/nature map should be continuously revised and improved the reliability with adding several new factors. In this point of view, this study has the significance in presenting the improvement scheme of ecology/nature map. 'A Study on Remote Probing Method for Drawing Ecology/Nature Map and the Application' that has been performed for 3 years since 1998 has researched the drawing method of subject maps that could be built in a short time - a land-covering classification map, a vegetation classification map, and a swamp classification map around river - and the promoting principles hereafter. This study also presented the possibility and limit of classification by several satellite image data, so it would be a big help to build the subject map in the Government level. The land-covering classification map, a result of the first year, has been already being built by Ministry of Environment as a national project, and the improvement scheme of the vegetation map that was presented as a result of second year has been used in building the basic ecology/nature map. We hope that the results from this study will be applied as basic data to draw an ecology/nature map and contribute to expanding the understanding on the usefulness of the several ecosystem analysis methods with applying an ecology/nature map and a remote probe. 55 refs., 38 figs., 24 tabs.

  16. Increased temperature tolerance of the air-breathing Asian swamp eel Monopterus albus after high-temperature acclimation is not explained by improved cardiorespiratory performance.

    Science.gov (United States)

    Lefevre, S; Findorf, I; Bayley, M; Huong, D T T; Wang, T

    2016-01-01

    This study investigated the hypothesis that in the Asian swamp eel Monopterus albus, an air-breathing fish from south-east Asia that uses the buccopharyngeal cavity for oxygen uptake, the upper critical temperature (TU) is increased by acclimation to higher temperature, and that the increased TU is associated with improved cardiovascular and respiratory function. Monopterus albus were therefore acclimated to 27° C (current average) and 32° C (current maximum temperature as well as projected average within 100-200 years), and both the effect of acclimation and acute temperature increments on cardiovascular and respiratory functions were investigated. Two weeks of heat acclimation increased upper tolerated temperature (TU ) by 2° C from 36·9 ± 0·1° C to 38·9 ± 0·1° C (mean ± s.e.). Oxygen uptake (M˙O2) increased with acclimation temperature, accommodated by increases in both aerial and aquatic respiration. Overall, M˙O2 from air (M˙O2a ) was predominant, representing 85% in 27° C acclimated fish and 80% in 32° C acclimated fish. M˙O2 increased with acute increments in temperature and this increase was entirely accommodated by an increase in air-breathing frequency and M˙O2a . Monopterus albus failed to upregulate stroke volume; rather, cardiac output was maintained through increased heart rate with rising temperature. Overall, acclimation of M. albus to 32° C did not improve its cardiovascular and respiratory performance at higher temperatures, and cardiovascular adaptations, therefore, do not appear to contribute to the observed increase in TU. © 2015 The Fisheries Society of the British Isles.

  17. PcToll3 was involved in anti-Vibrio response by regulating the expression of antimicrobial peptides in red swamp crayfish, Procambarus clarkii.

    Science.gov (United States)

    Lan, Jiang-Feng; Wei, Shun; Wang, Yu-Qing; Dai, Yun-Jia; Tu, Jia-Gang; Zhao, Li-Juan; Li, Xin-Cang; Qin, Qi-Wei; Chen, Nan; Lin, Li

    2016-10-01

    Tolls and Toll-like receptors (TLRs) play an important role in host immune defenses by regulating the expression of antimicrobial peptides (AMPs) and cytokines, but the functional differences of crustacean Tolls from Drosophila Tolls or Mammal TLRs are largely unknown. A novel Toll receptor, named PcToll3, was identified from red swamp crayfish, Procambarus clarkii. It was widely expressed in all detected tissues, and its transcript in hemocytes was up-regulated at 12 h after Vibrio parahemolyticus (Vibrio) injection or at 24 h post white spot syndrome virus (WSSV) challenge. After knockdown of PcToll3, the activity of bacterial clearance was inhibited, and the expression levels of AMPs including Crustin1 (Cru1), Anti-lippopolysaccharide factor 1 (ALF1), and Lysozymes1 (Lys1), which could be up-regulated by Vibrio, were all affected. Meanwhile, PcToll3 silencing influenced the expression of myeloid differentiation factor 88 (PcMyd88), tumor necrosis factor-associated factor 6 (PcTRAF6), and PcDorsal, which were the counterparts of Drosophila Toll signaling pathway. Interestingly, PcToll3 silencing inhibited translocation of PcDorsal from cytoplasm to nucleus. Furthermore, the knockdown of PcDorsal also impaired the expression of AMPs after Vibrio challenge. Hence, we concluded that, besides participating in antiviral immunity, PcToll3 might also regulate the expression of Cru1 and Lys1 to participate in anti-Vibrio immune responses by promoting PcDorsal translocation into nucleus. Copyright © 2016 Elsevier Ltd. All rights reserved.

  18. Swamp buffalo keeping – an out-dated farming activity? A case study in smallholder farming systems in Xishuangbanna, Yunnan Province, PR China

    Directory of Open Access Journals (Sweden)

    Anne Schiborra

    2012-01-01

    Full Text Available Expansion of rubber tree plantations and agricultural mechanization caused a decline of swamp buffalo numbers in the Naban River National Nature Reserve (NRNNR, Yunnan Province, China. We analysed current use of buffaloes for field work and the recent development of the regional buffalo population, based on interviews with 184 farmers in 2007/2008 and discussions with 62 buffalo keepers in 2009. Three types of NRNNR farms were distinguished, differing mainly in altitude, area under rubber, and involvement in livestock husbandry. While pig based farms (PB; n=37 have abandoned buffalo keeping, 11% of the rubber based farms (RB; n=71 and 100% of the livestock-corn based farms (LB; n=76 kept buffaloes in 2008. Herd size was 2.5 +/-1.80 (n=84 buffaloes in early 2008 and 2.2 +/-1.69 (n=62 in 2009. Field work on own land was the main reason for keeping buffaloes (87.3 %, but lending work buffaloes to neighbours (79.0% was also important. Other purposes were transport of goods (16.1%, buffalo trade (11.3% and meat consumption (6.4%. Buffalo care required 6.2 +/-3.00 working hours daily, while annual working time of a buffalo was 294 +/-216.6 hours. The area ploughed with buffaloes remained constant during the past 10 years despite an expansion of land cropped per farm. Although further replacement of buffaloes by tractors occurs rapidly, buffaloes still provide cheap work force and buffer risks on poor NRNNR farms. Appropriate advice is needed for improved breeding management to increase the efficiency of buffalo husbandry and provide better opportunities for buffalo meat sale in the region.

  19. PENGEMBANGAN KONSEP AGROINDUSTRI BERBASIS SISTEM USAHATANI TERPADU DI WILAYAH PASANG SURUT BAGIAN I: (KONSEP PEMIKIRAN The Concept Development of Agroindustry Based on Integrated Farming System at Tidal Swamp Land Areas Chapter I: Conceptual Thinkin

    Directory of Open Access Journals (Sweden)

    Rustan Massinai

    2013-06-01

    Full Text Available Integrated farming system was directed in efforts to lengthen biological cycle by optimizing use of agriculture and livestock products. Each chain of cycle resulted new product that have high economic value, so this system was expected to optimize empowerment and use of marginal land in all regions. The problems encountered in agricultural systems in tidal swamp land in general, i.e; (a limitations in the form of land, human resources, technology, and capital owned by farmers, then the potential of local resources need to be managed optimally, directed, integrated and sustainable with a view to improve land productivity and living standards of farmers by way of application of integrated farming systems by integrating crop and livestock based on the potential of local areas, and (b socio-economic problems and constraints in the development of food crops was due to a swamp area. The objective of this research was to produce integrated farming system concept to support agroindustry development in tidal swamp land in Pulang Pisau regency of Central Kalimantan province. This research was conducted with a book study method, which identifies a system consisting of integrated farming and agroindustry systems. In the both identification is performed by the system includes four aspects, i,e; economic aspects, technical aspects, social aspects of cultural and environmental. Integrated farming systems concept in tidal swamp land was generated from the production of integrated farming systems should first be processed through the processing system (agroindustry in the form of home industry, or using a mechanical device. After that, it was carried out the marketing of products, systems concepts was expected to increase the added value of agricultural production (rice, coffee and cow. With the application of agroindustry systems in tidal swamp land Pulang Pisau regency of Central Kalimantan Province is expected to increase the economic income of farmers in

  20. Estrutura de uma floresta brejosa em substrato turfoso, Sul de Santa Catarina, Brasil Structure of a swamp forests on peat substrates, south of Santa Catarina, Brazil

    Directory of Open Access Journals (Sweden)

    Rafael Martins

    2013-04-01

    Full Text Available Objetivou-se descrever a diversidade e a estrutura do componente lenhoso de uma floresta brejosa em substrato turfoso no sul do Estado de Santa Catarina, correlacionando dados florísticos com variáveis ambientais. Indivíduos com DAP ≥ 5 cm foram amostrados em 100 parcelas de 10 x 10 m em um quadrado permanente de 1 ha. As variáveis ambientais foram classificadas em topográficas, químicas e texturais do solo e de luminosidade. Correlações espécie-ambiente foram obtidas por Análise de Correspondência Canônica (CCA. Comparações florísticas foram realizadas por análise de agrupamento (UPGMA e análise de correspondência. A diversidade específica foi considerada baixa, pois foram amostradas apenas 26 espécies. A CCA evidenciou que as variáveis ambientais mensuradas possuem pouca influência na distribuição das espécies, ressaltando assim sua adaptação ao ambiente anóxico, fortemente limitante. Dados de similaridade demonstraram que o substrato turfoso age como um filtro ambiental adicional, além do estresse hídrico, na composição de espécies nas formações turfosas/brejosas.This study aimed to describe the diversity and structure of woody vegetation of a swamp forests on peat substrate in the southern state of Santa Catarina, correlating floristic data with environmental variables. Individuals with DBH < 5 cm were sampled in 100 plots of 10 x 10 m in one hectare squared plot. Environmental variables are classified in topographical, chemical and soil texture and light availability. Species-environment correlations were obtained by Canonical Correspondence Analysis (CCA. Floristic comparisons were performed by cluster (UPGMA and correspondence analysis. Diversity was considered low because of the occurrence only 26 species in the whole sample. The CCA revealed that the measured variables have little influence on the distribution of species, highlighting the adaptation of these strong limiting environment. Similarity

  1. The socio-cultural importance of Mauritia flexuosa palm swamps (aguajales) and implications for multi-use management in two Maijuna communities of the Peruvian Amazon.

