WorldWideScience

Sample records for susan kennison aquarius

  1. Susan Smith

    African Journals Online (AJOL)

    Owner

    Soveel lesers soveel lokmiddele soveel re- sponse kan gelys word om toegang tot die lees van poësie te registreer. 'n Resep om ge- trou of in ontrou na te volg, bestaan nie. Ge- lukkig nie. Susan Smith se (debuut)bundel lok my helaas nie deur die voorblad as vertrek- punt te neem nie. Aan visuele prikkelkrag gaan.

  2. Dedication - Susan L Greenblatt

    Science.gov (United States)

    Guberman, Steven L.

    2011-07-01

    Photo of Susan L Greenblatt Figure 1. Susan in May, 1994 This volume is dedicated to the memory of Susan L Greenblatt, the wife of Steven L Guberman. Susan attended 6 of the 8 dissociative recombination (DR) meetings. Her advice and wise counsel played a vital role in the organization of several of these meetings. The fifth meeting in Chicago in 2001 was her idea and it would not have occurred without her encouragement. Susan was always amused by the memory of the first group dinner at the second DR meeting at St Jacut in 1992. As we went around the dinner table identifying ourselves, it soon became her turn. Susan was a sociologist and after introducing herself she said: "I am not a chemist". A spontaneous chorus of attendees proclaimed "Neither are we!". Her husband and a few other chemists abstained. In 1983, Susan and I established the Institute for Scientific Research (ISR). The name was chosen so as to span sociology and chemical physics. Four years prior, an ophthalmologist had diagnosed a rare retinal condition of unknown origin and advised her to change her profession to one that did not involve reading. (She was able to read for the rest of her life.) Twenty years later we learned that the cause of the retinal and all her other health problems was a recently discovered rare mitochondrial mutation. Her experience with ophthalmologists and her life-long keen sense of injustice, led her to write a grant proposal to the US Department of Education to survey all ophthalmologists in the US to determine whether they were aware of and whether they told their patients about resources and aids that could help them to continue reading and participating in everyday activities. As part of the grant and based upon the survey results, she proposed to set up low-vision training programs for ophthalmology residents. We knew that the competition for funding was intense and included several well-known and more established organizations. Nevertheless, the proposal was funded

  3. Aquarius Radiometer Status

    Science.gov (United States)

    Le Vine, D. M.; Piepmeier, J. R.; Dinnat, E. P.; de Matthaeis, P.; Utku, C.; Abraham, S.; Lagerloef, G.S.E.; Meissner, T.; Wentz, F.

    2014-01-01

    Aquarius was launched on June 10, 2011 as part of the Aquarius/SAC-D observatory and the instrument has been operating continuously since being turned on in August of the same year. The initial map of sea surface salinity was released one month later (September) and the quality of the retrieval has continuously improved since then. The Aquarius radiometers include several special features such as measurement of the third Stokes parameter, fast sampling, and careful thermal control, and a combined passive/active instrument. Aquarius is working well and in addition to helping measure salinity, the radiometer special features are generating new results.

  4. Aquarius Main Structure Configuration

    Science.gov (United States)

    Eremenko, Alexander

    2012-01-01

    The Aquarius/SAC-D Observatory is a joint US-Argentine mission to map the salinity at the ocean surface. This information is critical to improving our understanding of two major components of Earth's climate system - the water cycle and ocean circulation. By measuring ocean salinity from space, the Aquarius/SAC-D Mission will provide new insights into how the massive natural exchange of freshwater between the ocean, atmosphere and sea ice influences ocean circulation, weather and climate. Aquarius is the primary instrument on the SAC-D spacecraft. It consists of a Passive Microwave Radiometer to detect the surface emission that is used to obtain salinity and an Active Scatterometer to measure the ocean waves that affect the precision of the salinity measurement. The Aquarius Primary Structure houses instrument electronics, feed assemblies, and supports a deployable boom with a 2.5 m Reflector, and provides the structural interface to the SAC-D Spacecraft. The key challenge for the Aquarius main structure configuration is to satisfy the needs of component accommodations, ensuring that the instrument can meet all operational, pointing, environmental, and launch vehicle requirements. This paper describes the evolution of the Aquarius main structure configuration, the challenges of balancing the conflicting requirements, and the major configuration driving decisions and compromises.

  5. Susan Flannery lahkub? / Harro Puusild

    Index Scriptorium Estoniae

    Puusild, Harro

    2008-01-01

    Ameerika teleseriaali "Vaprad ja ilusad" Stephanie Forresteri osatäitja Susan Flannery (1943) on seriaalis mänginud algusest peale s.o. 21 aastat. Lisatud intervjuu näitlejatariga. Sama ka Teleleht nr. 15, lk. 8-9 : ill

  6. Soil Moisture Retrieval from Aquarius

    Science.gov (United States)

    Aquarius observations over land offer an unprecedented opportunity to provide a value-added product, land surface soil moisture, which will contribute to a better understanding of the Earth’s climate and water cycle. Additionally, Aquarius will provide the first spaceborne data that can be used to a...

  7. Aquarius Overview and Up Date

    Science.gov (United States)

    Le Vine, D. M.; Lagerloef, G. S. E.; De Matthaeis, P.; Dinnat, E. P.; Abraham, S.

    2014-01-01

    Aquarius is an L-band instrument designed to map the surface salinity field of the global oceans. It consists of three L-band (1.41 GHz) radiometers and an L-band (1.26 GHz) scatterometer. The radiometers are the primary instruments for measuring salinity and the scatterometer provides a correction for surface roughness. Aquarius was launched in June 2011 and has been mapping the surface salinity field since it was turned on in August. In addition, Aquarius is now producing maps of radio frequency interference (RFI), Faraday rotation and soil moisture.

  8. NASA 3D Models: Aquarius

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius is making NASA's first space-based global observations of ocean surface salinity, flying 657 kilometers (408 miles) above Earth in a sun-synchronous polar...

  9. Aquarius and the Aquarius/SAC-D Mission

    Science.gov (United States)

    LeVine, D. M.; Lagerloef, G. S. E.; Torrusio, S.

    2010-01-01

    Aquarius is a combination L-band radiometer and scatterometer designed to map the salinity field at the ocean surface from space. It will be flown on the Aquarius/SAC-D mission, a partnership between the USA space agency (NASA) and Argentine space agency (CONAE). The mission is composed of two parts: (a) The Aquarius instrument being developed as part of NASA.s Earth System Science Pathfinder (ESSP) program; and (b) SAC-D the fourth spacecraft service platform in the CONAE Satellite de Aplicaciones Cientificas (SAC) program. The primary focus of the mission is to monitor the seasonal and interannual variations of the salinity field in the open ocean. The mission also meets the needs of the Argentine space program for monitoring the environment and for hazard detection and includes several instruments related to these goals.

  10. Aquarius iPhone Application

    Science.gov (United States)

    Estes, Joseph C., Jr.; Arca. Jeremy M.; Ko, Michael A.; Oks, Boris

    2012-01-01

    The Office of the CIO at JPL has developed an iPhone application for the Aquarius/SAC-D mission. The application includes specific information about the science and purpose of the Aquarius satellite and also features daily mission news updates pulled from sources at Goddard Space Flight Center as well as Twitter. The application includes a media and data tab section. The media section displays images from the observatory, viewing construction up to the launch and also includes various videos and recorded diaries from the Aquarius Project Manager. The data tab highlights many of the factors that affect the Earth s ocean and the water cycle. The application leverages the iPhone s accelerometer to move the Aquarius Satellite over the Earth, revealing these factors. Lastly, this application features a countdown timer to the satellite s launch, which is currently counting the days since launch. This application was highly successful in promoting the Aquarius Mission and educating the public about how ocean salinity is paramount to understanding the Earth.

  11. Aquarius Digital Processing Unit

    Science.gov (United States)

    Forgione, Joshua; Winkert, George; Dobson, Norman

    2009-01-01

    Three documents provide information on a digital processing unit (DPU) for the planned Aquarius mission, in which a radiometer aboard a spacecraft orbiting Earth is to measure radiometric temperatures from which data on sea-surface salinity are to be deduced. The DPU is the interface between the radiometer and an instrument-command-and-data system aboard the spacecraft. The DPU cycles the radiometer through a programmable sequence of states, collects and processes all radiometric data, and collects all housekeeping data pertaining to operation of the radiometer. The documents summarize the DPU design, with emphasis on innovative aspects that include mainly the following: a) In the radiometer and the DPU, conversion from analog voltages to digital data is effected by means of asynchronous voltage-to-frequency converters in combination with a frequency-measurement scheme implemented in field-programmable gate arrays (FPGAs). b) A scheme to compensate for aging and changes in the temperature of the DPU in order to provide an overall temperature-measurement accuracy within 0.01 K includes a high-precision, inexpensive DC temperature measurement scheme and a drift-compensation scheme that was used on the Cassini radar system. c) An interface among multiple FPGAs in the DPU guarantees setup and hold times.

  12. Aquarius/SAC-D mission

    Science.gov (United States)

    Sen, Amit; Caruso, Daniel; Lagerloef, Gary; Torrusio, Sandra; Durham, David; Falcon, Carlos

    2008-10-01

    Sea Surface Salinity (SSS) is a key parameter in the global water cycle but it is not yet monitored from space. Conventional in situ SSS sampling is too sparse to give the global view of salinity variability that a remote sensing satellite can provide. The Aquarius/SAC-D Mission will make pioneering space-based measurements of global SSS with the precision, resolution, and coverage needed to characterize salinity variations (spatial and temporal), investigate the linkage between ocean circulation, the Earth's water cycle, and climate variability. It is being jointly developed by NASA and the Space Agency of Argentina, the Comision Nacional de Actividades Espaciales (CONAE). The Project is currently in implementation phase with the flight Aquarius Instrument undergoing environmental testing at NASA-JPL/Caltech in California, USA and the SAC-D instruments and spacecraft development undergoing at CONAE/INVAP facilities in Argentina. Aquarius/SAC-D launch is scheduled for May 2010.

  13. Aquarius: Status and Recent Results

    Science.gov (United States)

    Le Vine, D. M.; Dinnat, E. P.; Lagerloef, G. S. E.; de Matthaeis, P.; Abraham, S.; Utku, C.; Kao, H.

    2014-01-01

    Aquarius is a combination active/passive instrument at L band designed to map sea surface salinity globally from space. The radiometer (passive) is the primary instrument for retrieving salinity, and the scatterometer (active) provides information to correct for a major source of error, sea surface roughness (waves). In addition, the radiometer includes a number of special features designed to meet the goal for this challenging measurement, including measurement of the third Stokes parameter to help with the correction for Faraday rotation and rapid sampling to help with the mitigation of radio frequency interference. Aquarius was launched on 10 June 2011 aboard the Aquarius/SAC-D observatory and has been working well. The salinity retrieval continues to improve, and the special features suggest the potential for new applications of remote sensing from space at L band.

  14. Soil moisture mapping for aquarius

    Science.gov (United States)

    Aquarius is the first satellite to provide both passive and active L-band observations of the Earth. In addition, the instruments on Satelite de Aplicaciones Cientificas-D (SAC-D) provide complementary information for analysis and retrieval algorithms. Our research focuses on the retrieval of soil m...

  15. In Conversation with Susan Holtz | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2010-11-26

    Nov 26, 2010 ... Susan Holtz is a private consultant and Adjunct Professor in the Environmental Planning Department of the Nova Scotia College for Art and Design. As a consultant, Ms. Holtz specializes in energy, environment, and sustainable development policy, and works on related issues as a mediator and facilitator.

  16. Roberts, Dennis C. & Komives, Susan R.

    African Journals Online (AJOL)

    Enhancing Student Learning and Development in Cross-Border Higher Education, edited by. Dennis C. Roberts and Susan R. Komives, is a book that resulted from a short-term study-abroad experience between the Universities of Maryland and San Diego with the Qatar Foundation's Education City in Doha in 2010.

  17. Design package lazy susan for the fuel retrieval system

    Energy Technology Data Exchange (ETDEWEB)

    TEDESCHI, D.J.

    1999-09-10

    This is a design package that contains the details for a Lazy Susan style small tool for the Fuel Retrieval System. The Lazy Susan tool is used to help rotate an MCO Fuel Basket when loading it. This document contains requirements, development design information, tests and test reports that pertain to the production of Lazy Susan small tool.

  18. The Aquarius Salinity Retrieval Algorithm

    Science.gov (United States)

    Meissner, Thomas; Wentz, Frank; Hilburn, Kyle; Lagerloef, Gary; Le Vine, David

    2012-01-01

    The first part of this presentation gives an overview over the Aquarius salinity retrieval algorithm. The instrument calibration [2] converts Aquarius radiometer counts into antenna temperatures (TA). The salinity retrieval algorithm converts those TA into brightness temperatures (TB) at a flat ocean surface. As a first step, contributions arising from the intrusion of solar, lunar and galactic radiation are subtracted. The antenna pattern correction (APC) removes the effects of cross-polarization contamination and spillover. The Aquarius radiometer measures the 3rd Stokes parameter in addition to vertical (v) and horizontal (h) polarizations, which allows for an easy removal of ionospheric Faraday rotation. The atmospheric absorption at L-band is almost entirely due to molecular oxygen, which can be calculated based on auxiliary input fields from numerical weather prediction models and then successively removed from the TB. The final step in the TA to TB conversion is the correction for the roughness of the sea surface due to wind, which is addressed in more detail in section 3. The TB of the flat ocean surface can now be matched to a salinity value using a surface emission model that is based on a model for the dielectric constant of sea water [3], [4] and an auxiliary field for the sea surface temperature. In the current processing only v-pol TB are used for this last step.

  19. Psychoanalytic Interpretation of Blueberries by Susan Gibb

    OpenAIRE

    Zalbidea Paniagua, Maya

    2014-01-01

    [ES] La obra de ficción digital titulada Blueberries (2009) de Susan Gibb, publicada en la ELO (Organización de literatura electrónica) invita al lector/a a viajar dentro de la mente de la protagonista para descubrir sus experiencias reales e imaginarias en las que se examinan las nociones de género, sexo, cuerpo e identidad de una mujer traumatizada. En este artículo se exploran los modos verbales y visuales en esta ficción digital breve siguiendo patrones semióticos así como se interpretan ...

  20. Tylopilus aquarius, comb. et stat. nov., and its new variety from Brazil

    Science.gov (United States)

    Anderlechi Barbosa-Silva; Clark L. Ovrebo; Beatriz Ortiz-Santana; Mariana C.A. Sá; Marcelo A. Sulzbacher; Melanie Roy; Felipe. Wartchow

    2017-01-01

    We propose the new species and new combination, Tylopilus aquarius var. aquarius, by elevating T. potamogeton v. aquarius to species level. We also describe a new variety, T. aquarius var. megistus, from the Atlantic Forest states Paraiba and...

  1. Aquarius: The Instrument and Initial Results

    Science.gov (United States)

    Vine, David M Le; Lagerloef, G.S.E.; Ruf, C.; Wentz, F.; Yueh, S.; Piepmeier, J.; Lindstrom, E.; Dinnat, E.

    2012-01-01

    Aquarius was launched on June 10, 2011 aboard the Aquarius/SAC-D observatory and the instrument has been operating continuously since the initial turned-on was completed on August 25. The initial observed antenna temperatures were close to predicted and the first salinity map was released in September. In order to map the ocean salinity field, Aquarius includes several special features such as the inclusion of a scatterometer to provide a roughness correction, measurement of the third Stokes parameter to correct for Faraday rotation, and fast sampling to mitigate the effects of RFI. This paper provides an overview of the instrument and an example of initial results. Details are covered in subsequent papers in the session on Aquarius

  2. 75 FR 38837 - Susan Harwood Training Grant Program, FY 2010

    Science.gov (United States)

    2010-07-06

    ...: Notification of Funding Opportunity for Susan Harwood Training Grant Program, FY 2010. Funding Opportunity No... project performance period is $250,000. DATES: Targeted Topic training grant applications must be received... Links section, and then select ``Susan Harwood Training Grant Program''. Please note that on the Harwood...

  3. Susan Lindquist: Visionary scientist and peerless mentor.

    Science.gov (United States)

    Bevis, Brooke J

    2017-01-02

    The science universe is dimmer after one of our brightest stars, Susan Lee Lindquist, was taken by cancer on October 27, 2016. Sue was an innovative, creative, out-of-the-box scientific thinker. She had unique biological intuition-an instinct for both the way things worked and the right questions to ask to uncover new research insights. Her wide-ranging career began with the study of protein folding and molecular chaperones, and she went on to show that protein folding can have profound and unexpected biological effects on such diverse processes as cancer, evolution, and neurodegenerative disease. As Sue's laboratory manager, I would like to offer a ground-floor perspective on what made her an exceptional scientist, mentor, and leader. She created a harmonious, collegial environment where collaborative synergy fueled meaningful progress that will impact science for decades to come. © 2017 Bevis.

  4. Aquarius

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    (the Water-bearer; abbrev. Aqr, gen. Aquarii; area 980 sq. deg.) A southern zodiacal constellation that lies between Pegasus and Piscis Austrinus, and culminates at midnight in late August. Its origin dates back to Babylonian times and it is said to represent Ganymede in Greek mythology, who was snatched up by Aquila (the eagle) on Zeus's behest, to become cup-bearer to the gods. Its brightest st...

  5. The Dawning of the Stream of Aquarius in RAVE

    Science.gov (United States)

    Williams, M. E. K.; Steinmetz, M.; Sharma, S.; Bland-Hawthorn, J.; de Jong, R. S.; Seabroke, G. M.; Helmi, A.; Freeman, K. C.; Binney, J.; Minchev, I.; Bienaymé, O.; Campbell, R.; Fulbright, J. P.; Gibson, B. K.; Gilmore, G. F.; Grebel, E. K.; Munari, U.; Navarro, J. F.; Parker, Q. A.; Reid, W.; Siebert, A.; Siviero, A.; Watson, F. G.; Wyse, R. F. G.; Zwitter, T.

    2011-02-01

    We identify a new, nearby (0.5kpc constellation of Aquarius, we name it the Aquarius Stream. We identify 15 members of the stream lying between 30° Aquarius stream is thus a specimen of ongoing hierarchical Galaxy formation, rare for being right in the solar suburb.

  6. Aquarius Instrument and Salinity Retrieval

    Science.gov (United States)

    Le Vine, D. M.

    2011-01-01

    Aquarius has been designed to map the surface salinity field of the global ocean from space a parameter important for understanding ocean circulation and its relationship to climate and the global water cycle. Salinity is measured remotely from space by measuring the thermal emission from the ocean surface. This is done at the low frequency end of the microwave spectrum (e.g. 1.4 GHz) where the emission is sufficiently sensitive to changes in salinity to be detected with sophisticated radiometers. The goal is to monitor the seasonal and interannual variation of the large scale features of the surface salinity field in the open ocean by providing maps on a monthly basis with a spatial resolution of 150 km and an accuracy of 0.2 psu. These are challenging requirements that have led to some unique features of the instrument. These include: a) The addition of a co-located scatterometer to help provide a correction for roughness; b) The addition of a polarimetric channel (third Stokes parameter) to the radiometer to help correct for Faraday rotation; c) Asun-synchronous orbit with a 6 pm ascending equatorial crossing to minimize Faraday rotation and with the antennas looking away from the sun toward the nighttime side to minimize contamination by radiation from the sun; and d) An antenna designed to limit side lobes in the direction of rays from the sun. In addition, achieving the accuracy goal of 0.2 psu requires averaging over one month and to do this requires a highly stable radiometer. Aquarius has three separate radiometers that image in pushbroom fashion with the three antenna beams looking across track. The antenna is a 2.5-m diameter, offset parabolic reflector with three feed horns and the three beams are arranged to image with the boresight aligned to look across track, roughly perpendicular to the spacecraft heading and pointing away from the Sun. The three beams point at angles of theta = 25.8 deg., 33.8 deg. and 40.3 deg. with respect to the spacecraft

  7. Psychoanalytic Interpretation of Blueberries by Susan Gibb

    Directory of Open Access Journals (Sweden)

    Maya Zalbidea Paniagua

    2014-06-01

    Full Text Available Blueberries (2009 by Susan Gibb, published in the ELO (Electronic Literature Organization, invites the reader to travel inside the protagonist’s mind to discover real and imaginary experiences examining notions of gender, sex, body and identity of a traumatised woman. This article explores the verbal and visual modes in this digital short fiction following semiotic patterns as well as interpreting the psychological states that are expressed through poetical and technological components. A comparative study of the consequences of trauma in the protagonist will be developed including psychoanalytic theories by Sigmund Freud, Jacques Lacan and the feminist psychoanalysts: Melanie Klein and Bracha Ettinger. The reactions of the protagonist will be studied: loss of reality, hallucinations and Electra Complex, as well as the rise of defence mechanisms and her use of the artistic creativity as a healing therapy. The interactivity of the hypermedia, multiple paths and endings will be analyzed as a literary strategy that increases the reader’s capacity of empathizing with the speaker.

  8. Susan Sontag — A Forgotten Mother?

    Directory of Open Access Journals (Sweden)

    Kludia Ziewiec

    2013-01-01

    Full Text Available The article discusses new and republished translations of Susan Sontag’s work, recently launched by the Karakter publishing house: Regarding the Pan of Others, On Photography, and Against Interpretation and Other Essays. The article focuses on the elements of Sontag’s thought that make her a forgotten mother of feminist and gender theoreticians, as well as such influential critics as Michel Foucault and Roland Barthes. The article points out to continuations of Sontag’s thought in contemporary theoretical and social projects, and to the pertinence of her critical observations on theories based on metaphysics of presence: psychoanalysis, Marxism, or hermeneutics. The article also touches upon history of war photography and related war journalism, and upon the ambivalent quality of imaging of the misery of war. It also present historical and cultural circumstances of the development of Sontag’s thought in the intellectual milieu of New York in the 1960s. The discussion recapitulates the main statements of Sontag’s essays, relating them to a wider theoretical context, which is aimed at a reappraisal of the forgotten intelectual in the history of literature.

  9. Aquarius Third Stokes Parameter Measurements: Initial Results

    Science.gov (United States)

    Utku, Cuneyt; Vine, David M Le; Abraham, S.; Piepmeier, J.

    2012-01-01

    The Aquarius/SAC-D observatory was launched on June 10, 2011 and the Aquarius instrument has been collecting data continuously since late August. One of the unique features of the L-band radiometers comprising Aquarius is the presence of a polarimetric channel to measure the third Stokes parameter. The purpose is to provide a measure of Faraday rotation, which can be important for remote sensing at L-band, especially in the case of remote sensing of salinity which requires high precision. Initial results are presented here showing a reasonable agreement between retrieved and modeled Faraday rotation and also the "noisy" behavior at land-water boundaries and other mixed scenes predicted by theory.

  10. Meet EPA Scientist Susan Yee, Ph.D.

    Science.gov (United States)

    Susan Yee, Ph.D., is an ecologist at EPA's Gulf Ecology Division. She is working on the Puerto Rico Sustainable Communities program, developing decision support tools to evaluate how alternative decisions impact coastal ecosystem goods and services

  11. Streams in the Aquarius stellar haloes

    NARCIS (Netherlands)

    Gomez, Facundo A.; Helmi, Amina; Cooper, Andrew P.; Frenk, Carlos S.; Navarro, Julio F.; White, Simon D. M.

    2013-01-01

    We use the very high resolution, fully cosmological simulations from the Aquarius Project, coupled to a semi-analytical model of galaxy formation, to study the phase-space distribution of halo stars in 'solar neighbourhood' like volumes. We find that this distribution is very rich in substructure in

  12. Aquarius-Pisces Constellation Boundary Update

    Science.gov (United States)

    Durst, Steve

    2017-06-01

    Observation, mapping and study of Galaxy Stars has provided humanity direction, foundation, clarity and understanding through the ages.Human civilization advances itself using increasing intelligence and knowledge to develop tools and know how, the science of constellation star maps included: All that has been created by humanity, is to serve humanity.When people continue to use constellation star maps that no longer serve people effectively, the maps are updated, as is now the Aquarius-Pisces Constellation Boundary Update (APCBU), which marks 2000 as the year the Sun is in Aquarius at the vernal equinox.The 21st Century APCBU accounts for and incorporates science factors of precession, relativity and galacticity for professional astronomers, and social imperatives of increasing freedom, liberation and egalitarian culture for the 7.5 billion people of Earth.Twenty years into this first century of a new millennium and a new age is an effective time for an APCBU of such elegant simplicity that it changes less than 0.1% of the area of the IAU 1930 official constellation map, which marks 2597 about the year the Sun is in Aquarius at the time of the vernal equinox.The 21st Century APCBU results provide clarity and direction for humanity's next 2,000 years, if not 10,000 or 12,000 years, and advance the official astronomy / science start of the Aquarius Age -- long anticipated, desired, and imperative, especially in America -- by some 600 years.How much attention is increasingly focused on this region of the sky -- such as the recent discovery of 7 Earth-like worlds orbiting the Trappist-1 star in the Aquarius constellation -- will be an epochal 21st Century phenomenon of human science, society, and starlife.

  13. Susan swan and the female grotesque Susan swan and the female grotesque

    Directory of Open Access Journals (Sweden)

    Suzana Bornéo Funck

    2008-04-01

    Full Text Available Introduced to readers as “the tallest woman freelance writer in Canada”, Susan Swan belongs to a generation of writers whose experimental, innovative fiction has proved vital in the contemporary project of de/re/constructing narrative practice. Her 1983 novel The Biggest Modern Woman of the World constitutes an excellent example of what critic Linda Hutcheon has termed “historiographic metafiction”—”fiction that is intensely, self-reflexively art, but is also grounded in historical, social, and political realities” (Canadian 13. As a conscious engagement with social and historical contexts, such fiction aims at destabilizing and subverting accepted patterns of belief by reconceptualizing and narrating possible subjectivities. By means of intertextuality, especially parody, it engages in an ideological critique in terms of both sexual and national politics. Introduced to readers as “the tallest woman freelance writer in Canada”, Susan Swan belongs to a generation of writers whose experimental, innovative fiction has proved vital in the contemporary project of de/re/constructing narrative practice. Her 1983 novel The Biggest Modern Woman of the World constitutes an excellent example of what critic Linda Hutcheon has termed “historiographic metafiction”—”fiction that is intensely, self-reflexively art, but is also grounded in historical, social, and political realities” (Canadian 13. As a conscious engagement with social and historical contexts, such fiction aims at destabilizing and subverting accepted patterns of belief by reconceptualizing and narrating possible subjectivities. By means of intertextuality, especially parody, it engages in an ideological critique in terms of both sexual and national politics.

  14. Aquarius Retrieval of Sea Ice Thickness: Initial Results

    Science.gov (United States)

    De Matthaeis, Paolo; Utku, C.; Le Vine, David M.; Moyer, A.

    2014-01-01

    Aquarius brightness temperature data are used to calculate sea ice thickness in the Arctic region. The method is based on the inversion of a radiative transfer model for icecovered sea. Using this technique, the initial sea ice thickness values retrieved from Aquarius data are compared to the SMOSIce Data as well as to estimates from NASA's Operation IceBridge. The results show similar trends between the SMOS- and Aquarius-derived sea ice thickness, however the Aquarius estimates tend to be higher and noisier than the corresponding SMOS values. The accuracy of retrieved Aquarius ice thickness is possibly influenced by uncertainties in the ancillary input parameters and by the coarser resolutions of Aquarius.

  15. The Aquarius Salinity Retrieval Algorithm: Early Results

    Science.gov (United States)

    Meissner, Thomas; Wentz, Frank J.; Lagerloef, Gary; LeVine, David

    2012-01-01

    The Aquarius L-band radiometer/scatterometer system is designed to provide monthly salinity maps at 150 km spatial scale to a 0.2 psu accuracy. The sensor was launched on June 10, 2011, aboard the Argentine CONAE SAC-D spacecraft. The L-band radiometers and the scatterometer have been taking science data observations since August 25, 2011. The first part of this presentation gives an overview over the Aquarius salinity retrieval algorithm. The instrument calibration converts Aquarius radiometer counts into antenna temperatures (TA). The salinity retrieval algorithm converts those TA into brightness temperatures (TB) at a flat ocean surface. As a first step, contributions arising from the intrusion of solar, lunar and galactic radiation are subtracted. The antenna pattern correction (APC) removes the effects of cross-polarization contamination and spillover. The Aquarius radiometer measures the 3rd Stokes parameter in addition to vertical (v) and horizontal (h) polarizations, which allows for an easy removal of ionospheric Faraday rotation. The atmospheric absorption at L-band is almost entirely due to O2, which can be calculated based on auxiliary input fields from numerical weather prediction models and then successively removed from the TB. The final step in the TA to TB conversion is the correction for the roughness of the sea surface due to wind. This is based on the radar backscatter measurements by the scatterometer. The TB of the flat ocean surface can now be matched to a salinity value using a surface emission model that is based on a model for the dielectric constant of sea water and an auxiliary field for the sea surface temperature. In the current processing (as of writing this abstract) only v-pol TB are used for this last process and NCEP winds are used for the roughness correction. Before the salinity algorithm can be operationally implemented and its accuracy assessed by comparing versus in situ measurements, an extensive calibration and validation

  16. Collaborative Internet Projects: An Interview with Susan Silverman about Her Passion and Hobby.

    Science.gov (United States)

    Strangman, Nicole

    2002-01-01

    Outlines an interview with Susan Silverman, an instructional technology integration teacher in the Comsewogue school district in Port Jefferson Station, New York. Describes Susan's transformation from technophobe to an innovator of collaborative Internet projects. (PM)

  17. The shape of dark matter subhaloes in the Aquarius simulations

    NARCIS (Netherlands)

    Vera Ciro, Carlos; Sales, Laura V.; Helmi, Amina; Navarro, Julio F.

    We analyse the Aquarius simulations to characterize the shape of dark matter haloes with peak circular velocity in the range 8 < Vmax <200 km s-1, and perform a convergence study using the various Aquarius resolution levels. For the converged objects, we determine the principal axis (a ≥ b ≥ c) of

  18. The Dawning of the Stream of Aquarius in RAVE

    NARCIS (Netherlands)

    Williams, M. E. K.; Steinmetz, M.; Sharma, S.; Bland-Hawthorn, J.; de Jong, R. S.; Seabroke, G. M.; Helmi, A.; Freeman, K. C.; Binney, J.; Minchev, I.; Bienayme, O.; Campbell, R.; Fulbright, J. P.; Gibson, B. K.; Gilmore, G. F.; Grebel, E. K.; Munari, U.; Navarro, J. F.; Parker, Q. A.; Reid, W.; Siebert, A.; Siviero, A.; Watson, F. G.; Wyse, R. F. G.; Zwitter, T.

    2011-01-01

    We identify a new, nearby (0.5 kpc less than or similar to d less than or similar to 10 kpc) stream in data from the RAdial Velocity Experiment (RAVE). As the majority of stars in the stream lie in the constellation of Aquarius, we name it the Aquarius Stream. We identify 15 members of the stream

  19. Development of a aquarius/sac-d soil moisture product

    Science.gov (United States)

    Our objective in this investigation is to exploit the large amount of land observations that Aquarius acquires and extend the mission scope to land applications through the retrieval of soil moisture. This research will increase the value and impact of the Aquarius mission by including a broader sci...

  20. THE DAWNING OF THE STREAM OF AQUARIUS IN RAVE

    OpenAIRE

    Williams, M. E. K.; Steinmetz, M.; Sharma, S.; Bland-Hawthorn, J.; de Jong, R. S.; Seabroke, G. M.; Helmi, A.; Freeman, K. C.; Binney, J.; Minchev, I.; Bienayme, O.; Campbell, R.; Fulbright, J. P.; Gibson, B. K.; Gilmore, G. F.

    2011-01-01

    We identify a new, nearby (0.5 < d < 10 kpc) stream in data from the RAdial Velocity Experiment (RAVE). As the majority of stars in the stream lie in the constellation of Aquarius we name it the Aquarius Stream. We identify 15 members of the stream lying between 30 < l < 75 and -70< b

  1. Jonckheere Double Star Photometry - Part VII: Aquarius

    Science.gov (United States)

    Knapp, Wilfried R. A.

    2017-10-01

    If any double star discoverer is in urgent need of photometry then it is Jonckheere. There are over 3000 Jonckheere objects listed in the WDS catalog and a good part of them with magnitudes obviously far too bright. This report covers the Jonckheere objects in the constellation Aquarius. One image per object was taken with V-filter to allow for visual magnitude measurement by differential pho-tometry. All objects were additionally checked for common proper motion by comparing 2MASS to GAIA DR1 positions and a rather surprisingly large part of the objects qualify indeed as potential CPM pairs. For a few objects also WDS position errors were found.

  2. Susan Dicklitch. The Elusive Promise of NGO's | Heck | Uganda ...

    African Journals Online (AJOL)

    Susan Dicklitch. The Elusive Promise of NGO's. Simon Heck. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · http://dx.doi.org/10.4314/uj.v46i1.23044 · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about ...

  3. Aquarius Radiometer Performance: Early On-Orbit Calibration and Results

    Science.gov (United States)

    Piepmeier, Jeffrey R.; LeVine, David M.; Yueh, Simon H.; Wentz, Frank; Ruf, Christopher

    2012-01-01

    The Aquarius/SAC-D observatory was launched into a 657-km altitude, 6-PM ascending node, sun-synchronous polar orbit from Vandenberg, California, USA on June 10, 2011. The Aquarius instrument was commissioned two months after launch and began operating in mission mode August 25. The Aquarius radiometer meets all engineering requirements, exhibited initial calibration biases within expected error bars, and continues to operate well. A review of the instrument design, discussion of early on-orbit performance and calibration assessment, and investigation of an on-going calibration drift are summarized in this abstract.

  4. Evaluation of sea‐surface salinity observed by Aquarius

    National Research Council Canada - National Science Library

    Abe, Hiroto; Ebuchi, Naoto

    2014-01-01

    Sea‐surface salinity (SSS) observed by Aquarius was compared with global observations from Argo floats and offshore moored buoys to evaluate the quality of satellite SSS data and to assess error structures...

  5. Aquarius L2 Swath Single Orbit Soil Moisture V004

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Level-2 global soil moisture estimates derived from the NASA Aquarius passive microwave radiometer on the Satélite de Aplicaciones Científicas...

  6. Remote Sensing of Salinity and Overview of Results from Aquarius

    Science.gov (United States)

    Le Vine, D. M.; Dinnat, E. P.; Meissner, T.; Wentz, F.; Yueh, S. H.; Lagerloef, G. S. E.

    2015-01-01

    Aquarius is a combined active/passive microwave (L-band) instrument designed to map the salinity of global oceans from space. The specific goal of Aquarius is to monitor the seasonal and interannual variation of the large scale features of the sea surface salinity (SSS) field of the open ocean (i.e. away from land). The instrumentation has been designed to provide monthly maps with a spatial resolution of 150 km and an accuracy of 0.2 psu

  7. TRACING THE ORIGIN OF THE AQUARIUS STREAM. I

    Energy Technology Data Exchange (ETDEWEB)

    Wylie-de Boer, Elizabeth; Freeman, Kenneth; Keller, Stefan [Research School of Astronomy and Astrophysics, Australian National University, Mount Stromlo Observatory, Cotter Road, Weston Creek, ACT 2611 (Australia); Williams, Mary; Steinmetz, Matthias [Leibniz-Institut fuer Astrophysik Potsdam (AIP), An der Sternwarte 16, D-14482 Potsdam (Germany); Munari, Ulisse, E-mail: ewylie@mso.anu.edu.au, E-mail: kcf@mso.anu.edu.au, E-mail: mary@aip.de [INAF Astronomical Observatory of Padova, 36012 Asiago (Italy)

    2012-08-10

    We present an abundance analysis of six member stars of the recently discovered Aquarius stream, in an attempt to ascertain whether this halo stream is real and, if so, to understand its origin. The mean metallicities of the six stars have a dispersion of only 0.10 dex, indicating that they are part of a chemically coherent structure. We then investigate whether the stream represents the debris of a disrupted dwarf galaxy or a disrupted globular cluster. The [Ni/Fe]-[Na/Fe] plane provides a good diagnostic: globular cluster stars and dwarf spheroidal galaxy stars are well separated in this plane, and the Aquarius stream stars lie unambiguously in the globular cluster region. The Aquarius stream stars also lie on the distinct [Na/Fe]-[O/Fe] and [Mg/Fe]-[Al/Fe] relations delineated by Galactic globular cluster stars. Spectroscopic parameters for the six Aquarius stars show that they are tightly confined to a 12 Gyr, [Fe/H] =-1.0, {alpha}-enhanced isochrone, consistent with their identification as globular cluster debris. We present evidence that the Aquarius stream may continue through the disk and out into the northern halo. Our results indicate a globular cluster origin for the Aquarius stream and demonstrate the potential for chemical tagging to identify the origins of Galactic substructures.

  8. Globular Cluster Messier 2 in Aquarius

    Science.gov (United States)

    2003-01-01

    This image of the Globular cluster Messier 2 (M2) was taken by Galaxy Evolution Explorer on August 20, 2003. This image is a small section of a single All Sky Imaging Survey exposure of only 129 seconds in the constellation Aquarius. This picture is a combination of Galaxy Evolution Explorer images taken with the far ultraviolet (colored blue) and near ultraviolet detectors (colored red). Globular clusters are gravitationally bound systems of hundreds of thousands of stars that orbit in the halos of galaxies. The globular clusters in out Milky Way galaxy contain some of the oldest stars known. M2 lies 33,000 light years from our Sun with stars distributed in a spherical system with a radius of approximately 100 light years.

  9. Aquarius L3 Polar-Gridded Weekly Normalized Radar Cross Section V005

    Data.gov (United States)

    National Aeronautics and Space Administration — The data set consists of weekly polar-gridded Level-3 products of Aquarius L-band Normalized Radar Cross Section (NRCS) retrievals from the Aquarius/Satélite de...

  10. Aquarius L3 Polar-Gridded Weekly Sea Surface Salinity V005

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set consists of weekly gridded Level-3 products of Aquarius L-band radiometer Sea Surface Salinity (SSS) retrievals from the Aquarius/Satélite de...