    Science.gov (United States)

    Gilmore, Michael P; Endress, Bryan A; Horn, Christa M

    2013-04-22

    Fruit from the palm Mauritia flexuosa (aguaje) is harvested throughout the Peruvian Amazon for subsistence and commercial purposes. Recent estimates suggest that residents of Iquitos, the largest city in the region, consume approximately 148.8 metric tons of aguaje fruit per month, the vast majority of which is harvested by felling and killing adult female trees. In this study, we sought to better understand and document the importance of M. flexuosa palm swamps (aguajales) in two Maijuna indigenous communities to inform the sustainable management of this habitat and species. Semi-structured interviews, focus groups, and household surveys were carried out to assess the significance of aguajales and their associated plant and animal resources as well as to determine how the relationship that the Maijuna have with aguajales has changed over time. Aguajales and their associated resources are culturally significant and useful to the Maijuna in a wide variety of ways. In addition to M. flexuosa, the Maijuna use over 60 different species of plants from aguajales. When M. flexuosa is in fruit, aguajales are important hunting areas with a total of 20 different animal species hunted. The Maijuna also have traditional beliefs about aguajales, believing that malevolent supernatural beings reside in them. Notably, the relationship that the Maijuna have with aguajales has changed considerably over the years as aguaje fruit went from a subsistence item collected opportunistically from the ground to a market good destructively harvested beginning in the early 1990s. The Maijuna are concerned not only about how this has affected the future commercial harvest of aguaje but also about its effects on game animals given the importance of hunting to Maijuna cultural identity, subsistence, and income generation. In order to meet the multiple socio-cultural and economic needs of the Maijuna, sustainable management efforts must be expanded to not only focus on the commercial harvest of

  2. Properties and expression of Na+/K+-ATPase α-subunit isoforms in the brain of the swamp eel, Monopterus albus, which has unusually high brain ammonia tolerance.

    Directory of Open Access Journals (Sweden)

    Xiu L Chen

    Full Text Available The swamp eel, Monopterus albus, can survive in high concentrations of ammonia (>75 mmol l(-1 and accumulate ammonia to high concentrations in its brain (4.5 µmol g(-1. Na(+/K(+-ATPase (Nka is an essential transporter in brain cells, and since NH4(+ can substitute for K(+ to activate Nka, we hypothesized that the brain of M. albus expressed multiple forms of Nka α-subunits, some of which might have high K(+ specificity. Thus, this study aimed to clone and sequence the nka α-subunits from the brain of M. albus, and to determine the effects of ammonia exposure on their mRNA expression and overall protein abundance. The effectiveness of NH4(+ to activate brain Nka from M. albus and Mus musculus was also examined by comparing their Na(+/K(+-ATPase and Na(+/NH4(+-ATPase activities over a range of K(+/NH4(+ concentrations. The full length cDNA coding sequences of three nkaα (nkaα1, nkaα3a and nkaα3b were identified in the brain of M. albus, but nkaα2 expression was undetectable. Exposure to 50 mmol l(-1 NH4Cl for 1 day or 6 days resulted in significant decreases in the mRNA expression of nkaα1, nkaα3a and nkaα3b. The overall Nka protein abundance also decreased significantly after 6 days of ammonia exposure. For M. albus, brain Na(+/NH4(+-ATPase activities were significantly lower than the Na(+/K(+-ATPase activities assayed at various NH4(+/K(+ concentrations. Furthermore, the effectiveness of NH4(+ to activate Nka from the brain of M. albus was significantly lower than that from the brain of M. musculus, which is ammonia-sensitive. Hence, the (1 lack of nkaα2 expression, (2 high K(+ specificity of K(+ binding sites of Nkaα1, Nkaα3a and Nkaα3b, and (3 down-regulation of mRNA expression of all three nkaα isoforms and the overall Nka protein abundance in response to ammonia exposure might be some of the contributing factors to the high brain ammonia tolerance in M. albus.

  3. Performans Produksi, Jumlah Nematoda Usus, dan Profil Metabolik Darah Kambing yang Diberi Pakan Hijauan Rawa Kalimantan (PRODUCTION PERFORMANS, INTESTINE NEMATODE NUMBER AND METABOLIC BLOOD PROFILE OF GOAT FEED WITH BORNEO SWAMP FORAGE

    Directory of Open Access Journals (Sweden)

    Tintin Rostini

    2017-09-01

    Full Text Available This study aims were to determine the effect of the use of swamp forage on the performances, the number of nematodes and the blood metabolic profile in goats. In this study, as many as 24 male goats were used; consisted of 12 local male goats (kacang goat with the average weight ranged from 12.65±1.65kg (diversity coefficient 11.34% and 12 PE goats with the average weight of 18.05±0.62 kg (diversity coefficient 7.54%. This research used a completely randomized factorial design (CRD 2x4 with 2 main treatments x 4 factorials and three replications. The first factor was based on the goat breed being used (Kacang and Peranakan Etawah. The second factor was based on four differents feed percentages that used, i.e.: (PR0 40% grass forage and 60% concentrate, (PR1 60% grass forage and 40% concentrate, (PR2, 40% of swamp forage and concentrates 60%, (PR3 60% swamp forage and 40% concentrate. Data were analyzed by using analysis of variance, then continued with Duncan test. The results of this study showed that the consumption of nutrients, daily weight gain and feed efficiency in treatment provision of swamp forage up to 60% (PR3 gave best result based on the metabolic profile of blood (total protein, glucose, cholesterol, Ca and P. The number of worm eggs in the goat feces were still in normal range. It was concluded that swamp forage is a potential forage that can be used as an alternative towards grass forage for the goats. ABSTRAK Penelitian ini bertujuan untuk mengetahui pengaruh penggunaan hijauan rawa terhadap performans, jumlah nematoda, dan profil metabolik darah kambing. Pada penelitian ini digunakan ternak kambing jantan sebanyak 24 ekor. Kambing yang digunakan terdiri dari 12 ekor kambing kacang jantan dengan rataan bobot badan berkisar antara 12,65 ± 1,65 kg (koefisien keragaman 11,34% dan 12 ekor kambing peranakan etawah (PE dengan rataan bobot badan 18,05 ± 0,62 kg (koefisien keragaman 7,54%. Dalam penelitian ini digunakan rancangan

  4. Footpaths in the Stuff Swamp.

    Science.gov (United States)

    Dron, Jon; Boyne, Chris; Mitchell, Richard

    This paper discusses stigmergy (i.e., the effect of communication through the environment) in relation to the Internet, especially with regard to World Wide Web-based learning. The paper begins by examining ways in which stigmergy occurs on the Web and then goes on to describe its use in the construction of a continually evolving system, CoFIND…

  5. Reflorestamento de manguezais e o valor de resgate para o seqüestro de carbono atmosférico The reforestation of mangrove swamps and its value in atmospheric carbon sequestration

    Directory of Open Access Journals (Sweden)

    Sérgio de Mattos Fonseca

    2003-12-01

    Full Text Available Os autores afirmam a relevância do reflorestamento de manguezais para projetos de seqüestro de carbono atmosférico, dentro dos princípios do chamado mecanismo de desenvolvimento limpo (MDL,definidos em diversas arenas técnicas e políticas internacionais, dentro da Convenção de Mudanças Climáticas. Descrevem um projeto de pesquisa em andamento, que inclui estudo de caso focalizado em manguezais da laguna de Itaipu (Niterói, RJ, cujo objetivo é selecionar e fazer medições preliminares de parâmetros ecológicos e socioambientais relevantes para a valoração econômica e financeira dos benefícios do reflorestamento. A seleção e as medições servirão como estudo de viabilidade para que projetos semelhantes se qualifiquem para obter apoio financeiro e alcançar sucesso técnico, gerando benefícios ambientais e sociais.The article argues that the reforestation of mangrove swamps is of relevance to projects for sequestering atmospheric carbon, within the principles of the Clean Development Mechanism (CDM currently being defined in different technical and political arenas as part of the Convention on Climate Change. The text describes a research project currently under way that includes a case study of mangrove swamps in the Itaipu Lagoon in Niterói, RJ. The project's goal is to select and take preliminary measurements of the ecological and socio-environmental parameters pertinent to the economic and financial valuation of the benefits of reforestation. These parameters will serve as part of feasibility studies that determine whether similar projects up for financing by the CDM qualify for financial support and whether they will achieve technical success that brings environmental and social benefits to the various social actors involved.

  6. Latitudinal patterns in plant defense: evolution of cardenolides, their toxicity and induction following herbivory.

    Science.gov (United States)

    Rasmann, Sergio; Agrawal, Anurag A

    2011-05-01

    Attempts over the past 50 years to explain variation in the abundance, distribution and diversity of plant secondary compounds gave rise to theories of plant defense. Remarkably, few phylogenetically robust tests of these long-standing theories have been conducted. Using >50 species of milkweed (Asclepias spp.), we show that variation among plant species in the induction of toxic cardenolides is explained by latitude, with higher inducibility evolving more frequently at lower latitudes. We also found that: (1) the production of cardenolides showed positive-correlated evolution with the diversity of cardenolides, (2) greater cardenolide investment by a species is accompanied by an increase in an estimate of toxicity (measured as chemical polarity) and (3) instead of trading off, constitutive and induced cardenolides were positively correlated. Analyses of root and shoot cardenolides showed concordant patterns. Thus, milkweed species from lower latitudes are better defended with higher inducibility, greater diversity and added toxicity of cardenolides. © 2011 Blackwell Publishing Ltd/CNRS.

  7. Evolutionary trade-offs in plants mediate the strength of trophic cascades.

    Science.gov (United States)

    Mooney, Kailen A; Halitschke, Rayko; Kessler, Andre; Agrawal, Anurag A

    2010-03-26

    Predators determine herbivore and plant biomass via so-called trophic cascades, and the strength of such effects is influenced by ecosystem productivity. To determine whether evolutionary trade-offs among plant traits influence patterns of trophic control, we manipulated predators and soil fertility and measured impacts of a major herbivore (the aphid Aphis nerii) on 16 milkweed species (Asclepias spp.) in a phylogenetic field experiment. Herbivore density was determined by variation in predation and trade-offs between herbivore resistance and plant growth strategy. Neither herbivore density nor predator effects on herbivores predicted the cascading effects of predators on plant biomass. Instead, cascade strength was strongly and positively associated with milkweed response to soil fertility. Accordingly, contemporary patterns of trophic control are driven by evolutionary convergent trade-offs faced by plants.

  8. Seasonal profiles of leaf ascorbic acid content and redox state in ozone-sensitive wildflowers

    International Nuclear Information System (INIS)

    Burkey, Kent O.; Neufeld, Howard S.; Souza, Lara; Chappelka, Arthur H.; Davison, Alan W.

    2006-01-01

    Cutleaf coneflower (Rudbeckia laciniata L.), crown-beard (Verbesina occidentalis Walt.), and tall milkweed (Asclepias exaltata L.) are wildflower species native to Great Smoky Mountains National Park (U.S.A.). Natural populations of each species were analyzed for leaf ascorbic acid (AA) and dehydroascorbic acid (DHA) to assess the role of ascorbate in protecting the plants from ozone stress. Tall milkweed contained greater quantities of AA (7-10 μmol g -1 fresh weight) than crown-beard (2-4 μmol g -1 fresh weight) or cutleaf coneflower (0.5-2 μmol g -1 fresh weight). DHA was elevated in crown-beard and cutleaf coneflower relative to tall milkweed suggesting a diminished capacity for converting DHA into AA. Tall milkweed accumulated AA in the leaf apoplast (30-100 nmol g -1 fresh weight) with individuals expressing ozone foliar injury symptoms late in the season having less apoplast AA. In contrast, AA was not present in the leaf apoplast of either crown-beard or cutleaf coneflower. Unidentified antioxidant compounds were present in the leaf apoplast of all three species. Overall, distinct differences in antioxidant metabolism were found in the wildflower species that corresponded with differences in ozone sensitivity. - Wildflower species exhibit differences in ascorbic acid content and redox status that affect ozone sensitivity

  9. Seasonal profiles of leaf ascorbic acid content and redox state in ozone-sensitive wildflowers

    Energy Technology Data Exchange (ETDEWEB)

    Burkey, Kent O. [Plant Science Research Unit, USDA-ARS and North Carolina State University, 3127 Ligon Street, Raleigh, NC 27607 (United States)]. E-mail: koburkey@unity.ncsu.edu; Neufeld, Howard S. [Appalachian State University, Boone, NC (United States); Souza, Lara [Department of Ecology and Evolutionary Biology, University of Tennessee, Knoxville, TN (United States); Chappelka, Arthur H. [Auburn University, Auburn, AL (United States); Davison, Alan W. [University of Newcastle, Newcastle, England (United Kingdom)

    2006-10-15

    Cutleaf coneflower (Rudbeckia laciniata L.), crown-beard (Verbesina occidentalis Walt.), and tall milkweed (Asclepias exaltata L.) are wildflower species native to Great Smoky Mountains National Park (U.S.A.). Natural populations of each species were analyzed for leaf ascorbic acid (AA) and dehydroascorbic acid (DHA) to assess the role of ascorbate in protecting the plants from ozone stress. Tall milkweed contained greater quantities of AA (7-10 {mu}mol g{sup -1} fresh weight) than crown-beard (2-4 {mu}mol g{sup -1} fresh weight) or cutleaf coneflower (0.5-2 {mu}mol g{sup -1} fresh weight). DHA was elevated in crown-beard and cutleaf coneflower relative to tall milkweed suggesting a diminished capacity for converting DHA into AA. Tall milkweed accumulated AA in the leaf apoplast (30-100 nmol g{sup -1} fresh weight) with individuals expressing ozone foliar injury symptoms late in the season having less apoplast AA. In contrast, AA was not present in the leaf apoplast of either crown-beard or cutleaf coneflower. Unidentified antioxidant compounds were present in the leaf apoplast of all three species. Overall, distinct differences in antioxidant metabolism were found in the wildflower species that corresponded with differences in ozone sensitivity. - Wildflower species exhibit differences in ascorbic acid content and redox status that affect ozone sensitivity.

  10. Karyological characterization and identification of four repetitive element groups (the 18S – 28S rRNA gene, telomeric sequences, microsatellite repeat motifs, Rex retroelements) of the Asian swamp eel (Monopterus albus)

    Science.gov (United States)

    Suntronpong, Aorarat; Thapana, Watcharaporn; Twilprawat, Panupon; Prakhongcheep, Ornjira; Somyong, Suthasinee; Muangmai, Narongrit; Surin Peyachoknagul; Srikulnath, Kornsorn

    2017-01-01

    Abstract Among teleost fishes, Asian swamp eel (Monopterus albus Zuiew, 1793) possesses the lowest chromosome number, 2n = 24. To characterize the chromosome constitution and investigate the genome organization of repetitive sequences in M. albus, karyotyping and chromosome mapping were performed with the 18S – 28S rRNA gene, telomeric repeats, microsatellite repeat motifs, and Rex retroelements. The 18S – 28S rRNA genes were observed to the pericentromeric region of chromosome 4 at the same position with large propidium iodide and C-positive bands, suggesting that the molecular structure of the pericentromeric regions of chromosome 4 has evolved in a concerted manner with amplification of the 18S – 28S rRNA genes. (TTAGGG)n sequences were found at the telomeric ends of all chromosomes. Eight of 19 microsatellite repeat motifs were dispersedly mapped on different chromosomes suggesting the independent amplification of microsatellite repeat motifs in M. albus. Monopterus albus Rex1 (MALRex1) was observed at interstitial sites of all chromosomes and in the pericentromeric regions of most chromosomes whereas MALRex3 was scattered and localized to all chromosomes and MALRex6 to several chromosomes. This suggests that these retroelements were independently amplified or lost in M. albus. Among MALRexs (MALRex1, MALRex3, and MALRex6), MALRex6 showed higher interspecific sequence divergences from other teleost species in comparison. This suggests that the divergence of Rex6 sequences of M. albus might have occurred a relatively long time ago. PMID:29093797

  11. The effects of concentrate added to pineapple (Ananas comosus Linn. Mer.) waste silage in differing ratios to form complete diets, on digestion, excretion of urinary purine derivatives and blood metabolites in growing, male, Thai swamp buffaloes.

    Science.gov (United States)

    Jetana, T; Suthikrai, W; Usawang, S; Vongpipatana, C; Sophon, S; Liang, J B

    2009-04-01

    Four, male, growing Thai swamp buffaloes (197 +/- 5.3 kg and all 1 year old) were used to evaluate the effects of concentrate added to pineapple waste silage in differing ratios, to form a complete diet, studying in vivo digestion, the rate of passage, microbial protein synthesis and blood metabolites. Animals were fed ad libitum with 4 diets, using four combinations of pineapple waste silage (P) and concentrate (C), in the proportions (on a dry matter basis) of 0.8:0.2 (P80:C20), 0.6:0.4 (P60:C40), 0.4:0.6 (P40:C60) and 0.2:0.8 (P20:C80). The results showed that the intakes of dry matter (DM), organic matter (OM), nitrogen (N), the N-balance, urinary purine derivatives (PD) excretion, the ratios of allantoin to creatinine (CR), PD to CR, the plasma urea-N (PUN) and insulin increased in the animals, but the intake of neutral detergent fiber (NDF), the coefficient of whole tract, apparent digestibility of NDF, the transit time (TT) and the mean retention time (TMRT) decreased, when the proportion of concentrate in the diet increased. This study indicated that the proportion of P40:C60 in the diet produced the best efficiency of urinary PD excretion (mmol) per digestible OM intake (kg DOMI).

  12. FLUCTUACIÓN DE LOS ENSAMBLES PLANCTÓNICOS EN LA CIÉNAGA DE AYAPEL (CÓRDOBA-COLOMBIA DURANTE UN CICLO SEMANAL FLUCTUATION OF PLANKTON ASSEMBLAGES AT AYAPEL SWAMP IN CÓRDOBA (COLOMBIA DURING A WEEKLY CYCLE

    Directory of Open Access Journals (Sweden)

    Juan Carlos Jaramillo-Londoño

    2012-12-01

    Full Text Available En esta investigación se evaluó la variación espacial y temporal de los ensamblajes fitoplanctónicos y zooplanctónicos, diariamente y durante un ciclo semanal, en seis estaciones de muestreo en la ciénaga de Ayapel (Córdoba, Colombia, tomando muestras integradas de la columna de agua. Ambos ensamblajes presentaron diferencias espaciales y una alta homogeneidad temporal. El fitoplancton estuvo dominado por cianobacterias principalmente Cylindropermopsis raciborskii y Planktolyngbya limnetica, y el zooplancton por rotíferos del género Brachionus.This research was intended to spatially and temporally evaluate phytoplankton and zooplankton assemblages on a daily basis during a weekly cycle, in six sampling stations at Ayapel swamp in Córdoba (Colombia, taking integrated samples of the water column. Both assemblages showed spatial differences and a high temporal homogeneity. Phytoplankton was dominated by cyanobacteria, specifically Cylindropermopsis raciborskii and Planktolyngbya limnetica; and zooplankton was dominated by Brachionus-genus rotifers..

  13. Restoring monarch butterfly habitat in the Midwestern US: 'All hands on deck'

    Science.gov (United States)

    Thogmartin, Wayne E.; Lopez-Hoffman, Laura; Rohweder, Jason; Diffendorfer, James E.; Drum, Ryan G.; Semmens, Darius J.; Black, Scott; Caldwell, Iris; Cotter, Donita; Drobney, Pauline; Jackson, Laura L.; Gale, Michael; Helmers, Doug; Hilburger, Steven B.; Howard, Elizabeth; Oberhauser, Karen S.; Pleasants, John M.; Semmens, Brice X.; Taylor, Orley R.; Ward, Patrick; Weltzin, Jake F.; Wiederholt, Ruscena

    2017-01-01

    The eastern migratory population of monarch butterflies (Danaus plexippus plexippus) has declined by >80% within the last two decades. One possible cause of this decline is the loss of ≥1.3 billion stems of milkweed (Asclepias spp.), which monarchs require for reproduction. In an effort to restore monarchs to a population goal established by the US Fish and Wildlife Service and adopted by Mexico, Canada, and the US, we developed scenarios for amending the Midwestern US landscape with milkweed. Scenarios for milkweed restoration were developed for protected area grasslands, Conservation Reserve Program land, powerline, rail and roadside rights of way, urban/suburban lands, and land in agricultural production. Agricultural land was further divided into productive and marginal cropland. We elicited expert opinion as to the biological potential (in stems per acre) for lands in these individual sectors to support milkweed restoration and the likely adoption (probability) of management practices necessary for affecting restoration. Sixteen of 218 scenarios we developed for restoring milkweed to the Midwestern US were at levels (>1.3 billion new stems) necessary to reach the monarch population goal. One of these scenarios would convert all marginal agriculture to conserved status. The other 15 scenarios converted half of marginal agriculture (730 million stems), with remaining stems contributed by other societal sectors. Scenarios without substantive agricultural participation were insufficient for attaining the population goal. Agricultural lands are essential to reaching restoration targets because they occupy 77% of all potential monarch habitat. Barring fundamental changes to policy, innovative application of economic tools such as habitat exchanges may provide sufficient resources to tip the balance of the agro-ecological landscape toward a setting conducive to both robust agricultural production and reduced imperilment of the migratory monarch butterfly.

  14. Restoring monarch butterfly habitat in the Midwestern US: ‘all hands on deck’

    Science.gov (United States)

    Thogmartin, Wayne E.; López-Hoffman, Laura; Rohweder, Jason; Diffendorfer, Jay; Drum, Ryan; Semmens, Darius; Black, Scott; Caldwell, Iris; Cotter, Donita; Drobney, Pauline; Jackson, Laura L.; Gale, Michael; Helmers, Doug; Hilburger, Steve; Howard, Elizabeth; Oberhauser, Karen; Pleasants, John; Semmens, Brice; Taylor, Orley; Ward, Patrick; Weltzin, Jake F.; Wiederholt, Ruscena

    2017-07-01

    The eastern migratory population of monarch butterflies (Danaus plexippus plexippus) has declined by >80% within the last two decades. One possible cause of this decline is the loss of ≥1.3 billion stems of milkweed (Asclepias spp.), which monarchs require for reproduction. In an effort to restore monarchs to a population goal established by the US Fish and Wildlife Service and adopted by Mexico, Canada, and the US, we developed scenarios for amending the Midwestern US landscape with milkweed. Scenarios for milkweed restoration were developed for protected area grasslands, Conservation Reserve Program land, powerline, rail and roadside rights of way, urban/suburban lands, and land in agricultural production. Agricultural land was further divided into productive and marginal cropland. We elicited expert opinion as to the biological potential (in stems per acre) for lands in these individual sectors to support milkweed restoration and the likely adoption (probability) of management practices necessary for affecting restoration. Sixteen of 218 scenarios we developed for restoring milkweed to the Midwestern US were at levels (>1.3 billion new stems) necessary to reach the monarch population goal. One of these scenarios would convert all marginal agriculture to conserved status. The other 15 scenarios converted half of marginal agriculture (730 million stems), with remaining stems contributed by other societal sectors. Scenarios without substantive agricultural participation were insufficient for attaining the population goal. Agricultural lands are essential to reaching restoration targets because they occupy 77% of all potential monarch habitat. Barring fundamental changes to policy, innovative application of economic tools such as habitat exchanges may provide sufficient resources to tip the balance of the agro-ecological landscape toward a setting conducive to both robust agricultural production and reduced imperilment of the migratory monarch butterfly.