  11. Evaluation of sea-surface salinity observed by Aquarius

    Science.gov (United States)

    Abe, Hiroto; Ebuchi, Naoto

    2014-11-01

    Sea-surface salinity (SSS) observed by Aquarius was compared with global observations from Argo floats and offshore moored buoys to evaluate the quality of satellite SSS data and to assess error structures. Aquarius products retrieved by different algorithms (Aquarius Official Release version 3.0 [V3.0], Combined Active-Passive [CAP] algorithm version 3.0, and Remote Sensing Systems test bed algorithm version 3) were compared. The Aquarius SSS was in good agreement with in situ salinity measurements for all three products. Root-mean-square (rms) differences of the salinity residual, with respect to Argo salinity, ranged from 0.41 to 0.52 psu. These three Aquarius products exhibit high SSS deviation from Argo salinity under lower sea-surface temperature conditions (wind conditions (>10 m s-1), probably due to model bias and uncertainty associated with sea-surface roughness. Furthermore, significant SSS differences between ascending (south-to-north) and descending (north-to-south) paths were detected. The monthly averaged Aquarius SSS (1° × 1° grid) was also compared with outputs from the ocean data optimal interpolation (OI) system operated by the Japan Agency for Marine-Earth Science Technology (JAMSTEC) and the ocean data assimilation system used by the Meteorological Research Institute, Japan Meteorological Agency (MRI/JMA). Negative bias, attributed to near-surface salinity stratification by precipitation, was detected in tropical regions. For 40°S-40°N, rms difference, with respect to JAMSTEC OI, is 0.27 psu for the V3.0, while the CAP product rms difference is only 0.22 psu, which is close to the Aquarius mission goal.

  12. Global soil moisture from the aquarius satellite: Description and initial assessment

    Science.gov (United States)

    Aquarius satellite observations over land offer a new resource for measuring soil moisture from space. Although Aquarius was designed for ocean salinity mapping, our objective in this investigation is to exploit the large amount of land observations that Aquarius acquires and extend the mission scop...

  13. Aquarius Radiometer RFI Detection, Mitigation, and Impact Assessment

    Science.gov (United States)

    Ruf, Christopher; Chen, David; Le Vine, David; de Matthaeis, Paolo; Piepmeier, Jeffrey

    2012-01-01

    The Aquarius/SAC-D satellite was launched on 10 June 2011 into a sun-synchronous polar orbit and the Aquarius microwave radiometers [1] became operational on 25 August 2011. Since that time, it has been measuring brightness temperatures at 1.4 GHz with vertical, horizontal and 3rd Stokes polarizations . Beginning well before the launch, there has been the concern that Radio Frequency Interference (RFI) could have an appreciable presence. This concern was initiated by, among other things, its prevalence in both early [2] and more recent [3,4] aircraft field experiments using 1.4 GHz radiometers, as well as by the strong RFI environment encountered during the recent ESA SMOS mission, also at 1.4 GHz [5]. As a result, a number of methods for RFI detection and mitigation have been developed and tested. One in particular, "glitch detection" and "pulse blanking" mitigation has been adapted for use by Aquarius [6, 7]. The early on-orbit performance of the Aquarius RFI detection and mitigation algorithm is presented here, together with an assessment of the global RFI environment at 1.4 GHz which can be derived from the Aquarius results.

  14. Synthesizing SMOS Zero-Baselines with Aquarius Brightness Temperature Simulator

    Science.gov (United States)

    Colliander, A.; Dinnat, E.; Le Vine, D.; Kainulainen, J.

    2012-01-01

    SMOS [1] and Aquarius [2] are ESA and NASA missions, respectively, to make L-band measurements from the Low Earth Orbit. SMOS makes passive measurements whereas Aquarius measures both passive and active. SMOS was launched in November 2009 and Aquarius in June 2011.The scientific objectives of the missions are overlapping: both missions aim at mapping the global Sea Surface Salinity (SSS). Additionally, SMOS mission produces soil moisture product (however, Aquarius data will eventually be used for retrieving soil moisture too). The consistency of the brightness temperature observations made by the two instruments is essential for long-term studies of SSS and soil moisture. For resolving the consistency, the calibration of the instruments is the key. The basis of the SMOS brightness temperature level is the measurements performed with the so-called zero-baselines [3]; SMOS employs an interferometric measurement technique which forms a brightness temperature image from several baselines constructed by combination of multiple receivers in an array; zero-length baseline defines the overall brightness temperature level. The basis of the Aquarius brightness temperature level is resolved from the brightness temperature simulator combined with ancillary data such as antenna patterns and environmental models [4]. Consistency between the SMOS zero-baseline measurements and the simulator output would provide a robust basis for establishing the overall comparability of the missions.

  15. Unwrapping the Thick Coat of Armor: A Conversation with Susan Albrecht

    Science.gov (United States)

    Kaff, Marilyn; Teagarden, Jim; Zabel, Robert

    2017-01-01

    Susan Albrecht's career has spanned more than 40 years. During those years she has served as an English teacher, school psychologist, behavior consultant, coordinator of services, and special education faculty member. Her contributions to the field include leadership positions with the Council for Children with Behavioral Disorders. Susan shared…

  16. Practitioner Profile: An Interview with Susan Bross, AFC®

    Directory of Open Access Journals (Sweden)

    Susan Bross

    2011-04-01

    Full Text Available

    Susan Bross is a nationally accredited financial counselor who established her private practice in 1992. She currently lives in San Rafael, California. She brings a multi-faceted background and a combination of skills to her work. As a financial counselor, she works with individuals, couples, and entrepreneurs throughout the nation to help clients develop a practical and emotionally healthy relationship with money. When asked, she will tell you that she is passionate about her work because it mirrors her own hard-won path with money. Readers of the Journal will find Ms. Bross’s approach to financial therapy inspiring. She teaches simple tools for effortless and sustainable cash flow and money management. She also guides her clients to balanced attitudes and beliefs about money and success.

  17. [The Durkheim Test. Remarks on Susan Leigh Star's Boundary Objects].

    Science.gov (United States)

    Gießmann, Sebastian

    2015-09-01

    The article reconstructs Susan Leigh Star's conceptual work on the notion of 'boundary objects'. It traces the emergence of the concept, beginning with her PhD thesis and its publication as Regions of the Mind in 1989. 'Boundary objects' attempt to represent the distributed, multifold nature of scientific work and its mediations between different 'social worlds'. Being addressed to several 'communities of practice', the term responded to questions from Distributed Artificial Intelligence in Computer Science, Workplace Studies and Computer Supported Cooperative Work (CSCW), and microhistorical approaches inside the growing Science and Technology Studies. Yet the interdisciplinary character and interpretive flexibility of Star’s invention has rarely been noticed as a conceptual tool for media theory. I therefore propose to reconsider Star's 'Durkheim test' for sociotechnical media practices.

  18. Aquarius: transitioning to an unmanned life support buoy.

    Science.gov (United States)

    Smith, S; Cooper, C

    1998-01-01

    The Aquarius underwater laboratory (or habitat) is the world's only operational saturation facility currently supporting scientific research and is operated by the University of North Carolina at Wilmington. The underwater laboratory accommodates and supports six aquanauts (scientists and habitat technicians) at habitat depth for 10-30-day missions. In the past, life support systems were provided by a manned support barge or Mobile Support Base (MSB) moored directly above Aquarius. The MSB was manned 24 h a day during saturation missions, which required 12 support staff in three separate shifts. A new unmanned Life Support Buoy (LSB) replaces the MSB and provides life support systems and is the voice, video, and data communications bridge from the habitat to the shore base. The LSB transmits status of all life support systems to the habitat and the shore base, thus minimizing the need for support staff to be present overtop of Aquarius during missions.

  19. Aquarius RFI Detection and Mitigation Algorithm: Assessment and Examples

    Science.gov (United States)

    Le Vine, David M.; De Matthaeis, P.; Ruf, Christopher S.; Chen, D. D.

    2013-01-01

    Aquarius is an L-band radiometer system designed to map sea surface salinity from space. This is a sensitive measurement, and protection from radio frequency interference (RFI) is important for success. An initial look at the performance of the Aquarius RFI detection and mitigation algorithm is reported together with examples of the global distribution of RFI at the L-band. To protect against RFI, Aquarius employs rapid sampling (10 ms) and a "glitch" detection algorithm that looks for outliers among the samples. Samples identified as RFI are removed, and the remainder is averaged to produce an RFI-free signal for the salinity retrieval algorithm. The RFI detection algorithm appears to work well over the ocean with modest rates for false alarms (5%) and missed detection. The global distribution of RFI coincides well with population centers and is consistent with observations reported by the Soil Moisture and Ocean Salinity mission.

  20. Aquarius Whole Range Calibration: Celestial Sky, Ocean, and Land Targets

    Science.gov (United States)

    Dinnat, Emmanuel P.; Le Vine, David M.; Bindlish, Rajat; Piepmeier, Jeffrey R.; Brown, Shannon T.

    2014-01-01

    Aquarius is a spaceborne instrument that uses L-band radiometers to monitor sea surface salinity globally. Other applications of its data over land and the cryosphere are being developed. Combining its measurements with existing and upcoming L-band sensors will allow for long term studies. For that purpose, the radiometers calibration is critical. Aquarius measurements are currently calibrated over the oceans. They have been found too cold at the low end (celestial sky) of the brightness temperature scale, and too warm at the warm end (land and ice). We assess the impact of the antenna pattern model on the biases and propose a correction. We re-calibrate Aquarius measurements using the corrected antenna pattern and measurements over the Sky and oceans. The performances of the new calibration are evaluated using measurements over well instrument land sites.

  1. Aquarius L-Band Radiometers Calibration Using Cold Sky Observations

    Science.gov (United States)

    Dinnat, Emmanuel P.; Le Vine, David M.; Piepmeier, Jeffrey R.; Brown, Shannon T.; Hong, Liang

    2015-01-01

    An important element in the calibration plan for the Aquarius radiometers is to look at the cold sky. This involves rotating the satellite 180 degrees from its nominal Earth viewing configuration to point the main beams at the celestial sky. At L-band, the cold sky provides a stable, well-characterized scene to be used as a calibration reference. This paper describes the cold sky calibration for Aquarius and how it is used as part of the absolute calibration. Cold sky observations helped establish the radiometer bias, by correcting for an error in the spillover lobe of the antenna pattern, and monitor the long-term radiometer drift.

  2. Aquarius Salinity Retrieval Algorithm: Final Pre-Launch Version

    Science.gov (United States)

    Wentz, Frank J.; Le Vine, David M.

    2011-01-01

    This document provides the theoretical basis for the Aquarius salinity retrieval algorithm. The inputs to the algorithm are the Aquarius antenna temperature (T(sub A)) measurements along with a number of NCEP operational products and pre-computed tables of space radiation coming from the galaxy and sun. The output is sea-surface salinity and many intermediate variables required for the salinity calculation. This revision of the Algorithm Theoretical Basis Document (ATBD) is intended to be the final pre-launch version.

  3. Topographic Signatures in Aquarius Radiometer/Scatterometer Response: Initial Results

    Science.gov (United States)

    Utku, C.; LeVine, D. M.

    2012-01-01

    The effect of topography on remote sensing at L-band is examined using the co-located Aquarius radiometer and scatterometer observations over land. A correlation with slope standard deviation is demonstrated for both the radiometer and scatterometer at topographic scales. Although the goal of Aquarius is remote sensing of sea surface salinity, the radiometer and scatterometer are on continuously and collect data for remote sensing research over land. Research is reported here using the data over land to determine if topography could have impact on the passive remote sensing at L-band. In this study, we report observations from two study regions: North Africa between 15 deg and 30 deg Northern latitudes and Australia less the Tasmania Island. Common to these two regions are the semi-arid climate and low population density; both favorable conditions to isolate the effect of topography from other sources of scatter and emission such as vegetation and urban areas. Over these study regions, topographic scale slopes within each Aquarius pixel are computed and their standard deviations are compared with Aquarius scatterometer and radiometer observations over a 36 day period between days 275 and 311 of 2011.

  4. Aquarius Active-Passive RFI Environment at L-Band

    Science.gov (United States)

    Le Vine, David M.; De Matthaeis, Paolo

    2014-01-01

    Active/Passive instrument combinations (i.e., radiometer and radar) are being developed at L-band for remote sensing of sea surface salinity and soil moisture. Aquarius is already in orbit and SMAP is planned for launch in the Fall of 2014. Aquarius has provided for the first time a simultaneous look at the Radio Frequency Interference (RFI) environment from space for both active and passive instruments. The RFI environment for the radiometer observations is now reasonably well known and examples from Aquarius are presented in this manuscript that show that RFI is an important consideration for the scatterometer as well. In particular, extensive areas of the USA, Europe and Asia exhibit strong RFI in both the radiometer band at 1.41 GHz and in the band at 1.26 GHz employed by the Aquarius scatterometer. Furthermore, in areas such as the USA, where RFI at 1.4 GHz is relatively well controlled, RFI in the scatterometer band maybe the limiting consideration for the operation of combination active/passive instruments.

  5. Substructure in the Stellar Halos of the Aquarius Simulations

    NARCIS (Netherlands)

    Helmi, Amina; Cooper, A. P.; White, S. D. M.; Cole, S.; Frenk, C. S.; Navarro, J. F.

    2011-01-01

    We characterize the substructure in the simulated stellar halos of Cooper et al. which were formed by the disruption of satellite galaxies within the cosmological N-body simulations of galactic halos of the Aquarius project. These stellar halos exhibit a wealth of tidal features: broad overdensities

  6. Soil Moisture Retrieval Using the Aquarius/SAC-D Instruments

    Science.gov (United States)

    Aquarius/SAC-D will share common elements with several current and future satellite missions that provide soil moisture. Passive microwave soil moisture retrieval using low frequencies is currently performed using Aqua Advanced Microwave Scanning Radiometer-E (AMSR-E) (C/X-band). This will extended ...

  7. Susan J. Quaal: the global and local impact of a transformational leader.

    Science.gov (United States)

    Finlay, L D

    1998-01-01

    To be a transformational leader in nursing, one must have forever changed the course of our practice. This article highlights the qualities of a great leader, Susan J. Quaal, PhD, APRN, CVS, CCRN. Described are examples of Susan's incredible clinical expertise and also the attributes that make her such a dynamic leader in all domains of the clinical nurse specialist role: Practitioner, educator/mentor, consultant, leader/administrator, and researcher. Interwoven in this article, you will also find the threads of humility and charity that make Susan such an extraordinary human being and a blessing to all the lives she touches.

  8. The RNA helicase Aquarius exhibits structural adaptations mediating its recruitment to spliceosomes.

    Science.gov (United States)

    De, Inessa; Bessonov, Sergey; Hofele, Romina; dos Santos, Karine; Will, Cindy L; Urlaub, Henning; Lührmann, Reinhard; Pena, Vladimir

    2015-02-01

    Aquarius is a multifunctional putative RNA helicase that binds precursor-mRNA introns at a defined position. Here we report the crystal structure of human Aquarius, revealing a central RNA helicase core and several unique accessory domains, including an ARM-repeat domain. We show that Aquarius is integrated into spliceosomes as part of a pentameric intron-binding complex (IBC) that, together with the ARM domain, cross-links to U2 snRNP proteins within activated spliceosomes; this suggests that the latter aid in positioning Aquarius on the intron. Aquarius's ARM domain is essential for IBC formation, thus indicating that it has a key protein-protein-scaffolding role. Finally, we provide evidence that Aquarius is required for efficient precursor-mRNA splicing in vitro. Our findings highlight the remarkable structural adaptations of a helicase to achieve position-specific recruitment to a ribonucleoprotein complex and reveal a new building block of the human spliceosome.

  9. Highlights of the First 15 Months of Aquarius Salinity Measurements

    Science.gov (United States)

    Lagerloef, Gary S. E.; Kao, Hsun-Ying; Wentz, Frank; LeVine, David M.; Yueh, Simon H.; Feldman, Gene C.

    2012-01-01

    Aquarius satellite salinity measurements are resolving the major global and regional spatial patterns, and temporal variations, since the start of routine data collection on 25 August 2011. This description includes the principal seasonal variations over the first annual cycle as observed by the mission. In particular, we identify the evolution of low salinity anomalies associated with the Atlantic and Pacific intertropical convergence zones (ITCZ), major river outflows such as the Amazon, a seasonal low salinity anomaly in the Panama bight, and other features. We also explore the links that the salinity variations have with precipitation and surface currents. We then will describe the variations related to the presently evolving 2012 El Nino, now evident, as it progresses through the summer and fall 2012. We conclude with a brief summary of the Aquarius data products and validation

  10. Is the Aquarius sea surface salinity variability representative?

    Science.gov (United States)

    Carton, J.; Grodsky, S.

    2016-12-01

    The leading mode of the Aquarius monthly anomalous sea surface salinity (SSS) is evaluated within the 50S-50N belt, where SSS retrieval accuracy is higher. This mode accounts for about 18% of the variance and resembles a pattern of the ENSO-induced anomalous rainfall. The leading mode of SSS variability deducted from a longer JAMSTEC analysis also accounts for about 17% of the variance and has very similar spatial pattern and almost a perfect correspondence of its temporal principal component to the SOI index. In that sense, the Aquarius SSS variability at low and middle latitudes is representative of SSS variability that may be obtained from longer records. This is explained by the fact that during the Aquarius period (2011-2015), the SOI index changed significantly from La Nina toward El Nino state, thus spanning a significant range of its characteristic variations. Multivariate EOF analysis of anomalous SSS and SST suggests that ENSO-induced shift in the tropical Pacific rainfall produces negatively correlated variability of temperature and salinity, which are expected if the anomalous surface flux (stronger rainfall coincident with less downward radiation) drives the system. But, anomalous SSS and SST are positively correlated in some areas including the northwestern Atlantic shelf (north of the Gulfstream) and the Pacific sector adjusting to the California peninsula. This positive correlation is indicative of an advection driven regime that is analyzed separately.

  11. The Aquarius Simulator and Cold-Sky Calibration

    Science.gov (United States)

    Le Vine, David M.; Dinnat, Emmanuel P.; Abraham, Saji; deMatthaeis, Paolo; Wentz, Frank J.

    2011-01-01

    A numerical simulator has been developed to study remote sensing from space in the spectral window at 1.413 GHz (L-band), and it has been used to optimize the cold-sky calibration (CSC) for the Aquarius radiometers. The celestial sky is a common cold reference in microwave radiometry. It is currently being used by the Soil Moisture and Ocean Salinity satellite, and it is planned that, after launch, the Aquarius/SAC-D observatory will periodically rotate to view "cold sky" as part of the calibration plan. Although radiation from the celestial sky is stable and relatively well known, it varies with location. In addition, radiation from the Earth below contributes to the measured signal through the antenna back lobes and also varies along the orbit. Both effects must be taken into account for a careful calibration. The numerical simulator has been used with the Aquarius configuration (antennas and orbit) to investigate these issues and determine optimum conditions for performing a CSC. This paper provides an overview of the simulator and the analysis leading to the selection of the optimum locations for a CSC.

  12. Development of a soil moisture product using aquarius/SAC-D observations

    Science.gov (United States)

    Our objective in this investigation is to exploit the large amount of land observations and extend the impact of the Aquarius satellite to land applications through the retrieval of soil moisture. This research will expand the impact of the Aquarius mission to a broader scientific community, explore...

  13. Aquarius/SAC-D soil moisture product using V3.0 observations

    Science.gov (United States)

    Although Aquarius was designed for ocean salinity mapping, our objective in this investigation is to exploit the large amount of land observations that Aquarius acquires and extend the mission scope to include the retrieval of surface soil moisture. The soil moisture retrieval algorithm development ...

  14. Aquarius and Remote Sensing of Sea Surface Salinity from Space

    Science.gov (United States)

    LeVine, David M.; Lagerloef, G. S. E.; Torrusio, S.

    2012-01-01

    Aquarius is an L-band radiometer and scatterometer instrument combination designed to map the salinity field at the surface of the ocean from space. The instrument is designed to provide global salinity maps on a monthly basis with a spatial resolution of 150 km and an accuracy of 0.2 psu. The science objective is to monitor the seasonal and interannual variation of the large scale features of the surface salinity field in the open ocean. This data will promote understanding of ocean circulation and its role in the global water cycle and climate.

  15. Textual Rhetorics and Textual Carnivals: Susan Miller and the "Subjects" of Rhetoric and Composition.

    Science.gov (United States)

    Reynolds, Nedra

    1991-01-01

    Reviews two books by Susan Miller: "Rescuing the Subject: A Critical Introduction to Rhetoric and the Writer" (1989) and "Textual Carnivals: The Politics of Composition" (1991). Notes how she rereads dominant histories of rhetoric and writing instruction, argues for a theory of textuality, and illustrates how attention to…

  16. Don't Take Touch for Granted: An Interview with Susan Lederman.

    Science.gov (United States)

    Verry, Rene

    1998-01-01

    Presents an interview with Susan Lederman that contains a fascinating and informative overview of the recent developments in neuropsychological research concerning the sense of touch. Discusses the physiological processes that support this sensory experience and reveals them to be much more flexible, intricate, and adaptive than previously…

  17. Re-Establishing Social Studies as a Core Subject: An Interview with Susan Griffin

    Science.gov (United States)

    Griffin, Susan

    2014-01-01

    NCSS Executive Director Susan Griffin was chair of the Task Force of Professional Organizations that worked with the Social Studies Assessment, Curriculum, and Instruction Collaborative (SSACI) of the Council of Chief State School Officers to initiate and guide the development of the "College, Career and Civic Life (C3) Framework for Social…

  18. Teaching Students About Stereotypes, Prejudice, and Discrimination: An Interview with Susan Fiske

    Science.gov (United States)

    Hackney, Amy

    2005-01-01

    Susan T. Fiske is professor of psychology, Princeton University (PhD, Harvard University; honorary doctorate, Universite Catholique de Louvain-la-Neuve, Belgium). She wrote Social Cognition (with Taylor) on how people make sense of each other. Currently, she investigates emotional prejudices (pity, contempt, envy, and pride) at cultural,…

  19. Inside the Sex Ed Studio: An Interview with Susan N. Wilson

    Science.gov (United States)

    Taverner, William J.

    2007-01-01

    "Inside the Sex Ed Studio" profiles leaders in the field of sexuality education. Susan N. Wilson, former Executive Coordinator of the Network for Family Life Education, long-time advocate for sexuality education, and the driving force behind New Jersey's K-12 mandate for comprehensive sexuality education was the first such leader to be…

  20. Aquarius Wind and SSS Retrieved Using the Combined Active-Passive Algorithm under All Weather Conditions

    Science.gov (United States)

    Yueh, S. H.; Tang, W.; Fore, A.; Freedman, A. P.; Neumann, G.; Hayashi, A.; Lagerloef, G. S.

    2012-12-01

    The Aquarius/SACD satellite was launched on June 10, 2011, and the Aquarius instrument has been operational since August 25, 2012. Aquarius is a combined passive/active L-band microwave instrument developed to map the salinity field at the surface of the ocean from space. The primary science objective of the Aquarius mission is to monitor the seasonal and interannual variation of the large scale features of the sea surface salinity (SSS) field in the open ocean with a spatial resolution of 150 km and a retrieval accuracy of 0.2 psu globally on a monthly basis. The measurement principle is based on the response of the L-band (1.413 GHz) sea surface brightness temperatures to sea surface salinity. To achieve the required 0.2 psu accuracy, the impact of sea surface roughness (e.g. wind-generated ripples and waves), along with several additional factors impacting the observed brightness temperature, must be corrected to better than a few tenths of a degree Kelvin. To this end, Aquarius includes a scatterometer to help correct for this surface roughness effect. In this paper we describe the characteristics and error estimates of the ocean surface wind vector and SSS retrieved using the Combined Active-Passive (CAP) algorithm, which does not use the NCEP wind for correcting Aquarius' brightness temperatures. Error estimates using the triple collocation analyses of SSM/I, NCEP and Aquarius-CAP winds indicate that the retrieved Aquarius wind speed accuracy is excellent with a random error of about 0.75 m s-1 for rain-free conditions. For rainy conditions when there were no SSM/I wind retrievals, we used the WindSAT-AW or ASCAT winds together with NCEP and CAP winds for triple collocation analysis. It is shown that Aquarius CAP wind speed is the most accurate under rainy conditions with RMS error below 2 m/s at 10 mm/h rain rate. In comparison with the NCEP wind direction, the Aquarius wind direction retrievals also appear accurate for above 10 m s-1. We further examine the

  1. Aquarius L3 Gridded 1-Degree Monthly Soil Moisture Climatology V004

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Level-3 gridded monthly global soil moisture climatology estimates derived from the NASA Aquarius passive microwave radiometer on the Satélite...

  2. Aquarius L3 Gridded 1-Degree Annual Soil Moisture V004

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Level-3 gridded annual global soil moisture estimates derived from the NASA Aquarius passive microwave radiometer on the Satélite de...

  3. Aquarius L3 Gridded 1-Degree Weekly Soil Moisture V004

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Level-3 gridded weekly global soil moisture estimates derived from the NASA Aquarius passive microwave radiometer on the Satélite de...

  4. Aquarius L3 Gridded 1-Degree Seasonal Soil Moisture V004

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Level-3 gridded seasonal global soil moisture estimates derived from the NASA Aquarius passive microwave radiometer on the Satélite de...

  5. Aquarius L3 Gridded 1-Degree Daily Soil Moisture V004

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Level-3 gridded daily global soil moisture estimates derived from the NASA Aquarius passive microwave radiometer on the Satélite de...

  6. Aquarius L3 Gridded 1-Degree Monthly Soil Moisture V004

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Level-3 gridded monthly global soil moisture estimates derived from the NASA Aquarius passive microwave radiometer on the Satélite de...

  7. Aquarius L3 Polar-Gridded Weekly Brightness Temperature and Sea Surface Salinity V005

    Data.gov (United States)

    National Aeronautics and Space Administration — The data set consists of weekly gridded Level-3 products of Aquarius L-band radiometer brightness temperature (TB) observations and Sea Surface Salinity (SSS)...

  8. Aquarius L3 Gridded 1-Degree Seasonal Soil Moisture Climatology V004

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Level-3 gridded seasonal global soil moisture climatology estimates derived from the NASA Aquarius passive microwave radiometer on the...

  9. Enhanced Resolution for Aquarius Salinity Retrieval near Land-Water Boundaries

    Science.gov (United States)

    Utku, Cuneyt; Le Vine, David M.

    2014-01-01

    A numerical reconstruction of the brightness temperature is examined as a potential way to improve the retrieval of salinity from Aquarius measurements closer to landwater boundaries. A test case using simulated ocean-land scenes suggest promise for the technique.

  10. Aquarius is required for proper CtIP expression and homologous recombination repair.

    Science.gov (United States)

    Sakasai, Ryo; Isono, Mayu; Wakasugi, Mitsuo; Hashimoto, Mitsumasa; Sunatani, Yumi; Matsui, Tadashi; Shibata, Atsushi; Matsunaga, Tsukasa; Iwabuchi, Kuniyoshi

    2017-10-23

    Accumulating evidence indicates that transcription is closely related to DNA damage formation and that the loss of RNA biogenesis factors causes genome instability. However, whether such factors are involved in DNA damage responses remains unclear. We focus here on the RNA helicase Aquarius (AQR), a known R-loop processing factor, and show that its depletion in human cells results in the accumulation of DNA damage during S phase, mediated by R-loop formation. We investigated the involvement of Aquarius in DNA damage responses and found that AQR knockdown decreased DNA damage-induced foci formation of Rad51 and replication protein A, suggesting that Aquarius contributes to homologous recombination (HR)-mediated repair of DNA double-strand breaks (DSBs). Interestingly, the protein level of CtIP, a DSB processing factor, was decreased in AQR-knockdown cells. Exogenous expression of Aquarius partially restored CtIP protein level; however, CtIP overproduction did not rescue defective HR in AQR-knockdown cells. In accordance with these data, Aquarius depletion sensitized cells to genotoxic agents. We propose that Aquarius contributes to the maintenance of genomic stability via regulation of HR by CtIP-dependent and -independent pathways.

  11. Validation of Aquarius Measurements Using Radiative Transfer Models at L-Band

    Science.gov (United States)

    Dinnat, E.; LeVine, David M.; Abraham, S.; DeMattheis, P.; Utku, C.

    2012-01-01

    Aquarius/SAC-D was launched in June 2011 by NASA and CONAE (Argentine space agency). Aquarius includes three L-band (1.4 GHz) radiometers dedicated to measuring sea surface salinity. We report detailed comparisons of Aquarius measurements with radiative transfer model predictions. These comparisons were used as part ofthe initial assessment of Aquarius data. In particular, they were used successfully to estimate the radiometer calibration bias and stability. Further comparisons are being performed to assess the performance of models in the retrieval algorithm for correcting the effect of sources of geophysical "noise" (e.g. the galactic background, atmospheric attenuation and reflected signal from the Sun). Such corrections are critical in bringing the error in retrieved salinity down to the required 0.2 practical salinity unit (psu) on monthly global maps at 150 km by 150 km resolution. The forward models making up the Aquarius simulator have been very useful for preparatory studies in the years leading to Aquarius' launch. The simulator includes various components to compute effects ofthe following processes on the measured signal: 1) emission from Earth surfaces (ocean, land, ice), 2) atmospheric emission and absorption, 3) emission from the Sun, Moon and celestial Sky (directly through the antenna sidelobes or after reflection/scattering at the Earth surface), 4) Faraday rotation, and 5) convolution of the scene by the antenna gain patterns. Since the Aquarius radiometers tum-on in late July 2011, the simulator has been used to perform a first order validation of the data. This included checking the order of magnitude ofthe signal over ocean, land and ice surfaces, checking the relative amplitude of signal at different polarizations, and checking the variation with incidence angle. The comparisons were also used to assess calibration bias and monitor instruments calibration drift. The simulator is also being used in the salinity retrieval. For example, initial

  12. Comparison of SMOS and Aquarius Sea Surface Salinity and Analysis of Possible Causes for the Differences

    Science.gov (United States)

    Dinnat, E. P.; Boutin, J.; Yin, X.; Le Vine, D. M.; Waldteufel, P.; Vergely, J. -L.

    2014-01-01

    Two ongoing space missions share the scientific objective of mapping the global Sea Surface Salinity (SSS), yet their observations show significant discrepancies. ESA's Soil Moisture and Ocean Salinity (SMOS) and NASA's Aquarius use L-band (1.4 GHz) radiometers to measure emission from the sea surface and retrieve SSS. Significant differences in SSS retrieved by both sensors are observed, with SMOS SSS being generally lower than Aquarius SSS, except for very cold waters where SMOS SSS is the highest overall. Figure 1 is an example of the difference between the SSS retrieved by SMOS and Aquarius averaged over one month and 1 degree in longitude and latitude. Differences are mostly between -1 psu and +1 psu (psu, practical salinity unit), with a significant regional and latitudinal dependence. We investigate the impact of the vicarious calibration and some components of the retrieval algorithm used by both mission on these differences.

  13. Comparisons of Aquarius Measurements over Oceans with Radiative Transfer Models at L-Band

    Science.gov (United States)

    Dinnat, E.; LeVine, D.; Abraham, S.; DeMattheis, P.; Utku, C.

    2012-01-01

    The Aquarius/SAC-D spacecraft includes three L-band (1.4 GHz) radiometers dedicated to measuring sea surface salinity. It was launched in June 2011 by NASA and CONAE (Argentine space agency). We report detailed comparisons of Aquarius measurements with radiative transfer model predictions. These comparisons are used as part of the initial assessment of Aquarius data and to estimate the radiometer calibration bias and stability. Comparisons are also being performed to assess the performance of models used in the retrieval algorithm for correcting the effect of various sources of geophysical "noise" (e.g. Faraday rotation, surface roughness). Such corrections are critical in bringing the error in retrieved salinity down to the required 0.2 practical salinity unit on monthly global maps at 150 km by 150 km resolution.

  14. "A hint of it, with initials": adultery, textuality and publicity in Jane Austen's Lady Susan.

    Science.gov (United States)

    Russell, Gillian

    2010-01-01

    In spite of Jane Austen's professed “eye” for an adulteress, comparatively little attention has been paid to adultery and divorce as themes and contexts of her fiction. Her unpublished epistolary novel Lady Susan has a distinctive status in Austen's oeuvre, recognized as being exemplary of her “style” and yet atypical of her later achievement. A neglected context for the novel is the extensive reporting of adultery trials in contemporary print culture and the moral panic concerning adultery in the 1780s and 1790s, focusing initially on the adulteress as the brazen woman of fashion and later as a figure of sentimentalized abjection. A particularly notorious case, that involving Lady Henrietta Grosvenor and George III's brother, the Duke of Cumberland, is directly alluded to in Lady Susan. The textual strategies of adultery trial literature, particularly its emphasis on indirection through the use of detail or “hint”, had a long-term influence on the development of Austen's fiction and her positioning of herself as a professional writer after the 1790s.

  15. First Results from the Microwave Radiometer (MWR) on Aquarius/SAC-D

    Science.gov (United States)

    Jones, L.; Gallo, J.; Rocca, D.; Rabolli, M.; Madero, F.; Kuba, J.; Masuelli, S.; Heredia, S. D.; Biswas, S. K.; Hejazin, Y.

    2011-12-01

    This paper presents first results from the Microwave Radiometer (MWR) instrument on the Aquarius/SAC-D satellite launched in June 2011. The MWR is a three channel pushbroom microwave radiometer with 8 antenna beams/channel that provides a measurement swath of approximately 380 Km. These channels provide 36.5 GHz dual horizontal and vertical polarized and 23.8 GHz horizontal polarized radiance measurements in an overlapping swath with the L-band Aquarius radiometer/scatterometer. From these microwave brightness temperatures, MWR provides ancillary geophysical measurements of columnar water vapor, ocean surface wind speed, oceanic rain rate and sea ice cover, which support the Aquarius mission objective of global sea surface salinity measurements. Results are presented showing MWR measurements compared to similar measurements made by the WindSat polarimetric radiometer on the US Navy's Coriolis satellite. The orbits of Aquarius and Windsat are very similar and provide about 60% overlap within a ± 45 minute window. First, inter-satellite radiometric comparisons of MWR brightness temperature with the WindSat are discussed. Also comparisons are made of MWR geophysical parameter retrievals with collocated WindSat environmental data records and the NOAA Global Data Assimilation System (GDAS) atmospheric and ocean surface parameters.

  16. An observing system simulation experiment (OSSE) for the aquarius/SAC-D soil moisture product

    Science.gov (United States)

    An Observing System Simulation Experiment for the Aquarius/SAC-D mission has been developed for assessing the accuracy of soil moisture retrievals from passive L-band remote sensing. The implementation of the OSSE is based on: a 1-km land surface model over the Red-Arkansas River Basin, a forward mi...

  17. Assessment of Aquarius/SAC-D Soil Moisture and Land Surface Temperature Using SMOS

    Science.gov (United States)

    Our objective is to exploit the large amount of land observations and extend the impact of Aquarius to land applications. The L-band observations over land present an unprecedented opportunity to provide a critical hydrologic parameter, land surface soil moisture. This research will expand the impac...

  18. The shape of dark matter haloes in the Aquarius simulations : evolution and memory

    NARCIS (Netherlands)

    Vera-Ciro, Carlos A.; Sales, Laura V.; Helmi, Amina; Frenk, Carlos S.; Navarro, Julio F.; Springel, Volker; Vogelsberger, Mark; White, Simon D. M.

    We use the high-resolution cosmological N-body simulations from the Aquarius project to investigate in detail the mechanisms that determine the shape of Milky Way type dark matter haloes. We find that, when measured at the instantaneous virial radius, the shape of individual haloes changes with

  19. Inter-comparison of SMAP, SMOS and Aquarius L-band brightness temperature observations

    Science.gov (United States)

    Verifying the calibration of the SMAP radiometer over land observations is an important mission requirement. Inter-comparison of L-band brightness temperature observations from different satellites (SMAP, SMOS and Aquarius) is a useful tool for radiometer calibration. Brightness temperatures observa...

  20. The shape of dark matter haloes in the Aquarius simulations : Evolution and memory

    NARCIS (Netherlands)

    Vera-Ciro, C.A.; Sales, L. V.; Helmi, A.; Reyle, C; Robin, A; Schultheis, M

    We use the high resolution cosmological N-body simulations from the Aquarius project to investigate in detail the mechanisms that determine the shape of Milky Way-type dark matter haloes. We find that, when measured at the instantaneous virial radius, the shape of individual haloes changes with

  1. The shape of dark matter haloes in the Aquarius simulations: Evolution and memory

    NARCIS (Netherlands)

    Vera-Ciro, C. A.; Sales, L. V.; Helmi, A.

    We use the high resolution cosmological N-body simulations from the Aquarius project to investigate in detail the mechanisms that determine the shape of Milky Way-type dark matter haloes. We find that, when measured at the instantaneous virial radius, the shape of individual haloes changes with

  2. Comparison Between AQUARIUS and SMOS brightness temperatures for Heterogeneous Land Areas

    Science.gov (United States)

    Benlloch, Amparo; Lopez-Baeza, Ernesto; Tenjo, Carolina; Navarro, Enrique

    2016-07-01

    Intercomparison between Aquarius and SMOS brightness temperatures (TBs) over land surfaces is more challenging than over oceans because land footprints are more heterogeneous. In this work we are comparing Aquarius and SMOS TBs under coherente conditions obtained both by considering similar areas, according to land uses and by stratifying by means of TVDI (Temperature Vegetation Dryness Index) that accounts for the dynamics of the vegetation instead of assuming static characteristics as in the previous approches. The area of study was chosen in central Spain where we could get a significant number of matches between both instruments. The study period corresponded to 2012-2014. SMOS level-3 data were obtained from the Centre Aval de Traitement des Données SMOS (CATDS) and Aquarius' from the Physical Oceanography Distributed Active Archive Center (PODAAC). Land uses were obtained from the Spanish SIOSE facility (Sistema de Informacion de Ocupacion del Suelo en España) that uses a scale of 1:25.000 and polygon geometrical structure layer. SIOSE is based on panchromatic and multispectral 2.5 m resolution SPOT-5 images together with Landsat-5 images and orthophotos from the Spanish Nacional Plan of Aerial Orthophotography (PNOA). TVDI values were obtained from MODIS operational products of land surface temperature and NDVI. SMOS ascending TBs were compared to inner-beam Aquarius descending half-orbit TBs coinciding over the study area at 06:00 h. The Aquarius inner beam has an incidence angle of 28,7º and SMOS data were considered for the 27,5º incidence angle. The SMOS products corresponded to version 2.6x (data before 31st Oct 2013) and version 2.7x (data after 1st Jan 2014). Intersections between both footprints were analysed under conditions of similar areas, land uses and TVDI values. For the latter (land uses/TVDI), a linear combination of SMOS land uses/TVDI was obtained to match the larger Aquarius footprint. A more physical approach is also under way

  3. Assessment of the Aquarius Space-borne Sea Surface Salinity Retrievals in Polar Ocean

    Science.gov (United States)

    Dinnat, E.; Brucker, L.; Caraballo Álvarez, I. O.