  15. RENDEMEN DAN KOMPOSISI PROKSIMAT GELATIN KULIT IKAN BELUT DAN LELE PADA KEADAAN SEGAR DAN KERING (YIELD AND PROXIMATE OF GELATIN EXTRACTED FROM FRESH AND DRY SWAMP ELL AND CATFISH SKIN

    Directory of Open Access Journals (Sweden)

    Hafni Rahmawati

    2017-02-01

    Full Text Available Kulit ikan belut dan lele berpotensi untuk diekstrak gelatinnya. Kulit ikan belut dan lele tidak bersisik, berlendir dan berlemak untuk ikan lele, berbeda dengan kulit ikan pada umumnya yang dijadikan gelatin. Penelitian ini mempelajari tentang gelatin kulit ikan belut dan lele dari segi rendemen dan komposisi proksimat. Untuk mengetahui pengaruh pengeringan, kondisi kulit segar dan kering juga dipelajari. Tahapan ekstraksi yang dilakukan untuk keseluruhan jenis ikan sama, kecuali penanganan kulit ikan kering yang sebelumnya direndam dalam air selama 4 jam. Kulit ikan direndam kembali dalam 0,05M asam asetat selama 10 jam, kemudian dicuci dan diekstraksi dengan aquadest pada suhu 80OC selama 2 jam, cairan yang didapat difiltrasi. Filtratnya dikeringkan dalam cabinet dryer suhu 55OC selama        48 jam hingga diperoleh lembaran gelatin, kemudian diblender menjadi granula gelatin. Hasil penelitian menunjukkan bahwa gelatin kulit ikan kering mempunyai rendemen sedikit lebih rendah dibandingkan gelatin dari kulit ikan segarnya. Kadar protein gelatin kulit ikan kering telihat tinggi dibandingkan kulit segarnya. Pengeringan kulit ikan berpengaruh pada penurunan kadar abu dan lemak, namun tidak mempengaruhi kadar air gelatin hasil ekstraksi. Gelatin kulit segar ikan lele memiliki nilai rendemen tertinggi yaitu 22,01%. Komposisi proksimat yang terbaik diantara keseluruhan kondisi dan jenis kulit dapat dilihat pada gelatin kulit segar ikan belut dimana memiliki kadar air 9,91%; kadar abu 3,07%; kadar protein 91,61%; dan kadar lemak 0,82%. Skin of swam ell and catfish were potential to gelatin extracted. Swamp ell skin doesn’t have scales, with much mucus and a few fat for catfish, it’s different from another fish skin that gelatin extracted usually. This research was studied yield and proximate gelatin extracted from skin of swam ell and catfish. Influence of drying was observed too. The first stage of the research was raw

  16. Patterns of resource use by milkweed insects in Sinai Abstract ...

    African Journals Online (AJOL)

    Francis

    Host-plant defensive chemistry is known to mediate food choice in many .... in the morning between 0745 and 1030 h (local time), and two times in the afternoon between ... high-pressure liquid chromatography (HPLC) eluted with methanol: ...

  17. Thermal properties of poly (lactic acid)/milkweed composites

    Science.gov (United States)

    Currently, most polymer composites utilize petroleum-based materials that are non-degradable and difficult to recycle or incur substantial cost for disposal. Green composites can be used in nondurable limited applications. In order to determine the degree of compatibility between Poly (lactic Acid...

  18. Studies on the cardenolide sequestration in African milkweed butterflies (Danaidae).

    Science.gov (United States)

    Mebs, Dietrich; Reuss, Esther; Schneider, Michael

    2005-04-01

    Butterflies of the Danaidae family are considered to be toxic or distasteful due to the presence of cardiac glycosides sequestered from their larval food plants. Alcoholic extracts of specimens of Danaus chrysippus aegyptius and Amauris ochlea ochlea from southern Africa (Namibia, S.-Africa, Mozambique) were analyzed by thin-layer chromatography for these cardenolides. But only 4 of 75 specimens of D. chrysippus aegyptius contained trace amounts, all others including 13 specimens of A. ochlea ochlea were negative. Genetic analysis of the ouabain binding site of the Na(+), K(+)-ATPase revealed that both species do not present an amino acid replacement at the position 122, which otherwise makes the enzyme insensitive to cardenolides suggesting that other strategies of toxin tolerance must have been developed.

  19. Beneficial Insects and Insect Pollinators on Milkweed in South Georgia

    Science.gov (United States)

    Insect pollinators are essential for the reproduction of more than two-thirds of the world’s crops, and beneficial insects play an important role in managing pest insects in agricultural farmscapes. These insects depend on nectar for their survival in these farmscapes. The flowers of tropical milkwe...

  20. Patterns of resource use by milkweed insects in Sinai | Elbanna ...

    African Journals Online (AJOL)

    Plant morphology and defensive chemistry are related to the insect community of herbivores on Gomphocarpus sinaicus (Boiss.) (Apocynaceae) in Sinai (Egypt). There appears to be significant variation among individual plants in the components of their chemical defences. The different components of the community ...

  1. Disease ecology across soil boundaries: effects of below-ground fungi on above-ground host-parasite interactions.

    Science.gov (United States)

    Tao, Leiling; Gowler, Camden D; Ahmad, Aamina; Hunter, Mark D; de Roode, Jacobus C

    2015-10-22

    Host-parasite interactions are subject to strong trait-mediated indirect effects from other species. However, it remains unexplored whether such indirect effects may occur across soil boundaries and connect spatially isolated organisms. Here, we demonstrate that, by changing plant (milkweed Asclepias sp.) traits, arbuscular mycorrhizal fungi (AMF) significantly affect interactions between a herbivore (the monarch butterfly Danaus plexippus) and its protozoan parasite (Ophryocystis elektroscirrha), which represents an interaction across four biological kingdoms. In our experiment, AMF affected parasite virulence, host resistance and host tolerance to the parasite. These effects were dependent on both the density of AMF and the identity of milkweed species: AMF indirectly increased disease in monarchs reared on some species, while alleviating disease in monarchs reared on other species. The species-specificity was driven largely by the effects of AMF on both plant primary (phosphorus) and secondary (cardenolides; toxins in milkweeds) traits. Our study demonstrates that trait-mediated indirect effects in disease ecology are extensive, such that below-ground interactions between AMF and plant roots can alter host-parasite interactions above ground. In general, soil biota may play an underappreciated role in the ecology of many terrestrial host-parasite systems. © 2015 The Author(s).

  2. Disease ecology across soil boundaries: effects of below-ground fungi on above-ground host–parasite interactions

    Science.gov (United States)

    Tao, Leiling; Gowler, Camden D.; Ahmad, Aamina; Hunter, Mark D.; de Roode, Jacobus C.

    2015-01-01

    Host–parasite interactions are subject to strong trait-mediated indirect effects from other species. However, it remains unexplored whether such indirect effects may occur across soil boundaries and connect spatially isolated organisms. Here, we demonstrate that, by changing plant (milkweed Asclepias sp.) traits, arbuscular mycorrhizal fungi (AMF) significantly affect interactions between a herbivore (the monarch butterfly Danaus plexippus) and its protozoan parasite (Ophryocystis elektroscirrha), which represents an interaction across four biological kingdoms. In our experiment, AMF affected parasite virulence, host resistance and host tolerance to the parasite. These effects were dependent on both the density of AMF and the identity of milkweed species: AMF indirectly increased disease in monarchs reared on some species, while alleviating disease in monarchs reared on other species. The species-specificity was driven largely by the effects of AMF on both plant primary (phosphorus) and secondary (cardenolides; toxins in milkweeds) traits. Our study demonstrates that trait-mediated indirect effects in disease ecology are extensive, such that below-ground interactions between AMF and plant roots can alter host–parasite interactions above ground. In general, soil biota may play an underappreciated role in the ecology of many terrestrial host–parasite systems. PMID:26468247

  3. Host Diet Affects the Morphology of Monarch Butterfly Parasites.

    Science.gov (United States)

    Hoang, Kevin; Tao, Leiling; Hunter, Mark D; de Roode, Jacobus C

    2017-06-01

    Understanding host-parasite interactions is essential for ecological research, wildlife conservation, and health management. While most studies focus on numerical traits of parasite groups, such as changes in parasite load, less focus is placed on the traits of individual parasites such as parasite size and shape (parasite morphology). Parasite morphology has significant effects on parasite fitness such as initial colonization of hosts, avoidance of host immune defenses, and the availability of resources for parasite replication. As such, understanding factors that affect parasite morphology is important in predicting the consequences of host-parasite interactions. Here, we studied how host diet affected the spore morphology of a protozoan parasite ( Ophryocystis elektroscirrha ), a specialist parasite of the monarch butterfly ( Danaus plexippus ). We found that different host plant species (milkweeds; Asclepias spp.) significantly affected parasite spore size. Previous studies have found that cardenolides, secondary chemicals in host plants of monarchs, can reduce parasite loads and increase the lifespan of infected butterflies. Adding to this benefit of high cardenolide milkweeds, we found that infected monarchs reared on milkweeds of higher cardenolide concentrations yielded smaller parasites, a potentially hidden characteristic of cardenolides that may have important implications for monarch-parasite interactions.

  4. Florística, estrutura e características do solo de um fragmento de floresta paludosa no sudeste do Brasil Floristics, structure and soil characteristics of a swamp forest fragment, in southeast Brazil

    Directory of Open Access Journals (Sweden)

    Laércio Loures

    2007-12-01

    downstream direction. Floristic composition and structure the tree community was different from other swamp and alluvial forests of southern and southeastern Brazil, at lower altitudes. Canonical correspondence analysis detected a tree-species distribution gradient correlated mainly with clay content and elevation variation.

  5. High Brain Ammonia Tolerance and Down-Regulation of Na+:K+:2Cl- Cotransporter 1b mRNA and Protein Expression in the Brain of the Swamp Eel, Monopterus albus, Exposed to Environmental Ammonia or Terrestrial Conditions

    Science.gov (United States)

    Ip, Yuen K.; Hou, Zhisheng; Chen, Xiu L.; Ong, Jasmine L. Y.; Chng, You R.; Ching, Biyun; Hiong, Kum C.; Chew, Shit F.