    2014-12-01

    Ocean salinity and temperature drive the thermohaline circulation and play a key role in the ocean-atmosphere coupling. With the availability of passive L-band (1.4 GHz) space-borne observations, Sea Surface Salinity (SSS) can be monitored globally at weekly time scales. SSS in the polar regions may be used to better constrain deep water formation, and to monitor changes due to freshening by the melting cryosphere. However, SSS remote sensing in the polar oceans is challenging because L-band radiometric observations are less sensitive to salinity in cold waters, SSS retrieval is less accurate for very rough seas and the presence of sea ice, icebergs and land in the radiometer field of view adds complexity to the retrieval process. Aquarius is a NASA space-borne instrument operating three L-band radiometers. While Aquarius SSS retrievals are performed with a good accuracy in tropical and mid-latitude oceans, a thorough assessment has not been performed in the colder waters of the polar oceans. To assess Aquarius data at high latitudes, we compare them to in-situ measurements from ship cruises. In the northern hemisphere, cruises between Denmark and Greenland are used. In the south, we use cruises in the Austral Ocean between Tasmania and Antarctica. These quality-controlled shipborne measurements (more extensive than the Argo profiling floats which are rare at high latitudes) allow us to assess Aquarius SSS over long transects, repeated weekly or monthly, over the three year period during which Aquarius has been operating. Our results show that significant contamination of SSS retrievals by ice and land are observed, despite the correction for land contamination applied in the Aquarius retrieval algorithm. Such long track comparisons with ship data will help refine the future versions of Aquarius space-borne products. Nonetheless, excluding the data contaminated by land or ice, the agreement with ship data is good. Specifically, the standard deviation is ~0.3 - 0

  4. In the postmodern mirror: intertextuality in Angels and Insects by Antonia Susan Byatt

    Directory of Open Access Journals (Sweden)

    Buda Agata

    2015-05-01

    Full Text Available The aim of the paper is to analyse the novel Angels and Insects by Antonia Susan Byatt in terms of intertextual references. The author’s assumptions are based on the categorisation by Ryszard Nycz, who distinguishes three major types of intertexts: text versus text, text versus literary genre and text versus mimesis. Byatt uses intertextuality mainly to comment on the role of nature in the world, as well as to enhance the importance of human relationship with nature. Moreover, the writer moves towards literary criticism, discussing poems by famous artists, such as Alfred Tennyson or John Milton. In this way, the novel by Byatt is also an example of metafiction. All the narration techniques used by the English writer make the novel a typically postmodern work of art.

  5. Intermittent large amplitude internal waves observed in Port Susan, Puget Sound

    Science.gov (United States)

    Harris, J. C.; Decker, L.

    2017-07-01

    A previously unreported internal tidal bore, which evolves into solitary internal wave packets, was observed in Port Susan, Puget Sound, and the timing, speed, and amplitude of the waves were measured by CTD and visual observation. Acoustic Doppler current profiler (ADCP) measurements were attempted, but unsuccessful. The waves appear to be generated with the ebb flow along the tidal flats of the Stillaguamish River, and the speed and width of the resulting waves can be predicted from second-order KdV theory. Their eventual dissipation may contribute significantly to surface mixing locally, particularly in comparison with the local dissipation due to the tides. Visually the waves appear in fair weather as a strong foam front, which is less visible the farther they propagate.

  6. (REREADING INDEX CARDS: THE ARCHIVIST AS INTERPRETER IN SUSAN PUI SAN LOK'S 'NEWS'

    Directory of Open Access Journals (Sweden)

    Sandra Camacho

    2018-01-01

    Full Text Available Looking at susan pui san lok's projects News (2005 and RoCH (2013, this paper contemplates the notions put forward by Michel-Rolph Trouillot and Jacques Derrida on the power of archivists, not solely as guardians of documents but also as their interpreters. Taking into consideration that photographic and moving image archives present unique difficulties in their cataloguing processes, I examine silences that might be generated by a thematic classification that is not impervious to archivists' biases. Moreover, I consider if the silences created by manual processes of classification and retrieval might be surpassed through digital technologies, or if it is possible that new technologies simply create different types of silencing.

  7. Improving knowledge of the surface salinity annual cycle with Aquarius satellite measurements

    Science.gov (United States)

    Lagerloef, G. S. E.

    2016-12-01

    To improve knowledge of the ocean surface salinity annual cycle, and its link to global precipitation patterns, remains a key science measurement objective for satellites. The Aquarius satellite data are applied here to address this, and the analysis is not as straightforward as it may seem. Sensor calibration is considered carefully to ensure that seasonality in external calibration data sources do not alias the satellite measurements. For example, quasi-monthly calibration error signals were identified early in the Aquarius mission. Subsequently, Aquarius data processing has relied primarily on an ocean target calibration method, whereby the satellite observations were co-located with output from the US Navy operational HYCOM model to adjust for these quasi-monthly calibration drifts. It was later determined that HYCOM salinity fields are themselves adjusted with a climatological restoring term, that imprints the seasonal climatology signal on the sensor calibration. When that output is compared with a parallel Aquarius data processing that bypasses the HYCOM ocean target calibration, and substitutes a simulation of the sensor electronics, the globally averaged output show very different annual signals between these trials. A modified ocean-target calibration, that employs satellite data matched directly with the in situ observations, is presently being investigated. The methodology uses signal processing to separate the satellite-in situ differences related to the sensor calibration from geophysical error sources. This remains a work-in-progress, and the results, with any unresolved issues, will be discussed. The presentation will also provide a very brief summary of Aquarius scientific accomplishments, the final "legacy" data set production, and the program to continue salinity data processing from other satellites.

  8. Global Soil Moisture from the Aquarius/SAC-D Satellite: Description and Initial Assessment

    Science.gov (United States)

    Bindlish, Rajat; Jackson, Thomas; Cosh, Michael; Zhao, Tianjie; O'Neil, Peggy

    2015-01-01

    Aquarius satellite observations over land offer a new resource for measuring soil moisture from space. Although Aquarius was designed for ocean salinity mapping, our objective in this investigation is to exploit the large amount of land observations that Aquarius acquires and extend the mission scope to include the retrieval of surface soil moisture. The soil moisture retrieval algorithm development focused on using only the radiometer data because of the extensive heritage of passive microwave retrieval of soil moisture. The single channel algorithm (SCA) was implemented using the Aquarius observations to estimate surface soil moisture. Aquarius radiometer observations from three beams (after bias/gain modification) along with the National Centers for Environmental Prediction model forecast surface temperatures were then used to retrieve soil moisture. Ancillary data inputs required for using the SCA are vegetation water content, land surface temperature, and several soil and vegetation parameters based on land cover classes. The resulting global spatial patterns of soil moisture were consistent with the precipitation climatology and with soil moisture from other satellite missions (Advanced Microwave Scanning Radiometer for the Earth Observing System and Soil Moisture Ocean Salinity). Initial assessments were performed using in situ observations from the U.S. Department of Agriculture Little Washita and Little River watershed soil moisture networks. Results showed good performance by the algorithm for these land surface conditions for the period of August 2011-June 2013 (rmse = 0.031 m(exp 3)/m(exp 3), Bias = -0.007 m(exp 3)/m(exp 3), and R = 0.855). This radiometer-only soil moisture product will serve as a baseline for continuing research on both active and combined passive-active soil moisture algorithms. The products are routinely available through the National Aeronautics and Space Administration data archive at the National Snow and Ice Data Center.

  9. "I Am Not a Fairy Tale": Contextualizing Sioux Spirituality and Story Traditions in Susan Power's "The Grass Dancer"

    Science.gov (United States)

    Diana, Vanessa Holford

    2009-01-01

    Standing Rock Sioux writer Susan Power's best-selling novel "The Grass Dancer" (1994) includes depictions of the supernatural and spiritual that do not conform to the Judeo-Christian or, in some cases, the atheist or rationalist worldviews of many readers. Power writes of ghost characters and haunted places, communication between the living and…

  10. 78 FR 75676 - Mark W. Dobronski and Susan K. Dobronski-Acquisition of Control Exemption-Adrian & Blissfield...

    Science.gov (United States)

    2013-12-12

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF TRANSPORTATION Surface Transportation Board Mark W. Dobronski and Susan K. Dobronski--Acquisition of Control Exemption... Company, Lapeer Industrial Railroad Company and Jackson & Lansing Railroad Company Mark W. Dobronski and...

  11. Dynamical Analysis of the Clusters and Superclusters of Galaxies on the Aquarius Region

    Science.gov (United States)

    Caretta, C. A.

    2002-03-01

    From photometric data in b(J) and R bands, obtained from plates and films digitized respectively with COSMOS and APM machines, we have carried out a study on the surface distribution of galaxies in a region of 10 deg x 6 deg in the Aquarius constellation that presents a great concentration of galaxy clusters according to the catalogs of such objects in the literature. From the application of counts-in-cells and matched-filters techniques, supplementing the identifications on the catalogs from the literature, we have constructed a list of 102 cluster candidates for the region. With spectroscopic observations of galaxy samples, selected in the highest density regions of the 102 candidates, we were able to detect 107 galaxy systems, clusters and groups, in the redshift space. A deeper analysis for most of these systems, specially those with more chance of being rich clusters, made possible the determination of structural and dynamical parameters, as well as the conclusion that 40 to 50% of the systems have substructures and also that 15% are subject to significant superposition effects. By applying a percolation algorithm to the spatial distribution of clusters and groups, as well as to the clusters available from the literature for a larger region 22 deg x 22 deg centered in Aquarius, we have found 2 very rich superclusters of galaxies, at z = 0.086 and z = 0.112, dubbed Aquarius-1 and Aquarius-2, respectively with 9 and 14 clusters. We also found a filament between 0.12 Aquarius-1 supercluster seems to be part of a larger structure, that extends north-westwards, with a PA about 120 deg, made of 20 clusters. The part of that structure in the studied region presents an overdensity of 85 times the mean one, a Virial mass of 1.1 x 10e+16 1/h MSol, an harmonic radius of 12.5 1/h Mpc, and contains two cores, each one with at least two bounded clusters. The Aquarius-2 supercluster, on the other hand, seems to be restricted to the studied region and presents a flat shape

  12. Consistency of Aquarius version-4 sea surface salinity with Argo products on various spatial and temporal scales

    Science.gov (United States)

    Lee, Tong

    2017-04-01

    Understanding the accuracies of satellite-derived sea surface salinity (SSS) measurements in depicting temporal changes and the dependence of the accuracies on spatiotemporal scales are important to capability assessment, future mission design, and applications to study oceanic phenomena of different spatiotemporal scales. This study quantifies the consistency between Aquarius Version-4 monthly gridded SSS (released in late 2015) with two widely used Argo monthly gridded near-surface salinity products. The analysis focused on their consistency in depicting temporal changes (including seasonal and non-seasonal) on various spatial scales: 1˚ x1˚ , 3˚ x3˚ , and 10˚ x10˚ . Globally averaged standard deviation (STD) values for Aquarius-Argo salinity differences on these three spatial scales are 0.16, 0.14, 0.09 psu, compared to those between the two Argo products of 0.10, 0.09, and 0.04 psu. Aquarius SSS compare better with Argo data on non-seasonal (e.g., interannual and intraseasonal) than for seasonal time scales. The seasonal Aquarius-Argo SSS differences are mostly concentrated at high latitudes. The Aquarius team is making active efforts to further reduce these high-latitude seasonal biases. The consistency between Aquarius and Argo salinity is similar to that between the two Argo products in the tropics and subtropics for non-seasonal signals, and in the tropics for seasonal signals. Therefore, the representativeness errors of the Argo products for various spatial scales (related to sampling and gridding) need to be taken into account when estimating the uncertainty of Aquarius SSS. The globally averaged uncertainty of large-scale (10˚ x10˚ ) non-seasonal Aquarius SSS is approximately 0.04 psu. These estimates reflect the significant improvements of Aquarius Version-4 SSS over the previous versions. The estimates can be used as baseline requirements for future ocean salinity missions from space. The spatial distribution of the uncertainty estimates is

  13. A Journey, the Pain of Others, and Historical Experience: Susan Silas

    Directory of Open Access Journals (Sweden)

    Sendyka, Roma

    2014-12-01

    Full Text Available The author interprets Susan Silas' Helmbrechts walk (1998-2003, a unique series of forty-five photographs and supplementing visual and textual materials collected during the walk along the route of two hundred and twenty-five miles. The walk repeats the route which in 1945 had to undertake women prisoners from the concentration camp in Helmbrechts near Flossenbürg in their death march to Prachatice in Czech Republic. The pictures Silas takes, the people she meets, and finally the trees, the very materiality of the road become the factors of creating her own, individual memory of the event from the past. Silas selects an object from "the margins of the Holocaust" – a forgotten event that she re-presents by reacting to contemporary objects placed along the route of the event. Silas' work offers an opportunity to critically review the concept of memory landscapes (where is memory located in a landscape? and the phenomenon of dark tourism (is following in the footsteps of the prisoners a kind of pilgrimage, tourism, or therapy?. Silas problematises the question of memory, as well as examines different kinds of non-memory. Her camera is directed at locations that can be termed "the non-sites of memory."

  14. Characterization and Correction of Aquarius Long Term Calibration Drift Using On-Earth Brightness Temperature Refernces

    Science.gov (United States)

    Brown, Shannon; Misra, Sidharth

    2013-01-01

    The Aquarius/SAC-D mission was launched on June 10, 2011 from Vandenberg Air Force Base. Aquarius consists of an L-band radiometer and scatterometer intended to provide global maps of sea surface salinity. One of the main mission objectives is to provide monthly global salinity maps for climate studies of ocean circulation, surface evaporation and precipitation, air/sea interactions and other processes. Therefore, it is critical that any spatial or temporal systematic biases be characterized and corrected. One of the main mission requirements is to measure salinity with an accuracy of 0.2 psu on montly time scales which requires a brightness temperature stability of about 0.1K, which is a challenging requirement for the radiometer. A secondary use of the Aquarius data is for soil moisture applications, which requires brightness temperature stability at the warmer end of the brightness temperature dynamic range. Soon after launch, time variable drifts were observed in the Aquarius data compared to in-situ data from ARGO and models for the ocean surface salinity. These drifts could arise from a number of sources, including the various components of the retrieval algorithm, such as the correction for direct and reflected galactic emission, or from the instrument brightness temperature calibration. If arising from the brightness temperature calibration, they could have gain and offset components. It is critical that the nature of the drifts be understood before a suitable correction can be implemented. This paper describes the approach that was used to detect and characterize the components of the drift that were in the brightness temperature calibration using on-Earth reference targets that were independent of the ocean model.

  15. Aquarius is required for proper CtIP expression and homologous recombination repair

    OpenAIRE

    Sakasai, Ryo; Isono, Mayu; Wakasugi, Mitsuo; Hashimoto, Mitsumasa; Sunatani, Yumi; Matsui, Tadashi; Shibata, Atsushi; Matsunaga, Tsukasa; Iwabuchi, Kuniyoshi

    2017-01-01

    Accumulating evidence indicates that transcription is closely related to DNA damage formation and that the loss of RNA biogenesis factors causes genome instability. However, whether such factors are involved in DNA damage responses remains unclear. We focus here on the RNA helicase Aquarius (AQR), a known R-loop processing factor, and show that its depletion in human cells results in the accumulation of DNA damage during S phase, mediated by R-loop formation. We investigated the involvement o...

  16. Analysis of RFI Statistics for Aquarius RFI Detection and Mitigation Improvements

    Science.gov (United States)

    de Matthaeis, Paolo; Soldo, Yan; Le Vine, David M.

    2016-01-01

    Aquarius is an L-band active/passive sensor designed to globally map sea surface salinity from space. Two instruments, a radar scatterometer and a radiometer, observe the same surface footprint almost simultaneously. The radiometer is the primary instrument for sensing sea surface salinity (SSS), while the scatterometer is included to provide a correction for sea surface roughness, which is a primary source of error in the salinity retrieval. Although the primary objective is the measurement of SSS, the instrument combination operates continuously, acquiring data over land and sea ice as well. An important feature of the data processing includes detection and mitigation of Radio Frequency Interference (RFI) which is done separately for both active and passive instruments. Correcting for RFI is particularly critical over ocean because of the high accuracy required in the brightness temperature measurements for SSS retrieval. It is also necessary for applications of the Aquarius data over land, where man-made interference is widespread, even though less accuracy is required in this case. This paper will provide an overview of the current status of the Aquarius RFI processing and an update on the ongoing work on the improvement of the RFI detection and mitigation performance.

  17. Aquarius Brightness Temperature Variations at Dome C and Snow Metamorphism at the Surface. [29

    Science.gov (United States)

    Brucker, Ludovic; Dinnat, Emmanuel Phillippe; Picard, Ghislain; Champollion, Nicolas

    2014-01-01

    The Antarctic Plateau is a promising site to monitor microwave radiometers' drift, and to inter-calibrate microwave radiometers, especially 1.4 GHz (L-band) radiometers on board the Soil Moisture and Ocean Salinity (SMOS), and AquariusSAC-D missions. The Plateau is a thick ice cover, thermally stable in depth, with large dimensions, and relatively low heterogeneities. In addition, its high latitude location in the Southern Hemisphere enables frequent observations by polar-orbiting satellites, and no contaminations by radio frequency interference. At Dome C (75S, 123E), on the Antarctic Plateau, the substantial amount of in-situ snow measurements available allows us to interpret variations in space-borne microwave brightness temperature (TB) (e.g. Macelloni et al., 2007, 2013, Brucker et al., 2011, Champollion et al., 2013). However, to analyze the observations from the Aquarius radiometers, whose sensitivity is 0.15 K, the stability of the snow layers near the surface that are most susceptible to rapidly change needs to be precisely assessed. This study focuses on the spatial and temporal variations of the Aquarius TB over the Antarctic Plateau, and at Dome C in particular, to highlight the impact of snow surface metamorphism on the TB observations at L-band.

  18. UNDERSTANDİNG SUSAN BORDO AND HER WORK; UNBEARABLE WEİGHT :FEMİNİSM, WESTERN CULTURE, BODY

    Directory of Open Access Journals (Sweden)

    ÇAĞLAR DEMİR

    2017-02-01

    Full Text Available Throughout history of thought, there have been many views about the women, their status in society, their struggle with patriarchy, and inequality  applied to them in all areas. There are different ways of oppression on women, such as confinement to home, inequality in wages between both sexes.  However, few scholars have written and declared their own views about how the patriarchal world and companies form women as they wish. Susan Bordo is one of  the most outstanding and distinguished feminist writers in the world who focuses on  how patriarchal capitalist understanding works on women’s body in terms of weight and weakness. According to Susan Bordo, male dominated capital world decides on women about what to wear and what to eat and women try to lose weight to be in the form men wish. State of  starving all the time leads to an illness called anorexia. The writer bases her views on the thoughts of literary critic and thinker, Foucault. The  objective of this article is to help the readers understand Susan Bordo’s views and analyse her impressive work; Unbearable Weight: Feminism, Western Culture and  the Body  and make her known in academic world.

  19. Bárbara Mujica, ed., Shakespeare and the Spanish «Comedia». Translation, Interpretation, Performance. Essays in Honor of Susan L. Fischer

    Directory of Open Access Journals (Sweden)

    Alejandro García-Reidy

    2016-01-01

    Full Text Available Reseña de Bárbara Mujica, ed., Shakespeare and the Spanish «Comedia». Translation, Interpretation, Performance. Essays in Honor of Susan L. Fischer, Bucknell University Press, Lewisburg, 2013, 298 pp. ISBN 9781611485172.

  20. Recent advances in the salinity retrieval algorithms for Aquarius and Soil Moisture Active Passive (SMAP)

    Science.gov (United States)

    Meissner, Thomas; Wentz, Frank; Lee, Tong

    2017-04-01

    Our presentation discusses the latest improvements in the salinity retrievals both for Aquarius and Soil Moisture Active-Passive (SMAP) since the last releases. The Aquarius V4.0 was released in June 2015. The final V5.0 release is planned for late 2017. SMAP V 2.0 has been released in September 2016. We will present validation results for both Aquarius V5.0 pre-release and SMAP V2.0 salinity comparing with near-surface salinity measurements from Argo floats. We show that salty biases at higher northern latitudes in Aquarius V4.0 can be explained by inaccuracy in the model used in correcting for the absorption by atmospheric oxygen. These biases will be mitigated in V5.0 by fine-tuning the parameters in the oxygen absorption model. The full 360-degree look capability of SMAP makes it possible to take observations from the forward and backward looking direction at the same instance of time. This two-look capability aids the salinity retrievals. One of the largest spurious contaminations in the salinity retrievals is caused by the galactic reflection from the ocean surface. Because in most instances the reflected galaxy appears only in either the forward or the backward look, it is possible to determine its contribution by taking the difference of the measured SMAP brightness temperatures between the two looks. Our result suggests that the surface roughness that is used in the galactic correction needs to be increased and also the estimated strength of some of the galactic sources need to be slightly adjusted. The improved galaxy correction has been implemented in SMAP V2.0 retrieval and will be included in Aquarius V5.0 as well. It helps the mitigation of residual zonal and temporal biases that were present in both products. Another major cause of the observed zonal biases in SMAP is the emissive SMAP mesh antenna. In order to correct for it, an accurate knowledge of the emissivity of the antenna and its physical temperature are required. We discuss the improvements

  1. Podróż, cudze cierpienie i doświadczenie historyczne: Susan Silas

    Directory of Open Access Journals (Sweden)

    Sendyka, Roma

    2014-12-01

    Full Text Available Autorka interpretuje pracę Susan Silas Helmbrechts walk (1998-2003, szczególny cykl czterdziestu pięciu zdjęć i dołączonych do nich materiałów wizualnych oraz tekstowych zbudowany podczas przejścia trasy dwustu dwudziestu pięciu mil, które w 1945 roku musiały przebyć kobiety pędzone w marszu śmierci z Helmbrecht koło Flossenbürga do czeskich Prachatic. Wykonywane zdjęcia, napotykani ludzie, w końcu – drzewa, sama materialność drogi stają się czynnikami wytwarzania własnej, indywidualnej pamięci wydarzenia sprzed lat. Silas wybiera szczególny obiekt "z marginesów Zagłady" – zapomniane zdarzenie, które przedstawia obserwując współczesne obiekty położone wzdłuż trasy tego zdarzenia. Praca Silas pozwala przyjrzeć się krytycznie koncepcji memory landscapes (gdzie w krajobrazie umiejscawia się pamięć? i zjawisku dark tourism (czy podążanie śladami więźniarek to pielgrzymka, turystyka czy terapia?. Silas problematyzuje nie tylko kwestię pamięci, bada również rodzaje nie-pamiętania. Jej kamera zostaje zwrócona ku lokalizacjom, które można nazwać "nie-miejscami pamięci".

  2. Treasure Your Exceptions: An Interview with 2017 George Beadle Award Recipient Susan A. Gerbi.

    Science.gov (United States)

    Gerbi, Susan A

    2017-12-01

    THE Genetics Society of America's (GSA) George W. Beadle Award honors individuals who have made outstanding contributions to the community of genetics researchers and who exemplify the qualities of its namesake. The 2017 recipient is Susan A. Gerbi, who has been a prominent leader and advocate for the scientific community. In the course of her research on DNA replication, Gerbi helped develop the method of Replication Initiation Point (RIP) mapping to map replication origins at the nucleotide level, improving resolution by two orders of magnitude. RIP mapping also provides the basis for the now popular use of λ-exonuclease to enrich nascent DNA to map replication origins genome-wide. Gerbi's second area of research on ribosomal RNA revealed a conserved core secondary structure, as well as conserved nucleotide elements (CNEs). Some CNEs are universally conserved, while other CNEs are conserved in all eukaryotes but not in archaea or bacteria, suggesting a eukaryotic function. Intriguingly, the majority of the eukaryotic-specific CNEs line the tunnel of the large ribosomal subunit through which the nascent polypeptide exits. Gerbi has promoted the fly Sciara coprophila as a model organism ever since she used its enormous polytene chromosomes to help develop the method of in situ hybridization during her Ph.D. research in Joe Gall's laboratory. The Gerbi laboratory maintains the Sciara International Stock Center and manages its future, actively spreading Sciara stocks to other laboratories. Gerbi has also served in many leadership roles, working on issues of science policy, women in science, scientific training, and career preparation. This is an abridged version of the interview. The full interview is available on the Genes to Genomes blog, at genestogenomes.org/gerbi. Copyright © 2017 by the Genetics Society of America.

  3. The Impact of Dielectric Constant Model and Surface Reference on Differences Between SMOS and Aquarius Sea Surface Salinity

    Science.gov (United States)

    Dinnat, E. P.; Boutin, J.; Yin, X.; LeVine, D. M.

    2014-01-01

    Two ongoing space missions share the scientific objective of mapping the global Sea Surface Salinity (SSS), yet their observations show significant discrepancies. ESA's Soil Moisture and Ocean Salinity (SMOS) and NASA's Aquarius use L-band (1.4 GHz) radiometers to measure emission from the sea surface and retrieve SSS. Significant differences in SSS retrieved by both sensors are observed, with SMOS SSS being generally lower than Aquarius SSS, except for very cold waters where SMOS SSS is the highest overall. Figure 1 is an example of the difference between the SSS retrieved by SMOS and Aquarius averaged over one month and 1 degree in longitude and latitude. Differences are mostly between -1 psu and +1 psu (psu, practical salinity unit), with a significant regional and latitudinal dependence. We investigate the impact of the vicarious calibration and retrieval algorithm used by both mission on these differences.

  4. Aquarius' Object-Oriented, plug and play component-based flight software

    Science.gov (United States)

    Murray, A.; Shahabuddin, M.

    The Aquarius mission involves a combined radiometer and radar instrument in low-Earth orbit, providing monthly global maps of Sea Surface Salinity. Operating successfully in orbit since June, 2011, the spacecraft bus was furnished by the Argentine space agency, Comision Nacional de Actividades Espaciales (CONAE). The instrument, built jointly by NASA's Caltech/JPL and Goddard Space Flight Center, has been successfully producing expectation-exceeding data since it was powered on in August of 2011. In addition to the radiometer and scatterometer, the instrument contains an command & data-handling subsystem with a computer and flight software (FSW) that is responsible for managing the instrument, its operation, and its data. Aquarius' FSW is conceived and architected as a Component based system, in which the running software consists of a set of Components, each playing a distinctive role in the subsystem, instantiated and connected together at runtime. Component architectures feature a well-defined set of interfaces between the Components, visible and analyzable at the architectural level. As we will describe, this kind of an architecture offers significant advantages over more traditional FSW architectures, which often feature a monolithic runtime structure. Component-based software is enabled by Object-Oriented (OO) techniques and languages, the use of which again is not typical in space mission FSW. We will argue in this paper that the use of OO design methods and tools (especially the Unified Modeling Language), as well as the judicious usage of C++, are very well suited to FSW applications, and we will present Aquarius FSW, describing our methods, processes, and design, as a successful case in point.

  5. Sac-D Aquarius a Satellite for Ocean, Climate and Environment. One Year of Data

    Science.gov (United States)

    Torrusio, S.; Lagerloef, G.; Rabolli, M.; LeVine, D.

    2012-07-01

    The SAC-D/Aquarius satellite was launched in June 10, 2011. It's a joint mission between Argentina (through CONAE) and US (NASA). This satellite is a true Observatory with a suite of sensors for Earth Observation, its weight is 1400 kg, sun-synchronous orbit at 657 km (6 pm ascendant node), revisit of seven days. Other space agencies have contributed with instruments and support (facilities and ground segment), as CNES, CSI, ASI and AEB/INPE. The primary objective is to monitor global variations in ocean surface salinity (SSS) in order to improve the knowledge about ocean circulation, water cycle and climate. The SSS is performed with Aquarius instrument (NASA). Other oceanic and atmospheric parameters are measured with a MWR, from CONAE, in K and Ka band, as wind speed, rain rate, sea ice, water vapour and liquid water in clouds. The thermal camera (NIRST) estimates sea surface temperature and detect high temperature events (fires and volcanic eruptions). The High Sensitivity Camera (HSC) generates night images (very useful for fishery activity monitoring in the sea, studying of electrical storms, polar auroras and urban application). The DCS (Data Collection System, from CONAE) can receive meteorological and environmental data from ground platforms and distribute among users. The TDP (Technological Demonstration Package, from CONAE) measures different parameters of satellite position and velocity. Other two important instruments are ROSA (from Italy) and CARMEN 1 (from France). The first is an atmospheric sounder, it allows elaborating atmospheric profiles of temperature, pressure and humidity, and the second has detectors for studies of space debris and the effects of radiation on electronic devices. This work provides a review of the first year of data, including the status of calibration and validation, other finding and at the same time we want to present the progress in the active educational and outreach program including the information of SAC-D Aquarius

  6. Retrieval of Sea Surface Salinity from The NASA Soil Moisture Active Passive and Aquarius Mission Data

    Science.gov (United States)

    Yueh, S. H.; Fore, A.; Tang, W.; Hayashi, A.

    2016-12-01

    NASA's Soil Moisture Active Passive (SMAP) mission was launched in January 2015 to provide global mapping of soil moisture. SMAP has two instruments, a polarimetric radiometer and a multi-polarization synthetic aperture radar. The radar stopped operation on 7 July 2015. Both instruments operate at L-band frequencies and share a single 6-m rotating mesh antenna, producing a fixed incidence angle conical scan at 40° across a 1000-km swath. We have analyzed all available SMAP and Aquarius data to improve the geophysical model functions, relating the L-band radar and radiometer data to ocean surface wind speed, wind direction, significant wave height and sea surface temperature. We find that it is necessary to account for the fourth order harmonics for wind direction effect and SST influence on sea surface scattering. The SMAP SSS retrieval algorithm developed at the Jet Propulsion Laboratory leverages the QuikSCAT and Aquarius algorithms to account for SMAP's two-look geometry for retrieval of SSS and wind speed. The retrieval algorithm has been applied to more than one year of SMAP radiometer data. We have also applied the Combined Active Passive (CAP) algorithm to about three months of SMAP data from April to early July 2015. The spatial patterns of the SMAP SSS agree well with climatological distributions, but exhibit several unique spatial and temporal features. The SMAP SSS reveals the temporal evolutions of freshwater plumes from several major rivers, consistent with the timing of rainy and dry seasons, indicated in the SMAP's soil moisture and Global Precipitation Missions' daily rain products. Accuracy assessment has been performed by comparison with in situ SSS data from buoys and ARGO floats. The accuracy of monthly averaged SMAP product is about 0.2 psu for tropics and mid-latitudes. The improved roughness model function has also been applied to the Aquarius data, resulting in reduction in standard deviation errors and seasonal bias at high latitudes.

  7. Aquarius' Object-Oriented, Plug and Play Component-Based Flight Software

    Science.gov (United States)

    Murray, Alexander; Shahabuddin, Mohammad

    2013-01-01

    The Aquarius mission involves a combined radiometer and radar instrument in low-Earth orbit, providing monthly global maps of Sea Surface Salinity. Operating successfully in orbit since June, 2011, the spacecraft bus was furnished by the Argentine space agency, Comision Nacional de Actividades Espaciales (CONAE). The instrument, built jointly by NASA's Caltech/JPL and Goddard Space Flight Center, has been successfully producing expectation-exceeding data since it was powered on in August of 2011. In addition to the radiometer and scatterometer, the instrument contains an command & data-handling subsystem with a computer and flight software (FSW) that is responsible for managing the instrument, its operation, and its data. Aquarius' FSW is conceived and architected as a Component-based system, in which the running software consists of a set of Components, each playing a distinctive role in the subsystem, instantiated and connected together at runtime. Component architectures feature a well-defined set of interfaces between the Components, visible and analyzable at the architectural level (see [1]). As we will describe, this kind of an architecture offers significant advantages over more traditional FSW architectures, which often feature a monolithic runtime structure. Component-based software is enabled by Object-Oriented (OO) techniques and languages, the use of which again is not typical in space mission FSW. We will argue in this paper that the use of OO design methods and tools (especially the Unified Modeling Language), as well as the judicious usage of C++, are very well suited to FSW applications, and we will present Aquarius FSW, describing our methods, processes, and design, as a successful case in point.

  8. L-band Radiometer Calibration Consistency Assessment for the SMOS, SMAP, and Aquarius Instruments

    Science.gov (United States)

    Dinnat, Emmanuel; Le Vine, David

    2016-01-01

    Three L-band radiometers have been observing the Earth in order to retrieve soil moisture and ocean salinity. They use different instrument configurations and calibration and retrieval algorithms. In any case, the brightness temperature retrieved at the Earth surface should be consistent between all instruments. One reason for inconsistency would be the use of different approaches for the instrument calibration or the use of different models to retrieve surface brightness temperature. We report on the different approaches used for the SMOS, SMAP and Aquarius instruments and their impact on the observations consistency.

  9. Recent Advances in the Salinity Retrieval Algorithms for Aquarius and SMAP

    Science.gov (United States)

    Meissner, T.; Wentz, F. J.

    2016-12-01

    Our presentation discusses the latest improvements in the salinity retrievals for both Aquarius and SMAP since the last releases. The Aquarius V4.0 was released in June 2015 and the SMAP V 1.0 was released in November 2015. Upcoming releases are planned for SMAP (V 2.0) in August 2016 and for Aquarius (V 5.0) late 2017. The full 360o look capability of SMAP makes it possible to take observations from the forward and backward looking direction at the same instance of time. This two-look capability strongly aids the salinity retrievals. One of the largest spurious contaminations in the salinity retrievals is caused by the galaxy that is reflected from the ocean surface. Because in most instances the reflected galaxy appears only in either the forward or the backward look, it is possible to determine its contribution by taking the difference of the measured SMAP brightness temperatures between the two looks. Our result suggests that the surface roughness that is used in the galactic correction needs to be increased and also the strength of some of the galactic sources need to be slightly adjusted. The improved galaxy correction is getting implemented in upcoming Aquarius and SMAP salinity releases and strongly aids the mitigation of residual zonal and temporal biases that are observed in both products. Another major cause of the observed zonal biases in SMAP is the emissive SMAP mesh antenna. In order to correct for it the physical temperature of the antenna is needed. No direct measurements but only a thermal model are available. We discuss recent improvements in the correction for the emissive SMAP antenna and show how most of the zonal biases in V1.0 can be mitigated. Finally, we show that observed salty biases at higher Northern latitudes can be explained by inaccuracies in the model that is used in correcting for the absorption by atmospheric oxygen. These biases can be decreased by fine-tuning the parameters in the absorption model.

  10. The Helicase Aquarius/EMB-4 Is Required to Overcome Intronic Barriers to Allow Nuclear RNAi Pathways to Heritably Silence Transcription.

    Science.gov (United States)

    Akay, Alper; Di Domenico, Tomas; Suen, Kin M; Nabih, Amena; Parada, Guillermo E; Larance, Mark; Medhi, Ragini; Berkyurek, Ahmet C; Zhang, Xinlian; Wedeles, Christopher J; Rudolph, Konrad L M; Engelhardt, Jan; Hemberg, Martin; Ma, Ping; Lamond, Angus I; Claycomb, Julie M; Miska, Eric A

    2017-08-07

    Small RNAs play a crucial role in genome defense against transposable elements and guide Argonaute proteins to nascent RNA transcripts to induce co-transcriptional gene silencing. However, the molecular basis of this process remains unknown. Here, we identify the conserved RNA helicase Aquarius/EMB-4 as a direct and essential link between small RNA pathways and the transcriptional machinery in Caenorhabditis elegans. Aquarius physically interacts with the germline Argonaute HRDE-1. Aquarius is required to initiate small-RNA-induced heritable gene silencing. HRDE-1 and Aquarius silence overlapping sets of genes and transposable elements. Surprisingly, removal of introns from a target gene abolishes the requirement for Aquarius, but not HRDE-1, for small RNA-dependent gene silencing. We conclude that Aquarius allows small RNA pathways to compete for access to nascent transcripts undergoing co-transcriptional splicing in order to detect and silence transposable elements. Thus, Aquarius and HRDE-1 act as gatekeepers coordinating gene expression and genome defense. Copyright © 2017 The Authors. Published by Elsevier Inc. All rights reserved.

  11. Investigating the Physical Basis of Aquarius/SAC-D Salinity Retrievals' Regional SST Bias

    Science.gov (United States)

    Scott, J. P.; Meissner, T.; Wentz, F. J.

    2014-12-01

    Sea-surface temperature (SST) plays an important, and yet to be fully understood, role in sea-surface sailinty (SSS) retrievals. The Version-3 release of Aquarius/SAC-D salinity retrievals applied an empirically derived adjustment to SSS that is a function of SST. This adjustment was derived after noticing regional salinity biases relative to modeled and in situ salinity observations. These SSS biases correlate well with climatological SST maps. While the ΔSSS(SST) adjustment has already been implemented in the ADPS standard processing, there is great value in determining the physical basis of this bias adjustment. Understanding the root causes of this adjustment will enable improved Aquarius's salinity retrievals, as well as ensure that no true SSS-SST correlations or variability are being removed by the adjustment. There are several factors contributing to the ΔSSS(SST) adjustment, which may be classified into direct, correlated, and indirect effects. Direct effects include the dependence of the sea-water dielectric constant on SST and the dependence of the roughness model on SST. Correlated effects include a small mis-modeling of the atmospheric oxygen absorption, which correlates with SST. Indirect effects include other errors sources such as reflected galactic radiation and RFI that produce ocean-basin-wide anomalies that are being misinterpreted as an SST effect. This presentation will demonstrate how the ΔSSS(SST) adjustment was derived, as well as present our findings regarding the physical basis of this adjustment.

  12. The shape of dark matter haloes in the Aquarius simulations: Evolution and memory

    Directory of Open Access Journals (Sweden)

    Sales L.V.

    2012-02-01

    Full Text Available We use the high resolution cosmological N-body simulations from the Aquarius project to investigate in detail the mechanisms that determine the shape of Milky Way-type dark matter haloes. We find that, when measured at the instantaneous virial radius, the shape of individual haloes changes with time, evolving from a typically prolate configuration at early stages to a more triaxial/oblate geometry at the present day. This evolution in halo shape correlates well with the distribution of the infalling material: prolate configurations arise when haloes are fed through narrow filaments, which characterizes the early epochs of halo assembly, whereas triaxial/oblate configurations result as the accretion turns more isotropic at later times. Interestingly, at redshift z = 0, clear imprints of the past history of each halo are recorded in their shapes at different radii, which also exhibit a variation from prolate in the inner regions to triaxial/oblate in the outskirts. Provided that the Aquarius haloes are fair representatives of Milky Way-like 1012M☉ objects, we conclude that the shape of such dark matter haloes is a complex, time-dependent property, with each radial shell retaining memory of the conditions at the time of collapse.