    2013-01-01

    Na+:K+:2Cl- cotransporter 1 (NKCC1) has been implicated in mediating ischemia-, trauma- or ammonia-induced astrocyte swelling/brain edema in mammals. This study aimed to determine the effects of ammonia or terrestrial exposure on ammonia concentrations in the plasma and brain, and the mRNA expression and protein abundance of nkcc/Nkcc in the brain, of the swamp eel Monopterus albus . Ammonia exposure led to a greater increase in the ammonia concentration in the brain of M. albus than terrestrial exposure. The brain ammonia concentration of M. albus reached 4.5 µmol g-1 and 2.7 µmol g-1 after 6 days of exposure to 50 mmol l-1 NH4Cl and terrestrial conditions, respectively. The full cDNA coding sequence of nkcc1b from M. albus brain comprised 3276 bp and coded for 1092 amino acids with an estimated molecular mass of 119.6 kDa. A molecular characterization indicated that it could be activated through phosphorylation and/or glycosylation by osmotic and/or oxidative stresses. Ammonia exposure for 1 day or 6 days led to significant decreases in the nkcc1b mRNA expression and Nkcc1b protein abundance in the brain of M. albus. In comparison, a significant decrease in nkcc1b mRNA expression was observed in the brain of M. albus only after 6 days of terrestrial exposure, but both 1 day and 6 days of terrestrial exposure resulted in significant decreases in the protein abundance of Nkcc1b. These results are novel because it has been established in mammals that ammonia up-regulates NKCC1 expression in astrocytes and NKCC1 plays an important role in ammonia-induced astrocyte swelling and brain edema. By contrast, our results indicate for the first time that M. albus is able to down-regulate the mRNA and protein expression of nkcc1b/Nkcc1b in the brain when confronted with ammonia toxicity, which could be one of the contributing factors to its extraordinarily high brain ammonia tolerance. PMID:24069137

  6. Gene cloning and mRNA expression of glutamate dehydrogenase in the liver, brain and intestine of the swamp eel, Monopterus albus, exposed to freshwater, terrestrial conditions, environmental ammonia or salinity stress

    Directory of Open Access Journals (Sweden)

    C Y Toh

    2011-12-01

    Full Text Available The swamp eel, Monopterus albus, is an obligatory air-breathing teleost which can survive long period of emersion, has high environmental and tissue ammonia tolerance, and acclimate from fresh to brackish water. This study was undertaken to clone and sequence gdh expressed in the liver, intestine and brain of M. albus, to verify whether more than one form of gdh were expressed, and to examine the gdh mRNA expressions in these three organs in fish exposed to various adverse conditions using quantitative real-time PCR. Only one gdh gene sequence, consisted of a 133 bp 5’ UTR, a CDS region spanning 1629 bp and a 3’ UTR of approximately 717 bp, was obtained from the liver, intestine and brain of M. albus. The translated Gdh amino acid sequence from the liver of M. albus had 542 residues and was confirmed to be Gdh1a. It had sequence identity of >90% with Oncorhynchus mykiss Gdh1a, Salmo salar Gdh1a1, Bostrychus sinensis Gdh1a and Tribolodon hakonensis Gdh1a, and formed a monophyletic clade with B. sinensis Gdh1a, Tetraodon nigroviridis Gdh1a, Chaenocephalus aceratus Gdh1a, Salmo salar Gdh1a1 and Gdh1a2 and O. mykiss Gdh1a. An increase in mRNA expression of gdh1a could be essential for increased glutamate production in support of increases in glutamine synthesis under certain environmental condition. Indeed, exposure of M. albus to 1 day of terrestrial conditions or 75 mmol l-1 NH4Cl, but not brackish water, resulted in a significant increase in gdh1a mRNA expression in the liver. However, exposure to brackish water, but not terrestrial conditions or 75 mmol l-1 NH4Cl, lead to a significant increase in the intestinal mRNA expression of gdh1a. By contrast, all the three experimental conditions had no significant effects on the mRNA expression of gdh1a in the brain of M. albus. Our results indicate for the first time that gdh mRNA expression was differentially up-regulated in the liver and intestine of M. albus, in responses to ammonia toxicity and

  7. Performans Kerbau Lumpur dan Strategi Pengembangannya pada Daerah dengan Ketinggian Berbeda di Kabupaten Cianjur (PERFORMANCE ANALYSIS OF SWAMP BUFFALO AT DIFFERENT ALTITUDES IN CIANJUR DISTRICT AND ITS DEVELOPMENT STRATEGIES

    Directory of Open Access Journals (Sweden)

    Komariah .

    2016-01-01

    Full Text Available The research objectives were to analyze reproduction performance and productivity of swamp buffalofrom different altitudes in Cianjur and draw up a hierarchy of productivity strategy development usinganalysis of SWOT (Strength, Weakness, Opportunity, Threats and Analytical Hierarchy Process (AHPwith four criteria: technology, costs, impact, and the response of farmers. Survey was conducted in Cianjurduring January-March 2014 by interview prepared questionnaires and direct observation of 63 buffalo farmers. Secondary data were also obtained from relevant agencies. Primary data were collected usingdirect observation of 139 reproductive female buffaloes then were further analyzed. A total of 58 buffaloesat their productive period were sampled and taken their morphometric data. Whilst 37 buffaloes weremeasured their frame size using Body Condition Score (BCS. The results showed that the reproductionperformance of buffaloes in the lowlands are not significantly different from those in the highland. The ageat first oestrus, first mating, first calving, gestation period were 25.6 months, 26.6 months, 38.7 months,11.8 months, respectively.. The oestrus period was 5.3 days, and post-partum mating interval was 54.6days. Differences in altitude and sex significantly affected (P <0.05 the morphometry assessment. Thebody weight of male buffaloes were found lower than the females both in highlands and lowlands (P<0.05.The body conditioning score of buffalo performance at highland was better compared to those in thelowland. Based on the SWOT analysis and AHP: (1 The main strategy is to improve the technology basedon the criteria of internal weakness by increasing scale holdings to seize opportunities buffalo meat selfsufficiency;(2 based on the criteria of cost and impact, the strategy was to cover threats over the professionout of the region by empowering farmers (facilitate increased productivity buffalo; (3 based on the responsecriteria, the primary

  8. Zoneamento ambiental dos banhados da Estação Ecológica do Taim, RS Environmental zoning of swamps in the Ecological Station of Taim, RS, Brazil

    Directory of Open Access Journals (Sweden)

    Fabio Charão Kurtz

    2003-02-01

    Full Text Available O "Zoneamento Ambiental dos Banhados da Estação Ecológica do Taim" permitiu avaliar a deterioração ambiental dos ecossistemas existentes na Estação Ecológica do Taim (ESEC/TAIM, municípios de Rio Grande e Santa Vitória do Palmar (RS. Consideraram-se dois tipos distintos de ecossistemas: o do Banhado (ECO1 = Ecossistema Límnico e o da Planície Marítima (ECO2 = Ecossistema Planície Marítima. A ECO TOTAL (ECO1 + ECO2 apresentou 64% de classe APP (Área de Preservação Permanente, 27,6% de ACP (Área de Conservação Permanente, 5,6% de AUO (Uso e Ocupação; em menor porcentagem encontrou-se a classe AR (Área de Restauração com 2,8%. A deterioração ambiental média para o ECO1 foi de 10,32%, sendo menor que a ECO2 (23,94%. A deterioração ambiental da ESEC/TAIM (ECO ficou em 13,65%. Com relação à análise de regressão para ECO1, concluiu-se que com 06 parâmetros ambientais se obteve a precisão de 95%, enquanto que, com 04 parâmetros ambientais obteve-se a mesma precisão para a ECO2. Com relação à análise fatorial concluiu-se que essa técnica permitiu conhecer a estrutura dos dados, mostrando as correlações entre cada variável (classes de exuberância e seu respectivo fator, entretanto não foi possível separar grupos ou quantificar a influência de uma ou mais variáveis sobre outra de interesse (variável resposta, como por exemplo: quantos parâmetros são necessários para elaborar um zoneamento ambiental, sendo esta pergunta respondida pela análise de regressão. Recomenda-se que o zoneamento ambiental seja elaborado pelos órgãos públicos ambientais nas demais estações ecológicas e nas unidades de conservação.The "Environmental Zoning of swamps in the Ecological Station of Taim (RS" allowed to evaluate an environmental deterioration of the existent ecosystems in the Ecological Station of Taim (ESEC/TAIM; municipal districts of Rio Grande and Santa Vitória do Palmar (RS. Two types of different

  9. Significance of mangrove swamps for aquaculture

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, S.; Untawale, A.G.

    stream_size 9 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_249.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_249.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  10. Aspectos produtivos do capim-elefante (Pennisetum purpureum, Schum. cv. Roxo no brejo paraibano Productive aspects of elephant grass (Pennisetum purpureum, Schum. var. Roxo in Paraíba swamp region

    Directory of Open Access Journals (Sweden)

    Estácio Alves dos Santos

    2001-02-01

    Full Text Available O trabalho foi realizado com o objetivo de verificar o efeito de diferentes alturas de corte sobre a produtividade do capim-elefante cv. Roxo em épocas de seca e chuva no Brejo paraibano. O esquema experimental foi um fatorial 4 x 2, sendo quatro alturas de corte (0, 15, 30 e 45 cm, duas épocas (períodos seco e chuvoso e quatro blocos. Foram avaliadas as produções por hectare de massa verde (MV, matéria seca total (MS, de folhas (MSF e colmos (MSC e proteína bruta (PB. Após o corte de uniformização, efetuaram-se dois cortes no período seco em intervalos de 90 dias e três no período chuvoso em intervalos de 60 dias. Não houve interação entre altura de corte e a época. Entretanto, à medida que se elevou a altura do corte, reduziram-se as produções de MV, MS e MSC. As produções de PB e MSF não diferiram. Quando elevadas as alturas dos cortes de 0 para 45 cm, houve redução de aproximadamente 33% na produção para MV, 24,83% para MSF e 60% para MSC. Os cortes no período seco foram mais produtivos em relação aos da época chuvosa. As médias das produções de MS, MV, MSF, MSC e PB foram, respectivamente, 4,12; 21,19; 2,65; 1,47 e 0,32 t/ha no período seco e 12,44; 2,45; 1,81; 0,54 e 0,17 t/ha no período chuvoso.This work was carried to evaluate the effect of different cutting heights on the productivity of elephant grass var. Roxo in dry and rainy season in the Paraíba swamp region. A randomized complete block design in a 4 X 2 factorial, arrangement, with four cutting heights (0, 15, 30 and 45 cm, two periods (dry and rainy seasons and 4 blocks were used. It was evaluated the production/ha of fresh matter (FM, dry matter (DM, leaves (DML, stems (DMS and crude protein (CP. After the uniformity cut, two cuts in dry season with 90 days interval and three cuts in the rainy season with 60 days interval were made. There was no interaction between seasons and cutting heights. However, as cutting height increased, the values

  11. Propagação da corticeira do banhado (Erythrina crista-galli L. (FABACEAE pelo processo de estaquia Propagation of swamp corticeira (Erythrina crista-galli L. (Fabacae by the cutting technique

    Directory of Open Access Journals (Sweden)