  13. The Impact of the Assimilation of Aquarius Sea Surface Salinity Data in the GEOS Ocean Data Assimilation System

    Science.gov (United States)

    Vernieres, Guillaume Rene Jean; Kovach, Robin M.; Keppenne, Christian L.; Akella, Santharam; Brucker, Ludovic; Dinnat, Emmanuel Phillippe

    2014-01-01

    Ocean salinity and temperature differences drive thermohaline circulations. These properties also play a key role in the ocean-atmosphere coupling. With the availability of L-band space-borne observations, it becomes possible to provide global scale sea surface salinity (SSS) distribution. This study analyzes globally the along-track (Level 2) Aquarius SSS retrievals obtained using both passive and active L-band observations. Aquarius alongtrack retrieved SSS are assimilated into the ocean data assimilation component of Version 5 of the Goddard Earth Observing System (GEOS-5) assimilation and forecast model. We present a methodology to correct the large biases and errors apparent in Version 2.0 of the Aquarius SSS retrieval algorithm and map the observed Aquarius SSS retrieval into the ocean models bulk salinity in the topmost layer. The impact of the assimilation of the corrected SSS on the salinity analysis is evaluated by comparisons with insitu salinity observations from Argo. The results show a significant reduction of the global biases and RMS of observations-minus-forecast differences at in-situ locations. The most striking results are found in the tropics and southern latitudes. Our results highlight the complementary role and problems that arise during the assimilation of salinity information from in-situ (Argo) and space-borne surface (SSS) observations

  14. Chemistry and Kinematics of the Late-forming Dwarf Irregular Galaxies Leo A, Aquarius, and Sagittarius DIG

    Science.gov (United States)

    Kirby, Evan N.; Rizzi, Luca; Held, Enrico V.; Cohen, Judith G.; Cole, Andrew A.; Manning, Ellen M.; Skillman, Evan D.; Weisz, Daniel R.

    2017-01-01

    We present Keck/DEIMOS spectroscopy of individual stars in the relatively isolated Local Group dwarf galaxies Leo A, Aquarius, and the Sagittarius dwarf irregular galaxy. The three galaxies—but especially Leo A and Aquarius—share in common delayed star formation histories (SFHs) relative to many other isolated dwarf galaxies. The stars in all three galaxies are supported by dispersion. We found no evidence of stellar velocity structure, even for Aquarius, which has rotating H I gas. The velocity dispersions indicate that all three galaxies are dark-matter-dominated, with dark-to-baryonic mass ratios ranging from {4.4}-0.8+1.0 (SagDIG) to {9.6}-1.8+2.5 (Aquarius). Leo A and SagDIG have lower stellar metallicities than Aquarius, and they also have higher gas fractions, both of which would be expected if Aquarius were further along in its chemical evolution. The metallicity distribution of Leo A is inconsistent with a closed or leaky box model of chemical evolution, suggesting that the galaxy was pre-enriched or acquired external gas during star formation. The metallicities of stars increased steadily for all three galaxies, but possibly at different rates. The [α/Fe] ratios at a given [Fe/H] are lower than that of the Sculptor dwarf spheroidal galaxy, which indicates more extended SFHs than Sculptor, consistent with photometrically derived SFHs. Overall, the bulk kinematic and chemical properties for the late-forming dwarf galaxies do not diverge significantly from those of less delayed dwarf galaxies, including dwarf spheroidal galaxies. The data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation.

  15. Susan Magoffin’s Santa Fe Days in 1846: The Value of Testimony Les journées de Santa Fé en 1846 de Susan Magoffin : la valeur du témoignage

    Directory of Open Access Journals (Sweden)

    Susanne Berthier-Foglar

    2009-11-01

    Full Text Available Susan Magoffin, la jeune épouse d’un commerçant de la piste de Santa Fe, accompagna son mari en 1846 pour un voyage où la caravane suivait de près l’Armée de l’Ouest et pendant lequel elle tint un journal. Cet article traite des 37 jours que dura la pause de la caravane à Santa Fe et aborde plus spécifiquement la façon dont l’auteur appréhendait l’altérité dans un environnement inhabituel et parfois dangereux. Pour apprécier la valeur du témoignage, je combine une analyse du discours avec une évaluation statistique du contenu. La description, parfois naïve, de Santa Fe sous l’occupation américaine illustre les raisons de la guerre contre le Mexique. En tant qu’agent de la destinée manifeste, Susan Magoffin admirait le général Kearny en lui attribuant des qualités surhumaines et en participant à ses efforts de propagande. Alors qu’elle était enracinée dans sa classe et sa culture, elle voyait la population mexicaine et les Amérindiens avec un esprit ouvert bien que ses motifs pour apprendre l’espagnol, ainsi que le métier de commerçante, avaient une fonction plus prosaïque.

  16. Development of the Aquarius Antenna Deployment Mechanisms and Spring/Damper Actuator

    Science.gov (United States)

    Johnson, Joel A.

    2008-01-01

    The Aquarius Instrument s large radar reflector dish needed to be stowed for launch, and then deployed on-orbit. The Deployment Subsystem consisted of a cantilevered boom structure and two single-axis hinge mechanisms to accurately deploy and position the reflector dish relative to the radar feed horns. The cantilevered design demanded high stiffness and accuracy from the deployment mechanism at the root of the boom. A preload-generating end-of-travel latch was also required. To largely eliminate the need for control systems, each deployment mechanism was actuated by a passive spring motor with viscous-fluid damping. Tough requirements and adaptation of a heritage actuator to the new application resulted in numerous challenges. Fabrication, assembly, and testing encountered additional problems, though ultimately the system was demonstrated very successfully. This paper revisits the development to highlight which design concepts worked and the many important lessons learned.

  17. Radio emission of the group of stars in the Aquarius and Cetus constellations

    Directory of Open Access Journals (Sweden)

    Anton A. Lipovka

    2017-06-01

    Full Text Available In the present work, the optical identification of a group of radio sources located in the Aquarius and Cetus constellations in a field with the size of 1.2 square degrees has been carried out. Ten radio sources under investigation were identified with stars and one object was identified with a diffuse image (ESO-538-10. It should be stressed that eight radio objects were found to have a non-thermal radio spectrum. This fact is likely to indicate the presence of the significant magnetic field in the atmosphere of the sources. Precise radio and optical coordinates of the identified objects were suggested. Significant radio refraction in the interstellar medium in the tested space direction was revealed.

  18. Sea Surface Salinity Variability from Simulations and Observations: Preparing for Aquarius

    Science.gov (United States)

    Jacob, S. Daniel; LeVine, David M.

    2010-01-01

    Oceanic fresh water transport has been shown to play an important role in the global hydrological cycle. Sea surface salinity (SSS) is representative of the surface fresh water fluxes and the upcoming Aquarius mission scheduled to be launched in December 2010 will provide excellent spatial and temporal SSS coverage to better estimate the net exchange. In most ocean general circulation models, SSS is relaxed to climatology to prevent model drift. While SST remains a well observed variable, relaxing to SST reduces the range of SSS variability in the simulations (Fig.1). The main objective of the present study is to simulate surface tracers using a primitive equation ocean model for multiple forcing data sets to identify and establish a baseline SSS variability. The simulated variability scales are compared to those from near-surface argo salinity measurements.

  19. Global variability and changes in ocean total alkalinity from Aquarius satellite data

    Science.gov (United States)

    Fine, Rana A.; Willey, Debra A.; Millero, Frank J.

    2017-01-01

    This work demonstrates how large-scale Aquarius satellite salinity data have provided an unprecedented opportunity when combined with total alkalinity (TA) equations as a function of salinity and temperature to examine global changes in the CO2 system. Alkalinity is a gauge on the ability of seawater to neutralize acids. TA correlates strongly with salinity. Spatial variability in alkalinity and salinity exceed temporal variability. Northern Hemisphere has more spatial variability in TA and salinity, while less variability in Southern Ocean TA is due to less salinity variability and upwelling of waters enriched in alkalinity. For the first time it is shown that TA in subtropical regions has increased as compared with climatological data; this is reflective of large-scale changes in the global water cycle. Thus, as temperature and salinity increase in subtropical regions, the resultant increase in TA and ocean acidification is reinforcing that from oceanic uptake of atmospheric CO2.

  20. Endovascular abdominal aortic aneurysm sizing and case planning using the TeraRecon Aquarius workstation.

    Science.gov (United States)

    Lee, W Anthony

    2007-01-01

    The gold standard for preoperative evaluation of an aortic aneurysm is a computed tomography angiogram (CTA). Three-dimensional reconstruction and analysis of the computed tomography data set is enormously helpful, and even sometimes essential, in proper sizing and planning for endovascular stent graft repair. To a large extent, it has obviated the need for conventional angiography for morphologic evaluation. The TeraRecon Aquarius workstation (San Mateo, Calif) represents a highly sophisticated but user-friendly platform utilizing a combination of task-specific hardware and software specifically designed to rapidly manipulate large Digital Imaging and Communications in Medicine (DICOM) data sets and provide surface-shaded and multiplanar renderings in real-time. This article discusses the basics of sizing and planning for endovascular abdominal aortic aneurysm repair and the role of 3-dimensional analysis using the TeraRecon workstation.

  1. One tool, many uses: precopulatory sexual selection on genital morphology in Aquarius remigis.

    Science.gov (United States)

    Bertin, A; Fairbairn, D J

    2005-07-01

    While congruent evidence indicates that sexual selection is the most likely selective force explaining the rapid divergence of male genital morphology in insects, the mechanisms involved in this process remain unclear. In particular, little attention has been paid to precopulatory sexual selection. We examine sexual selection for mating success on male genital components in six populations of Aquarius remigis, a water strider characterized by unique genital morphology. Multivariate selection analysis confirms previous findings that precopulatory sexual selection favours longer external genitalia, and provides new evidence that this selection acts independently on external genital components. In contrast, the size of the major internal genital sclerite is not correlated with mating success. Thus, precopulatory sexual selection acts strongly on the size of the external genitalia, but not on the intromittent organ itself. These results highlight the multiple functions of genital organs and the importance of both precopulatory and post-copulatory sexual selection in shaping the remarkable diversity of male genitalia in insects.

  2. Morphology and neurophysiology of tarsal vibration receptors in the water strider Aquarius paludum (Heteroptera: Gerridae).

    Science.gov (United States)

    Perez Goodwyn, Pablo; Katsumata-Wada, Ayako; Okada, Koutaroh

    2009-09-01

    Substrate vibratory information receptors are extensively studied in insects and spiders, however for water surface dwelling species little data is available. We studied the vibration receptive organs in tarsi of the water strider Aquarius paludum, using light, transmission and scanning electron microscopes, and recorded the neural activity of the organs in response to vibrational stimuli, which were afterwards analysed with a custom made spike sorting program. We found that the tarsal chordotonal organ has one set of three scoloparia: one in the tarsomere I and two in the tarsomere II, all of which consisted of a few scolopidia. The chordotonal organ clearly responded to vibratory stimulation. Furthermore, we found that a pair of large subapical emergent dorsal setae, which had been deemed mechanosensory by previous authors, are not so. In turn, four ventral subapical trichobothria that are in direct contact with the water surface during locomotion, proved to be mechanosensory. The anatomical and ultrastructural observations support these electro-physiological results.

  3. Aquarius L-Band Microwave Radiometer: Three Years of Radiometric Performance and Systematic Effects

    Science.gov (United States)

    Piepmeier, Jeffrey R.; Hong, Liang; Pellerano, Fernando A.

    2015-01-01

    The Aquarius L-band microwave radiometer is a three-beam pushbroom instrument designed to measure sea surface salinity. Results are analyzed for performance and systematic effects over three years of operation. The thermal control system maintains tight temperature stability promoting good gain stability. The gain spectrum exhibits expected orbital variations with 1f noise appearing at longer time periods. The on-board detection and integration scheme coupled with the calibration algorithm produce antenna temperatures with NEDT 0.16 K for 1.44-s samples. Nonlinearity is characterized before launch and the derived correction is verified with cold-sky calibration data. Finally, long-term drift is discovered in all channels with 1-K amplitude and 100-day time constant. Nonetheless, it is adeptly corrected using an exponential model.

  4. Evaluation of differential protein expression in Haliclona aquarius and sponge-associated microorganisms under cadmium stress.

    Science.gov (United States)

    Wanick, Rodrigo Cunha; de Sousa Barbosa, Herbert; Frazão, Leonardo Revoredo; Santelli, Ricardo Erthal; Arruda, Marco Aurélio Zezzi; Coutinho, Cristiano Carvalho

    2013-09-01

    A comparative proteomic approach was used to assess differentially expressed proteins in marine sponges after 36 h of exposure to cadmium (Cd). After separation performed by 2-D polyacrylamide gel electrophoresis, 46 protein spots indicated differential expression, and 17 of these proteins were identified by electrospray ionization quadrupole time-of-flight mass spectrometry. From the proteins identified, 76% were attributed to sponge-associated microorganisms (fungi and bacteria), and 24% were attributed to Haliclona aquarius. Some of the proteins that were identified may be related to cell proliferation and differentiation or processes of oxidative stress repair and energy procurement. An integrated evaluation based on spot expression levels and the postulated functions of these proteins allowed a more accurate evaluation of the stress caused to the sponge holobiont system by cadmium exposure. This study could provide new insights into the use of a proteomic approach in the marine sponge to assess the effects of Cd pollution in a marine environment.

  5. A deep optical survey of a small region in Aquarius. I Stellar photometry and galactic structure

    Science.gov (United States)

    Tritton, K. P.; Morton, D. C.

    1984-07-01

    An area of 0.31 square degrees was selected in the constellation of Aquarius, and an attempt was made to identify and classify all objects to a limiting magnitude of m(B) = 20.0. The present investigation is concerned with stellar photometry derived from the obtained photographs, taking into account also the statistical consequences for various aspects of galactic structure. Attention is given to the separation of stars and galaxies, details of photographic geometry, the data, distribution by color and apparent magnitude, corrections to absolute magnitudes, and the galactic scale height and local star density. Measurements were conducted of 747 ordinary stars, 3 white stars, 4 QSOs, and 143 galaxies. The B and V magnitudes of the 747 stars were measured, and the 401 stars with B equal to or less than 19.0 were used to derive some basic parameters of the Galaxy.

  6. Galactic Structure Examined from a Faint Object Survey in a Field in Aquarius

    Science.gov (United States)

    Tritton, K. P.; Morton, D. C.

    An area in the constellation of Aquarius, one third of a square degree, has been selected for study because of its low interstellar extinction and the availability of good photometric calibration. An attempt has been made to identify and classify all objects in the area to a magnitude B = 20.0. For the results presented in this report UK Schmidt and Anglo-Australian telescope photographs were used to separate stellar and non-stellar objects and provide UBVRI photometry of the stars. With absolute magnitudes derived from the colours, the stars in this area have been compared in detail with the Galactic model of Bahcall and Soneira (1980). Considerable discrepancies are revealed which imply defects in the adopted model of the spheroidal component.

  7. Total column water vapor estimation over land using radiometer data from SAC-D/Aquarius

    Science.gov (United States)

    Epeloa, Javier; Meza, Amalia

    2018-02-01

    The aim of this study is retrieving atmospheric total column water vapor (CWV) over land surfaces using a microwave radiometer (MWR) onboard the Scientific Argentine Satellite (SAC-D/Aquarius). To research this goal, a statistical algorithm is used for the purpose of filtering the study region according to the climate type. A log-linear relationship between the brightness temperatures of the MWR and CWV obtained from Global Navigation Satellite System (GNSS) measurements was used. In this statistical algorithm, the retrieved CWV is derived from the Argentinian radiometer's brightness temperature which works at 23.8 GHz and 36.5 GHz, and taking into account CWVs observed from GNSS stations belonging to a region sharing the same climate type. We support this idea, having found a systematic effect when applying the algorithm; it was generated for one region using the previously mentioned criteria, however, it should be applied to additional regions, especially those with other climate types. The region we analyzed is in the Southeastern United States of America, where the climate type is Cfa (Köppen - Geiger classification); this climate type includes moist subtropical mid-latitude climates, with hot, muggy summers and frequent thunderstorms. However, MWR only contains measurements taken from over ocean surfaces; therefore the determination of water vapor over land is an important contribution to extend the use of the SAC-D/Aquarius radiometer measurements beyond the ocean surface. The CWVs computed by our algorithm are compared against radiosonde CWV observations and show a bias of about -0.6 mm, a root mean square (rms) of about 6 mm and a correlation of 0.89.

  8. ‘Speaking Kleinian’: Susan Isaacs as Ursula Wise and the Inter-War Popularisation of Psychoanalysis

    Science.gov (United States)

    Shapira, Michal

    2017-01-01

    How did the complex concepts of psychoanalysis become popular in early twentieth-century Britain? This article examines the contribution of educator and psychoanalyst Susan Isaacs (1885–1948) to this process, as well as her role as a female expert in the intellectual and medical history of this period. Isaacs was one of the most influential British psychologists of the inter-war era, yet historical research on her work is still limited. The article focuses on her writing as ‘Ursula Wise’, answering the questions of parents and nursery nurses in the popular journal Nursery World, from 1929 to 1936. Researched in depth for the first time, Isaacs’ important magazine columns reveal that her writing was instrumental in disseminating the work of psychoanalyst Melanie Klein in Britain. Moreover, Isaacs’ powerful rebuttals to behaviourist, disciplinarian parenting methods helped shift the focus of caregivers to the child’s perspective, encouraging them to acknowledge children as independent subjects and future democratic citizens. Like other early psychoanalysts, Isaacs was not an elitist; she was in fact committed to disseminating her ideas as broadly as possible. Isaacs taught British parents and child caregivers to ‘speak Kleinian’, translating Klein’s intellectual ideas into ordinary language and thus enabling their swift integration into popular discourse. PMID:28901872

  9. Aquarius, a novel gene isolated by gene trapping with an RNA-dependent RNA polymerase motif.

    Science.gov (United States)

    Sam, M; Wurst, W; Klüppel, M; Jin, O; Heng, H; Bernstein, A

    1998-06-01

    In a retinoic acid (RA) gene trap screen of mouse embryonic stem (ES) cells, a novel gene, named Aquarius (Aqr), was identified and characterized. The promoterless lacZ marker was used to trap the genomic locus and to determine the expression pattern of the gene. Aqr transcripts are strongly induced in response to RA in vitro. During embryogenesis, Aqr is expressed in mesoderm, in the neural crest and its target tissues, and in neuroepithelium. Expression was first detected at 8.5 days postcoitum, when neural crest cells are visible at the lateral ridges of the neural plate. The gene-trapped Aqr locus was transmitted through the mouse germ line in three genetic backgrounds. In the F2 generation, the expected mendelian ratio of 1:2:1 was observed in all backgrounds, indicating that homozygous mice are viable. Homozygotes are normal in size and weight and breed normally. The gene trap insertion, however, does not seem to generate a null mutation, because Aqr transcripts are still present in the homozygous mutant animals. The Aqr open reading frame has weak homology to RNA-dependent RNA polymerases (RRPs) of the murine hepatitis viruses and contains an RRP motif. Aqr was mapped to mouse chromosome 2 between regions E5 through F2 by using fluorescence in situ hybridization analysis.

  10. Reduced dispersal propensity in the wingless waterstrider Aquarius najas in a highly fragmented landscape.

    Science.gov (United States)

    Ahlroth, Petri; Alatalo, Rauno V; Suhonen, Jukka

    2010-02-01

    Dispersal behaviour of animals in fragmented habitats has generated intensive theoretical attention but empirical data on the evolution of dispersal are still relatively scarce. Theory predicts reduced dispersal propensity in small and isolated habitat patches. We tested these predictions in the waterstrider Aquarius najas, a wingless species with special habitat demands. Flightlessness constrains insect dispersal and as a stream specialist A. najas cannot survive on still water. Lakes therefore represent a dispersal barrier for this species. We measured dispersal propensity of the waterstrider A. najas which originated from ten fragmented populations. In the experiment, we transplanted laboratory-grown individuals to the field. We did not find differences between sex in dispersal propensity. However, we found that waterstriders that originated from small and isolated patches moved less than individuals from large and more continuous habitats. This suggests that the cost of dispersal over hostile surrounding habitats may be high. We conclude that a low likelihood of dispersal in A. najas is an adaptation to small and isolated stream habitats.

  11. Weekly Gridded Aquarius L-band Radiometer-scatterometer Observations and Salinity Retrievals over the Polar Regions - Part 1: Product Description

    Science.gov (United States)

    Brucker, Ludovic; Dinnat, Emmanuel Phillippe; Koenig, Lora S.

    2014-01-01

    Passive and active observations at L band (frequency (is) approximately 1.4 GHz) from the Aquarius/SAC-D mission offer new capabilities to study the polar regions. Due to the lack of polar-gridded products, however, applications over the cryosphere have been limited. We present three weekly polar-gridded products of Aquarius data to improve our understanding of L-band observations of ice sheets, sea ice, permafrost, and the polar oceans. Additionally, these products intend to facilitate access to L-band data, and can be used to assist in algorithm developments. Aquarius data at latitudes higher than 50 degrees are averaged and gridded into weekly products of brightness temperature (TB), normalized radar cross section (NRCS), and sea surface salinity (SSS). Each grid cell also contains sea ice fraction, the standard deviation of TB, NRCS, and SSS, and the number of footprint observations collected during the seven-day cycle. The largest 3 dB footprint dimensions are 97 km×156 km and 74 km×122 km (along × across track) for the radiometers and scatterometer, respectively. The data is gridded to the Equal-Area Scalable Earth version 2.0 (EASE2.0) grid, with a grid cell resolution of 36 km. The data sets start in August 2011, with the first Aquarius observations and will be updated on a monthly basis following the release schedule of the Aquarius Level 2 data sets. The weekly gridded products are distributed by the US National Snow and Ice Data Center at http://nsidc.org/data/aquarius/index.html

  12. Diasporic Reconciliations of Politics, Love and Trauma: Susan Abulhawa’s Quest for Identity in Mornings in Jenin

    Directory of Open Access Journals (Sweden)

    Ayman M Abu-Shomar

    2015-04-01

    Full Text Available Negotiating human conditions is an emblematic critical impetus of diaspora informed by multiple cultural possibilities practiced through the creation of multiple spaces that cross the realm of the ‘self’ to that of the ‘other’. It offers a locale to cross from the oppressed ‘self’ to an understanding of an oppressor ‘other’. Yet, diasporic negotiation is politically involved in the most responsible manner; it engages the contextual social realities in order to enable creative possibilities for overcoming the logic of the politics altogether. It invites a kind of political involvement that assures the ‘situatedness of the ethical’ in a framework of moral humanistic realisations. The realisation of diasporic negotiations is dialogically engaged in manners that will give birth to new possibilities for human togetherness. In this essay, I trace the signs of diasporic negotiations of politics, love and trauma in Susan Abulhawa’s Mornings in Jenin by focusing on the Diasporic identity of Amal (the central character. I consider the intersections between diaspora, dislocation of identity and the creation of negotiating spaces that qualify an 'epistemology of Diaspora' against essentialised and ethnocentric construction of realities. I argue that Abulhawa creates diasporic spaces and immense moral scenes to transcend a particular stance of politics via transcending love in opposition to suffering and tribulation. I contend that Abulhawa’s conceptualisation of Diasporic negotiations enables her to depict and gauge two extreme human sentiments: love and trauma, yet, without yielding or compromising the right of just resistance and dissent. Keywords: Diaspora, humanism, Trauma, identity, negotiating difference, and 'Otherness'

  13. Delayed star formation in isolated dwarf galaxies: Hubble space telescope star formation history of the Aquarius dwarf irregular

    Energy Technology Data Exchange (ETDEWEB)

    Cole, Andrew A. [School of Physical Sciences, University of Tasmania, Private Bag 37, Hobart, Tasmania, 7001 Australia (Australia); Weisz, Daniel R. [Department of Astronomy, University of California at Santa Cruz, 1156 High Street, Santa Cruz, CA 95064 (United States); Dolphin, Andrew E. [Raytheon, 1151 East Hermans Road, Tucson, AZ 85706 (United States); Skillman, Evan D. [Minnesota Institute for Astrophysics, University of Minnesota, Minneapolis, MN 55441 (United States); McConnachie, Alan W. [NRC Herzberg Institute of Astrophysics, Dominion Astrophysical Observatory, Victoria, BC, V9E 2E7 Canada (Canada); Brooks, Alyson M. [Department of Physics and Astronomy, Rutgers, The State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854 (United States); Leaman, Ryan, E-mail: andrew.cole@utas.edu.au, E-mail: drw@ucsc.edu, E-mail: adolphin@raytheon.com, E-mail: skillman@astro.umn.edu, E-mail: alan.mcconnachie@nrc-cnrc.gc.ca, E-mail: abrooks@physics.rutgers.edu, E-mail: rleaman@iac.es [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain)

    2014-11-01

    We have obtained deep images of the highly isolated (d = 1 Mpc) Aquarius dwarf irregular galaxy (DDO 210) with the Hubble Space Telescope Advanced Camera for Surveys. The resulting color-magnitude diagram (CMD) reaches more than a magnitude below the oldest main-sequence turnoff, allowing us to derive the star formation history (SFH) over the entire lifetime of the galaxy with a timing precision of ≈10% of the lookback time. Using a maximum likelihood fit to the CMD we find that only ≈10% of all star formation in Aquarius took place more than 10 Gyr ago (lookback time equivalent to redshift z ≈ 2). The star formation rate increased dramatically ≈6-8 Gyr ago (z ≈ 0.7-1.1) and then declined until the present time. The only known galaxy with a more extreme confirmed delay in star formation is Leo A, a galaxy of similar M {sub H} {sub I}/M {sub *}, dynamical mass, mean metallicity, and degree of isolation. The delayed stellar mass growth in these galaxies does not track the mean dark matter accretion rate from CDM simulations. The similarities between Leo A and Aquarius suggest that if gas is not removed from dwarf galaxies by interactions or feedback, it can linger for several gigayears without cooling in sufficient quantity to form stars efficiently. We discuss possible causes for the delay in star formation including suppression by reionization and late-time mergers. We find reasonable agreement between our measured SFHs and select cosmological simulations of isolated dwarfs. Because star formation and merger processes are both stochastic in nature, delayed star formation in various degrees is predicted to be a characteristic (but not a universal) feature of isolated small galaxies.

  14. Comparison of seasonal variability of Aquarius sea surface salinity time series with in situ observations in the Karimata Strait, Indonesia

    Science.gov (United States)

    Susanto, R. D.; Setiawan, A.; Zheng, Q.; Sulistyo, B.; Adi, T. R.; Agustiadi, T.; Trenggono, M.; Triyono, T.; Kuswardani, A.

    2016-12-01

    The seasonal variability of a full lifetime of Aquarius sea surface salinity time series from August 25, 2011 to June 7, 2015 is compared to salinity time series obtained from in situ observations in the Karimata Strait. The Karimata Strait plays dual roles in water exchange between the Pacific and the Indian Ocean. The salinity in the Karimata Strait is strongly affected by seasonal monsoon winds. During the boreal winter monsoon, northwesterly winds draws low salinity water from the South China Sea into the Java Sea and at the same time, the Java Sea receives an influx of the Indian Ocean water via the Sunda Strait. The Java Sea water will reduce the main Indonesian throughflow in the Makassar Strait. Conditions are reversed during the summer monsoon. Low salinity water from the South China Sea also controls the vertical structure of water properties in the upper layer of the Makassar Strait and the Lombok Strait. As a part of the South China Sea and Indonesian Seas Transport/Exchange (SITE) program, trawl resistance bottom mounted CTD was deployed in the Karimata Strait in mid-2010 to mid-2016 at water depth of 40 m. CTD casts during the mooring recoveries and deployments are used to compare the bottom salinity data. This in situ salinity time series is compared with various Aquarius NASA salinity products (the level 2, level 3 ascending and descending tracks and the seven-days rolling averaged) to check the consistency, correlation and statistical analysis. The preliminary results show that the seasonal variability of Aquarius salinity time series has larger amplitude variability compared to that of in situ data.

  15. Improved Sea Surface Salinity Retrievals using Ancillary data for Aquarius Ocean Roughness Correction

    Science.gov (United States)

    Jones, L.; Hejazin, Y.; Rabollii, M.

    2012-12-01

    The Aquarius/SAC-D sea surface salinity (SSS) measurement mission was launched into polar orbit during the summer of 2011. The prime sensor is a combined L-band radiometer/scatterometer developed jointly by NASA Goddard Space Flight Center and the Jet Propulsion Laboratory, which derives SSS from ocean surface brightness temperature (Tb) measurements. This paper deals with a method of improving AQ SSS by making a making an ocean roughness brightness temperature correction (ΔTbr). The ΔTbr is derived using several ancillary data sources of surface wind measurements, namely; NOAA numerical weather model - Global Data Assimilation System (GDAS), WindSat ocean vector wind, and the CONAE Microwave Radiometer (MWR). The basis of the correction is the excess (warming) brightness temperature that is produced when the ocean is roughened by the surface wind. We model the increase in L-band Tb as a function of wind speed and direction relative to the antenna azimuth look direction. Our radiative transfer model by El-Nimri [2010] has been tuned to actual AQ ocean surface Tb's with corresponding surface wind vector. Using this ocean emissivity model and the ancillary wind vector, we derive the roughness correction, ΔTbr, which is applied to the AQ measured ocean surface Tb before retrieving SSS. Finally the effect of ΔTbr is evaluated by computing the difference between the HYCOM ocean salinity model and the AQ retrievals. These differences are cross correlated with the ancillary surface wind vector to assess the effectiveness of the roughness correction. Finally, we compare our ΔTbr with the AQ scatterometer derived ΔTbr. We compare the similarities and differenced versus the ancillary surface wind speed. S. El-Nimri et al., 2010, "An improved C-band ocean surface emissivity model at hurricane force wind speeds over a wide range of earth incidence angles," IEEE Geosci. Rem. Sens. Letters, vol. 7, NO. 4, October.

  16. Fitness consequences of alternative life histories in water striders, Aquarius remigis (Heteroptera: Gerridae).

    Science.gov (United States)

    Blanckenhorn, W U

    1994-04-01

    Using field and laboratory observations and experiments over 3 years, I investigated whether reproductive trade-offs shape individual life histories in two natural populations of the water strider, Aquarius remigis, in which univoltine and bivoltine life cycles coexist. Both later eclosion dates and food shortages, even after adult eclosion, induced diapause in females, thus deferring reproduction to the following spring. Adult body size was positively affected by food availability during juvenile development. Higher food levels also increased the reproductive output of females, but not their longevity or oviposition period. When compared to spring breeders (univoltine life cycle), direct (summer) breeders (bivoltine life cycle) experienced reduced lifetime egg numbers and longevity, as well as reduced survivorship of their second-summer-generation offspring; these reproductive costs offset, at least in part, the advantage in non-decreasing populations of having two generations per year. Fecundity was correlated with body size, and among summer-generation females direct breeders were larger than non-breeders. The time remaining before the onset of winter and/or the time since adult eclosion augmented cumulative energy uptake, and consequently the lipid reserves and winter survival probability of non-breeding (diapausing) summer adults approaching hibernation. Overwintered spring reproductives died at faster rates than non-reproductive summer individuals despite greater food availability in spring, indicating a mortality cost of reproduction. Body length correlated with absolute and not with proportional lipid content but showed no consistent relationship with survivorship in the field. These results are in agreement with current theory on the evolution of insect voltinism patterns, and further indicate high degrees of life history flexibility (phenotypic plasticity) in the study populations in response to variable environmental factors (notably photoperiod and food

  17. Potential soil moisture products from the aquarius radiometer and scatterometer using an observing system simulation experiment

    Directory of Open Access Journals (Sweden)

    Y. Luo

    2013-02-01

    Full Text Available Using an observing system simulation experiment (OSSE, we investigate the potential soil moisture retrieval capability of the National Aeronautics and Space Administration (NASA Aquarius radiometer (L-band 1.413 GHz and scatterometer (L-band, 1.260 GHz. We estimate potential errors in soil moisture retrievals and identify the sources that could cause those errors. The OSSE system includes (i a land surface model in the NASA Land Information System, (ii a radiative transfer and backscatter model, (iii a realistic orbital sampling model, and (iv an inverse soil moisture retrieval model. We execute the OSSE over a 1000 × 2200 km2 region in the central United States, including the Red and Arkansas river basins. Spatial distributions of soil moisture retrieved from the radiometer and scatterometer are close to the synthetic truth. High root mean square errors (RMSEs of radiometer retrievals are found over the heavily vegetated regions, while large RMSEs of scatterometer retrievals are scattered over the entire domain. The temporal variations of soil moisture are realistically captured over a sparely vegetated region with correlations 0.98 and 0.63, and RMSEs 1.28% and 8.23% vol/vol for radiometer and scatterometer, respectively. Over the densely vegetated region, soil moisture exhibits larger temporal variation than the truth, leading to correlation 0.70 and 0.67, respectively, and RMSEs 9.49% and 6.09% vol/vol respectively. The domain-averaged correlations and RMSEs suggest that radiometer is more accurate than scatterometer in retrieving soil moisture. The analysis also demonstrates that the accuracy of the retrieved soil moisture is affected by vegetation coverage and spatial aggregation.

  18. Potential Soil Moisture Products from the Aquarius Radiometer and Scatterometer Using an Observing System Simulation Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Yan [I.M. Systems Group at NOAA/NCEP/EMC; Feng, Xia [George Mason University; Houser, Paul [George Mason University; Anantharaj, Valentine G [ORNL; Fan, Xingang [Western Kentucky University, Bowling Green; De Lannoy, Gabrielle [Ghent University, Belgium; Zhan, Xiwu [NOAA/NESDIS Center for Satellite Applications and Research; Dabbiru, Lalitha [Mississippi State University (MSU)

    2013-01-01

    Using an observing system simulation experiment (OSSE), we investigate the potential soil moisture retrieval capability of the National Aeronautics and Space Administration (NASA) Aquarius radiometer (L-band 1.413 GHz) and scatterometer (L-band, 1.260 GHz). We estimate potential errors in soil moisture retrievals and identify the sources that could cause those errors. The OSSE system includes (i) a land surface model in the NASA Land Information System, (ii) a radiative transfer and backscatter model, (iii) a realistic orbital sampling model, and (iv) an inverse soil moisture retrieval model. We execute the OSSE over a 1000 2200 km2 region in the central United States, including the Red and Arkansas river basins. Spatial distributions of soil moisture retrieved from the radiometer and scatterometer are close to the synthetic truth. High root mean square errors (RMSEs) of radiometer retrievals are found over the heavily vegetated regions, while large RMSEs of scatterometer retrievals are scattered over the entire domain. The temporal variations of soil moisture are realistically captured over a sparely vegetated region with correlations 0.98 and 0.63, and RMSEs 1.28% and 8.23% vol/vol for radiometer and scatterometer, respectively. Over the densely vegetated region, soil moisture exhibits larger temporal variation than the truth, leading to correlation 0.70 and 0.67, respectively, and RMSEs 9.49% and 6.09% vol/vol respectively. The domain-averaged correlations and RMSEs suggest that radiometer is more accurate than scatterometer in retrieving soil moisture. The analysis also demonstrates that the accuracy of the retrieved soil moisture is affected by vegetation coverage and spatial aggregation.

  19. How do water striders, Aquarius paludum, react to brackish water simulated by NaCl solutions?

    Science.gov (United States)

    Kishi, Manabu; Fujisaki, Kenji; Harada, Tetsuo

    2006-01-01

    Several stages, from eggs to adults, of the water strider, Aquarius paludum (Fabricius), inhabiting fresh water are sometimes conveyed by heavy flow in the rainy or typhoon seasons in Japan to lotic brackish water in the mouth of rivers. The water striders might then respond to salinity either by remaining to wait for extensive rainfall to reduce osmotic pressure locally before reproducing ("breed here and later tactic") or by flying away to reproduce in fresh waters elsewhere ("breed elsewhere and later tactic"). All first instars died before the first molt when they were exposed to 1.75 and 3.5% NaCl solutions in a laboratory experiment. Living on 0.5 and 0.9% solutions through larval and adult stages slowed down larval growth and suppressed female reproduction. When exposed to the 0.5 and 0.9% solutions, 90 and 92% of males, respectively, showed histolysis of their flight muscles. Therefore, in brackish natural habitats, larvae and adults seem to follow the strategy "breed here and later." When water striders were exposed to 0.9% solution either just after emergence or 20 days later, females showed a higher flight propensity than those kept on fresh waters throughout, and they delayed the deposition of eggs. Therefore, when conveyed to brackish water after emergence by stream flow after heavy rain, adults seem to leave the area by flight, demonstrating the strategy "breed elsewhere and later" tactic. We conclude that water striders use alternative tactics for responding to salinity, depending on the stage of exposure.

  20. SEXUAL SELECTION AND THE EVOLUTION OF SEXUAL SIZE DIMORPHISM IN THE WATER STRIDER, AQUARIUS REMIGIS.

    Science.gov (United States)

    Fairbairn, Daphne J; Preziosi, Richard F

    1996-08-01

    Sexual size dimorphism (SSD) is often attributed to sexual selection, particularly when males are the larger sex. However, sexual selection favoring large males is common even in taxa where females are the larger sex, and is therefore not a sufficient explanation of patterns of SSD. As part of a more extensive study of the evolution of SSD in water striders (Heteroptera, Gerridae), we examine patterns of sexual selection and SSD in 12 populations of Aquarius remigis. We calculate univariate and multivariate selection gradients from samples of mating and single males, for two sexually dimorphic traits (total length and profemoral width) and two sexually monomorphic traits (mesofemoral length and wing form). The multivariate analyses reveal strong selection favoring larger males, in spite of the female-biased SSD for this trait, and weaker selection favoring aptery and reduced mesofemoral length. Selection is weakest on the most dimorphic trait, profemoral width, and is stabilizing rather than directional. The pattern of sexual selection on morphological traits is therefore not concordant with the pattern of SSD. The univariate selection gradients reveal little net selection (direct + indirect) on any of the traits, and suggest that evolution away from the plesiomorphic pattern of SSD is constrained by antagonistic patterns of selection acting on this suite of positively correlated morphological traits. We hypothesize that SSD in A. remigis is not in equilibrium, a hypothesis that is consistent with both theoretical models of the evolution of SSD and our previous studies of allometry for SSD. A negative interpopulation correlation between the intensity of sexual selection and the operational sex ratio supports the hypothesis that, as in several other water strider species, sexual selection in A. remigis occurs through generalized female reluctance rather than active female choice. The implications of this for patterns of sexual selection are discussed. © 1996 The

  1. Body size and fecundity in the waterstrider Aquarius remigis: a test of Darwin's fecundity advantage hypothesis.

    Science.gov (United States)

    Preziosi, Richard F; Fairbairn, Daphne J; Roff, Derek A; Brennan, Julie M

    1996-11-01

    The general female bias in body size of animals is usually attributed to fecundity selection. While many studies have demonstrated a positive relationship between body size and fecundity, the most common interpretation of fecundity selection is that larger females have larger abdomens and can hold more eggs, yet the relationship between abdomen size and fecundity has rarely been examined. For the waterstrider, Aquarius remigis, we find a significant relationship between body size and fecundity and demonstrate that the target of fecundity selection is abdomen size. Thus, larger females have higher fecundities because they have larger abdomens and not because of their total size per se. The rate at which fecundity increases with increasing abdomen size exceeds that which would be expected due to a simple volume constraint and suggests that other factors, such as increased ability to obtain resources, may contribute to the increase in fecundity with body size. Selection intensities estimated from our data indicate that fecundity selection could be a significant selective force on both total and abdomen lengths. Previous studies have found that abdomen size increased faster than body size and thus, larger females had relatively larger abdomens. The relationship of abdomen length and thorax length in A. remigis is hypoallometric and indicates that larger females have relatively smaller abdomens. We hypothesize that this may reflect conservation of abdomen size in females developing under poor conditions. Finally, while egg size is not directly related to body size, we find a trade-off between egg size and number when female abdomen length is held constant, suggesting that selection on egg size may influence abdomen length only indirectly through its effects on fecundity.