    Ariane Gratieri-Sossella

    2008-02-01

    Full Text Available A corticeira-do-banhado é uma árvore nativa com uso ornamental no paisagismo urbano e possui potencial de utilização em áreas desprotegidas e degradadas, devido a sua rusticidade. Entretanto, tendo em vista a dificuldade de obtenção de sementes, pela baixa produção e qualidade destas com a conseqüente desuniformidade da germinação, torna-se necessário aprofundar o estudo de outras formas de propagação dessa espécie. Desse modo, conduziu-se este trabalho na Faculdade de Agronomia e Medicina Veterinária da Universidade de Passo Fundo, com o objetivo de estudar a formação de mudas de Erythrina crista-galli L. pela técnica da estaquia. Em quatro experimentos foram testadas doses do fitorregulador ácido indolbutírico (AIB, em diferentes tipos de estacas (lenhosas, semilenhosas, herbáceas e foliares e substratos. Os resultados indicaram que mini-estacas herbáceas, coletadas de plantas jovens, com menos de 1 ano de idade, são as mais indicadas (75% a 100% de enraizamento, e o uso do AIB diminuiu a mortalidade, ao favorecer o processo do enraizamento. Em razão do ataque de insetos (brocas às plantas no seu hábitat, recomenda-se a técnica de jardim clonal, com a formação de matrizeiros no viveiro, fornecendo material juvenil e sadio em maior escala para a propagação dessa espécie por miniestacas.Swamp corticeira is a native tree with ornamental use in urban landscape gardening with the potential to be used in unprotected and degraded areas due to its rustic feature. However, the difficulty of obtaining seeds due to its low productivity and quality, and consequent lack of uniformity in its germination makes it necessary to search for other forms of propagation of this species. Thus, this study was carried out at the Agronomy and Veterinary Medicine College of Passo Fundo University, aiming to study the formation of Erythrina crista-galli L. cuttings by applying the cutting technique. Doses of phytoregulator Indol Butyric

  12. EMISI CO2 TANAH AKIBAT ALIH FUNGSI LAHAN HUTAN RAWA GAMBUT DI KALIMANTAN BARAT (Soil Emissions of CO2 Due to Land Use Change of Peat Swamp Forest at West Kalimantan

    Directory of Open Access Journals (Sweden)

    Rossie Wiedya Nusantara

    2015-01-01

    Full Text Available ABSTRAK Penelitian ini bertujuan untuk menganalisis alih fungsi lahan gambut yang menyebabkan perubahan emisi CO2 tanah pada hutan rawa gambut primer (HP, hutan gambut sekunder (HS, semak belukar (SB, kebun sawit (KS, dan kebun jagung (KJ dan menganalisis pengaruh suhu dan jeluk muka air tanah (water-table depth terhadap emisi CO2 tanah. Sampel dari tiap tipe lahan diambil sebanyak lima ulangan, total sampel 25. Saat pengukuran respirasi CO2 tanah gambut dilakukan pengukuran suhu tanah dan muka air tanah. Pengukuran di lapangan dilaksanakan dua kali yaitu awal musim kemarau dan musim hujan. Hasil penelitian menunjukkan bahwa emisi CO2 tanah tertinggi dan terendah pada dua waktu pengukuran tersebut adalah pada tipe lahan KJ (6,512 ton ha-1 th-1 dan SB (1,698  ton ha-1 th-1 serta pada tipe lahan KS (6,701 ton ha-1 th-1 dan SB (3,169 ton ha-1 th-1 berturut-turut. Suhu tanah gambut tertinggi dan terendah pada dua waktu pengukuran tersebut berturut-turut adalah pada tipe lahan SB (27,78 oC dan HP (22,78 oC, dan pada tipe lahan KS (29,08 oC dan HP (26,56 oC serta jeluk muka air tanah gambut berturut-turut pada tipe lahan KJ (56,2 cm dan  SB (32,1 cm. Faktor-faktor yang menyebabkan perubahan emisi CO2 tanah gambut adalah suhu tanah, jeluk muka air tanah dan pengelolaan lahan yang menyebabkan perubahan sifat tanah gambut, seperti ketersediaan C-organik (jumlah dan kualitas bahan organik, pH tanah dan kematangan gambut. ABSTRACT This study aims to analyze peatland use change that caused changes soil emissions of CO2 at primary peat swamp forest (HP, secondary peat forest (HS, shrub (SB, oil palm plantations (KS and corn field (KJ, and to analyze the influence of temperature and water-table depth to soil emission of CO2. Soil samples were taken from each five replications that accunt for 25 samples. Simultaneously with measurement of soil respiration measuremnts soil temperature. Field measurement is carried out twice at the beginning of dry season and

  13. Density estimates of monarch butterflies overwintering in central Mexico

    Directory of Open Access Journals (Sweden)

    Wayne E. Thogmartin

    2017-04-01

    Full Text Available Given the rapid population decline and recent petition for listing of the monarch butterfly (Danaus plexippus L. under the Endangered Species Act, an accurate estimate of the Eastern, migratory population size is needed. Because of difficulty in counting individual monarchs, the number of hectares occupied by monarchs in the overwintering area is commonly used as a proxy for population size, which is then multiplied by the density of individuals per hectare to estimate population size. There is, however, considerable variation in published estimates of overwintering density, ranging from 6.9–60.9 million ha−1. We develop a probability distribution for overwinter density of monarch butterflies from six published density estimates. The mean density among the mixture of the six published estimates was ∼27.9 million butterflies ha−1 (95% CI [2.4–80.7] million ha−1; the mixture distribution is approximately log-normal, and as such is better represented by the median (21.1 million butterflies ha−1. Based upon assumptions regarding the number of milkweed needed to support monarchs, the amount of milkweed (Asclepias spp. lost (0.86 billion stems in the northern US plus the amount of milkweed remaining (1.34 billion stems, we estimate >1.8 billion stems is needed to return monarchs to an average population size of 6 ha. Considerable uncertainty exists in this required amount of milkweed because of the considerable uncertainty occurring in overwinter density estimates. Nevertheless, the estimate is on the same order as other published estimates. The studies included in our synthesis differ substantially by year, location, method, and measures of precision. A better understanding of the factors influencing overwintering density across space and time would be valuable for increasing the precision of conservation recommendations.

  14. Density estimates of monarch butterflies overwintering in central Mexico

    Science.gov (United States)

    Thogmartin, Wayne E.; Diffendorfer, James E.; Lopez-Hoffman, Laura; Oberhauser, Karen; Pleasants, John M.; Semmens, Brice X.; Semmens, Darius J.; Taylor, Orley R.; Wiederholt, Ruscena

    2017-01-01

    Given the rapid population decline and recent petition for listing of the monarch butterfly (Danaus plexippus L.) under the Endangered Species Act, an accurate estimate of the Eastern, migratory population size is needed. Because of difficulty in counting individual monarchs, the number of hectares occupied by monarchs in the overwintering area is commonly used as a proxy for population size, which is then multiplied by the density of individuals per hectare to estimate population size. There is, however, considerable variation in published estimates of overwintering density, ranging from 6.9–60.9 million ha−1. We develop a probability distribution for overwinter density of monarch butterflies from six published density estimates. The mean density among the mixture of the six published estimates was ∼27.9 million butterflies ha−1 (95% CI [2.4–80.7] million ha−1); the mixture distribution is approximately log-normal, and as such is better represented by the median (21.1 million butterflies ha−1). Based upon assumptions regarding the number of milkweed needed to support monarchs, the amount of milkweed (Asclepias spp.) lost (0.86 billion stems) in the northern US plus the amount of milkweed remaining (1.34 billion stems), we estimate >1.8 billion stems is needed to return monarchs to an average population size of 6 ha. Considerable uncertainty exists in this required amount of milkweed because of the considerable uncertainty occurring in overwinter density estimates. Nevertheless, the estimate is on the same order as other published estimates. The studies included in our synthesis differ substantially by year, location, method, and measures of precision. A better understanding of the factors influencing overwintering density across space and time would be valuable for increasing the precision of conservation recommendations.

  15. Food preference and feeding rhythm in red swamp crayfish Procambarus clarkii%克氏原螯虾的食物选择性及其摄食节律

    Institute of Scientific and Technical Information of China (English)

    徐增洪; 周鑫; 水燕

    2012-01-01

    Juvenile and adult red swamp crayfish (Procambarus clarkii) were reared in tanks (60 cm × 40 cm × 40 cm) at a rate of 20 individuals per tank and fed 5 aquatic plant species (Altemanthera philoxeroides, Eichhornia crassipes, Lesser duckweed Lemna minor, Elodea nultallii, and pondweed ValUsneria natans) to evaluate food I-tems and changes in food filling in stomach and intestines during day and night. In addition, the growth was compared in th crayfish reared in a paddyfield and fed three diets ( crayfish feedstuff with 30% protein, aquatic grasses and trash fish). The food in the intestine of the juvenile crayfish was found to be primarily comprised of zooplankton and phytoplankton. The adult crayfish was shown to have lower food preference, almost all of edible aquatic animals and plants, organic detritus, and artificial feed available in waters being consumed, and aquatic plants constituting their main food due to wide distribution, and easy ingesting. The feeding rhythm was observed during day and night in the crayfish culture pond, the two peaks at 8:00-10:00 and 19:00-22:00. There was significantly better growth in the adult crayfish fed Elodea nuttallii, Lesser duckweed and Vallisneria natans than that in the crayfish fed Altemanthera philoxeroides and Eichharnia crassipes(P0. 05) , even though the crayfish fed Lesser duckweed had slightly better growth than the crayfish fed Elodea nuUallii, and ValUsneria natans did. There was significant difference in daily weight gain rate in the juvenile crayfish fed lesser duckweed, Elodea nuttallii, Vallisneria natans, Altemanthera philoxeroides,Eichhornia crassipes(P<0.05). In the rice field, however, the crayfish fed trash fish was shown to have much better growth than that the crayfish fed pelleted food, and pelleted feedstuff combined with aquatic plants.%对克氏原螫虾Procambarus clarkii幼虾和成虾的胃及肠道内的食物组成和食物充塞度的昼夜变化规律进行了观察;在水族箱(60 cm

  16. Propriedades termodinâmicas de adsorção de água do amido de rizomas do lírio-do-brejo (Hedychium coronarium Thermodynamic properties of water adsortion of the starch of rhizome of swamp lily (Hedychium coronarium

    Directory of Open Access Journals (Sweden)

    Diego Palmiro Ramirez Ascheri

    2009-06-01

    Full Text Available Determinaram-se as propriedades termodinâmicas (entalpia diferencial, entropia diferencial, entalpia integral e entropia integral do amido de rizomas do lírio-do-brejo (Hedychium coronarium por meio de isotermas de adsorção de água. As isotermas foram determinadas em atividades de água no intervalo de 0,11 a 0,84, sob temperaturas que variaram de 30 a 50 °C. A Equação de GAB, que se ajustou bem às isotermas experimentais, foi utilizada para estimar as propriedades termodinâmicas de adsorção. As isotermas apresentaram ligeira inversão, indicando a precença de amido danificado. A entalpia diferencial e a entropia diferencial aumentaram com a diminuição da umidade de equilíbrio e correlacionaram entre si confirmando a compensação química linear. Um modelo exponencial do tipo Y = b.e(a/Xe descreveu adequadamente a dependência destas propriedades diferenciais ao teor de umidade de equilíbrio. A entalpia integral e a entropia integral aumentaram continuamente com o teor de umidade de equil��brio, porém com valores negativos para a entropia integral. Estas propriedades termodinâmicas de adsorção de água demonstraram que o amido extraído dos rizomas do lírio-do-brejo possui baixa higrocopicidade apesar da ocorrência de grânulos de amido danificados.Thermodynamic properties where determined (differential enthalpy, of differential entropy, integral enthalpy, and integral entropy of the starch of rhizomes of swamp lily through water adsorption isotherms. The isotherms were determined in water activities in the range of 0.11 to 0.84, in temperatures ranging from 30 to 50 °C. The GAB equation which fits well to the experimental isotherms was used to estimate the properties of thermodynamic adsorption. The slight reversal of the isotherms indicates damaged starch. The enthalpy and entropy differential gap increased with the decrease in moisture and correlated to each other confirming the chemical linear compensation. An