  2. Vozvrashtshenije "Ekzorsista" / Susan Howard

    Index Scriptorium Estoniae

    Howard, Susan

    2001-01-01

    William Friedkini 1973.a. valminud õudusfilm "Exorcist", selle järjed ja selle hiljuti restaureeritud ja taas ekraanile paisatud versioon ning nende mõju näitlejanna Linda Blair'i elukäigule, kes filmis mängis saatanast vaevatud teistmelist

  3. Assessing the Potential to Derive Air-Sea Freshwater Fluxes from Aquarius-Like Observations of Surface Salinity

    Science.gov (United States)

    Zhen, Li; Adamec, David

    2009-01-01

    A state-of-the-art numerical model is used to investigate the possibility of determining freshwater flux fields from temporal changes io sea-surface salinity (SSS), a goal of the satellite salinity-measuring mission, Aquarius/SAC-D. Because the estimated advective temporal scale is usually longer than the Aquarius/SAC-D revisit time, the possibility of producing freshwater flux estimates from temporal salinity changes is first examined by using a correlation analysis. For the mean seasonal cycle, the patterns of the correlations between the freshwater fluxes and surface salinity temporal tendencies are mainly zonally oriented, and are highest where the local precipitation is also relatively high. Nonseasonal (deviations from the monthly mean) correlations are highest along mid-latitude moon tracks and are relatively small in the tropics. The complex correlation patterns presented here suggest that a global retrieval of the difference between evaporation and precipitation (E-P) from salinity changes requires more complex techniques than a simple consideration of local balance with surface forcing.

  4. Inter-Comparison of SMOS and Aquarius Sea Surface Salinity: Effects of the Dielectric Constant and Vicarious Calibration

    Science.gov (United States)

    Dinnat, Emmanuel P.; Boutin, Jacqueline; Yin, Xiaobin; Le Vine, David M.

    2014-01-01

    Two spaceborne instruments share the scientific objective of mapping the global Sea Surface Salinity (SSS). ESA's Soil Moisture and Ocean Salinity (SMOS) and NASA's Aquarius use L-band (1.4 GHz) radiometry to retrieve SSS. We find that SSS retrieved by SMOS is generally lower than SSS retrieved by Aquarius, except for very cold waters where SMOS SSS is higher overall. The spatial distribution of the differences in SSS is similar to the distribution of sea surface temperature. There are several differences in the retrieval algorithm that could explain the observed SSS differences. We assess the impact of the dielectric constant model and the ancillary sea surface salinity used by both missions for calibrating the radiometers and retrieving SSS. The differences in dielectric constant model produce differences in SSS of the order of 0.3 psu and exhibit a dependence on latitude and temperature. We use comparisons with the Argo in situ data to assess the performances of the model in various regions of the globe. Finally, the differences in the ancillary sea surface salinity products used to perform the vicarious calibration of both instruments are relatively small (0.1 psu), but not negligible considering the requirements for spaceborne remote sensing of SSS.

  5. Effect of forward/inverse model asymmetries over retrieved soil moisture assessed with an OSSE for the Aquarius/SAC-D

    Science.gov (United States)

    An Observing System Simulation Experiment (OSSE) for the Aquarius/SAC-D mission that includes different models for forward and retrieval processes is presented. This OSSE is implemented to study the errors related to the use of simple retrieval models in passive microwave applications. To this end...

  6. Aquarius salinity and wind retrieval using the cap algorithm and application to water cycle observation in the Indian ocean and subcontinent

    Science.gov (United States)

    Aquarius is a combined passive/active L-band microwave instrument developed to map the ocean surface salinity field from space. The primary science objective of this mission is to monitor the seasonal and interannual variation of the large scale features of the surface salinity field in the open oc...

  7. An observing system simulation experiment (OSSE) for the aquarius/SAC-D soil moisture product: An investigation of forward/retrieval model asymmetries

    Science.gov (United States)

    An Observing System Simulation Experiment (OSSE) for the Aquarius/SAC-D mission is being developed for assessing the accuracy of soil moisture retrieval from passive and active L band remote sensing. This OSSE is able to capture the influence of different error sources: land surface heterogeneity, i...

  8. Dennis C. Roberts & Susan R. Komives (Eds. (2016. Enhancing Student Learning and Development in Cross-Border Higher Education. San Francisco: Jossey-Bass.

    Directory of Open Access Journals (Sweden)

    Munita Dunn-Coetzee

    2017-07-01

    Full Text Available Enhancing Student Learning and Development in Cross-Border Higher Education, edited by Dennis C. Roberts and Susan R. Komives, is a book that resulted from a short-term study-abroad experience between the Universities of Maryland and San Diego with the Qatar Foundation’s Education City in Doha in 2010. This partnership challenged the way in which higher education internalisation was viewed – in such a way that the visit was replicated in 2012 and this book was authored.

  9. Testudinibacter aquarius gen. nov., sp. nov., a member of the family Pasteurellaceae isolated from the oral cavity of freshwater turtles.

    Science.gov (United States)

    Hansen, Mie Johanne; Pennanen, Elin Anna Erica; Bojesen, Anders Miki; Christensen, Henrik; Bertelsen, Mads Frost

    2016-02-01

    A total of 13 Pasteurellaceae isolates from healthy freshwater turtles were characterized by genotypic and phenotypic tests. Phylogenetic analysis of partial 16S rRNA and rpoB gene sequences showed that the isolates investigated formed a monophyletic group. The closest related species based on 16S rRNA gene sequencing was Chelonobacter oris CCUG 55632T with 94.4 % similarity and the closest related species based on rpoB gene sequence comparison was [Pasteurella] testudinis CCUG 19802T with 91.5 % similarity. All the investigated isolates exhibited phenotypic characteristics of the family Pasteurellaceae. However, they could be separated from existing genera of the Pasteurellaceae by the following test results: indole, ornithine decarboxylase and Voges-Proskauer positive; and methyl red, urease and PNPG (α-glucosidase) negative. No X- or V-factor requirement was observed. A zone of β-haemolysis surrounded the colonies after 24 h of incubation on bovine blood agar at 37 °C. Acid was produced from l-arabinose, dulcitol, d-mannitol, sucrose and trehalose. Representative strain ELNT2xT had a fatty acid profile that was characteristic for members of the Pasteurellaceae. ELNT2xT expressed only one respiratory quinone, ubiquinone-8 (100 %). The DNA G+C content of strain ELNT2xT was 42.8 mol%. On the basis of both phylogenetic and phenotypic evidence, it is proposed that the strains should be classified as representatives of a novel species of a new genus, Testudinibacter aquarius gen. nov., sp. nov. The type strain of Testudinibacter aquarius is ELNT2xT ( = CCUG 65146T = DSM 28140T), which was isolated from the oral cavity of a captive eastern long-necked turtle (Chelodina longicollis) in Denmark in 2012.

  10. GENETIC POPULATION STRUCTURE AND LEVELS OF GENE FLOW IN THE STREAM DWELLING WATERSTRIDER, AQUARIUS (=GERRIS) REMIGIS (HEMIPTERA: GERRIDAE).

    Science.gov (United States)

    Preziosi, Richard F; Fairbairn, Daphne J

    1992-04-01

    Gene flow, in combination with selection and drift, determines levels of differentiation among local populations. In this study we estimate gene flow in a stream dwelling, flightless waterstrider, Aquarius remigis. Twenty-eight Aquarius remigis populations from Quebec, Ontario, New Brunswick, Iowa, North Carolina, and California were genetically characterized at 15 loci using starch gel electrophoresis. Sampling over two years was designed for a hierarchical analysis of population structure incorporating variation among sites within streams, streams within watersheds, watersheds within regions, and regions within North America. Hierarchical F statistics indicated that only sites within streams maintained enough gene flow to prevent differentiation through drift (Nm = 27.5). Above the level of sites within streams gene flow is highly restricted (Nm ≤ 0.5) and no correlation is found between genetic and geographic distances. This agrees well with direct estimates of gene flow based on mark and recapture data, yielding an N e of approximately 170 individuals. Previous assignment of subspecific status to Californian A. remigis is not supported by genetic distances between those populations and other populations in North America. Previous suggestion of specific status for south-eastern A. remigis is supported by genetic distances between North Carolina populations and other populations in North America, and a high proportion of region specific alleles in the North Carolina populations. However, because of the high degree of morphological and genetic variability throughout the range of this species, the assignment of specific or subspecific status to parts of the range may be premature. © 1992 The Society for the Study of Evolution.

  11. Effects of aliskiren in diabetic and non-diabetic patients with coronary artery disease: Insights from AQUARIUS.

    Science.gov (United States)

    Puri, Rishi; Nissen, Steven E; Menon, Venu; Shao, Mingyuan; Hsu, Amy; Bakris, George L; Kastelein, John J P; Williams, Bryan; Armbrecht, Juergen; Brunel, Patrick; Kataoka, Yu; Nicholls, Stephen J

    2015-12-01

    Aliskiren previously was found to have potentially harmful effects in diabetic individuals prescribed concomitant angiotensin converting enzyme inhibitors (ACEI) or angiotenisn receptor antagonists (ARB). We explored potential effects of aliskiren on coronary atheroma progression and major adverse cardiovascular events (MACE: death/non-fatal MI/non-fatal stroke/hospitalization for heart failure/hospitalization for ACS/arterial revascularization) in patients with and without diabetes mellitus (DM). AQUARIUS employed serial intravascular ultrasound measures of coronary atheroma volume in coronary artery disease patients randomized to receive daily aliskiren 300 mg or placebo for 104 weeks. This post hoc analysis compared changes in plaque volume [percent atheroma volume (PAV) and total atheroma volume (TAV)] and MACE in patients with (n = 115) and without (n = 343) DM stratified by treatment allocation. In multivariable propensity-weighted analyses, which included controlling for baseline and concomitant ACEI/ARB therapy and duration of aliskiren therapy, aliskiren-treated non-DM patients demonstrated the greatest PAV and TAV regression, whereas aliskiren-treated DM patients demonstrated the greatest TAV progression and greater PAV. Aliskiren-treated non-DM patients appeared at significantly lower risk of MACE compared with their aliskiren-treated DM counterparts [HR 95% CI 0.28 (0.10, 0.80)]. Statistical interactions were noted between DM status and treatment allocation for both changes in PAV (p AQUARIUS, the pro-atherosclerotic effects of aliskiren in this population are inconclusive, and these results should be thus considered hypothesis generating. Further outcome studies are required in non-diabetic patients to confirm the possible favorable effects of aliskiren. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  12. Development of a L-band ocean emissivity electromagnetic model using observations from the Aquarius Radiometer

    Science.gov (United States)

    Hejazin, Y.; Jones, W.; El-Nimri, S.

    2012-12-01

    The Aquarius/SAC-D ocean salinity measurement mission was launched into polar orbit during the summer of 2011. The prime sensor is an L-band radiometer/scatterometer developed jointly by NASA Goddard Space Flight Center and the Jet Propulsion Laboratory. This paper deals with the development of an ocean emissivity model using AQ radiometer brightness temperature (Tb) observations. This model calculates the ocean surface emissivity as a function of ocean salinity, sea surface temperature, surface wind speed and direction. One unique aspect of this model is that it calculates ocean emissivity over wide ranges of Earth incidence angles (EIAs) from nadir to > 60°and ocean wind speeds from 0 m/s to > 70 m/s. This physical electromagnetic model with empirical coefficients follows the form of Stogryn [1967] that treats the ocean as a mixture of foam and clean rough water. The CFRSL ocean surface emissivity (ɛocean) is modeled as a linear sum of foam (ɛfoam) and foam-free seawater (ɛrough) emissivities, according to ɛocean = FF * ɛfoam + (1 - FF) * ɛrough (1) where FF is the fractional area coverage by foam. The foam emissivity is modeled as ɛfoam = Q(freq, U10, EIA) (2) where Q( ) is the empirical dependence of foam emissivity on radiometer frequency, the 10-m neutral stability wind speed and EIA according to El-Nimri [2010]. Following Stogryn, the foam-free seawater emissivity (ɛrough) is modeled ɛrough = ɛsmooth +Δɛexcess (3) where ɛsmooth = (1 - Γ) is the smooth surface emissivity, Γ is the Fresnel power reflection coefficient, and Δɛexcess is the wind-induced excess emissivity, given by Δɛexcess = G(freq, U10, WDir, EIA) (4) Where G( ) is the empirical signature of foam-free rough ocean, which depends upon the surface wind speed and wind direction. This function is determined empirically from measured AQ radiometer Tb's associated with surface wind vector from collocated NOAA GDAS numerical weather model. Ocean emissivity calculations are compared

  13. Near-surface salinity stratification following rainfall using the Aquarius Rain Impact Model (RIM)

    Science.gov (United States)

    Jacob, Maria; Jones, Linwood; Asher, Bill; Drushka, Kyla; Santos-Garcia, Andrea; Scavuzzo, Marcelo

    2017-04-01

    Rainfall freshens the near-surface ocean, producing a vertical salinity profile that is fresher at the surface than at a depth of a few meters. As a result, there is a discrepancy between sea surface salinity (SSS) measured by satellites (which sample only the top few centimeters of the ocean surface) and salinity measured by in situ platforms (e.g., Argo floats, drifters, and moorings) that typically sample at a 1-5 m depth. Therefore, accurate comparisons between satellite and in-situ salinities in rainy conditions requires knowledge of how the upper ocean responds to rainfall. At moderate wind speeds in the absence of rain, the ocean upper layer (i.e. from the surface to a depth of 5 m) is well-mixed and SSS is constant as a function of depth. However, under rainy conditions the near-surface salinity is diluted by the freshwater input from rain. This fresher water is mixed downward by turbulent diffusion through gravity waves and the wind stress. These processes create a salinity gradient in the upper 1-2 m of the ocean, which dissipates over a few hours until the upper layer becomes well mixed at a slightly fresher salinity value. As part of the Aquarius/SAC-D mission, a rain impact model (RIM) was developed to estimate the change in SSS due to precipitation near the time of the satellite observation. RIM uses ocean surface salinities from HYCOM (Hybrid Coordinate Ocean Model), which does not include the short-term rain effects, and the NOAA global rainfall product CMORPH to model transient changes in the near-surface salinity profile in 0.5 h time increments. The mechanical mixing of the ocean caused by wind and waves rapidly reduces the salinity stratification caused by rain. The persistence of rain-induced salinity gradients has been shown to depend on wind speed, with rain freshening during weak winds (less than 2 m/s) persisting for 8 hours or more. The original RIM assumes a constant vertical diffusivity, which neglects the effect of wind speed on the

  14. Weekly Gridded Aquarius L-band Radiometer-Scatterometer Observations and Salinity Retrievals over the Polar Regions - Part 2: Initial Product Analysis

    Science.gov (United States)

    Brucker, L.; Dinnat, E. P.; Koenig, L. S.

    2014-01-01

    Following the development and availability of Aquarius weekly polar-gridded products, this study presents the spatial and temporal radiometer and scatterometer observations at L band (frequency1.4 GHz) over the cryosphere including the Greenland and Antarctic ice sheets, sea ice in both hemispheres, and over sub-Arctic land for monitoring the soil freeze-thaw state. We provide multiple examples of scientific applications for the L-band data over the cryosphere. For example, we show that over the Greenland Ice Sheet, the unusual 2012 melt event lead to an L-band brightness temperature (TB) sustained decrease of 5 K at horizontal polarization. Over the Antarctic ice sheet, normalized radar cross section (NRCS) observations recorded during ascending and descending orbits are significantly different, highlighting the anisotropy of the ice cover. Over sub-Arctic land, both passive and active observations show distinct values depending on the soil physical state (freeze-thaw). Aquarius sea surface salinity (SSS) retrievals in the polar waters are also presented. SSS variations could serve as an indicator of fresh water input to the ocean from the cryosphere, however the presence of sea ice often contaminates the SSS retrievals, hindering the analysis. The weekly grided Aquarius L-band products used a redistributed by the US Snow and Ice Data Center at http:nsidc.orgdataaquariusindex.html, and show potential for cryospheric studies.

  15. An interommatidial exocrine gland with a "nail-headed" structure in the water strider Aquarius remigis (Hemiptera, Gerridae).

    Science.gov (United States)

    Jia, Lei-Po; Liang, Ai-Ping

    2015-09-01

    The fine structure of the interommatidial exocrine glands, found in the compound eyes of the water strider Aquarius remigis, is described using light, scanning, and transmission electron microscopy. The glandular pores of the glands are specialized into minute "nail-headed" structures (NS), which are described for the first time in arthropod compound eyes. Each NS is composed of two components: a rod-like stalk and a cup-like depression. The TEM study shows that the glands are class 3 epidermal glands as defined by Noirot and Quennedey (1974, 1991). Each gland consists of 3 cells: a gland cell, an intermediary cell, and a duct (canal) cell. The gland cell contains abundant electron-lucent vesicles, while the intermediary cell contains a large number of osmiophilic secretory granules. These two cells might secrete different substances which mix together in the dilated sac-like portion of the conducting canal before final release. The possible functions of the secretions released from these glands are discussed. Copyright © 2015 Elsevier Ltd. All rights reserved.

  16. Cost of oviposition site selection in a water strider Aquarius paludum insularis: egg mortality increases with oviposition depth.

    Science.gov (United States)

    Hirayama, Hiroyuki; Kasuya, Eiiti

    2010-06-01

    Females generally avoid selecting sites for oviposition which have a high predation risk to increase offspring survival. Previous studies have focused on costs to ovipositing females. However, although offspring may also incur costs by being oviposited at low predation risk sites, no studies have focused on costs to offspring. Such costs to offspring were examined by using Aquarius paludum insularis, females of which avoid eggs parasitism by ovipositing at deep sites. Deep sites are safe from egg parasitism but may be unsuitable for hatching due to environmental factors. We examined the costs to offspring at deep sites by comparing the hatching rate, the duration to hatching and the proportion of drowned larvae between eggs that were set at three levels of water depth (0 cm, 25 cm and 50 cm depth). While the hatching rate at 50 cm was lower than that at 0 cm, the rate at 25 cm did not differ from that at 0 cm. Duration to hatching and the proportion of drowned larvae did not differ between the three depths. It is suggested that the declining survival rate of A. paludum eggs was due to increased water pressure at greater depth. Such a cost may exist in other species and such an observation may aid in understanding oviposition site selection. Copyright 2010 Elsevier Ltd. All rights reserved.

  17. The role of multilevel selection in the evolution of sexual conflict in the water strider aquarius remigis.

    Science.gov (United States)

    Eldakar, Omar Tonsi; Wilson, David Sloan; Dlugos, Michael J; Pepper, John W

    2010-11-01

    In evolution, exploitative strategies often create a paradox in which the most successful individual strategy "within" the group is also the most detrimental strategy "for" the group, potentially resulting in extinction. With regard to sexual conflict, the overexploitation of females by harmful males can yield similar consequences. Despite these evolutionary implications, little research has addressed why sexual conflict does not ultimately drive populations to extinction. One possibility is that groups experiencing less sexual conflict are more productive than groups with greater conflict. However, most studies of sexual conflict are conducted in a single isolated group, disregarding the potential for selection among groups. We observed Aquarius remigis water striders in a naturalistic multigroup pool in which individuals could freely disperse among groups. The free movement of individuals generated variation in aggression and sex-ratio among groups, thereby increasing the importance of between-group selection compared to within-group selection. Females dispersed away from local aggression, creating more favorable mating environments for less-aggressive males. Furthermore, the use of contextual analysis revealed that individual male aggression positively predicted fitness whereas aggression at the group level negatively predicted fitness, empirically demonstrating the conflict between levels of selection acting on mating aggression. © 2010 The Author(s). Evolution© 2010 The Society for the Study of Evolution.

  18. Aquarius Radiometer and Scatterometer Weekly-Polar-Gridded Products to Monitor Ice Sheets, Sea Ice, and Frozen Soil

    Science.gov (United States)

    Brucker, Ludovic; Dinnat, Emmanuel; Koenig, Lora

    2014-01-01

    Space-based microwave sensors have been available for several decades, and with time more frequencies have been offered. Observations made at frequencies between 7 and 183 GHz were often used for monitoring cryospheric properties (e.g. sea ice concentration, snow accumulation, snow melt extent and duration). Since 2009, satellite observations are available at the low frequency of 1.4 GHz. Such observations are collected by the Soil Moisture and Ocean Salinity (SMOS) mission, and the AquariusSAC-D mission. Even though these missions have been designed for the monitoring of soil moisture and sea surface salinity, new applications are being developed to study the cryosphere. For instance, L-band observations can be used to monitor soil freezethaw (e.g. Rautiainen et al., 2012), and thin sea ice thickness (e.g. Kaleschke et al., 2010, Huntemann et al., 2013). Moreover, with the development of satellite missions comes the need for calibration and validation sites. These sites must have stable characteristics, such as the Antarctic Plateau (Drinkwater et al., 2004, Macelloni et al., 2013). Therefore, studying the cryosphere with 1.4 GHz observations is relevant for both science applications, and remote sensing applications.

  19. Assembly of the fluorescent acrosomal matrix and its fate in fertilization in the water strider, Aquarius remigis.

    Science.gov (United States)

    Miyata, Haruhiko; Noda, Naoki; Fairbairn, Daphne J; Oldenbourg, Rudolf; Cardullo, Richard A

    2011-04-01

    Animal sperm show remarkable diversity in both morphology and molecular composition. Here we provide the first report of intense intrinsic fluorescence in an animal sperm. The sperm from a semi-aquatic insect, the water strider, Aquarius remigis, contains an intrinsically fluorescent molecule with properties consistent with those of flavin adenine dinucleotide (FAD), which appears first in the acrosomal vesicle of round spermatids and persists in the acrosome throughout spermiogenesis. Fluorescence recovery after photobleaching reveals that the fluorescent molecule exhibits unrestricted mobility in the acrosomal vesicle of round spermatids but is completely immobile in the acrosome of mature sperm. Fluorescence polarization microscopy shows a net alignment of the fluorescent molecules in the acrosome of the mature sperm but not in the acrosomal vesicle of round spermatids. These results suggest that acrosomal molecules are rearranged in the elongating acrosome and FAD is incorporated into the acrosomal matrix during its formation. Further, we followed the fate of the acrosomal matrix in fertilization utilizing the intrinsic fluorescence. The fluorescent acrosomal matrix was observed inside the fertilized egg and remained structurally intact even after gastrulation started. This observation suggests that FAD is not released from the acrosomal matrix during the fertilization process or early development and supports an idea that FAD is involved in the formation of the acrosomal matrix. The intrinsic fluorescence of the A. remigis acrosome will be a useful marker for following spermatogenesis and fertilization. Copyright © 2010 Wiley-Liss, Inc.

  20. Aquarius Radiometer and Scatterometer Weekly Polar-Gridded Products to Monitor Ice Sheets, Sea Ice, and Frozen Soil

    Science.gov (United States)

    Brucker, Ludovic; Dinnat, Emmanuel; Koenig, Lora

    2014-01-01

    Space-based microwave sensors have been available for several decades, and with time more frequencies have been offered. Observations made at frequencies between 7 and 183 GHz were often used for monitoring cryospheric properties (e.g. sea ice concentration, snow accumulation, snow melt extent and duration). Since 2009, satellite observations are available at the low frequency of 1.4 GHz. Such observations are collected by the Soil Moisture and Ocean Salinity (SMOS) mission, and the Aquarius/SAC-D mission. Even though these missions have been designed for the monitoring of soil moisture and sea surface salinity, new applications are being developed to study the cryosphere. For instance, L-band observations can be used to monitor soil freeze/thaw (e.g. Rautiainen et al., 2012), and thin sea ice thickness (e.g. Kaleschke et al., 2010, Huntemann et al., 2013). Moreover, with the development of satellite missions comes the need for calibration and validation sites. These sites must have stable characteristics, such as the Antarctic Plateau (Drinkwater et al., 2004, Macelloni et al., 2013). Therefore, studying the cryosphere with 1.4 GHz observations is relevant for both science applications, and remote sensing applications.

  1. Allometry for sexual size dimorphism: testing two hypotheses for Rensch's rule in the water strider Aquarius remigis.

    Science.gov (United States)

    Fairbairn, Daphne J

    2005-10-01

    Within any given clade, male size and female size typically covary, but male size often varies more than female size. This generates a pattern of allometry for sexual size dimorphism (SSD) known as Rensch's rule. I use allometry for SSD among populations of the water strider Aquarius remigis (Hemiptera, Gerridae) to test the hypothesis that Rensch's rule evolves in response to sexual selection on male secondary sexual traits and an alternative hypothesis that it is caused by greater phenotypic plasticity of body size in males. Comparisons of three populations reared under two temperature regimes are combined with an analysis of allometry for genital and somatic components of body size among 25 field populations. Contrary to the sexual-selection hypothesis, genital length, the target of sexual selection, shows the lowest allometric slope of all the assayed traits. Instead, the results support a novel interpretation of the differential-plasticity hypothesis: that the traits most closely associated with reproductive fitness (abdomen length in females and genital length in males) are "adaptively canalized." While this hypothesis is unlikely to explain Rensch's rule among species or higher clades, it may explain widespread patterns of intraspecific variation in SSD recently documented for many insect species.

  2. Protease activation and the signal transduction pathway regulating motility in sperm from the water strider Aquarius remigis.

    Science.gov (United States)

    Miyata, Haruhiko; Thaler, Catherine D; Haimo, Leah T; Cardullo, Richard A

    2012-04-01

    Many motile processes are regulated such that movement occurs only upon activation of a signaling cascade. Sperm from a variety of species are initially quiescent and must be activated prior to beating. The signaling events leading to the activation and regulation of sperm motility are not well characterized. Mature seminal vesicle sperm from the water strider Aquarius remigis are immotile in vitro, but vigorous motility is activated by trypsin. Trypsin-activated motility was blocked by pretreatment of the sperm with BAPTA-AM to chelate intracellular Ca(2+) and was partially rescued by subsequent addition of A23187 and Ca(2+). Thapsigargin stimulated motility in the absence of trypsin, suggesting that intracellular Ca(2+) stores are available. In addition, motility could be fully activated by the phosphatase inhibitor calyculin A, suggesting that the immotile state is maintained by an endogenous phosphatase and that kinase activity is required for motility. The MEK1/2 inhibitor U0126 significantly reduced trypsin activated motility, and MPM-2, an antibody which recognizes proline-directed phosphorylation by kinases such as MAPK, recognized components of the water strider sperm flagellum. Antibodies specific for the mouse protease activated receptor PAR2 recognized an antigen on the sperm flagellum. These results suggest that trypsin stimulates a Ca(2+) and MAPK mediated signaling pathway and potentially implicate a PAR2-like protein in regulating motility. Copyright © 2012 Wiley Periodicals, Inc.

  3. How well do mating frequency and duration predict paternity success in the polygynandrous water strider Aquarius remigis?

    Science.gov (United States)

    Vermette, Richard; Fairbairn, Daphne J

    2002-09-01

    The relationship between mating success and paternity success is a key component of sexual selection but has seldom been estimated for species in which both sexes mate with many partners (polygynandry). We used a modification of Parker's sterile male technique to measure this relationship for the water strider Aquarius remigis in 47 laboratory populations simulating natural conditions of polygynandry. We also tested the hypothesis that prolonged copulation, a characteristic of this species, enhances paternity success. Mating behavior and paternity success were assayed for four days while males and females freely interacted. Paternity success was also assayed for an additional 7 days when females were isolated from males. Mating success significantly predicted paternity success and accounted for < or = 36% of the variance. Copulation duration was negatively related to both mating success and paternity success and did not explain any of the residual variance in paternity success. Thus, we found no evidence that prolonged copulation functions as a paternity assurance strategy in this species. Comparisons of sterile and fertile males suggested that paternity success is directly influenced by the quantity of sperm transferred. Our results support previous studies that have used mating success to estimate sexual selection, but also highlight the potential importance of sperm competition and other postinsemination processes.

  4. Characterization of plasma membrane associated type II α-D-mannosidase and β-N-acetylglucosaminidase of Aquarius remigis sperm.

    Science.gov (United States)

    Stephens, Kimberly; Thaler, Catherine D; Cardullo, Richard A

    2015-05-01

    For successful fertilization to occur, molecules on the surface of male and female gametes must recognize each other in a complementary manner. In some organisms, sperm possess a glycosidase on the plasma membrane overlying the head while eggs have glycoproteins that are recognized by those glycosidases resulting in sperm-egg recognition. In this study, two glycosidases, mannosidase and β-N-acetylglucosaminidase, were identified and biochemically characterized in Aquarius remigis sperm. The mannosidase had a Km of 2.36 ± 0.19 mM, a Vmax of 27.49 ± 0.88 pmol/min and a Hill coefficient of 0.94 ± 0.18 at its optimal pH of 7.0. The mannosidase was extracted most efficiently with CHAPSO but was also efficiently extracted with sodium chloride. Mannosidase activity was effectively inhibited by swainsonine, but not by kifunesine, and was significantly reduced in the presence of Mn(2+) and Mg(2+), but not Zn(2+). N-acetylglucosaminidase had a Km of 0.093 ± 0.01 mM, a Vmax of 153.80 ± 2.97 pmol/min and a Hill coefficient of 0.96 ± 0.63 at its optimal pH of 7.0. N-acetylglucosaminidase was extracted most efficiently with potassium iodide but was also efficiently extracted with Triton X-100 and Zn(2+), but not Ca(2+), Co(2+), Mn(2+) or Mg(2+), significantly inhibited its activity. Taken together, these results indicate that the A. remigis sperm surface contains at least two glycosidases that may recognize complementary glycoconjugates on the surface of water strider eggs. Copyright © 2015 Elsevier Ltd. All rights reserved.

  5. The Development and Validation of a Quality Assessment and Rating of Technique for Injections of the Spine (AQUARIUS).

    Science.gov (United States)

    Bicket, Mark C; Hurley, Robert W; Moon, Jee Youn; Brummett, Chad M; Hanling, Steve; Huntoon, Marc A; van Zundert, Jan; Cohen, Steven P

    2016-01-01

    Systematic reviews evaluate the utility of procedural interventions of the spine, including epidural steroid injections (ESIs). However, existing quality assessment tools either fail to account for proper technical quality and patient selection or are not validated. We developed and validated a simple scale for ESIs to provide a quality assessment and rating of technique for injections of the spine (AQUARIUS). Seven experts generated items iteratively based on prior ESI technique studies and professional judgment. Following testing for face and content validity, a 17-item instrument was used by 8 raters from 2 different backgrounds to assess 12 randomized controlled trials, selected from 3 different categories. Using frequency of assessment, a 12-item instrument was also generated. Both instruments underwent reliability (intraclass correlation coefficient), validity (ability to distinguish "low," "random," and "high" study categories), and diagnostic accuracy (receiver operating characteristics) testing. Both 17- and 12-item instruments were scored consistently by raters regardless of background, with overall intraclass correlation coefficients of 0.72 (95% confidence interval [CI], 0.53-0.89) and 0.71 (95% CI, 0.51-0.89), respectively. Both instruments discriminated between clinical trials from all 3 categories. Diagnostic accuracy was similar for the 2 instruments, with areas under receiver operating characteristic curves of 0.89 (95% CI, 0.82-0.96) and 0.90 (95% CI, 0.82-0.97), respectively. The instrument in both 17- and 12-item formats demonstrates good reliability and diagnostic accuracy in rating ESI studies. As a complement to other tools that assess bias, the instrument may improve the ability to evaluate evidence for systematic reviews and improve clinical trial design.

  6. "If you thought this story sour, sweeten it with your own telling" - a feminist poetics of rewriting in Susan Price's Ghost dance

    Directory of Open Access Journals (Sweden)

    Sanna Lehtonen

    2010-01-01

    Full Text Available The attempts to challenge conventional gendered discourses in children's fantasy have often resulted in feminist rewritings of earlier stories. Ghost dance (1994 by the English author Susan Price is a novel that reflects a specific feminist poetics of rewriting: metafictional passages highlight the constructedness of the narrative and at the end readers are invited to tell their own versions of the story. Moreover, the rewriting freely combines and recontextualises elements from different source texts and reformulates them to create a narrative that challenges conventional discourses of gender. While this poetics has an appeal from a feminist perspective, the play with cross-cultural intertexts and gender becomes more complex when the novel is examined in a postcolonialist framework in relation to ethnicity and the issue of cultural appropriation. Ghost dance is situated in a setting that has a real-world equivalent (Russia, involves characters that are identified with names of real-world ethnic groups (Lapps (Sámi, Russian, and mixes elements from Russian wonder tales, Nordic mythology and an Ojibwe legend. The novel does not aim at historical accuracy in its representations nor is it a direct retelling of any of the pre-texts but combines motifs, themes, names, characters and settings freely from each source. In this textual melting pot, the protagonist Shingebiss is, on one level, a revision of the witch Baba Yaga, but also described as a Lappish shaman with an Ojibwe name. To rewrite gendered discourses, certain elements from the pretexts are chosen and others left out – the question is, then, what effects does this recontextualisation have on the representation of ethnicity? Or, are the feminist rewriting strategies actually a form of cultural appropriation?

  7. Idufirma Silicon Valleyta / Susan Adams

    Index Scriptorium Estoniae

    Adams, Susan

    2014-01-01

    Tarkvarafirma Apprenda toodab teenindusplatvormi tarkvara, mis võimaldab klientidel luua ja hoida käigus uusi mobiilseid ja pilvetehnoloogiapõhiseid rakendusi. Oma töötajatele pakub odavaid elamispindu ja madalaid makse

  8. SU-E-J-180: A Characterization of the LAP Aquarius Phantom for External LAP Laser Alignment and MR Geometric Distortion Verification for the use of SRS Patient Simulation.

    Science.gov (United States)

    Vergara, D; Shang, C; Schramm, A; McPhillips, P; Ouhib, Z

    2012-06-01

    To explore additional application of the new Aquarius external laser alignment verification Phantom by LAP (Aq-LAP Phantom) examining geometric accuracy of magnetic resonance images (MRI) commonly used for planning intracranial stereotactic radiation surgery (ICSRS) cases. Newly designed external patient alignment lasers were first aligned by the Aq-LAP Phantom at a Siemens Magneton Vario 3T MR unit. The scans were then performed with the T1 Axial 3D MPRAGE protocols with 0.9 mm temporal resolution, which may be used for ICSRS. They also include FLAIR, T2 BLADE and Diffusion Axial TRACE imaging acquisitions with 1 mm temporal resolution. The MRI will be fused to 1 mm cut computerized tomography (CT) images acquired by a Siemens Somatom Sensation Open©. The geometric distortions (GD) were measured against the CT in all axial, sagital, and coronal directions at different levels. MR images of the Aquarius Phantom indicate a distinct similarity between the nonlinear GD along the z-axis crosshair and typical magnetic field gradient nonlinearity. There is linear correlation between MR divergence datasets of distorted crosshairs (p-values from 0.57 to 0.00), and nonlinear correlation between MR divergence datasets of the distorted crosshair with the CT divergence datasets of the cross plane (p-values from 8.45×10̂-4 to 1.38×10̂-46). The margin of error exceeded no more than 0.29 mm. GDs up to about 2 mm are observed at the distal regions of the longitudinal axis in the SRS treatment planning MR images. Using the Aquarius Phantom, one is able to detect GD in ICSRS planning MRI acquisitions, and align the external LAP patient alignment lasers by following the LAP QA. Based on the results, one may recommend using the Aquarius Phantom to determine if margins should be included for SRS treatment planning. The Aquarius Phantom, used for laser alignment and geometric distortion detection, was provided by LAP of America. © 2012 American Association of Physicists in Medicine.

  9. The effect of ambient humidity and metabolic rate on the gas-exchange pattern of the semi-aquatic insect Aquarius remigis.

    Science.gov (United States)

    Contreras, Heidy L; Bradley, Timothy J

    2011-04-01

    We have examined the effects of temperature on metabolic rate and respiratory pattern in the water strider Aquarius remigis. As temperature was increased from 10 to 30°C, the metabolic rate of the insects increased and the respiratory pattern transitioned from discontinuous, to cyclic, to continuous. The discontinuous gas-exchange cycle (DGC) was observed even in insects standing on water when the respirometry chamber was being perfused with humid (>95% relative humidity) air. Comparisons of insects at 20°C in humid and dry air showed no statistically significant differences in metabolic rate or respiratory pattern (P>0.05). The proportion of time that the spiracles were closed was greater at 10°C than at 20°C (Ppatterns of insects are determined by the relationship between oxygen supply and oxygen demand. There was no evidence in this insect that humidity had any effect on the respiratory pattern. The results are discussed in the context of the ongoing discussion in the literature of the origin, maintenance and adaptive significance of the DGC in insects.

  10. A comparison of the Pac-X trans-Pacific Wave Glider data and satellite data (MODIS, Aquarius, TRMM and VIIRS.

    Directory of Open Access Journals (Sweden)

    Tracy A Villareal

    Full Text Available Four wave-propelled autonomous vehicles (Wave Gliders instrumented with a variety of oceanographic and meteorological sensors were launched from San Francisco, CA in November 2011 for a trans-Pacific (Pac-X voyage to test platform endurance. Two arrived in Australia, one in Dec 2012 and one in February 2013, while the two destined for Japan both ran into technical difficulties and did not arrive at their destination. The gliders were all equipped with sensors to measure temperature, salinity, turbidity, oxygen, and both chlorophyll and oil fluorescence. Here we conduct an initial assessment of the data set, noting necessary quality control steps and instrument utility. We conduct a validation of the Pac-X dataset by comparing the glider data to equivalent, or near-equivalent, satellite measurements. Sea surface temperature and salinity compared well to satellite measurements. Chl fluorescence from the gliders was more poorly correlated, with substantial between glider variability. Both turbidity and oil CDOM sensors were compromised to some degree by interfering processes. The well-known diel cycle in chlorophyll fluorescence was observed suggesting that mapping physiological data over large scales is possible. The gliders captured the Pacific Ocean's major oceanographic features including the increased chlorophyll biomass of the California Current and equatorial upwelling. A comparison of satellite sea surface salinity (Aquarius and glider-measured salinity revealed thin low salinity lenses in the southwestern Pacific Ocean. One glider survived a direct passage through a tropical cyclone. Two gliders traversed an open ocean phytoplankton bloom; extensive spiking in the chlorophyll fluorescence data is consistent with aggregation and highlights another potential future use for the gliders. On long missions, redundant instrumentation would aid in interpreting unusual data streams, as well as a means to periodically image the sensor heads

  11. Skating and diving: Changes in functional morphology of the setal and microtrichial cover during ontogenesis in Aquarius paludum fabricius (Heteroptera, Gerridae).