  17. Mycorrhizae Alter Toxin Sequestration and Performance of Two Specialist Herbivores

    Directory of Open Access Journals (Sweden)

    Amanda R. Meier

    2018-04-01

    Full Text Available Multitrophic species interactions are shaped by both top-down and bottom-up factors. Belowground symbionts of plants, such as arbuscular mycorrhizal fungi (AMF, can alter the strength of these forces by altering plant phenotype. For example, AMF-mediated changes in foliar toxin and nutrient concentrations may influence herbivore growth and fecundity. In addition, many specialist herbivores sequester toxins from their host plants to resist natural enemies, and the extent of sequestration varies with host plant secondary chemistry. Therefore, by altering plant phenotype, AMF may affect both herbivore performance and their resistance to natural enemies. We examined how inoculation of plants with AMF influences toxin sequestration and performance of two specialist herbivores feeding upon four milkweed species (Asclepias incarnata, A. curassavica, A. latifolia, A. syriaca. We raised aphids (Aphis nerii and caterpillars (Danaus plexippus on plants for 6 days in a fully factorial manipulation of milkweed species and level of AMF inoculation (zero, medium, and high. We then assessed aphid and caterpillar sequestration of toxins (cardenolides and performance, and measured defensive and nutritive traits of control plants. Aphids and caterpillars sequestered higher concentrations of cardenolides from plants inoculated with AMF across all milkweed species. Aphid per capita growth rates and aphid body mass varied non-linearly with increasing AMF inoculum availability; across all milkweed species, aphids had the lowest performance under medium levels of AMF availability and highest performance under high AMF availability. In contrast, caterpillar survival varied strongly with AMF availability in a plant species-specific manner, and caterpillar growth was unaffected by AMF. Inoculation with AMF increased foliar cardenolide concentrations consistently among milkweed species, but altered aboveground biomasses and foliar phosphorous concentrations in a plant

  18. Hyb-Seq: Combining Target Enrichment and Genome Skimming for Plant Phylogenomics

    Directory of Open Access Journals (Sweden)

    Kevin Weitemier

    2014-08-01

    Full Text Available Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. Methods and Results: Genome and transcriptome assemblies for milkweed (Asclepias syriaca were used to design enrichment probes for 3385 exons from 768 genes (>1.6 Mbp followed by Illumina sequencing of enriched libraries. Hyb-Seq of 12 individuals (10 Asclepias species and two related genera resulted in at least partial assembly of 92.6% of exons and 99.7% of genes and an average assembly length >2 Mbp. Importantly, complete plastomes and nuclear ribosomal DNA cistrons were assembled using off-target reads. Phylogenomic analyses demonstrated signal conflict between genomes. Conclusions: The Hyb-Seq approach enables targeted sequencing of thousands of low-copy nuclear exons and flanking regions, as well as genome skimming of high-copy repeats and organellar genomes, to efficiently produce genome-scale data sets for phylogenomics.

  19. Hyb-Seq: Combining target enrichment and genome skimming for plant phylogenomics1

    Science.gov (United States)

    Weitemier, Kevin; Straub, Shannon C. K.; Cronn, Richard C.; Fishbein, Mark; Schmickl, Roswitha; McDonnell, Angela; Liston, Aaron

    2014-01-01

    • Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. • Methods and Results: Genome and transcriptome assemblies for milkweed (Asclepias syriaca) were used to design enrichment probes for 3385 exons from 768 genes (>1.6 Mbp) followed by Illumina sequencing of enriched libraries. Hyb-Seq of 12 individuals (10 Asclepias species and two related genera) resulted in at least partial assembly of 92.6% of exons and 99.7% of genes and an average assembly length >2 Mbp. Importantly, complete plastomes and nuclear ribosomal DNA cistrons were assembled using off-target reads. Phylogenomic analyses demonstrated signal conflict between genomes. • Conclusions: The Hyb-Seq approach enables targeted sequencing of thousands of low-copy nuclear exons and flanking regions, as well as genome skimming of high-copy repeats and organellar genomes, to efficiently produce genome-scale data sets for phylogenomics. PMID:25225629

  20. Plant-derived differences in the composition of aphid honeydew and their effects on colonies of aphid-tending ants

    Science.gov (United States)

    Pringle, Elizabeth G; Novo, Alexandria; Ableson, Ian; Barbehenn, Raymond V; Vannette, Rachel L

    2014-01-01

    In plant–ant–hemipteran interactions, ants visit plants to consume the honeydew produced by phloem-feeding hemipterans. If genetically based differences in plant phloem chemistry change the chemical composition of hemipteran honeydew, then the plant's genetic constitution could have indirect effects on ants via the hemipterans. If such effects change ant behavior, they could feed back to affect the plant itself. We compared the chemical composition of honeydews produced by Aphis nerii aphid clones on two milkweed congeners, Asclepias curassavica and Asclepias incarnata, and we measured the responses of experimental Linepithema humile ant colonies to these honeydews. The compositions of secondary metabolites, sugars, and amino acids differed significantly in the honeydews from the two plant species. Ant colonies feeding on honeydew derived from A. incarnata recruited in higher numbers to artificial diet, maintained higher queen and worker dry weight, and sustained marginally more workers than ants feeding on honeydew derived from A. curassavica. Ants feeding on honeydew from A. incarnata were also more exploratory in behavioral assays than ants feeding from A. curassavica. Despite performing better when feeding on the A. incarnata honeydew, ant workers marginally preferred honeydew from A. curassavica to honeydew from A. incarnata when given a choice. Our results demonstrate that plant congeners can exert strong indirect effects on ant colonies by means of plant-species-specific differences in aphid honeydew chemistry. Moreover, these effects changed ant behavior and thus could feed back to affect plant performance in the field. PMID:25505534

  1. Use of bioindicators and passive sampling devices to evaluate ambient ozone concentrations in north central Pennsylvania

    Energy Technology Data Exchange (ETDEWEB)

    Yuska, D.E.; Skelly, J.M.; Ferdinand, J.A.; Stevenson, R.E.; Savage, J.E.; Mulik, J.D.; Hines, A

    2003-09-01

    Passive samplers and bioindicator plants detect ozone air pollution in north central Pennsylvania. - Ambient concentrations of tropospheric ozone and ozone-induced injury to black cherry (Prunus serotina) and common milkweed (Asclepias syriaca) were determined in north central Pennsylvania from 29 May to 5 September 2000 and from 28 May to 18 September 2001. Ogawa passive ozone samplers were utilized within openings at 15 forested sites of which six were co-located with TECO model 49 continuous ozone monitors. A significant positive correlation was observed between the Ogawa passive samplers and the TECO model 49 continuous ozone monitors for the 2000 (r=0.959) and 2001 (r=0.979) seasons. In addition, a significant positive correlation existed in 2000 and 2001 between ozone concentration and elevation (r=0.720) and (r=0.802), respectively. Classic ozone-induced symptoms were observed on black cherry and common milkweed. In 2000, initial injury was observed in early June, whereas for the 2001 season, initial injury was initially observed in late June. During both seasons, injury was noted at most sites by mid- to late-July. Soil moisture potential was measured for the 2001 season and a significant positive relationship (P<0.001) showed that injury to black cherry was a function of cumulative ozone concentrations and available soil moisture.

  2. Phylogenetic incongruence and the evolutionary origins of cardenolide-resistant forms of Na+,K+-ATPase in Danaus butterflies

    Science.gov (United States)

    Aardema, Matthew L.; Andolfatto, Peter

    2016-01-01

    Many distantly-related insect species are specialized feeders of cardenolide-containing host plants such as milkweed (Asclepias spp.). Studies have revealed frequent, parallel substitution of a functionally important amino acid substitution (N122H) in the alpha subunit of Na+,K+-ATPase (N122H) in many of these species. This substitution facilitates the ability of these insects to feed on their toxic hosts. Among milkweed butterflies of the genus Danaus, the previously established phylogeny for this group suggests that N122H arose independently and fixed in two distinct lineages. We re-evaluate this conclusion by examining Danaus phylogenetic relationships using >400 orthologous gene sequences assembled from transcriptome data. Our results indicate that the three Danaus species known to harbor the N122H substitution are more closely related than previously thought, consistent with a single, common origin for N122H. However, we also find evidence of both incomplete lineage sorting and post-speciation genetic exchange among these butterfly species, raising the possibility of collateral evolution of cardenolide-insensitivity in this species group. PMID:27405795

  3. Use of bioindicators and passive sampling devices to evaluate ambient ozone concentrations in north central Pennsylvania

    International Nuclear Information System (INIS)

    Yuska, D.E.; Skelly, J.M.; Ferdinand, J.A.; Stevenson, R.E.; Savage, J.E.; Mulik, J.D.; Hines, A.

    2003-01-01

    Passive samplers and bioindicator plants detect ozone air pollution in north central Pennsylvania. - Ambient concentrations of tropospheric ozone and ozone-induced injury to black cherry (Prunus serotina) and common milkweed (Asclepias syriaca) were determined in north central Pennsylvania from 29 May to 5 September 2000 and from 28 May to 18 September 2001. Ogawa passive ozone samplers were utilized within openings at 15 forested sites of which six were co-located with TECO model 49 continuous ozone monitors. A significant positive correlation was observed between the Ogawa passive samplers and the TECO model 49 continuous ozone monitors for the 2000 (r=0.959) and 2001 (r=0.979) seasons. In addition, a significant positive correlation existed in 2000 and 2001 between ozone concentration and elevation (r=0.720) and (r=0.802), respectively. Classic ozone-induced symptoms were observed on black cherry and common milkweed. In 2000, initial injury was observed in early June, whereas for the 2001 season, initial injury was initially observed in late June. During both seasons, injury was noted at most sites by mid- to late-July. Soil moisture potential was measured for the 2001 season and a significant positive relationship (P<0.001) showed that injury to black cherry was a function of cumulative ozone concentrations and available soil moisture

  4. An Evaluation of Butterfly Gardens for Restoring Habitat for the Monarch Butterfly (Lepidoptera: Danaidae).

    Science.gov (United States)

    Cutting, Brian T; Tallamy, Douglas W

    2015-10-01

    The eastern migratory monarch butterfly (Danaus plexippus L.) population in North America hit record low numbers during the 2013-2014 overwintering season, prompting pleas by scientists and conservation groups to plant the butterfly's milkweed host plants (Asclepias spp.) in residential areas. While planting butterfly gardens with host plants seems like an intuitive action, no previous study has directly compared larval survival in gardens and natural areas to demonstrate that gardens are suitable habitats for Lepidoptera. In this study, milkweed was planted in residential gardens and natural areas. In 2009 and 2010, plants were monitored for oviposition by monarch butterflies and survival of monarch eggs and caterpillars. Monarchs oviposited significantly more frequently in gardens than in natural sites, with 2.0 and 6.2 times more eggs per plant per observation in 2009 and 2010, respectively. There were no significant differences in overall subadult survival between gardens and natural areas. Significant differences in survival were measured for egg and larval cohorts when analyzed separately, but these were not consistent between years. These results suggest that planting gardens with suitable larval host plants can be an effective tool for restoring habitat for monarch butterflies. If planted over a large area, garden plantings may be useful as a partial mitigation for dramatic loss of monarch habitat in agricultural settings. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  5. Stochastic prey arrivals and crab spider giving-up times: simulations of spider performance using two simple "rules of thumb".