    Science.gov (United States)

    Goodwyn, P J Perez; Voigt, D; Fujisaki, K

    2008-06-01

    We examined the morphology of setae and microtrichia in Aquarius paludum during larval development using a scanning electron microscope. We then conducted immersion experiments with larvae and adults in oxygenated and deoxygenated water. The adult water strider body is covered by a pilose double layer consisting of upper long setae (30-80 microm) and lower filiform microtrichia (5-9 microm). Only setae are present on the legs. Microtrichia on the larval body are very short: 0.5-0.6 microm in first and second instars, and 0.8-1.7 microm in third to fifth instars. Larval body setae are approximately as long as those of adults (25-50 microm), but are much less dense at 1,800-5,750 setae per mm(2) versus 15,000-20,000 setae per mm(2) in adults. The density of setae on the legs remains relatively constant throughout development (larvae: 15,000-20,000 setae per mm(2); adults: 20,000-26,000 setae per mm(2)). Immersion experiments demonstrated that young instars may use cuticular respiration. First- and second-instar larvae survived underwater for several hours without a visible air supply, although they did not survive in deoxygenated water. We posit that the short body microtrichia have a waterproofing function in larvae, whereas they create a compressible air bubble in adults. In adults, waterproofing is accomplished by the setae. The density and length of setae on the legs of larvae was nearly the same as that on the body and legs of adults and is presumably optimized for waterproofing. Thus, a change in morphometrical parameters can result in a large functional change in the same structure. We discuss this interpretation in both ecological and physiological contexts. 2008 Wiley-Liss, Inc

  12. The form of sexual selection on male genitalia cannot be inferred from within-population variance and allometry - a case study in Aquarius remigis.

    Science.gov (United States)

    Bertin, Angéline; Fairbairn, Daphne J

    2007-04-01

    Male genital morphology in insects and arachnids is characterized by static hypoallometry and low intrapopulational levels of phenotypic variation relative to other male traits. The one-size-fits-all model of genital evolution attributes these patterns to stabilizing sexual selection. This model relies on the assumption that the observed patterns of variation and allometry reflect the form of sexual selection acting these traits. We test this by examining the patterns of scaling and trait variation for a set of genitalic and somatic morphological traits in male water striders (Aquarius remigis). This suite of traits is of particular interest because previous work has shown that the genitalic traits are under strong directional selection whereas the somatic traits are under either weak directional or stabilizing selection. Because the selection regime for these traits is known, we can, for the first time, test the purported relationship between trait variation, scaling, and the form of sexual selection. We show that the patterns of variation and scaling of these traits differ sharply from those predicted for traits experiencing strong directional sexual selection. Specifically, the male genital structures show static hypoallometry and low intrapopulational levels of phenotypic variation relative to other male traits, in spite of consistent, strong, directional sexual selection. These scaling relationships and levels of variation are typical of genital traits in other insect species, where they have been presumed to reflect stabilizing sexual selection. Our data clearly refute the assumption of the one-size-fits-all hypothesis that hypoallometric scaling of genitalic traits implies stabilizing selection. We discuss the implications of this finding and propose future directions for improving our current understanding of genital evolution in arthropods.

  13. A comparison of the Pac-X trans-Pacific Wave Glider data and satellite data (MODIS, Aquarius, TRMM and VIIRS).

    Science.gov (United States)

    Villareal, Tracy A; Wilson, Cara

    2014-01-01

    Four wave-propelled autonomous vehicles (Wave Gliders) instrumented with a variety of oceanographic and meteorological sensors were launched from San Francisco, CA in November 2011 for a trans-Pacific (Pac-X) voyage to test platform endurance. Two arrived in Australia, one in Dec 2012 and one in February 2013, while the two destined for Japan both ran into technical difficulties and did not arrive at their destination. The gliders were all equipped with sensors to measure temperature, salinity, turbidity, oxygen, and both chlorophyll and oil fluorescence. Here we conduct an initial assessment of the data set, noting necessary quality control steps and instrument utility. We conduct a validation of the Pac-X dataset by comparing the glider data to equivalent, or near-equivalent, satellite measurements. Sea surface temperature and salinity compared well to satellite measurements. Chl fluorescence from the gliders was more poorly correlated, with substantial between glider variability. Both turbidity and oil CDOM sensors were compromised to some degree by interfering processes. The well-known diel cycle in chlorophyll fluorescence was observed suggesting that mapping physiological data over large scales is possible. The gliders captured the Pacific Ocean's major oceanographic features including the increased chlorophyll biomass of the California Current and equatorial upwelling. A comparison of satellite sea surface salinity (Aquarius) and glider-measured salinity revealed thin low salinity lenses in the southwestern Pacific Ocean. One glider survived a direct passage through a tropical cyclone. Two gliders traversed an open ocean phytoplankton bloom; extensive spiking in the chlorophyll fluorescence data is consistent with aggregation and highlights another potential future use for the gliders. On long missions, redundant instrumentation would aid in interpreting unusual data streams, as well as a means to periodically image the sensor heads. Instrument placement is

  14. Comparing salinity tolerance in embryonic and larval development of two species of water strider, Aquarius paludum and Gerris latiabdominis (Hemiptera: Gerridae).

    Science.gov (United States)

    Kishi, Manabu; Harada, Tetsuo; Fujisaki, Kenji

    2013-08-01

    Water strider Aquarius paludum (Fabricius) is a cosmopolitan species colonizes mainly freshwater but occasionally brackish habitats throughout the Palearctic and Oriental regions. Water strider Gerris latiabdominis (Miyamoto) is a common species in Japan lives in temporary habitats as freshwater paddy fields. These two species often occur syntopically. We investigated differences in the developmental response to brackish water during embryonic and larval stages between the two species. Eggs were exposed to 0-1.8% NaCl solutions within 24 h of oviposition. Larvae of G. latiabdominis were exposed to salinities of 0, 0.5%, and 0.9% from the first instar until adult emergence. Limits of NaCl concentration for hatching were 1.3% and 1.0% for A. paludum and G. latiabdominis, respectively. The hatching rate of G. latiabdominis was lower than that of A. paludum at salinities ≥ 0.9%. The period of embryonic development of G. latiabdominis was more prolonged than that of A. paludum at a given salinity. Although the salinity tolerance of G. latiabdominis was lower than that of A. paludum, our results suggest G. latiabdominis has the physiological capacity to expand into brackish waters. High and low salinity tolerances of A. paludum and G. latiabdominis, respectively, reflect the relatively wide range of habitat salinities utilized by A. paludum and the relatively restricted habitats preferred by G. latiabdominis. The high salinity tolerance of A. paludum could be an important factor contributing to their cosmopolitan distribution because high tolerance to salinity means the possibility of them to be dispersed via ocean or sea to other continents and islands. © 2012 The Authors Insect Science © 2012 Institute of Zoology, Chinese Academy of Sciences.

  15. Solutions Network Formulation Report. Reducing Light Pollution in U.S. Coastal Regions Using the High Sensitivity Cameras on the SAC-C and Aquarius/SAC-D Satellites

    Science.gov (United States)

    Andrews, Jane C.; Knowlton, Kelly

    2007-01-01

    Light pollution has significant adverse biological effects on humans, animals, and plants and has resulted in the loss of our ability to view the stars and planets of the universe. Over half of the U.S. population resides in coastal regions where it is no longer possible to see the stars and planets in the night sky. Forty percent of the entire U.S. population is never exposed to conditions dark enough for their eyes to convert to night vision capabilities. In coastal regions, urban lights shine far out to sea where they are augmented by the output from fishing boat, cruise ship and oil platform floodlights. The proposed candidate solution suggests using HSCs (high sensitivity cameras) onboard the SAC-C and Aquarius/SAC-D satellites to quantitatively evaluate light pollution at high spatial resolution. New products modeled after pre-existing, radiance-calibrated, global nighttime lights products would be integrated into a modified Garstang model where elevation, mountain screening, Rayleigh scattering, Mie scattering by aerosols, and atmospheric extinction along light paths and curvature of the Earth would be taken into account. Because the spatial resolution of the HSCs on SAC-C and the future Aquarius/SAC-D missions is greater than that provided by the DMSP (Defense Meteorological Satellite Program) OLS (Operational Linescan System) or VIIRS (Visible/Infrared Imager/Radiometer Suite), it may be possible to obtain more precise light intensity data for analytical DSSs and the subsequent reduction in coastal light pollution.

  16. Binned level-3 Sea Surface Salinity from Aquarius/Satélite de Aplicaciones Científicas (SAC)-D mission in support of the National Centers for Environmental Information (NCEI) data quality monitoring system (DQMS) from 2011-08-28 to 2015-06-10 (NCEI Accession 0151631)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The data quality monitoring system (DQMS) for the Aquarius/Satélite de Aplicaciones Científicas (SAC)-D satellites level-2 sea-surface salinity (SSS) swath data...

  17. Aquarius - A Modelling Package for Groundwater Flow and Coupled Heat Transport in the Range 0.1 to 100 MPa and 0.1 to 1000 C

    Science.gov (United States)

    Cook, S. J.

    2009-05-01

    Aquarius is a Windows application that models fluid flow and heat transport under conditions in which fluid buoyancy can significantly impact patterns and magnitudes of fluid flow. The package is designed as a visualization tool through which users can examine flow systems in environments, both low temperature aquifers and regions with elevated PT regimes such as deep sedimentary basins, hydrothermal systems, and contact thermal aureoles. The package includes 4 components: (1) A finite-element mesh generator/assembler capable of representing complex geologic structures. Left-hand, right-hand and alternating linear triangles can be mixed within the mesh. Planer horizontal, planer vertical and cylindrical vertical coordinate sections are supported. (2) A menu-selectable system for setting properties and boundary/initial conditions. The design retains mathematical terminology for all input parameters such as scalars (e.g., porosity), tensors (e.g., permeability), and boundary/initial conditions (e.g., fixed potential). This makes the package an effective instructional aide by linking model requirements with the underlying mathematical concepts of partial differential equations and the solution logic of boundary/initial value problems. (3) Solution algorithms for steady-state and time-transient fluid flow/heat transport problems. For all models, the nonlinear global matrix equations are solved sequentially using over-relaxation techniques. Matrix storage design allows for large (e.g., 20000) element models to run efficiently on a typical PC. (4) A plotting system that supports contouring nodal data (e.g., head), vector plots for flux data (e.g., specific discharge), and colour gradient plots for elemental data (e.g., porosity), water properties (e.g., density), and performance measures (e.g., Peclet numbers). Display graphics can be printed or saved in standard graphic formats (e.g., jpeg). This package was developed from procedural codes in C written originally to

  18. Assessment of Simulated and Aquarius-Observed Sea Surface Salinity Using Salinity Measurements in Dry Tortugas National Park, Florida, U.S.A.: Application for Pseudocoral δ18O

    Science.gov (United States)

    Chaichitehrani, N.; DeLong, K. L.

    2016-02-01

    Salinity plays a critical role in ocean physics thus is a target for paleoclimatologic and paleoceanographic reconstruction. Here we assess the quality of space-borne sea surface salinity (SSS) determinations and simulated SSS versus SSS measurements from an open ocean coral reef site, Dry Tortugas National Park (DTNP). The oxygen isotopic composition of seawater (δ18Osw) is related to SSS, thus SSS can be used to understand δ18Osw variability when measurements of δ18Osw are sparse. In marine carbonates such as corals, δ18Ocoral varies with temperature and δ18Osw creating a bivariate system, which is difficult to calibrate with two variables. Accurate determinations of SSS from satellites and simulations can be substituted for local SSS, converted to δ18Osw, in bivariate forward models to estimate δ18Ocoral or pseudocoral thus improving calibrations of δ18Ocoral for locations and time intervals without in situ observations. Monthly and daily Aquarius-retrieved SSS data Level-3 (Official Version 3.0) with spatial resolution are compared with local SSS in DTNP obtained from Water Quality Monitoring Project for the Florida Keys National Marine Sanctuary and southwest Florida shelf, which includes DTNP, for the concurrent interval from 2011-2014. Our statistical analysis shows a satisfactory agreement between daily Aquarius SSS and local SSS (r2=0.68; RMSE=0.24 psu). Additional SSS data are obtained from the National Data Buoy Center DRYF1 station in DTNP. Monthly-simulated SSS (Global Ocean Physics Reanalysis GLORYS2V3) obtained from the MyOcean WebPortal compares relatively well with DRYF1 monthly SSS data (r2=0.68; RMSE=0.35 psu) for the earlier interval from 1998-2002. Our analysis indicates that Aquarius-retrieved and simulated SSS can be utilized as a substitute for local SSS in bivariate forward models to calculate pseudocoral δ18Ocoral as well as forward models other marine carbonates for locations without SSS observations.

  19. Susan G. Komen for the Cure

    Science.gov (United States)

    ... de sus senos:Consejos útiles para mujeres El Cancer de Mama y el Medio Ambiente: Preguntas y Respuestas Guía de herramientas de educación sobre el cancer de seno para comunidades hispanas/Latinas About Us ...

  20. Entretien avec Susan Holtz | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Au seuil du prochain millénaire, le développement planétaire durable pose des défis complexes et d'envergure. Partout dans le monde, on cherche à relever ces défis en intégrant les politiques environnementales, sociales et économiques.

  1. From Book Learning to Aquarius

    Science.gov (United States)

    Coppedge, Walter R.

    1970-01-01

    In education today, it is fundamentally important to require answers to the problems of our environment, of latent racism and patent violence, of poverty and war and indifference to one another. (Author/NH)

  2. A Prolog Benchmark Suite for Aquarius

    Science.gov (United States)

    1989-04-01

    restarted after each run." #endif aspel randomlogic.m random_logic.m: benchmark (compactor) random_logic master file % generated: _MDAY MONTH _YEAR_...Elistout), asp .8 compactor getcye(Co , Type, X, Node) : * cort(TYPe, ot(X, Co1), Oset, Node). getwyel( Coi , Layer, XI, X2, Wid, Node) wire(Layer, pt(X...Srow, Grow, Newdistj)) trueydist( Coi , Dist)0 rnaxcol (Maxcol), Col >= Maxcol, assert(hcol(G, 0)), ’K Irueydist(Col, Dist) : Nextcol is Col , 1, ydist(Col

  3. Education in the Age of Aquarius.

    Science.gov (United States)

    Traverso, Edmund

    1969-01-01

    Process, not facts; objective analysis and evaluation, not emotional and uncritical patriotism: these are the emphases of the new social studies and history materials. Curriculum designers of the 1950's reflected that decade's belief that there is a nature to things and that the discipline learned while using inquiry methods helps students become…

  4. Good-By Aquarius, Hello Anxiety.

    Science.gov (United States)

    Wharton, Clifton R., Jr.

    1981-01-01

    Problems, such as the declining availability of state and federal funds, and increasing state regulation are identified. It is suggested that the predicted college enrollment disaster looks less threatening, that the public attitude toward education has improved, and administrators and trustees have learned from their experiences. (Author/MLW)

  5. Foreign Languages in the Age of Aquarius.

    Science.gov (United States)

    Lippman, Jane Neustein

    1971-01-01

    The role of language instruction in a changing society is scrutinized in this article. Enrollment trends in several subject areas are compared and reasons for the decline in English, mathematics, science, and languages are related to current student attitudes. Instructional objectives of language programs are criticized particularly for their…

  6. Adolescent Literature in the Age of Aquarius.

    Science.gov (United States)

    Hamilton, Harlan

    To avoid the demise of adolescent literature, educators must revise their way of thinking to include a great many paperback media tie-in books in the English curriculum. Among the possible reasons many teachers have thus far neglected media tie-ins are their beliefs that the tie-ins are inferior literature or that they are just another gimmick.…

  7. Contravene, write ... About the pain of others of Susan Sontag

    Directory of Open Access Journals (Sweden)

    Lucía Belén Couso

    2014-08-01

    Full Text Available Regarding the pain of others challenges our knowledge, challenges what is held as true. We appreciate this attitude condensed in the verb “to defy”. We analyze how Sontag develops her hypothesis and, from that point onward, which is the idea of criticism that emerges from the writing of Regarding the pain of others. Our analysis focuses on three of its topics: the reviewing of the ideas about the war that Virginia Woolf establishes on Three Guineas, the discussion of her own text On photography, and the criticism about Sebastião Salgado’s photography.

  8. From Estonian Exile to Executive Office / Susan Frith

    Index Scriptorium Estoniae

    Frith, Susan

    2008-01-01

    Eesti Vabariigi Presidendi Toomas Hendrik Ilvese elukäigust, haridusteest, poliitilistest vaadetest. T. H. Ilves lõpetas Pennsylvania ülikooli psühholoogia alal magistrikraadiga 1978. a. Artiklis on kasutatud telefoniintervjuud presidendiga. T. H. Ilvese kohta avaldavad arvamust ülikoolikaaslane Brian Wandell ja Eesti Rahvuskomitee Ühendriikides endine president Juhan Simonson. Ülevaade artiklist ilmunud ka: Vaba Eesti Sõna, 24. jaan. 2008, lk. 7, 10: Vaga, Airi. Eesti president Toomas H. Ilves Pennsylvania ülikooli ajakirjas

  9. Reading Susan Isaacs: toward a radically revised theory of thinking.

    Science.gov (United States)

    Ogden, Thomas H

    2011-08-01

    The author views Isaacs's (1952) paper, The nature and function of phantasy, as making an important contribution to the development of a radically revised psychoanalytic theory of thinking. Perhaps Isaacs's most important contribution is the notion that phantasy is the process that creates meaning, and that phantasy is the form in which all meanings - including feelings, defense 'mechanisms,' impulses, bodily experiences, and so on - exist in unconscious mental life. The author discusses both explicit formulations offered by Isaacs as well as his own extensions of her ideas. The latter include (1) the idea that phantasying generates not only unconscious psychic content, but also constitutes the entirety of unconscious thinking; (2) the notion that transference is a form of phantasying that serves as a way of thinking for the first time (in relation to the analyst) emotional events that occurred in the past, but were too disturbing to be experienced at the time they occurred and (3) a principal aim and function of phantasy is that of fulfilling the human need to get to know and understand the truth of one's experience. The author concludes by discussing the relationship between Isaacs's concept of phantasy and Bion's concepts of alpha function and the human need for the truth, as well as the differences between Fairbairn's and Isaacs's conceptions of the nature of unconscious internal object relationships. Copyright © 2011 Institute of Psychoanalysis.

  10. A polarised SUSANS facility to study magnetic systems

    Indian Academy of Sciences (India)

    magnet, at a small angle to the diagonal of the rectangle. Neutrons were thus de- flected by the 'magnetic air prism' [5] of 90◦ apex angle. The magnet was fabricated by attaching eight rare earth permanent magnet slabs (2 cm wide, 5 cm long and. 1.25 cm high, maximum energy product BHmax > 30 MGOe) each, just ...

  11. A polarised SUSANS facility to study magnetic systems

    Indian Academy of Sciences (India)

    Spatial pair-distribution functions for the up- and down-spins as well as the nuclear and magnetic scattering length density distributions in the micrometer domain, have ... Solid State Physics Division, Bhabha Atomic Research Centre, Mumbai 400 085, India; Berlin Neutron Scattering Center, Hahn-Meitner-Institut, Glienicker ...

  12. Entretien avec Susan Holtz | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    26 nov. 2010 ... À l'échelle planétaire, toutes les institutions continueront d'évoluer et de changer, c'est sûr. C'est ce qui se passe présentement étant donné la conjugaison d'une intégration plus poussée de l'économie planétaire à l'évolution rapide des technologies, particulièrement dans le monde des communications.

  13. In Conversation with Susan Holtz | CRDI - Centre de recherches ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In response to Chapter 8 of Agenda 21, "Integrating environment and development in decision making," IDRC undertook to research and document the practical, policy integration problems encountered in its development work. The Cornerstone of Development: Integrating Environmental, Social, and Economic Policies, ...

  14. Rene Valner ja Mikk Suursild - lihtsa elu tegelased / Susan Lahesalu

    Index Scriptorium Estoniae

    Lahesalu, Susan

    2007-01-01

    Arhitekt Rene Valner ja Mikk Suursild - tandem nimega UNITe - ehitavad ökonoomseid ja ökoloogilisi looduslikest materjalidest maju. Nende koostöös on valminud ka Peipsi ääres Nina külas 3 põhumaja. Ott Kadariku, Margit Mutso ja Kuido Kartau kommentaarid

  15. The Problem of Citizenship Training in the Age of Aquarius.

    Science.gov (United States)

    Vermont State Dept. of Education, Montpelier.

    This paper attempts to aid Vermont educators in re-examining traditional education practices designed to foster responsible citizenship behavior patterns in youth, and establishes basic directions for new programs and procedures. The paper outlines behavioral objectives and goals of a new citizenship program in Vermont. It is the position of this…

  16. Oncoming tides in the Age(ing) of Aquarius.

    Science.gov (United States)

    Frost, David W; Fowler, Robert

    2009-01-01

    The demographic shift in the age of most industrialized countries' populations is profoundly impacting all areas of healthcare, perhaps nowhere more so than critical care. As the proportion of elderly patients increases, so to will our consideration for admission of elderly patients to the intensive care unit (ICU). Whether explicitly acknowledged or not, intensivists routinely debate (both inwardly and outwardly) the benefit, utility, and patient-focused dignity of admitting very elderly patients to the ICU. Despite the apparent increase in demand for, and provision of critical care services to, the elderly, there are few data on the outcomes from these admissions, and how one might predict which elderly patients are most likely to derive benefit from the invasive and resource-intensive services provided in modern ICUs.

  17. In Appreciation of Claude Warren and Susan Rose's "William Pengelly's Techniques of Archaeological Excavation"

    Directory of Open Access Journals (Sweden)

    David L. Browman

    1997-11-01

    Full Text Available The short (40 pages pamphlet by Warren and Rose (1994 provides the answer to a complex question regarding credit for an important archaeological methodology, stratigraphic excavation. Let me set the stage for this appreciation. Continuing research on the beginnings of stratigraphic excavations in North America (Browman and Givens 1996, I sought the origins of the idea of actually excavating by strata, rather than post-facto interpretation, seen in North American as early as 1895 in the work of Henry Chapman Mercer, but not really introduced into the repertoire of American techniques until the work of Gamio, Kidder and Nelson between 1911 and 1914. The roots of the latter three seemed to lie with individuals such as Reisner, Boas, Uhle, who in turn seemed to rely on Hugo Obennaier, Gabriel de Mortillet, Marcellin Boule, and perhaps Pitt-Rivers, while Mercer's work could be traced to Boule and Albert Gaudry. Doggedly following back the roots, I found that Chapman (1989 could make a reasonable case that Pitt-Rivers had actually learned of the idea of strati­graphic excavation from Evans, Prestwich, and Lubbock, from the British scientists working with the Upper and Middle Paleolithic excavations during 1858-1868.

  18. Nõukogude "kaasaegne stiil" : sotsialistlik modernism = The Soviet "contemporary style" : a socialist modernism / Susan E. Reid

    Index Scriptorium Estoniae

    Reid, Susan E., 1959-

    2009-01-01

    Modernismile lähenemisest nõukogude kunstis. Nõukogude kunstikriitikast ja -praktikast. Kaasaegne stiil sünteesis arhitektuuriga. Nõukogude Palee teostamata projektist Moskvas. 1962. aastal valminud Moskva Pioneeride Paleest kui stalinistliku praktika hülgamise näitest

  19. Comment on "Revisiting the 1872 owens valley, California, earthquake" by Susan E. Hough and Kate Hutton

    Science.gov (United States)

    Bakun, W.H.

    2009-01-01

    Bakun (2009) argues that the conclusions of Hough and Hutton (2008) are wrong because the study failed to take into account the Sierra Nevada attenuation model of Bakun (2006). In particular, Bakun (2009) argues that propagation effects can explain the relatively high intensities generated by the 1872 Owens Valley earthquake. Using an intensity attenuation model that attempts to account for attenuation through the Sierra Nevada, Bakun (2006) infers the magnitude estimate (Mw 7.4–7.5) that is currently accepted by National Earthquake Information Center (NEIC).

  20. David Brailer on a private-public health information technology infrastructure. Interview by Susan V. White.

    Science.gov (United States)

    Brailer, David

    2004-01-01

    David Brailer, MD PhD, was appointed the first National Health Information Technology Coordinator by the U.S. Department of Health and Human Services Secretary Tommy Thompson on May 6, 2004. As National Coordinator he is to execute President Bush's Executive Order of April 27, 2004, calling for widespread deployment of health information technology (HIT) within 10 years. Dr. Brailer is an authority on clinical data sharing, local health information exchanges, and the use of peer-to-peer technologies in healthcare. He is a leader in the strategy and financing of quality and efficiency in healthcare, with a particular emphasis on HIT and health systems management. Previously, Dr. Brailer was a Senior Fellow at the Health Technology Center in San Francisco, advising a variety of regional and national data-sharing projects and several major corporations about the role of IT in improving the quality of healthcare. Dr. Brailer recently completed 10 years as Chairman and CEO of CareScience, Inc., a provider of care management services and Internet-based solutions that help reduce medical errors and improve physician and hospital-based performance. Dr. Brailer holds doctoral degrees in both medicine and economics. While in medical school, he was a Charles A. Dana Scholar at the University of Pennsylvania School of Medicine and the first recipient of the National Library of Medicine Martin Epstein Award for his work in expert systems. Dr. Brailer was among the first medical students to serve on the Board of Trustees of the American Medical Association.

  1. 77 FR 73663 - Susan F. Knott; Denial of Hearing; Final Debarment Order

    Science.gov (United States)

    2012-12-11

    ... seeking treatment with BOTOX/BOTOX Cosmetic (BOTOX) with a product, TRI-toxin, distributed by Toxic Research International, Inc. (TRI). BOTOX is a biological product derived from botulinum toxin type A that... approved for use, to be offered for sale as an approved drug product, BOTOX. This conduct clearly relates...

  2. Cracking the finger code: an interview with CCR’s Susan Mackem | Center for Cancer Research

    Science.gov (United States)

    The creation of the digits in our hand—the thumb, index-middle-ring fingers and pinky—begins early in development, but little is known about the exact programming that occurs to produce the different digit types. Investigators in the Cancer and Developmental Biology Laboratory, (CDBL), provide the first genetic evidence of how the tuning of signals sets digit identity by studying the effects of dysregulation (abnormal regulation) in several mutations. Read more…

  3. Understanding Unlikeness, in John Chamberlain: Choices, Susan Davidson, ed. (New York: Solomon R. Guggenheim Museum, 2012), pp. 45–55

    OpenAIRE

    Adrian Kohn

    2017-01-01

    ere is just some of what we are given to understand John Chamberlain’s art as being like: car wrecks and dancers, artichokes and mummies and giant phalluses, drapery, a football player, ornaments for an immense Christmas tree and monstrous jungle-gyms, a sucked egg, and Titans beside themselves with rage. Next, a long list of the art-historical movements that his pieces have brought to mind: the baroque and rococo, neoclassicism, Cubism, Dada and Surrealism, both Abstract Expressionism and Po...

  4. Uncovering Our History, Teaching Primary Sources (Tarihimizi Keşfetme, Birincil Kaynaklarla Öğretim - Susan H. Veccia

    Directory of Open Access Journals (Sweden)

    Duygu Alphan Şentuna

    2014-05-01

    Full Text Available Okul yıllarından bahseden insanların büyük bir çoğunluğu için tarih dersi, not almak için isimlerin ve tarihlerin ezberlendiği, sınavdan sonra ise unutulduğu bir ders olarak hatıralarda yer alır. Günümüzde tarih öğretiminde önemli gelişmeler olmasına rağmen hala derslerde öğretmenlerin isim, tarih ve ders kitabı merkezli bir öğretim izledikleri görülmektedir. Öğrencilerin eleştirel ve tarihsel düşünme becerisi elde etmeleri için ilk önce bilgiye sahip olmaları gerektiği inancı, öğretmenlerin derslerde yenilikçi yöntemlere yeterli zaman ayırmalarını engellemektedir. Bu durum öğrencilerin tarih dersinden soğumalarına ve dersi zaman kaybı olarak görmelerine neden olmaktadır.

  5. 75 FR 22012 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition to List Susan's...

    Science.gov (United States)

    2010-04-27

    ... that incidental dispersal via wind or adhesion to animals or humans could occur, but neither dispersal... species is imperiled (at a high risk of extinction) globally due to a very restricted range, very few... Spring may be impacted by poor water quality because of large amounts of filamentous algae in Trout Creek...

  6. Separated by Sex: A Critical Look at Single-Sex Education for Girls (edited by Susan Morse)

    Science.gov (United States)

    Ceraulo, Reviewed By Sandra C.

    1999-05-01

    As Cornelius Riordan states in his round-table paper, "The challenge of effective and equitable schooling in the next century is to overcome the resistance and recalcitrance of youth cultures in and out of school" (p 58). While this is admittedly not a new problem, it is more complex in its modern form and innovative ways to solve it are needed. In an old tradition, one such attempt has been single-sex schools, which have had particular success with the disadvantaged and white females in American society, with the notable involvement of Catholic religious communities. The report does not make clear whether their successes can be reproduced in some modification of the public school format. However, the AAUW report on single-sex schools sheds light on some of the characteristics that make true learning communities out of ordinary schools and on what it takes to reach disadvantaged girls. For these reasons, the AAUW report is good reading for educators at all levels.

  7. Estimation of the Barrier Layer Thickness in the Indian Ocean Using Aquarius Salinity

    Science.gov (United States)

    2014-07-08

    seasonal river discharge cycle in the BoB indicating that freshwater influx from the rivers sur- rounding the BoB are likely producing the errors pattern...that BL forma- tion in the Indian Ocean is driven by the monsoon cycle. Reversing winds, currents, and freshwater fluxes (evaporation (E), precipitation...eastern side of the basin, freshwater inputs into the Bay of Bengal, from river runoff and precipitation, drive seasonally very low salinities (ថ PSU

  8. Planet-Mediated Precision-Reconstruction of the Evolution of the Cataclysmic Variable HU Aquarius

    OpenAIRE

    Zwart, Simon Portegies

    2012-01-01

    Cataclysmic variables (CVs) are binaries in which a compact white dwarf accretes material from a low-mass companion star. The discovery of two planets in orbit around the CV HU Aquarii opens unusual opportunities for understanding the formation and evolution of this system. In particular the orbital parameters of the planets constrains the past and enables us to reconstruct the evolution of the system through the common-envelope phase. During this dramatic event the entire hydrogen envelope o...

  9. Estimation of the barrier layer thickness in the Indian Ocean using Aquarius Salinity.

    Digital Repository Service at National Institute of Oceanography (India)

    Felton, C.S.; Subrahmanyam, B.; Murty, V.S.N; Shriver, J.F.

    , as well as the advantages and disadvantages of the current model are discussed. BLT estimations using HYCOM simulations display large errors that are related to model layer structure and the selected BLT methodology....

  10. Creative Leadership and Supervision in Education in the Age of Aquarius

    Science.gov (United States)

    Diomede, Matthew

    1974-01-01

    This article discusses need for creative leadership and better supervision in educational situations. There is a need for better understanding of adolescents and their needs. The Supervisor today must know who he is and who he should be. (Author/EK)

  11. Composing Aloud: Oral Composition "Communication Skills for the Age of Aquarius."

    Science.gov (United States)

    Monaster, Rebecca

    New curriculum emphases and new devices to make language teaching more productive are needed to meet the needs of students who are involved in a new age. The following assumptions should be implicit in developing an oral language program plan: oral language is vital to thinking, reading, and writing; mass media have created a new and different…

  12. Age of Aquarius and Vietnam: Today's Students Flock to Courses about 1960's.

    Science.gov (United States)

    Collison, Michele N-K.

    1988-01-01

    The dramatic increase in college course offerings about the decade of the 1960s is a result of both to student curiosity with its protest movements and of faculty composition. Some feel the courses are essential to student understanding of modern life, whereas others feel more research is needed. (MSE)

  13. Potential use of aquarius scatterometer observations to estimate vegetation water content

    Science.gov (United States)

    Information about vegetation water content (VWC) is useful in agriculture, forestry and hydrology. It will be also employed in several of the soil moisture retrieval algorithms. All of these algorithms utilize variations of the same radiative transfer equation that accounts for vegetation attenuatio...

  14. Sperry and the Age of Aquarius: science, values and the split brain.

    Science.gov (United States)

    Corballis, M C

    1998-10-01

    Although Sperry's empirical science reinforced a materialist view of the relation between mind and brain, his concept of an emergent consciousness that could causally influence neural function is reminiscent of Cartesian dualism, purportedly allowing for free will, individual responsibility for action and a synthesis of science with moral and religious values. Yet Sperry insisted that his view was entirely materialistic and that the critical distinction was not between a non-material mind and a material brain, but rather between holism and reductionism. A similar distinction is attributed to right- vs left-brain modes of thought as revealed by the split-brain studies, and Sperry's hope for the unification of holistic and reductionist approaches may also relate to his conviction that these two modes are fundamentally unified in the normal brain.

  15. Inter-comparison of SMAP, Aquarius and SMOS L-band brightness temperature observations

    Science.gov (United States)

    Soil Moisture Active Passive (SMAP) mission is scheduled for launch on January 29, 2015. SMAP will make observations with an L-band radar and radiometer using a shared 6 m rotating reflector antenna. SMAP is a fully polarimetric radiometer with the center frequency of 1.41 GHz. The target accuracy o...

  16. The kinematics of globular clusters systems in the outer halos of the Aquarius simulations

    NARCIS (Netherlands)

    Veljanoski, J.; Helmi, A.

    2016-01-01

    Stellar halos and globular cluster (GC) systems contain valuable information regarding the assembly history of their host galaxies. Motivated by the detection of a significant rotation signal in the outer halo GC system of M 31, we investigate the likelihood of detecting such a rotation signal in

  17. STT Doubles with Large DM - Part V: Aquila, Delphinus, Cygnus, Aquarius

    Science.gov (United States)

    Knapp, Wilfried; Nanson, John

    2016-07-01

    The results of visual double star observing sessions suggested a pattern for STT doubles with large DM of being harder to resolve than would be expected based on the WDS catalog data. It was felt this might be a problem with expectations on one hand, and on the other might be an indication of a need for new precise measurements, so we decided to take a closer look at a selected sample of STT doubles and do some research. We found that, as in the other constellations covered so far (Gem, Leo, UMa etc.), at least several of the selected objects in Aql, Del, Cyg and Aqr show parameters quite different from the current WDS data

  18. PODAAC-AQR50-2SOCS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 5.0 Aquarius Level 2 product is the official third release of the orbital/swath data from AQUARIUS/SAC-D mission. The Aquarius Level 2 data set contains...

  19. Interview with a quality leader. Linda Aiken on the healthcare industry and workplace issues. Interview by Susan V. White and Colleen J. Hewes.

    Science.gov (United States)

    Aiken, Linda

    2003-01-01

    Linda Aiken, PhD MSN, is director of the Center for Health Outcomes and Policy Research and The Claire M. Fagin Leadership Professor of Nursing and Professor of Sociology at the University of Pennsylvania in Philadelphia. Dr. Aiken's other appointments at the University of Pennsylvania include senior fellow at the Leonard Davis Institute for Health Economics and research associate in the Population Studies Center. Before joining the University of Pennsylvania faculty in 1988, Dr. Aiken served as vice president of the Robert Wood Johnson Foundation. She is a member of the Institute of Medicine, a fellow of the American Academy of Arts and Sciences and of the National Academy of Social Insurance, a former president of the American Academy of Nursing, a distinguished fellow of the Academy for Health Services Research and Health Policy (now AcademyHealth), and a member of the Council on the Economic Impact of Health System Change. Dr. Aiken served on the Medicare Physician Payment Review Commission for 6 years and was a member of the 1982 Social Security Advisory Council and of President Clinton's National Health Reform Task Force. Her recent work, for which she received the Sigma Theta Tau International Clinical Research Award in 1999, has focused on accounting for variation in hospital patient outcomes in the United States, Canada, the United Kingdom, and Germany. Dr. Aiken received her bachelor's and master's degrees in nursing from the University of Florida, Gainesville, and her doctorate in sociology and demography from the University of Texas at Austin.

  20. The Susan G. Komen for the Cure Tissue Bank at the IU Simon Cancer Center: a unique resource for defining the "molecular histology" of the breast

    National Research Council Canada - National Science Library

    Sherman, Mark E; Figueroa, Jonine D; Henry, Jill E; Clare, Susan E; Rufenbarger, Connie; Storniolo, Anna Maria

    2012-01-01

    "Molecular histology" of the breast may be conceptualized as encompassing the normative ranges of histologic structure and marker expression in normal breast tissues in relation to a woman's age and life experiences...

  1. The Greek Life of St. Leo bishop of Catania (BHG 981b), Text and Notes by Alexandros G. Alexakis, Translation by Susan Wessel

    OpenAIRE

    Peters-Custot, Annick

    2014-01-01

    Le dossier hagiographique de Léon, évêque de Catane en Sicile, est un des plus originaux et des plus complexes de l’hagiographie médiévale en langue grecque. Logiquement, les débats savants qui entourent le dossier sont intenses et stimulés par chaque nouvelle publication. Toutefois, l’intérêt du dossier hagiographique de Léon dépasse largement le cercle restreint des spécialistes de l’hagiographie iconoclaste, crypto-iconoclaste et iconodoule, tant le contenu de cette Vie et les mystères de ...

  2. Interview with a quality leader: Kent Bottles, MD, president of ICSI, on transforming care for the future. Interview by Susan V. White.

    Science.gov (United States)

    Bottles, Kent

    2010-01-01

    Kent Bottles, MD, President of the Institute for Clinical Systems Improvement (ICSI). Dr. Bottles is a board-certified pathologist who specialized in surgical and cyto-pathology. He earned a medical degree from Case Western Reserve University in Ohio. He has extensive experience in integrated healthcare delivery systems, research, academia, commercial laboratories, genomics, proteomics, and management of biotech start-up companies. Dr. Bottles was vice president and chief medical officer of the Iowa Health System. Before that, he served as president and CEO of Grand Rapids Medical Education and Research Center for Health Professions, a multi-institutional consortium of healthcare organizations, and as president of Genomics Repository and chief knowledge officer, Genomics Collaborative Inc. Dr. Bottles has extensive academic experience, serving as Professor and Acting Head, Department of Pathology and Laboratory Medicine at the University of Iowa. He was also the founding medical director of managed care plans for University of Iowa employees. Dr. Bottles has addressed topics ranging from quality and patient safety and disruptive technology to patient-physician relationships and the future of medicine. He has received numerous honors, including the Rodney T. West Literary Achievement Award for the most important article on medical management presented by the American College of Physician Executives. He has broad clinical experience with the University of Iowa and the San Francisco General Hospital, and has been a national leader in changing the practice of pathology and laboratory medicine to meet the challenges of managed care.

  3. Sal die Era van Aquarius met ’n “skrikkelsprong” in die millennium tot sy reg kom

    Directory of Open Access Journals (Sweden)

    D. P. Smits

    2001-09-01

    Full Text Available Waar ons nou die einde van die 2de millennium AD nader, het dit duidelik geword dat daar heelwat verwarring heers oor hoe en waarom ons kalender opgestel is soos dit is. Die lengte van ’n jaar en van die astronomiese eeu word beide gedefinieer aan die hand van die posisie van ’n bepaalde punt aan die hemel, wat bekend staan as die Eerste punt van Aries. Deurdat hierdie punt met betrekking tot die sterre-agtergrond beweeg, skep dit probleme om sterrekundige gebeurtenisse, wat die seisoene bepaal, aan ’n vaste datum in ons kalender te koppel. Die Katolieke Kerk se wens om Paasfees op ’n datum te vier wat deur spesifieke astronomiese gebeurtenis se bepaal word, het in die 16de eeu gelei tot die implementering van die kalender wat nou internasionaal in gebruik is.

  4. Effect of aliskiren on progression of coronary disease in patients with prehypertension: the AQUARIUS randomized clinical trial.

    Science.gov (United States)

    Nicholls, Stephen J; Bakris, George L; Kastelein, John J P; Menon, Venu; Williams, Bryan; Armbrecht, Juergen; Brunel, Patrick; Nicolaides, Maria; Hsu, Amy; Hu, Bo; Fang, Hui; Puri, Rishi; Uno, Kiyoko; Kataoka, Yu; Bash, Dianna; Nissen, Steven E

    2013-09-18

    Blood pressure reduction and renin-angiotensin-aldosterone system inhibition are targets for treatment of atherosclerosis. The effect of renin inhibition on coronary disease progression has not been investigated. To determine the effects of renin inhibition with aliskiren on progression of coronary atherosclerosis. A double-blind, randomized, multicenter trial (Aliskiren Quantitative Atherosclerosis Regression Intravascular Ultrasound Study) comparing aliskiren with placebo in 613 participants with coronary artery disease, systolic blood pressure between 125 and 139 mm Hg (prehypertension range), and 2 additional cardiovascular risk factors conducted at 103 academic and community hospitals in Europe, Australia, and North and South America (enrollment from March 2009 to February 2011; end of follow-up: January 31, 2013). Participants underwent coronary intravascular ultrasound (IVUS) imaging and were randomized to receive 300 mg of aliskiren (n = 305) or placebo (n = 308) taken orally daily for 104 weeks. Disease progression was measured by repeat IVUS examination after at least 72 weeks of treatment. The primary efficacy parameter was the change in percent atheroma volume (PAV) from baseline to study completion. Secondary efficacy parameters included the change in normalized total atheroma volume (TAV) and the percentage of participants with atheroma regression. Safety and tolerability were also assessed. Evaluable imaging data were available at baseline and follow-up for 458 participants (74.7%). The primary IVUS efficacy parameter, PAV, did not differ between participants treated with aliskiren (-0.33%; 95% CI, -0.68% to 0.02%) and placebo (0.11%; 95% CI, -0.24% to 0.45%) (between-group difference, -0.43% [95% CI, -0.92% to 0.05%]; P = .08). The secondary IVUS efficacy parameter, TAV, did not differ between participants treated with aliskiren (-4.1 mm3; 95% CI, -6.27 to -1.94 mm3) and placebo (-2.1 mm3; 95% CI, -4.21 to 0.07 mm3) (between-group difference, -2.04 mm3 [95% CI, -5.03 to 0.95 mm3]; P = .18). There were no significant differences in the proportion of participants who demonstrated regression of PAV (56.9% vs 48.9%; P = .08) and TAV (64.4% vs 57.5%; P = .13) in the aliskiren and placebo groups, respectively. Among participants with prehypertension and coronary artery disease, the use of aliskiren compared with placebo did not result in improvement or slowing of progression of coronary atherosclerosis. These findings do not support the use of aliskiren for regression or prevention of progression of coronary atherosclerosis. clinicaltrials.gov Identifier: NCT00853827.

  5. Aquarius Project: Research in the System Architecture of Accelerators for the High Performance Execution of Logic Programs.

    Science.gov (United States)

    1991-05-31

    34 , " means and, variables begin with a capital letter, tree (V, L, R) is a compound object with three fields, and the underscore "-" is an anonymous variable... capital lettrs, variables by capital letters, and constants by lower case letters. Addressing modes are defined recursively. with a base case consisting...iterations. siman(InitTemp. StateO, Cost. Finalstate, Finalcost):- doOuter(Iniffemnp, StateO, CostO , Finaistate, Finalcost). % Outer Loop do~uter(Temp

  6. Weekly gridded Aquarius L-band radiometer/scatterometer observations and salinity retrievals over the polar regions - Part 1: Product description

    National Research Council Canada - National Science Library

    Brucker, L; Dinnat, E. P; Koenig, L. S

    2014-01-01

    ...), normalized radar cross section (NRCS), and sea surface salinity (SSS). Each grid cell also contains sea ice fraction, the standard deviation of TB, NRCS, and SSS, and the number of footprint observations collected during the seven-day...

  7. Assessment of seasonal and year-to-year surface salinity signals retrieved from SMOS and Aquarius missions in the Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Akhil, V.P.; Lengaigne, M.; Durand, F.; Vialard, J.; Chaitanya, A.V.S.; Keerthi, M.G.; Gopalakrishna, V.V.; Boutin, J.; de Boyer, M.C.

    for the application of satellite-derived SSS measurements because of the potential pollution of the SSS signal by radio frequency interference (RFI) and land-induced contamination in this semi-enclosed basin. The present study validates recent level-3 monthly gridded...

  8. Testudinibacter aquarius gen. nov., sp nov., a member of the family Pasteurellaceae isolated from the oral cavity of freshwater turtles

    DEFF Research Database (Denmark)

    Hansen, Mie Johanne; Pennanen, Elin Anna Erica; Bojesen, Anders Miki

    2016-01-01

    -haemolysis surrounded the colonies after 24 h of incubation on bovine blood agar at 37 degrees C. Acid was produced from L-arabinose, dulcitol, D-mannitol, sucrose and trehalose. Representative strain ELNT2x(T) had a fatty acid profile that was characteristic for members of the Pasteurellaceae. ELNT2x(T) expressed only...

  9. PODAAC-AQR50-3RMAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ancillary sea surface temperature (SST) standard mapped image data are the ancillary SST data used in the Aquarius calibration for salinity...

  10. PODAAC-AQR50-3RQCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ancillary sea surface temperature (SST) standard mapped image data are the ancillary SST data used in the Aquarius calibration for salinity...

  11. PODAAC-AQR50-3R1DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ancillary sea surface temperature (SST) standard mapped image data are the ancillary SST data used in the Aquarius calibration for salinity...

  12. PODAAC-AQR50-3R3DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ancillary sea surface temperature (SST) standard mapped image data are the ancillary SST data used in the Aquarius calibration for salinity...

  13. PODAAC-AQR50-3RRCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ancillary sea surface temperature (SST) standard mapped image data are the ancillary SST data used in the Aquarius calibration for salinity...

  14. Sources of character conflict in a clade of water striders (Heteroptera: Gerridae)

    DEFF Research Database (Denmark)

    Damgaard, Jakob; Cognato, Anthony I.

    2003-01-01

    molecular systematics, insects, Aquarius, Gerris, Limnoporus, COI, 16SrRNA, EF-1a, combined analysis, hidden branch support......molecular systematics, insects, Aquarius, Gerris, Limnoporus, COI, 16SrRNA, EF-1a, combined analysis, hidden branch support...

  15. The Susan G. Komen for the Cure® Tissue Bank at the IU Simon Cancer Center: A Unique Resource for Defining the “Molecular Histology” of the Breast

    Science.gov (United States)

    Sherman, Mark E.; Figueroa, Jonine D.; Henry, Jill E.; Clare, Susan E.; Rufenbarger, Connie; Storniolo, Anna Maria

    2014-01-01

    “Molecular histology” of the breast may be conceptualized as encompassing the normative ranges of histological structure and marker expression in normal breast tissues in relation to a woman’s age and life experiences. Studies of molecular histology can aid our understanding of early events in breast carcinogenesis and provide data for comparison with diseased breast tissues. Until recently, lack of epidemiologically annotated, optimally prepared normal breast tissues obtained from healthy women presented a barrier to breast cancer research. The Komen Tissue Bank at Indiana University is a unique biorepository that was developed to overcome this limitation. The Bank enrolls healthy donors who provide questionnaire data, blood, and up to four breast biopsies, which are prepared as both formalin fixed paraffin embedded and frozen tissues. The resource is accessible to researchers worldwide through a proposal submission, review, and approval process. As of November 2010, the Bank had collected specimens and information from 1,174 donors. In this review, we discuss the importance of studying normal breast tissues, assess the strengths and limitations of studying normal tissues obtained from different sources, and summarize the features of the Komen Tissue Bank. As research projects are completed, results will be posted on the Bank’s website. PMID:22345117

  16. Shoot winter injury and nut cold tolerance: Possible limitations for American chestnut restoration in cold environments? In: Sniezko, Richard A.; Yanchuk, Alvin D.; Kliejunas, John T.; Palmieri, Katharine M.; Alexander, Janice M.; Frankel, Susan J., tech

    Science.gov (United States)

    Thomas M. Saielli; Paul G. Schaberg; Gary J. Hawley; Joshua M. Halman; Kendra M. Gurney

    2012-01-01

    Approximately 100 years ago, American chestnut (Castanea dentata (Marsh.) Borkh.) was rapidly removed as an overstory tree by the fungal pathogen Cryphonectria parasitica (the causal agent of chestnut blight). Currently, the most effective method of restoration involves the hybridization of American chestnut with the...

  17. A Book Review of Arts-Based and Contemplative Practices in Research and Teaching: Honoring Presence Edited by Susan Walsh, Barbara Bickel, and Carl Leggo, Published by Routledge, 2015

    Directory of Open Access Journals (Sweden)

    John J Guiney Yallop

    2016-07-01

    Full Text Available This book review of Arts-Based and Contemplative Practices in Research and Teaching: Honoring Presence is both a review of the work as well as a contemplation on the work. The reader is invited into the book through witnessing the impact reading the book had on this reviewer. Attention is given to each author’s contributions to the publication, noting how each chapter and each Lectio Divina (opportunities for contemplation between chapters calls us to pay attention.

  18. The Practice of Nursing Research: Appraisal, Synthesis, and Generation of Evidence - Seventh edition Grove Susan K The Practice of Nursing Research: Appraisal, Synthesis, and Generation of Evidence - Seventh edition 752pp Elsevier 9781455707362 1455707368 [Formula: see text].

    Science.gov (United States)

    2013-04-03

    This classic research text has been updated for nursing students and those in nursing practice. Though a substantial book, it is easy to dip in and out of, covering a wide range of topics from the research process and analysing data to sampling and seeking funding.

  19. Dicty_cDB: FC-IC0191 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 06 ) RecName: Full=Intron-binding protein aquarius; AltName:... 75 9e-13 BC108262_1( BC108262 |pid:none) Homo sapiens aquarius... homolog (mou... 75 9e-13 BC036913_1( BC036913 |pid:none) Homo sapiens aquarius homolog (m...ou... 75 9e-13 BC042479_1( BC042479 |pid:none) Mus musculus aquarius, mRNA (cDNA

  20. Iron-Deficiency Anemia

    Medline Plus

    Full Text Available ... coped with having iron-deficiency anemia. Prior to her diagnosis, Susan had symptoms such as tiredness, poor skin tone, dizziness, and depression. After her doctor diagnosed her with iron-deficiency anemia, Susan ...

  1. Program Development and Evaluation - Finance / Money Management

    OpenAIRE

    2004-01-01

    Karen Biers: Ca$hing in on Business Opportunities: A Curriculum for Building an Effective Home-Based and Micro Business Educational Program. Susan E. Cosgrove: Statewide Personal Financial Literacy Campaign. Susan Shockey: Financial Education Helps IDA Participants Save Money.

  2. 2011 Women in Defense (WID) National Fall Conference

    Science.gov (United States)

    2011-10-19

    PANEL: “RECENT DEVELOPMENTS IN ACQUISITION: NEW LAWS, REGULATIONS AND DIRECTIVES” Moderator: Ms. Susan Ebner , Counsel, Buchanan Ingersoll...ACQUISITION: NEW LAWS, REGULATIONS AND DIRECTIVES” Moderator: u Ms. Susan Ebner , Counsel, Buchanan Ingersoll & Rooney PC Panelists: u Ms. Jennifer Schaus...Commendation Medal, Navy Achievement Medal with gold star and various unit citations, campaign medals and service medals. MS. SUSAN EBNER Counsel

  3. Dicty_cDB: Contig-U11064-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( O60306 ) RecName: Full=Intron-binding protein aquarius; AltName:... 69 7e-10 BC108262_1( BC108262 |pid:none) Homo sapiens aquarius... homolog (mou... 69 7e-10 BC036913_1( BC036913 |pid:none) Homo sapiens aquarius... homolog (mou... 69 7e-10 BC042479_1( BC042479 |pid:none) Mus musculus aquarius, mRNA ...69 7e-10 (Q8CFQ3) RecName: Full=Intron-binding protein aquarius; &AK1455... 69 7e-10 T00333( T00333 )hypothe...ccus lucimarinus CCE9901 ... 69 7e-10 BC140525_1( BC140525 |pid:none) Bos taurus aquarius homolog (mouse...

  4. Dicty_cDB: Contig-U03328-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e-12 ( O60306 ) RecName: Full=Intron-binding protein aquarius; AltName:... 73 4e-...12 BC108262_1( BC108262 |pid:none) Homo sapiens aquarius homolog (mou... 73 4e-12 BC036913_1( BC036913 |pid:none) Homo sapiens aquari...us homolog (mou... 73 4e-12 BC042479_1( BC042479 |pid:none) Mus musculus aquarius, ...) RecName: Full=Intron-binding protein aquarius; &AK1455... 73 4e-12 T00333( T00333 )hypothetical protein KI...AA0560 - human 73 4e-12 BC140525_1( BC140525 |pid:none) Bos taurus aquarius homolog (mouse... 73 4e-12 BC133

  5. Dicty_cDB: Contig-U01980-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3519_1( EF553519 |pid:none) Homo sapiens clone DKFZp686B23123 ... 84 3e-15 ( O60306 ) RecName: Full=Intron-binding protein aquarius...; AltName:... 84 3e-15 BC108262_1( BC108262 |pid:none) Homo sapiens aquarius... homolog (mou... 84 3e-15 BC036913_1( BC036913 |pid:none) Homo sapiens aquarius homolog (m...hypothetical protein KIAA0560 - human 84 3e-15 BC042479_1( BC042479 |pid:none) Mus musculus aquarius, mRNA (...cName: Full=Intron-binding protein aquarius; &AK1455... 83 9e-15 BC140525_1( BC140525 |pid:none) Bos taurus aquarius

  6. A ESCOLA COMO ESPAÇO DE INTERDISCIPLINARIDADE E REFLEXÃO – UM ESTUDO SOBRE A PRIMEIRA EDIÇÃO DO FÓRUM DE HUMANIDADES PROMOVIDO PELO COLÉGIO UNIVAP - UNIDADE AQUARIUS, SJC-SP

    Directory of Open Access Journals (Sweden)

    Thifani de Carvalho

    2017-01-01

    Full Text Available Este trabalho consiste em apresentar os resultados acerca das experiências educacionais, no que tange a interdisciplinaridade, na área de ciências humanas e suas tecnologias a partir da temática proposta pela UNESCO (Organização das Nações Unidas para a Educação, Ciência e Cultura, de acordo com a proposta “2016 Ano Internacional do Entendimento Global”. Ante a necessidade de refletir e debater os principais problemas globais que afetam o desenvolvimento da sociedade como um todo, o fórum propôs a todos uma reflexão em torno dos seguintes problemas: crise dos refugiados, problemas ambientais, relações sociais e a globalização. A metodologia adotada teve base em pesquisas de artigos acadêmicos, livros didáticos e sites de organizações governamentais idôneas que foram indispensáveis na construção deste artigo. Considera-se relevante abordar temas globais na formação dos alunos do ensino médio, preparando-os para uma postura firme ao abordar estas temáticas, assim como tantas outras.

  7. PODAAC-AQR40-3Q7CS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 4.0 Aquarius-CAP Level 3 product contains the third release of the gridded/mapped 7day running mean SSS rain corrected data from AQUARIUS/SAC-D for the...

  8. A Practitioner's Commentary

    Science.gov (United States)

    McVey, Richard

    2010-01-01

    I have been delivering the flexible family work approaches outlined in this supplement at Aquarius for the past 8 years. Aquarius is an English Midlands-based addictions charity working with people who have problems with alcohol, drugs, or gambling and supporting their family members/concerned others. I have been a practitioner participating in…

  9. EST Table: FY745537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY745537 E_FL_famL_27E06_F_0 11/11/04 78 %/254 aa ref|XP_001600886.1| PREDICTED: similar to aquarius...milar to Intron-binding protein aquarius (Intron-binding protein of 160 kDa) (IBP160) [Tribolium castaneum] FY745710 famL ...

  10. Contribución al conocimiento de los heteróptros (Insecta de ríos de Navarra

    Directory of Open Access Journals (Sweden)

    OSCOZ, J., ESCALA, M.C., LEUNDA, P.M., MIRANDA, R.

    2003-01-01

    Full Text Available Se pesentan los resultados de las capturas de heterópteros (Gerromorpha y Nepomorpha en cinco ríos de Navarra. Se han identificado un total de 91 heterópteros pertenecientes a cuatro especies (Aquarius najas, Aquarius paludum, Hydrometra stagnorum y Nepa cinerea. Cabe destacar la captura de A. paludum, primera cita de esta especie en Navarra

  11. Piscis Austrinus

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    (sometimes called Piscis Australis; the Southern Fish; abbrev. PsA, gen. Piscis Austrini; area 245 sq. deg.) A southern constellation which lies between Aquarius and Grus, and culminates at midnight in late August. Its origin dates back to Babylonian times, and it is usually shown on early celestial charts unnaturally drinking water from an urn carried by Aquarius. Its brightest stars were catalo...

  12. Reply to “Comment on ‘Ground motions from the 2015 Mw 7.8 Gorkha, Nepal, earthquake constrained by a detailed assessment of macroseismic data’ by Stacey S. Martin, Susan E. Hough, and Charleen Hung” by Andrea Tertulliani, Laura Graziani, Corrado Castellano, Alessandra Maramai, and Antonio Rossi

    Science.gov (United States)

    Martin, Stacey S.; Hough, Susan E.

    2016-01-01

    We thank Andrea Tertulliani and his colleagues for their interest in our article on the 2015 Gorkha earthquake (Martin, Hough, et al., 2015), and for their comments pertaining to our study (Tertulliani et al., 2016). Indeed, as they note, a comprehensive assessment of macroseismic effects for an earthquake with far‐reaching effects as that of Gorkha is not only critically important but is also an extremely difficult undertaking. In the absence of a widely known web‐based system, employing a well‐calibrated algorithm with which to collect and systematically assess macroseismic information (e.g., Wald et al., 1999; Coppola et al., 2010; Bossu et al., 2015) in the Indian subcontinent, one is left with two approaches to characterize effects of an event such as the Gorkha earthquake: a comprehensive ground‐based survey such as the one undertaken in India following the 2001 Bhuj earthquake (Pande and Kayal, 2003), or an assessment such as Martin, Hough, et al. (2015) akin to other contemporary studies (e.g., Nuttli, 1973; Sieh, 1978; Meltzner and Wald, 1998; Martin and Szeliga, 2010; Ambraseys and Bilham, 2012; Mahajan et al., 2012; Gupta et al., 2013; Singh et al., 2013; Hough and Martin, 2015; Martin and Hough, 2015; Martin, Bradley, et al., 2015; Ribeiro et al., 2015), based primarily upon media reports and other available documentary accounts.

  13. Human Resource Management, 11th Edition International Student Version. By David A. DeCenzo, Stephen P. Robbins and Susan L. Verhulst, Wiley, 2013; 448 Pages. Price £54.99 / €66.00, ISBN 978-1-1183-7971-4

    Directory of Open Access Journals (Sweden)

    Shu-Kun Lin

    2013-02-01

    Full Text Available The 11th Edition of Human Resource Management helps students understand and remember concepts through a straightforward and conversational writing style and a wealth of examples to clarify ideas and build interest. The authors provide a strong foundation of essential elements of Human Resource Management (HRM as well as a clear understanding of how Human Resource Management links with business strategy. Through practical applications, the authors illustrate the importance of employees on every level of the organization, helping students understand HRM elements such as recruitment, training, motivation, retention, safety, the legal environment, and how they support successful business strategies.

  14. Staffing an Academic Reference Desk with Librarians is not Cost-effective. A Review of: Ryan, Susan M. “Reference Transactions Analysis: The Cost-effectiveness of Staffing a Traditional Academic Reference Desk.” Journal of Academic Librarianship 34.5 (2008: 389-99.

    Directory of Open Access Journals (Sweden)

    Cari Merkley

    2009-06-01

    Full Text Available Objective – To determine whether it is cost effective to staff an academic reference desk with librarians through an examination of the types of reference questions being asked and the qualifications required to answer them.Design – Content analysis of reference transaction logs and activity-based costing for reference services based on quantitative data derived from the logs.Setting – Stetson University, a private institution in the United States with an FTE of approximately 2500.Subjects – 6959 phone, email, and in-person reference transactions logged at the reference desk by four full-time and two part-time librarians.Methods – This study repurposes data originally collected to determine the frequency with which librarians turned to online versus print sources when responding to questions at the reference desk. Librarians working at the Stetson University library reference desk recorded all reference queries received in person, by phone, or by email for a total of eight months between 2002 and 2006. Data collection took place in two month intervals in fall 2002, spring 2003, spring 2006, and fall 2006. Each question and the sources used to address it were logged by the librarian. Directional questions that were not related to the library’s collections and technical questions dealing with printer or copier mechanical problems were counted, but the specifics of these questions were not recorded. It was felt that these queries would not yield data relevant to the original research question on sources used as they “did not directly relate to an information need” (391. A total of 6959 questions were logged by librarians during the four collection periods. Questions were recorded for only 4431 transactions; the remaining 2528 queries related to printer/copier problems or non-library specific directions and were described as “direction and machine: non- informational” (394. The 4431 recorded questions were then divided into four categories derived by the researcher: look-up (a search for a known item, directional (library-specific orientation to the space and collections, technology (assistance with using library technology and electronic resources, and reference. The category of reference was further subdivided into eight additional categories: catalogue search, citation help, database help, “guide to correct databases,” “personal knowledge or referral,” “quick internet search,” research, and Serials Solutions (392. “Guide to correct databases” referred to advice on the appropriate database to answer a question and serials solutions included questions that could be answered using the Serials Solutions product, such as the availability of a particular journal or article in the collection (392. Questions were assigned to the single most appropriate category by the researcher. Question categories were then mapped to “suggested staffing levels” (396. This determination was made by the researcher, and no details were given as to how the decision was made for each category. The three levels of staffing discussed were librarian, “trained student or staff,” and “well-trained staff/occasional librarian referral” (396. The cost of staffing the reference desk during the eight months captured in this study was calculated by multiplying the hours worked by each librarian by his/her individual average rate of pay across the four data collection periods. Indirect staff costs such as benefits were not included in this calculation. The average cost per reference transaction was determined by dividing the total salary costs by the total number of reference queries during the periods of study. Costs for those categories of questions best addressed by a librarian could then be determined. The actual number of librarians who participated in the study is unclear. The methodology refers to four full-time and two part-time librarians (391. However, later in the article there is reference to five full-time and three part-time librarians rather than the numbers initially stated (396. This may reflect staffing changes during the study period, with the first set of numbers referring to positions rather than individuals, but this cannot be verified with the evidence presented in the article.Main Results – It was determined that most questions asked at the reference desk during the study period could have been addressed by trained student and staff member rather than librarians. Only 11% (784 of questions logged were deemed sufficiently complex by the researcher to require the attention of a librarian. The remaining 6175 transactions (89% of all those logged could most likely be handled by a different staffing complement. According to Ryan, approximately 74% of the reference transactions, including directional, technology, “quick internet,” and known item searching questions could have been answered by “trained student and staff” (396. Questions on catalogue searching, databases, citations, Serial Solutions, and personal knowledge/referrals, representing approximately 15% of all questions, could have been handled by experienced and knowledgeable staff with limited librarian intervention. The complexity of the question was in part judged by the number of sources required to answer it, with most (75% answerable with just one source. The total cost of staffing the reference desk with librarians for the eight months studied was approximately US$49,328.00. A total of 6959 questions were logged during this period, resulting in an average cost of US$7.09 per reference transaction. This cost is approximate, as the exact time spent on each question was not recorded. The cost of answering “non-informational” directional and technical questions was the most significant (396. This category represented 36.3% of all questions received at the reference desk, with a total staffing cost of $17, 919.41 ($7.09 x 2528. “Information-orientated” directional and technology questions followed at 15.4% (US$7,620 and 12.4% (US$6,110.18 respectively (396. According to Ryan, questions in all three categories could be addressed by students and staff. The cost of addressing research questions, the only category requiring librarians, was US$5557.29. Research transactions were greatly outnumbered by directional and technology related questions. An average of 3.6 research questions were asked at the reference desk during the 12 hours it was open each day, compared to 20.8 directional/technical questions.Conclusion – The nature of questions logged at the Stetson University library reference desk suggests that it is inefficient to staff the desk with librarians, given the salary costs of such a staffing model and the fact that librarian’s skills may not be required to answer most of the questions posed. Since the number of questions that need a librarian is so low, Ryan suggests that alternative staffing and service models be considered, so the energies of librarians could be more effectively employed elsewhere in the organization in areas such as information literacy instruction and the development of enhanced web services. It is noted that any reorganization of reference services should be done in concert with user surveys, consultation with staff, and extensive training to prepare staff for new roles. Suggested areas for further research identified by the researcher include the quality of reference transactions in an increasingly online environment.

  15. Online Programs and Geographic Proximity are Key Determinants of Information Professionals’ Interest in Pursuing Post-Master’s Education at the Doctoral Level. A Review of: Powell, Ronald R. and Susan E. Boling. “Post-Master’s Educational Needs of Information Professionals.” Journal of Access Services 3.4 (2005: 29-43.

    Directory of Open Access Journals (Sweden)

    Martha Ingrid Preddie

    2009-03-01

    Full Text Available Objective – To investigate post-master’s educational needs and interests of information professionals.Design – Survey research using print and electronic questionnaires.Setting – The geographic area surrounding Wayne State University in Michigan, United States of America.Subjects – Members of the library associations of Michigan, Ohio, Indiana, and Southwestern Ontario, Canada.Methods – Systematic random samples were derived from the membership lists of the library associations in Ohio, Indiana, and Southwestern Ontario. Paper questionnaires were mailed to those selected. Michigan Library Association’s official policy barred the release of its membership list to researchers. Consequently, announcements of the survey were placed in three successive issues of the Association’s electronic newsletter. Interested members were directed to a website to complete an electronic version of the questionnaire. This option was also extended to members of the other three library associations. The overall research question was investigated through specific questions that sought to ascertain the overall level of interest in professional library and information studies (LIS education, levels of interest in specific types of programs, factors that favoured or deterred enrolment in doctoral programs, as well as the fields of study that were preferred for combination with LIS in doctoral programs. With the exception of demographic type questions (e.g., place of residence and educational qualifications and two questions that required open ended responses, the questionnaire design encompassed questions with Likert scale type responses. Analysis of the responses included descriptive statistics, the use of Pearson chi square to determine statistically significant relationships, and, to a lesser extent, content analysis.Main Results – A total of 270 questionnaires(33% were returned from three populations: Ohio, Indiana, and Ontario. A self-selected sample of 101 members (6% of the Michigan Library Association responded. In general, almost 80% of the respondents admitted some importance to adding to their LIS qualification. However, only 41% felt that this was important or extremely important. From a choice of six educational offerings, namely, continuing education activities, non-degree master’s coursework, a second master’s degree, post-master’s certification, doctoral programs, and other, continuing education activities was the most valued, by 65.5% of the respondents. Participants were asked about their reasons, and the importance of these, for considering or deciding to enrol in an LIS doctoral program. The yearning to acquire knowledge was reported by 69.7% as the major reason, followed by 45.8% of the respondents who cited the wish to increase their income potential. In terms of major factors, prestige received the lowest rating, 21.1%. The time involved (73.8%, cost(66.3%, and distance from the program (63.2% were cited as the major deterrents to enrolling in doctoral programs. When asked about the likelihood of pursuing a doctoral LIS program in combination with business administration, computer science, or without any combination, “not likely” was the most popular choice. Those who were very likely or likely to pursue a joint program totalled approximately 30% of the respondents, while 37% indicated an interest in undertaking a doctorate in LIS only. The most frequent reasons proffered by those who selected “not likely” or “definitely not” for any of the three doctoral offerings included lack of interest, mitigating factors (e.g. time, cost, age, and program location, unfavourable cost/benefit analysis, preference for another area of knowledge,and the view that Ph.D.s were only useful for university faculty. Given the option to name subject areas that they desired to see combined with LIS in a doctoral program, 23 of 101 respondents proposed education, while 19 opted for public administration. A question inviting any other comments on the issue of post-master’s education yielded a predominant desire for “non traditional instruction,” particularly online courses as well as classes held in convenient locations. In terms of relationships between geographic location and factors that influenced interest in enrolling in a doctoral program, the desire “to become a more effective manager,” and “other” were statistically significant. The analysis also revealed a strong positive relationship between willingness to pursue an LIS-only doctoral program and the availability of such a program in geographic proximity. Similarly, there was a strong relationship between willingness to pursue an LIS program in close vicinity and the importance that was given to further LIS education.Conclusion – Online instruction and geographic proximity are key determinants of information professionals’ interest in pursuing post-master’s education at the doctoral level. Continuing education activities, non-degree coursework, and certificate programs are preferred over doctoral LIS programs, despite the finding that the major reason for enrolling in doctoral LIS programs is to fulfill the desire for knowledge acquisition. Schools offering Library and Information Science studies need to explore options for providing distance-education doctoral LIS programs as a means of reversing the current shortage of LIS faculty.

  16. Dicty_cDB: Contig-U11115-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 06 ) RecName: Full=Intron-binding protein aquarius; AltName:... 44 0.051 BC163556_1( BC163556 |pid:none) Dan...2479 |pid:none) Mus musculus aquarius, mRNA (cDNA ... 44 0.051 DQ900937_1( DQ900937 |pid:none) Ciona intesti...omolog; ... 44 0.051 (Q8CFQ3) RecName: Full=Intron-binding protein aquarius; &AK1455... 44 0.051 T00333( T00...rom clone ... 44 0.051 BC140525_1( BC140525 |pid:none) Bos taurus aquarius homolo..._1457( AE014296 |pid:none) Drosophila melanogaster chromos... 44 0.051 BC133727_1( BC133727 |pid:none) Rattus norvegicus aquarius

  17. AcEST: BP921437 [AcEST

    Lifescience Database Archive (English)

    Full Text Available t sp_hit_id O60306 Definition sp|O60306|AQR_HUMAN Intron-binding protein aquarius...icant alignments: (bits) Value sp|O60306|AQR_HUMAN Intron-binding protein aquarius... OS=Homo sapi... 134 1e-36 sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus muscu... 134 1e-36 sp...8.6 >sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 Length = 1485 Scor...TVRP 569 >sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=2 SV=2 Length = 1481

  18. AcEST: BP915582 [AcEST

    Lifescience Database Archive (English)

    Full Text Available d Q8CFQ3 Definition sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus Align length 63 Scor...nments: (bits) Value sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus muscu... 102 3e-31 sp|O60306...|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapi... 102 4e-31 sp|Q8R054|SRPX2_MOUSE Sushi repeat-cont...QR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=2 SV=2 Length ...QQDMTNTIQNG 645 >sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 Length

  19. Dicty_cDB: Contig-U11500-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne) Homo sapiens clone DKFZp686B23123 ... 43 0.019 ( O60306 ) RecName: Full=Intron-binding protein aquarius;... AltName:... 43 0.019 BC108262_1( BC108262 |pid:none) Homo sapiens aquarius homolog (mou... 43 0.019 BC03691...3_1( BC036913 |pid:none) Homo sapiens aquarius homolog (mou... 43 0.019 CP000117_...se with zinc finger domain... 43 0.019 BC042479_1( BC042479 |pid:none) Mus musculus aquarius, mRNA (cDNA ......|pid:none) Homo sapiens mRNA for KIAA0560 pro... 43 0.019 (Q8CFQ3) RecName: Full=Intron-binding protein aquarius

  20. AcEST: BP915703 [AcEST

    Lifescience Database Archive (English)

    Full Text Available s-Prot sp_hit_id Q8CFQ3 Definition sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus Align...significant alignments: (bits) Value sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus muscu... 234... 3e-61 sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapi... 234 3e-61 sp|O94508|CWF11_SCHPO C... OS=Mesocricetu... 47 7e-05 >sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius ...RARLGLYIFARVSLFQNCFELTPAFSQLTARPLHLHIIPTE-PFPTSRK 1347 >sp|O60306|AQR_HUMAN Intron-binding protein aquarius

  1. AcEST: BP918091 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ult : Swiss-Prot sp_hit_id O60306 Definition sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sap...producing significant alignments: (bits) Value sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo s...api... 102 6e-31 sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus muscu... 102 6e-31 sp|O94508|CWF...p|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV... WL DIILGYGDP +A Sbjct: 670 LETIRNLMNTDCVVPDWLHDIILGYGDPSSA 700 >sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius

  2. Fathom Magazine, v. 8, no. 2, Summer 1996 22pp :Florida sharks

    OpenAIRE

    Humphreys, Jay; Sokol, Kelly Marie; Grantham, Susan; Hueter,Robert

    1996-01-01

    CONTENTS. Protecting the Predators, by Jay Humphrey. Economics Create Responsible Shark Management, by Jay Humphreys. The Healing Power of Sharks, by Kelly Marie Sokol. Shark! by Jay Humphreys. Florida's Sharks. Entering the Sharks' Environment, by Susan Grantham. Regulations Affect the Commercial Shark Fishing Industry, by Susan Grantham. Fishing for Information, by Susan Grantham. Tagging, not Bagging, by Robert Hueter, Mote Marine Laboratory. Shark Sites of In...

  3. A User’s Guide to BISAM (BIvariate SAMple): The Bivariate Data Modeling Program.

    Science.gov (United States)

    1983-08-01

    SU1Sam 842 EN*NE*OSSS :2. C 5 .... !0N SSU A S2S. SZ LUEN............S..A a&:. 55m CUNSSU A C2. 5 LUSENGUT.USYNSUSI SUSAN C21 THE 1S*VANNS*IT SUSAN4...SUSAN 142sS REAL YUNU.Y UA 2427 VUUUSUA 2429. 15. SUSAN 2S2 as TO 20SSA 2422. SD UUP SAN 2425 LP * .WIP I SSA 384 25 UIUU-P.TS sD TD

  4. The Handbook for Student Leadership Development. 2nd Edition

    Science.gov (United States)

    Komives, Susan R.; Dugan, John P.; Owen, Julie E.; Slack, Craig; Wagner, Wendy

    2011-01-01

    This is a must-have book for leadership educators and all student affairs professionals who want to develop impactful leadership programs and the leadership capacity of students. This book contains: (1) Advancing Leadership Education (Susan R. Komives); (2) Leadership Theories (John P. Dugan and Susan R. Komives); (3) Research on College Student…

  5. Coping with a Breast Cancer Diagnosis

    Science.gov (United States)

    ... regarding the accuracy, completeness, timeliness, quality or non-infringement of any of the materials, products or information provided by the organizations referenced herein. The Running Ribbon is a registered trademark of Susan G. Komen ® . ©2014 Susan G. Komen ® ...

  6. Breast Cancer in Men

    Science.gov (United States)

    ... regarding the accuracy, completeness, timeliness, quality or non-infringement of any of the materials, products or information provided by the organizations referenced herein. The Running Ribbon is a registered trademark of Susan G. Komen. © 2016 Susan G. Komen ® ...

  7. Breast Reconstruction and Prosthesis

    Science.gov (United States)

    ... regarding the accuracy, completeness, timeliness, quality or non-infringement of any of the materials, products or information provided by the organizations referenced herein. The Running Ribbon is a registered trademark of Susan G. Komen. © 2016 Susan G. Komen ® ...

  8. SAMJFoRUM

    African Journals Online (AJOL)

    By Susan Lightman and Hamish Tawler. Fundamentals ofClinical. Ophthalmology. Series Editor: Susan Lightman. Pp. ix + 163. Illustrated. £42. BM]. 1998. ISBN 0-7279-1201-X. The recognition of the different patterns of uveitis is dependent primarily upon basic clinical skills, relying on the acquisition of a careful ophthalmic ...

  9. The Development of the C3 Framework

    Science.gov (United States)

    Social Education, 2013

    2013-01-01

    Susan Griffin, executive director of NCSS, was chair of the Task Force of Professional Organizations that initiated and guided the development of "The College, Career, and Civic Life (C3) Framework for Social Studies State Standards", which will soon be released. In this interview with "Social Education", Susan explains how the…

  10. Schedule Risk Event Driven Methodology (SREDM): FY13 Army Studies Program Project Findings

    Science.gov (United States)

    2015-01-01

    TRADOC Analysis Center ATRC-PR/ Susan Matus 255 Sedgwick Avenue Fort Leavenworth, KS 66027-2345 susan.g.matus.civ@mail.mil US...Army TRAC- White Sands Missile Range ATRC-W/Dr. Lambert Bldg 1400 Martin Luther King Drive White Sands Missile Range, NM 88002-5502

  11. Army Independent Risk Assessment Guidebook

    Science.gov (United States)

    2014-04-01

    Rd. Aberdeen Proving Ground, MD 21005-5071 US Army TRADOC Analysis Center ATRC-PR/ Susan Matus 255 Sedgwick Avenue Fort Leavenworth, KS...66027-2345 susan.g.matus.civ@mail.mil US Army TRAC- White Sands Missile Range ATRC-W/Dr. Lambert Bldg 1400 Martin Luther King Drive White

  12. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. SEBA SUSAN. Articles written in Sadhana. Volume 41 Issue 12 December 2016 pp 1393-1406. Image coding based on maximum entropy partitioning for identifying improbable intensities related to facial expressions · SEBA SUSAN NANDINI AGGARWAL SHEFALI CHAND AYUSH GUPTA.