    Science.gov (United States)

    Kareiva, Peter; Morse, Douglass H; Eccleston, Jill

    1989-03-01

    We compared the patch-choice performances of an ambush predator, the crab spider Misumena vatia (Thomisidae) hunting on common milkweed Asclepias syriaca (Asclepiadaceae) umbles, with two stochastic rule-of-thumb simulation models: one that employed a threshold giving-up time and one that assumed a fixed probability of moving. Adult female Misumena were placed on milkweed plants with three umbels, each with markedly different numbers of flower-seeking prey. Using a variety of visitation regimes derived from observed visitation patterns of insect prey, we found that decreases in among-umbel variance in visitation rates or increases in overall mean visitation rates reduced the "clarity of the optimum" (the difference in the yield obtained as foraging behavior changes), both locally and globally. Yield profiles from both models were extremely flat or jagged over a wide range of prey visitation regimes; thus, differences between optimal and "next-best" strategies differed only modestly over large parts of the "foraging landscape". Although optimal yields from fixed probability simulations were one-third to one-half those obtained from threshold simulations, spiders appear to depart umbels in accordance with the fixed probability rule.

  6. Phylogenetic incongruence and the evolutionary origins of cardenolide-resistant forms of Na(+) ,K(+) -ATPase in Danaus butterflies.

    Science.gov (United States)

    Aardema, Matthew L; Andolfatto, Peter

    2016-08-01

    Many distantly related insect species are specialized feeders of cardenolide-containing host plants such as milkweed (Asclepias spp.). Previous studies have revealed frequent, parallel substitution of a functionally important amino acid substitution (N122H) in the alpha subunit of Na(+) ,K(+) -ATPase in a number of these species. This substitution facilitates the ability of these insects to feed on their toxic hosts and sequester cardenolides for their own use in defense. Among milkweed butterflies of the genus Danaus, the previously established phylogeny for this group suggests that N122H arose independently and fixed in two distinct lineages. We reevaluate this conclusion by examining Danaus phylogenetic relationships using >400 orthologous gene sequences assembled from transcriptome data. Our results indicate that the three Danaus species known to harbor the N122H substitution are more closely related than previously thought, consistent with a single, common origin for N122H. However, we also find evidence of both incomplete lineage sorting and post-speciation genetic exchange among these butterfly species, raising the possibility of collateral evolution of cardenolide-insensitivity in this species group. © 2016 The Author(s). Evolution © 2016 The Society for the Study of Evolution.

  7. Evidence for adaptive radiation from a phylogenetic study of plant defenses

    Science.gov (United States)

    Agrawal, Anurag A.; Fishbein, Mark; Halitschke, Rayko; Hastings, Amy P.; Rabosky, Daniel L.; Rasmann, Sergio

    2009-01-01

    One signature of adaptive radiation is a high level of trait change early during the diversification process and a plateau toward the end of the radiation. Although the study of the tempo of evolution has historically been the domain of paleontologists, recently developed phylogenetic tools allow for the rigorous examination of trait evolution in a tremendous diversity of organisms. Enemy-driven adaptive radiation was a key prediction of Ehrlich and Raven's coevolutionary hypothesis [Ehrlich PR, Raven PH (1964) Evolution 18:586–608], yet has remained largely untested. Here we examine patterns of trait evolution in 51 North American milkweed species (Asclepias), using maximum likelihood methods. We study 7 traits of the milkweeds, ranging from seed size and foliar physiological traits to defense traits (cardenolides, latex, and trichomes) previously shown to impact herbivores, including the monarch butterfly. We compare the fit of simple random-walk models of trait evolution to models that incorporate stabilizing selection (Ornstein-Ulenbeck process), as well as time-varying rates of trait evolution. Early bursts of trait evolution were implicated for 2 traits, while stabilizing selection was implicated for several others. We further modeled the relationship between trait change and species diversification while allowing rates of trait evolution to vary during the radiation. Species-rich lineages underwent a proportionately greater decline in latex and cardenolides relative to species-poor lineages, and the rate of trait change was most rapid early in the radiation. An interpretation of this result is that reduced investment in defensive traits accelerated diversification, and disproportionately so, early in the adaptive radiation of milkweeds. PMID:19805160

  8. Intoxicação experimental por Asclepias curassavica (Asclepiadaceae em bovinos. Dados complementares

    Directory of Open Access Journals (Sweden)

    Tokarnia Carlos Hubinger

    2001-01-01

    Full Text Available Em experimentos com bovinos, que receberam diariamente doses subletais repetidas (2,5 e 5,0 g/kg/dia durante 12 dias até alcançar a dose letal e/ou ultrapassá-la, A. curassavica recém-coletada não demonstrou efeito acumulativo. Em um animal houve desenvolvimento de tolerância contra a dose que anteriormente causou sintomas de intoxicação (5,0 g/kg, mas não contra uma dose maior (10 g/kg. A planta dessecada continuou tóxica até 2 meses após a coleta, mas após 6 meses tinha perdido a sua toxidez. A mistura da planta fresca picada com capim fresco picado não foi ingerida pelos animais em quantidades que pudessem causar sintomas de intoxicação, em nenhuma das proporções que variaram de 1:2 a 1:6, planta : capim. A planta recentemente dessecada picada em mistura com capim fenado picado, na proporção de 1:3, só foi consumida por um de quatro bovinos em quantidades que poderiam provocar sintomas de intoxicação; mas mesmo esse bovino não chegou a adoecer.

  9. Leaf size indices and structure of the peat swamp forest

    Directory of Open Access Journals (Sweden)

    L.G. Aribal

    2017-12-01

    Full Text Available Leaf size indices of the tree species in the peatland of Agusan del Sur in Mindanao in Philippines was examined to deduce the variation of forest structure and observed forest zonation.  Using raunkiaer and webb’s leaf size classification, the leaf morphometrics of seven tree species consistently found on the established sampling plots were determined.  The species includes Ternstroemia philippinensis Merr., Polyscias aherniana Merr. Lowry and G.M. Plunkett, Calophyllum sclerophyllum Vesque, Fagraea racemosa Jack, Ilex cymosa Blume, Syzygium tenuirame (Miq. Merr. and Tristaniopsis micrantha Merr. Peter G.Wilson and J.T.Waterh.The LSI were correlated against the variables of the peat physico-chemical properties (such as bulk density, acrotelm thickness, peat depth, total organic carbon, nitrogen, phosphorus, and potassium, pH; water (pH, ammonium, nitrate, phosphate; and leaf tissue elements (nitrogen, phosphorus and potassium.  Result showed a decreasing leaf size indices and a three leaf size category consisting of mesophyllous, mesophyllous-notophyllous and microphyllous were observed which corresponds to the structure of vegetation i.e., from the tall-pole forest having the biggest average leaf area of 6,142.29 mm2 to the pygmy forest with average leaf area of 1,670.10 mm2.  Such decreased leaf size indices were strongly correlated to soil nitrogen, acrotelm thickness, peat depth, phosphate in water, nitrogen and phosphorus in the plant tissue.

  10. Massive gene swamping among cheese-making Penicillium fungi

    Directory of Open Access Journals (Sweden)

    Jeanne Ropars

    2015-03-01

    Full Text Available Horizontal gene transfers (HGT, i.e., the transmission of genetic material between species not directly attributable to meiotic gene exchange, have long been acknowledged as a major driver of prokaryotic evolution and is increasingly recognized as an important source of adaptation in eukaryotes. In fungi in particular, many convincing examples of HGT have been reported to confer selective advantages on the recipient fungal host, either promoting fungal pathogenicity on plants or increasing their toxicity by the acquisition of secondary metabolic clusters, resulting in adaptation to new niches and in some cases eventually even in speciation. These horizontal gene transfers involve single genes, complete metabolic pathways or even entire chromosomes. A recent study has uncovered multiple recent horizontal transfers of a 575 kb genomic island in cheese Penicillium fungi, representing ca. 2% of the Penicillium roqueforti’s genome, that may confer selective advantage in the competing cheese environment where bacteria and fungi occur. Novel phylogenomic methods are being developed, revealing massive HGT among fungi. Altogether, these recent studies indicate that HGT is a crucial mechanism of rapid adaptation, even among eukaryotes.

  11. The Utilization of Rawa Pening Swamp Area for Fisheries

    Directory of Open Access Journals (Sweden)

    Su Ritohardoyo

    2004-01-01

    Full Text Available This article concern with the impact of the fishery ‘karamba’ system on socio-economics of fishermen in the Rawa Pening Environs. The aim of the study is to appraise the activities of fishery ‘karamba’ system. In the relationship with loccal fishermen income, and labor force employment. To some extent, the research is directed to study on income differentation based on job status as fishermen and ‘karamba’ farmers. Differentation of tools kinds for fishing, and seasonal variation. Survey method is employed in this research, whether it is for karamba farmer or local fishermen. Respondent number about 187 consists of 139 fishermen, 28 ‘karamba’ labors, and 20 ‘karamba’ farmers. Technical of tabulation and ‘t’ test statistical use for data analysis. The research shows that fishery ‘karamba’ system so much decreases on the activities, number of facilities, and it fish production. Decreasing of those are mainly caused by uncontrolled growth of ‘eceng gondok’ (Eichornia crassipes, capital constrain, and security constraint especially stealing of fish production. The existing of fishery ‘karamba’ system employs 68,00% labors are local fishermen, and 32,00% are not fishermen come from other areas. Viewed by the job opportunities most of part contribute ‘karamba’ farmers (55% who ome from out of the area, and 45% ‘karamba’ farmer are local people. Really affect of the fishery ‘karamba’ system to the local fishermen is decreasing of fish production. Fish production of local fishermen has been lower since fishery ‘karamba’ system be carried out in this lake. Though the fish production of fishery ‘karamba’ system decreases, however income average of the ‘karamba’ farmer is higher (Rp 1,849,000/annum than the income average of local fishermen. The average of fishermen income who using fish grasper is higher (Rp 1,401,000/annum than the average of fishermen income who using fish trap (Rp 1,21,000/unnum and who using fish grasper and fish trap (Rp 1,349,000/annum. Nevertheless the average of fishermen’s income is higher than ‘karamba’s’ labor (Rp 897,000. This research is also finding wether it is average production or income of the ‘karamba’ farmer are not seasonal, and those are quite difference with local fishermen. The average of fish production on dry season (825 kg are higher than on wet season (625 kg. Therefore, the average of income on dry season are higher than that on wet season.

  12. Mathematical model for scheduling irrigation for swamp rice in Port ...

    African Journals Online (AJOL)

    While the mother model indicated that the planted crops will be under severe water stress because the values of their d2 were below the allowable range of water depletion except in weeks 1,7,10,16 and 17 with their d2 values to be; 178.50mm, 181.47mm, 162.11mm, 198.80mm and 187.60mm respectively. Water ...

  13. mathematical model for scheduling irrigation for swamp rice in port

    African Journals Online (AJOL)

    2017-03-24

    Mar 24, 2017 ... The thirst for increased food production and management of our natural resources (water) .... 16th, 2009. .... formula, Karl P