  13. Mitigating Information Overload: The Impact of "Context-Based Approach" to the Design of Tools for Intelligence Analysts

    Science.gov (United States)

    2008-03-01

    Reference Meetings Allen G. Schick, Lawrence A. Gordon, and Susan Haka , “Information overload: A temporal approach,” Accounting Organizations and...conversations Allen G. Schick, Lawrence A. Gordon, and Susan Haka , “Information overload: A temporal approach,” Accounting Organizations and

  14. An Analysis of the Purpose and Development of Management Reserve.

    Science.gov (United States)

    1995-09-01

    first article reviewed was "Participative Budgeting and Managerial Performance" by Peter Chalos and Susan Haka . Their study examined two hypotheses...Susan Haka . "Participative Budgeting and Managerial Performance," Decision Sciences, Vol. 20: 334-347. 3. Department of Defense. Cost/Schedule

  15. Big Data for Education: Data Mining, Data Analytics, and Web Dashboards. Governance Studies at Brookings

    Science.gov (United States)

    West, Darrell M.

    2012-01-01

    Twelve-year-old Susan took a course designed to improve her reading skills. She read short stories and the teacher would give her and her fellow students a written test every other week measuring vocabulary and reading comprehension. A few days later, Susan's instructor graded the paper and returned her exam. The test showed that she did well on…

  16. Iron-Deficiency Anemia

    Medline Plus

    Full Text Available ... shows how Susan, a full-time worker and student, has coped with having iron-deficiency anemia. Prior to her diagnosis, Susan had symptoms such as tiredness, poor skin tone, dizziness, and depression. After her doctor diagnosed her with iron-deficiency ...

  17. Vitamin D, Vitamin D Receptor Polymorphisms and Breast Cancer Aggressiveness in African American and European American Women

    Science.gov (United States)

    2011-05-01

    Ruszczyk, Gregory Ciupak, Warren Davis, Helena Hwang, Susan McCann, Elisa Bandera , Christine Ambrosone Common single nucleotide polymorphisms (SNPs) in...Sucheston, Jyoti Shankar, Michelle Roberts, Melanie Ruszczyk, Gregory Ciupak, Warren Davis, Helena Hwang, Susan McCann, Elisa Bandera , Christine Ambrosone

  18. Fed up: winning the war against childhood obesity

    National Research Council Canada - National Science Library

    Okie, Susan

    2005-01-01

    .... Library of Congress Cataloging-in-Publication Data Okie, Susan. Fed up! : winning the war against childhood obesity / Susan Okie. p. ; cm. Includes bibliographical references and index. ISBN 0-309-09310-4 (hardcover) 1. Obesity in children- United States. 2. Obesity in children- United States- Prevention. [DNLM: 1. Obesity- epidemiology- United ...

  19. The Collocation Policy: A Useful Personnel Assignment Policy for Those Who Don’t Understand Counterinsurgencies

    Science.gov (United States)

    2009-02-20

    the Navy, SECNAVINST 1300.12C, December 28, 2005), 4.  12 Susan Dominus. “The War’s Deadliest Day for Women,” Glamour , May 1, 2006. http...January 4, 2009). Dominus, Susan. “The War’s Deadliest Day for Women,” Glamour , May 1, 2006. http://www.leatherneck.com/forums/ showthread.php?t

  20. Representing Evil

    DEFF Research Database (Denmark)

    Holm, Henrik

    2008-01-01

    Analyse af billedmateriale, der forholder sig til krig, især krigen mod terror, med afsæt i Alain Badiou, Jürgen Habermas og Susan Sontag.......Analyse af billedmateriale, der forholder sig til krig, især krigen mod terror, med afsæt i Alain Badiou, Jürgen Habermas og Susan Sontag....

  1. PODAAC-AQR50-3P7CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  2. PODAAC-AQR50-3SMAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  3. PODAAC-AQR40-4U7CS

    Data.gov (United States)

    National Aeronautics and Space Administration — The IPRC/SOEST Aquarius OI-SSS v4 product is a level 4, near-global, 0.5 degree spatial resolution, 7-day, optimally interpolated salinity dataset based on version...

  4. PODAAC-AQR50-3Y3AS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  5. PODAAC-AQR50-3DUDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution density data averaged over daily, 7 day, monthly, and...

  6. PODAAC-AQR50-3WQCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  7. PODAAC-AQR50-2JOCS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 5.0 Aquarius Level 2 quicklook product includes the instrumental wiggle correction and exponential drift correction and is part of the official end of...

  8. PODAAC-AQR50-3PMDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  9. PODAAC-AQR50-3PAAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  10. PODAAC-AQR50-3YCCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  11. PODAAC-AQR50-3Y1CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  12. PODAAC-AQR50-3P7AS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  13. PODAAC-AQR50-3SUCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  14. PODAAC-AQR50-3D7CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution derived density averaged over daily, 7 day, monthly, and...

  15. PODAAC-AQR50-3DACS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and seasonal...

  16. PODAAC-AQR50-3PCDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  17. PODAAC-AQR50-3P3AS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  18. PODAAC-AQR50-3SRDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  19. PODAAC-AQR50-3SACS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  20. PODAAC-AQR50-3YADS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  1. PODAAC-AQR50-3S3DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  2. PODAAC-AQR50-3DMCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution derived density averaged over daily, 7 day, monthly, and...

  3. PODAAC-AQR50-3PRAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day,...

  4. PODAAC-AQR50-3PRDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  5. PODAAC-AQR50-3DCDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution density data averaged over daily, 7 day, monthly, and...

  6. PODAAC-AQR50-3W1CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  7. PODAAC-AQR50-3S1CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  8. PODAAC-AQR50-3SVCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  9. PODAAC-AQR50-3W1AS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  10. PODAAC-AQR50-3Y1AS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  11. PODAAC-AQR50-3PMAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  12. PODAAC-AQR50-3DMDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution density data averaged over daily, 7 day, monthly, and...

  13. PODAAC-AQR50-3YRCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  14. PODAAC-AQR50-3S7DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  15. PODAAC-AQR50-3W1DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  16. PODAAC-AQR50-3YMCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  17. PODAAC-AQR50-3DUAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution density data averaged over daily, 7 day, monthly, and...

  18. PODAAC-AQR50-3DRDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution density data averaged over daily, 7 day, monthly, and...

  19. PODAAC-AQR50-3S7CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  20. PODAAC-AQR50-3WUDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  1. PODAAC-AQR50-3W3AS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  2. PODAAC-AQR50-3YRDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  3. PODAAC-AQR50-3YCAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  4. PODAAC-AQR50-3YCDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  5. PODAAC-AQR50-3D1CS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution derived density averaged over daily, 7 day, monthly, and...

  6. PODAAC-AQR50-3WMCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  7. PODAAC-AQR50-3P7DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  8. PODAAC-AQR50-3WMDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  9. PODAAC-AQR50-3D7AS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution density data averaged over daily, 7 day, monthly, and...

  10. PODAAC-AQR50-3D3DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution density data averaged over daily, 7 day, monthly, and...

  11. PODAAC-AQR50-3WCDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  12. PODAAC-AQR50-3WRDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  13. PODAAC-AQR50-3D7DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution density data averaged over daily, 7 day, monthly, and...

  14. PODAAC-AQR50-3SUAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  15. PODAAC-AQR50-3D1DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution density data averaged over daily, 7 day, monthly, and...

  16. Dicty_cDB: Contig-U13365-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available apiens clone DKFZp686B23123 ... 36 0.37 ( O60306 ) RecName: Full=Intron-binding protein aquarius; AltName:.....6 0.37 (Q8CFQ3) RecName: Full=Intron-binding protein aquarius; &AK1455... 36 0.37 T00333( T00333 )hypothetic...al protein KIAA0560 - human 36 0.37 BC140525_1( BC140525 |pid:none) Bos taurus aquarius homolog (mouse... 36... 0.37 BC133727_1( BC133727 |pid:none) Rattus norvegicus aquarius homolog... 36 0....arius, mRNA (cDNA ... 36 0.37 CP001330_363( CP001330 |pid:none) Micromonas sp. RCC2

  17. PODAAC-AQR50-3YMAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  18. PODAAC-AQR50-3ZMAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  19. NASA Extreme Environments Mission Operations 10 - Evaluation of Robotic and Sensor Technologies for Surgery in Extreme Environments

    National Research Council Canada - National Science Library

    Broderick, Timothy J

    2006-01-01

    .... The mission, held in collaboration with NASA, was conducted from April 3 - 20, 2006. Dr. Broderick served as an aquanaut aboard the Aquarius habitat, which is submerged off the coast of Key Largo, FL...

  20. PODAAC-AQR50-3WRCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  1. PODAAC-AQR50-2IOCS

    Data.gov (United States)

    National Aeronautics and Space Administration — The version 5.0 Aquarius Level 2 product Cal product includes only the instrumental wiggle correction and is part of the official end of mission release of the...

  2. PODAAC-AQR50-3YVAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  3. PODAAC-AQR50-3SAAS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day, monthly, and...

  4. PODAAC-AQR50-3W3DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  5. PODAAC-AQR50-3DUCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution derived density averaged over daily, 7 day, monthly, and...

  6. PODAAC-AQR50-3YACS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface salinity (SSS) rain-flagged standard mapped image data contains gridded 1 degree spatial resolution SSS averaged over daily, 7 day,...

  7. PODAAC-AQR50-3P3DS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface spiciness standard mapped image data contains gridded 1 degree spatial resolution spice data averaged over daily, 7 day, monthly, and...

  8. PODAAC-AQR50-3DQCS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 sea surface density standard mapped image data contains gridded 1 degree spatial resolution derived density averaged over daily, 7 day, monthly, and...

  9. High Performance Miniature Bandpass Filters Project

    Data.gov (United States)

    National Aeronautics and Space Administration — This proposal is submitted for developing low impedance, miniature bandpass RF frequency filter via MEMS technique, in applications of SMAP, Aquarius follow-on,...

  10. PODAAC-AQR50-3WVDS

    Data.gov (United States)

    National Aeronautics and Space Administration — Aquarius Level 3 ocean surface wind speed standard mapped image data contains gridded 1 degree spatial resolution wind speed data averaged over daily, 7 day,...

  11. Sea Surface Salinity : Research Challenges and Opportunities

    Science.gov (United States)

    Halpern, David; Lagerloef, Gary; Font, Jordi

    2012-01-01

    Sea surface salinity (SSS) can be important in regulating sea surface temperature (SST). Two technological breakthrough satellite SSS missions, Aquarius and Soil Moisture and Ocean Salinity (SMOS), are currently producing high-quality SSS data. This paper provides an overview of the importance of SSS for weather and climate applications and describes the Aquarius and SMOS missions. The newness of adequately sampled SSS data prompted a first-time at-sea field campaign devoted to improved understanding of SSS variations.

  12. A 9-Year-Old Girl Discovers That Her Mother Was Murdered.

    Science.gov (United States)

    Schonfeld, David J; Shekunov, Julia; Jellinek, Michael; Stein, Martin T

    Susan was a 9-year-old girl living with her mother; she had never met her father. Her mother returned one evening from her job as a cocktail waitress and Susan met her at the apartment door to let her know they had run out of cat food. Her mother said she would go and buy some the next morning because it was late and she was tired, but Susan insisted she go out that evening because the cat had not eaten all day. Her mother was fatally shot in the parking lot of the convenience store shortly thereafter; since there was no robbery involved, the police suspected it was someone that she knew. Susan's extended family had her move out of the apartment that evening and relocate to live with her aunt and uncle out-of-state. The transition happened quickly. Susan was unable to return to her apartment to pick up any additional belongings and never returned to say goodbye to her friends. The family decided she was too young to attend the funeral.Susan had trouble fitting in with her aunt and uncle's family; they had 2 children who were 8 and 6 years old, and Susan felt she was being treated like a baby. She resented having a bedtime (her mother allowed her to stay up as late as she wished), and she complained that the work at school was boring and her classmates were childish. When the family went to a festival in town, she left abruptly without telling them, which frightened Susan's aunt and uncle. They wanted to be supportive but felt that she needed more structure than her mother had provided her. Susan's aunt and uncle sought bereavement support for Susan from her pediatrician and parenting advice for themselves.

  13. Ovarian Sertoli-Leydig Cell Tumor with Elevated Inhibin B As a Cause of Secondary Amenorrhea in Adolescents with Germline DICER1 Mutation

    Science.gov (United States)

    2017-04-06

    DEPARTMENT OF THE AIR FORCE 59TH MEDICAL W ING (AETC) JOINT BASE SAN ANTON IO - LACKLAND TEXAS MEMORANDUM FOR SGOBS A TIN: MAJ SUSAN WHITEW A Y...CLINICAL RESEARCH 2. FROM: (Author’s Name. Rank. Grade, Office Symbol) 3. GMEJGHSE STUDENT: 4. PROTOCOL NUMBER: Susan Whitcway, Maj , 0-4, SGOBS DYES 181...c. Snitchler, A ndrea 0-5/C DR DCSS U S Naval H ospital, Naples d. Whitcway, Susan L 0-4/ Maj 9 59MDOS/959MDG/ SGOBS 59MDW e. 17. IS A 502 ISG/JAC

  14. Inflow Measurements Made with a Laser Velocimeter on a Helicopter Model in Forward Flight. Volume 7. Rectangular Planform Blades at an Advance Ratio of 0.40

    Science.gov (United States)

    1989-04-01

    IIELICOIPTER MODEL IN FORWARD FLIGH-T Volume VII: RECTANGULAR PLANFORM BLAD)ES AT AN ADVANCI RAIO OF10.40(A( Danny R. -load, Susan L. Althoff , and Joe W...Organization Report No. Danny R. Hoad, Susan L. Althoff , Joe W. Elliott, and Richard H. Sailey 10. Work Unit No. 9. Performing Organization Name and Address...and 14 Sponsoring Agency Code US Army Aviation Systems Comnand St. Louis, INK) 63120-1798 15. Supplementary Notes Danny R. Hoad, Susan L. Althoff , and

  15. A guide to nursing students' written reflections for students and educators.

    Science.gov (United States)

    Naber, Jessica; Markley, Liz

    2017-07-01

    Experiences from the clinical setting are ideal for building critical thinking skills if reflection is used as a teaching tool. Reflective writing is the purposeful and recurring inspection of thoughts, feelings, and occurrences that coordinate with experiences during practice. Reflecting on clinical experiences develops critical thinking ability, fosters self-understanding, facilitates coping, and leads to improvement in clinical practice (Kennison, 2006). Reflective writing allows students to combine clinical experiences and takeaways with didactic material to better understand both practice and instruction. Reflective writing is defined as an assignment that is focused on students' experiences, like textbook readings, clinical experiences, or group activities, that highlights what the student has taken from the activity (McGuire et al., 2009). This study will explore reflective writing from the perspective of the nursing student and the nurse educator. The following questions will be answered: What are the benefits of reflective writing? Why would nurse educators want to use reflective writing in their nursing courses, both clinical and didactic? What are the barriers to using reflective writing for students and educators? What is the role of the nurse educator in student reflection? Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. 77 FR 31216 - Changes in Flood Elevation Determinations

    Science.gov (United States)

    2012-05-25

    ... Honorable Steve February 13, 2012 060017 1235). of Butte County (11- October 14, 2011; Lambert, Chairman... Docket No.: B- Unincorporated areas October 6, 2011; The Honorable Susan February 10, 2012 320003 1235...

  17. Ämbliku jäljed kivimüüril / Sigrid Saarep

    Index Scriptorium Estoniae

    Saarep, Sigrid, 1963-

    2009-01-01

    Suurbritannia paviljonis 53. Veneetsia kunstibiennaalil esinevad kunstnikud Steve McQueen, John Cale (Wales), Martin Boyce (Šotimaa) ja Susan MacWilliam (Põhja-Iirimaa). Videokunstnik Steve McQueeni filmist "Giardini" (2009)

  18. Iron-Deficiency Anemia

    Medline Plus

    Full Text Available ... red meats, nuts, dried fruits, and beans. Other lifestyle changes, such as getting enough sleep and exercising, ... By following her treatment plan and making smart lifestyle choices, Susan continues to feel better and see ...

  19. 75 FR 25830 - Agency Information Collection Activities: Proposed Collection; Comment Request, Supplemental...

    Science.gov (United States)

    2010-05-10

    ... Request, Supplemental Nutrition Assistance Program Regulations, Part 275--Quality Control AGENCY: Food and... collection for the Supplemental Nutrition Assistance Program's Regulations, Part 275--Quality Control... Susan Wilkinson, Program Analyst, Quality Control Branch, Program Accountability and Administration...

  20. Iron-Deficiency Anemia

    Medline Plus

    Full Text Available ... periods. By following her treatment plan and making smart lifestyle choices, Susan continues to feel better and see the benefits of treatment. For more information about living with ...

  1. Browse Title Index

    African Journals Online (AJOL)

    Global challenges and local opportunities, Abstract. Susan Malcolm-Smith, Michelle Hoogenhout, Natalia Ing, Kevin GF Thomas, Petrus de Vries. Vol 22, No 2 (2010), Commentary Challenges in international collaboration in ...

  2. 75 FR 28853 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

    Science.gov (United States)

    2010-05-24

    ... CHEN MICHAEL JEN-KWEI CHENG KENNY CHEONG JUNE CHENG CHIN WILLIAM KUO FENG CHOA JAMES MICHAEL CHU-YIP... WALTER CORINE CHRISTINE WANG SHUI MING WATERS MICHAEL WATERS SUSAN WEBB CANDACE CYNTHIA WEBER KLAUS...

  3. Resistance ja Rootsi turvaühiskond / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2001-01-01

    "Vastupanukunsti" näitus "The Path of Resistance : MoMa meets Moderna" Stockholmi Moodsa Kunsti Muuseumis, kuraatorid Susan Kismaric ja Joshua Siegel. Resistance'i kunsti raames käsitletakse ka nn. poliitilist kunsti

  4. With Home Testing, Consumers Take Charge of Their Health

    Science.gov (United States)

    ... Used in Previous Reviews Mark Hughes and Joseph Keane, Enterprise Analysis Corporation, Stamford, CT. Interviews: 7/3/ ... Emery J. Stephans, MS, Gerard Conti, MS, Michelle Keane, MBA, and Susan Farber, MBA. Does the Economic ...

  5. Õnnelikud kodud kahel pool eesriiet / Triin Ojari

    Index Scriptorium Estoniae

    Ojari, Triin, 1974-

    2004-01-01

    Elukeskkonna konverents "Võistlevad õnned. Elukeskkond külma sõja perioodil" Eesti Kunstiakadeemias. Esinevad David Crowley, Jeremy Morris, Susan E. Reidi, Adrian Forty, Kirsi Saarikangas. Kodumaistel teemadel kõnelevad Liina Jänes ja etnoloog Anu Kannike

  6. Foundations of health psychology

    National Research Council Canada - National Science Library

    Friedman, Howard S; Silver, Roxane Cohen

    2007-01-01

    ... and Effective Treatment 9 Adjustment to Chronic Disease: Progress and Promise in Research Annette L. Stanton and Tracey A. Revenson 203 10 Aging and Health 234 Karen S. Rook, Susan T. Charles, and...

  7. Journal of the Cameroon Academy of Sciences - Vol 11, No 1 (2013)

    African Journals Online (AJOL)

    ) Yields in Meme Division, South West Region of Cameroon · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Martin Keghe Nkobe, Susan Imbolo Mulua, Amougou Joseph Armathée, ...

  8. Layout ppp

    African Journals Online (AJOL)

    Nubidga

    ) Yields in. Meme Division, South West Region of Cameroon. Martin Keghe Nkobe1, Susan Imbolo Mulua2, Amougou Joseph Armathée3, Samuel Ndonwi. Ayonghe 2. 1 Institute of Agricultural Research for Development (IRAD), Barombi Kang ...

  9. 76 FR 41086 - Approval and Promulgation of Air Quality Implementation Plans; Ohio; Volatile Organic Compound...

    Science.gov (United States)

    2011-07-13

    ...) a new rule for the control of volatile organic compound (VOC) emissions from reinforced plastic..., Reporting and recordkeeping requirements, Volatile organic compounds. Dated: June 24, 2011. Susan Hedman... Organic Compound Reinforced Plastic Composites Production Operations Rule AGENCY: Environmental Protection...

  10. Resources and Information for Parents about Braille

    Science.gov (United States)

    ... Nemeth code. Often used in university programs. Exceptional Teaching Aids 3994 Oleander Way Castro Valley, CA 94546 Telephone: (800) 549-6999 E-Mail: ... Visual Impairments , edited by Susan LaVenture AFB Press American ...

  11. Nofretete muumia võib olla leitud / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2001-01-01

    Briti uurija Susan Jamesi väitel võib Nofretete olla 1898. a. prantsuse arheoloogi Victor Lloret' poolt Kuningate orust leitud naisemuumia, mis meenutab hämmastavalt palju skulptuuridena kujutatud vaarao Ehnatoni naist

  12. Practice question.

    Science.gov (United States)

    2010-06-01

    Chris Beech, nurse consultant, Services for Older People, NHS Forth Valley and member of the nurses' and allied health professionals' special interest group, British Geriatrics Society; Susan Nixon, service manager, Services for Older People, Falkirk Council.

  13. Environmental, Health, and Safety Research Needs for Engineered Nanoscale Materials

    Science.gov (United States)

    2006-09-01

    Canady Forest Service (FS/USDA) Christopher Risbrudt Theodore Wegner Intelligence Technology Innovation Center (ITIC) Susan Durham International...particle agglomeration and settling. Some types of nanomaterials could become attached to dust, pollen , or other airborne particulates. Particles larger

  14. EPA Regional Administrator Highlights the Benefits of Reducing Food Waste in South Bend

    Science.gov (United States)

    (SOUTH BEND, IND. - November 5, 2015) U.S. Environmental Protection Agency Regional Administrator Susan Hedman joined South Bend Mayor Pete Buttigieg today at Ivy Tech Community College's culinary school to highlight the benefits of diverting food waste fr

  15. Kui sulg ei jookse... / Jaanus Noormets

    Index Scriptorium Estoniae

    Noormets, Jaanus

    2003-01-01

    Kuidas stsenarist Charlie Kaufman kirjutas stsenaariumi oma loomevaevadest Susan Orleani raamatu filmiks kirjutamisel : mängufilm "Kuidas kirjutada kassafilmi" ("Adaptation") : režissöör Spike Jonze : Ameerika Ühendriigid 2002

  16. 77 FR 64819 - New Agency Information Collection Activity Under OMB Review: Office of Law Enforcement/Federal...

    Science.gov (United States)

    2012-10-23

    ... SECURITY Transportation Security Administration New Agency Information Collection Activity Under OMB Review... INFORMATION CONTACT: Susan L. Perkins, TSA PRA Officer, Office of Information Technology (OIT), TSA-11... other forms of information technology. Information Collection Requirement Title: LEO Reimbursement...

  17. The Westray chronicles: a case study in corporate crime

    National Research Council Canada - National Science Library

    McCormick, Christopher

    1999-01-01

    ..., and Corporate Crime John McMullan and Sherman Hinze 183 Chapter Ten: Unsettled Accounts after Westray Susan Dodd 218 Endnotes 250 References 273 List of IllustrationsLIST OF ILLUSTRATIONS Westray ...

  18. Iron-Deficiency Anemia

    Medline Plus

    Full Text Available ... Anemia What Is... CAUSES WHO IS AT RISK SIGNS & SYMPTOMS DIAGNOSIS TREATMENTS PREVENTION LIVING WITH CLINICAL TRIALS LINKS Related ... with having iron-deficiency anemia. Prior to her diagnosis, Susan had symptoms such as tiredness, poor skin ...

  19. Eesti president Toomas H. Ilves Pennsylvania ülikooli ajakirjas / Airi Vaga

    Index Scriptorium Estoniae

    Vaga, Airi, 1940-

    2008-01-01

    University of Pennsylvania ajakirjas "The Pennsylvania Gazette" ilmunud artiklist "From Estonian Exile to Executive Office", autor Susan Frith - järjekordsest võimalusest tutvustada Eestit ja eestlasi USA ülikoolide kaudu

  20. GENE EXPRESSION PROFILES IN ARSENIC-TREATED MCF-7 BREAST CANCER CELLS EXPRESSING DIFFERENT LEVELS OF HSP70

    Science.gov (United States)

    Gene expression profiles in arsenic-treated MCF-7 breast cancer cells expressing different levels of HSP70Gail Nelson, Susan Hester, Ernest Winkfield, Jill Barnes, James AllenEnvironmental Carcinogenesis Division, NHEERL, ORD, US Environmental Protection Agency, Rese...

  1. Web-Based Instruction A Guide for Libraries

    CERN Document Server

    Smith, Susan Sharpless

    2010-01-01

    Expanding on the popular, practical how-to guide for public, academic, school, and special libraries, technology expert Susan Sharpless Smith offers library instructors the confidence to take Web-based instruction into their own hands.

  2. 1. IV avati Tallinna Kunstihoone galeriis šoti videokunstinäitus "Nähtamatud väljad"

    Index Scriptorium Estoniae

    2004-01-01

    Kuraatorid Sarah Felton ja Su Grierson, osalevad kunstnikud Victoria Clare Bernie, Samantha Clark, Maria Doyle, S. Felton, S. Grierson, Belinda Guidi, Anne Bjerge Hansen, Metacorpus, Jane McInally, Rosalind Nashashibi, Susannah Silver ja Susan Sloan

  3. Iron-Deficiency Anemia

    Medline Plus

    Full Text Available ... iron-deficiency anemia may require treatment in a hospital, blood transfusions , iron injections, or intravenous iron therapy. ... beans. Other lifestyle changes, such as getting enough sleep and exercising, also have helped Susan feel better. ...

  4. Biographies of Eminent Women in Psychology: Models for Achievement.

    Science.gov (United States)

    Furumoto, Laurel; And Others

    1980-01-01

    In order to recognize women's contributions to the field of psychology, biographies of Margaret Floy Washburn, Mary Cover Jones, Karen Horney, Susan Grey, Edna Heidbreder, Ann Roe, and Mary Whitton Calkins are presented. (BEF)

  5. The Law and the Ladies in "Trifles."

    Science.gov (United States)

    Zehfuss, Ruth E.

    1992-01-01

    Shows how Susan Glaspell's one-act play "Trifles" (when linked to "Antigone") illustrates the difficult moral choices that human beings face. Discusses Glaspell's social and political context; cultural influences; and parallels in situation, setting, and character. (PRA)

  6. Raamatututvustus / Rein Põder

    Index Scriptorium Estoniae

    Põder, Rein, 1943-

    1995-01-01

    Rousseau, Jean-Jacques. Üksildase uitaja mõtisklused; Hill, Susan. Proua de Winter; Kõrvemaast põhjarannani : Kuusalu kihelkonna kirjanduslik-kodulooline antoloogia / Koost. Helmut Elstrok; Tead.toim. Oskar Kuningas

  7. Injury-related behaviour among South African high-school students ...

    African Journals Online (AJOL)

    Injury-related behaviour among South African high-school students at six sites. Alan J Flisher, Catherine L Ward, Holan Liang, Handsome Onya, Nomfundo Mlisa, Susan Terblanche, Arvin Bhana, Charles DH Parry, Carl J Lombard ...

  8. Must Surm võib varitseda viirusena / Tiit Kändler

    Index Scriptorium Estoniae

    Kändler, Tiit, 1948-

    2001-01-01

    Üldlevinud arusaama kohaselt on Must Surm muhkkatk, nüüd on Liverpooli ülikooli arstiteadlased Susan Scott ja Christopher Duncan avaldanud raamatu, milles väidavad, et katk polnud bakteri, vaid hoopis viiruse tekitatud

  9. The Tropenmuseum and the Colonial Heritage : Position paper

    NARCIS (Netherlands)

    Legêne, Susan

    1998-01-01

    Policy document outlining the Tropenmuseum's intention to work on the colonial past as an essential aspect of its contemporary policies. Author: Susan Legêne, at the time head of the Curatorial Department of the tropenmuseum.

  10. Investigation of manganese homeostasis in dogs with anaemia and ...

    African Journals Online (AJOL)

    Investigation of manganese homeostasis in dogs with anaemia and chronic enteropathy. Marisa da Fonseca Ferreira, Arielle Elizabeth Ann Aylor, Richard John Mellanby, Susan Mary Campbell, Adam George Gow ...

  11. A Contributing Listener and Other Composition Wives: Reading and Writing the Feminine Metaphors in Composition Studies.

    Science.gov (United States)

    Reichert, Pegeen

    1996-01-01

    Draws on Susan Miller's distinction between "feminist composition studies" and "feminine composition studies" to raise concerns about the perception, place, and role of composition studies in English departments. Examines the feminine metaphors used in composition theory and research. (TB)

  12. Travelers' Health: Cruise Ship Travel

    Science.gov (United States)

    ... Kara Tardivel, Susan A. Lippold, Krista Kornylo Duong INTRODUCTION Cruise ship travel presents a unique combination of ... may include countries where vectorborne diseases such as malaria, dengue, yellow fever, Japanese encephalitis, and Zika are ...

  13. Brazilian physicists take centre stage

    Science.gov (United States)

    Curtis, Susan

    2014-06-01

    With the FIFA World Cup taking place in Brazil this month, Susan Curtis travels to South America's richest nation to find out how its physicists are exploiting recent big increases in science funding.

  14. Kui kapital veab alt, siis turvaliselt / Aleksander Tsapov

    Index Scriptorium Estoniae

    Tsapov, Aleksander

    2006-01-01

    Kuraatorinäitus "Kapital (see veab meid alt)" Tallinna Kunstihoones. Kuraator Simon Sheikh. Fia-Stina Sandlundi, Katya Sanderi, Oliver Ressleri, Ashley Hunti ja Susan Kelly&Stephen Mortoni töödest näitusel

  15. Ni rara, ni extraordinaria: política y corporalidad en Eva Perón

    National Research Council Canada - National Science Library

    Karina Elizabeth Vázquez

    2017-01-01

    This essay analyzes images and representations of Eva Perón combining theories of corporeality and affection with theories of the photo-image proposed by WJT Mitchell, Roland Barthes and Susan Sontag...

  16. Reported school experiences of young people living with sickle cell disorder in England.

    OpenAIRE

    Dyson, Simon; Abuateya, Hala; Atkin, Karl; Culley, Lorraine; Dyson, Sue; Rowley, David T.

    2010-01-01

    We are grateful to all the young people and their families for their time in replying to the survey. We would like to acknowledge the work of the Sickle Cell and Education group (SCED) in helping with the survey, including David Rees, Moira Dick, Susan Height, Sandra O’Driscoll, Shirley Samuel, Baba Inusa, Jo Howard, Helen Appleby, Neil Westerdale, Lola Oni, Elizabeth Okuyiga, Vesna Graham, Beatrice Barbola, Gavin Cho, Michele Afif, Lurieteen Miller, Susan Crawford, Maureen Williams, Janet L...

  17. Disclosure and sickle cell disorder: a mixed methods study of the young person with sickle cell at school.

    OpenAIRE

    Dyson, Simon; Atkin, Karl; Culley, Lorraine; Dyson, Sue; Evans, Hala; Rowley, David T.

    2010-01-01

    We are grateful to all the young people and their families for their time in replying to the questionnaires and the interviews. We would like to acknowledge the work of the Sickle Cell and Education group (SCED) in helping with the survey, including David Rees, Moira Dick, Susan Height, Sandra O’Driscoll, Shirley Samuel, Baba Inusa, Jo Howard, Helen Appleby, Neil Westerdale, Lola Oni, Elizabeth Okuyiga, Vesna Graham, Beatrice Barbola, Gavin Cho, Michele Afif, Lurieteen Miller, Susan Crawford...

  18. Preparing Women for Strategic Leadership Roles in the Army

    Science.gov (United States)

    2003-03-01

    USAWC STRATEGY RESEARCH PROJECT PREPARING WOMEN FOR STRATEGIC LEADERSHIP ROLES IN THE ARMY by COL Susan R. Myers U.S. Army CDR Robert Kedney Project...to xx-xx-2003 4. TITLE AND SUBTITLE Preparing Women for Strategic Leadership Roles in the Army Unclassified 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c...ii iii ABSTRACT AUTHOR: COL Susan R. Myers TITLE: Preparing Women for Strategic Leadership Roles in the Army FORMAT: Strategy Research Project DATE: 01

  19. Metal Residue Deposition from Military Pyrotechnic Devices and Field Sampling Guidance

    Science.gov (United States)

    2012-05-01

    PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Jay L. Clausen, Julie Richardson, Nic Korte, Nancy Perron, Susan Taylor, Anthony Bednar, Patricia Tuminello...Julie Richardson1, Nic Korte3, Nancy Perron1, Susan Taylor1, Anthony Bednar2, Andrew Bray2, Patricia Tuminello2, William Jones2, Shawna Tazik2...in a warm water bath . Each sample was vacuum-filtered through a Whatman glass microfiber grade GF/A 1.6 µm filter. Several filters were required

  20. Social Media - DoD’s Greatest Information Sharing Tool or Weakest Security Link?

    Science.gov (United States)

    2010-04-15

    OR WEAKEST SECURITY LINK? BY LIEUTENTANT COLONEL SUSAN CAMORODA United States Army National Guard Se ni or S er vi ce C ol le ge F el lo w...SHARING TOOL OR WEAKEST SECURITY LINK? by Lieutenant Colonel Susan Camoroda United States Army National Guard Dr Rahul...CRP is submitted in partial fulfillment of the requirements of the Senior Serivce College Fellowship. The U.S. Army War College is accredited by the

  1. STS-102 Crew Activity Report/Flight Day 7 Highlights

    Science.gov (United States)

    2001-01-01

    Footage shows STS-102 Mission Specialist Andy Thomas, Expedition 1 crewmember Sergei Krikalev, and Expedition 2 crewmember Susan Helms transferring supplies from the Leonardo Module to the International Space Station (ISS). Then STS-102 Commander Jim Wetherbee joins the crew of Expedition 2 (James Voss, Susan Helms, and Yuriy Usachev) for an on-orbit interview, where they answer questions about the spacewalks performed by Voss and Helms and about living on the ISS.

  2. The Burden of Disability among Active Duty Air Force Members

    Science.gov (United States)

    2006-09-01

    regarding active duty pilots and navigators who experienced a cardiac event, which included myocardial infarctions, angina , and sudden death. The study...a Cohort of Active-Duty U.S. Air Force Members Authors: Anthony S. Robbins, MD, PhD, Susan Y. Chao, MS, Vincent P. Fonseca, MD, MPH, Michael R...Physical Fitness in a Cohort of Active-Duty U.S. Air Force Members Anthony S. Robbins, Susan Y. Chao, Vincent P. Fonseca, Michael R

  3. Possible Regulatory Improvements of the American Housing Finance System

    DEFF Research Database (Denmark)

    Lunde, Jens

    2017-01-01

    Book review of: Susan M. Wachter and Joseph Tracy (eds.): Principles of Housing Finance Reform. PENN—University of Pennsylvania Press, Philadelphia, 282 pp, $65.00s, ISBN: 978-0-8122-4862-3......Book review of: Susan M. Wachter and Joseph Tracy (eds.): Principles of Housing Finance Reform. PENN—University of Pennsylvania Press, Philadelphia, 282 pp, $65.00s, ISBN: 978-0-8122-4862-3...

  4. Sun River (24CA74): A Stratified Pelican Lake and Oxbow Occupation Site near Great Falls, Montana.

    Science.gov (United States)

    1983-08-31

    Oxbow Cascade County Phytoliths Pelican Lake Settlement Flotation 20. A.STIRACT . -u are. dde If n-"e- .. d nden~ff7 by block .- ber) The Sun River...Susan K. Short, Pollen Analyst * Rhoda Owen Lewis, Phytolith Analyst Meg Van Ness, Flotation Analyst Historical Research Associates Missoula, Montana...ANALYSES Susan K. Short, Institute of Arctic and Alpine Research, Boulder, Colorado D PHYTOLITH RESULTS Rhoda Lewis, Paleoenvironmental Consultants

  5. Sea-surface salinity: the missing measurement

    Science.gov (United States)

    Stocker, Erich F.; Koblinsky, Chester

    2003-04-01

    Even the youngest child knows that the sea is salty. Yet, routine, global information about the degree of saltiness and the distribution of the salinity is not available. Indeed, the sea surface salinity measurement is a key missing measurement in global change research. Salinity influences circulation and links the ocean to global change and the water-cycle. Space-based remote sensing of important global change ocean parameters such as sea-surface temperature and water-cycle parameters such as precipitation have been available to the research community but a space-based global sensing of salinity has been missing. In July 2002, the National Aeronautical and Space Administration (NASA) announced that the Aquarius mission, focused on the global measurement of sea surface salinity, is one of the missions approved under its ESSP-3 program. Aquarius will begin a risk-reduction phase during 2003. Aquarius will carry a multi-beam 1.4 GHz (L-band) radiometer used for retrieving salinity. It also will carry a 1.2 GHz (L-band) scatterometer used for measuring surface roughness. Aquarius is tentatively scheduled for a 2006 launch into an 8-day Sun-synchronous orbit. Aquarius key science data product will be a monthly, global surface salinity map at 100 km resolution with an accuracy of 0.2 practical salinity units. Aquarius will have a 3 year operational period. Among other things, global salinity data will permit estimates of sea surface density, or buoyancy, that drives the ocean's three-dimensional circulation.

  6. Six minute exposure of stars taken through airlock on Skylab

    Science.gov (United States)

    1973-01-01

    A six minute exposure of stars in the constellation Aquarius and others taken with a 35mm camera through the antisolar scientific airlock in the Orbital Workshop (OWS) of the Skylab space station in Earth orbit. Crewmen of the second manned Skylab mission took this picture as part of the Zodiacal Light/Gegenschein (S073) experiment. Most of the stars seen here belong to the constellation Aquarius and range in the stellar magnitude from +3, +6, +9. The dark patch on the right of the photograph is due to shielding of the sky by part of the experiment hardware.

  7. Seasonal variability of salinity and salt transport in the northern Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    D’Addezio, J.M.; Subrahmanyam, B.; Nyadjro, E.S.; Murty, V.S.N.

    of salinity at the surface and at depths up to 200 m, surface salt transport in the top 5-m layer, and depth-integrated salt transports revealed different salinity processes in the NIO that are dominantly related to the semiannual monsoons. Aquarius proves a...

  8. Building blocks of the Milky Way's accreted spheroid

    NARCIS (Netherlands)

    van Oirschot, Pim; Starkenburg, Else; Helmi, Amina; Nelemans, Gijs

    2017-01-01

    In the $\\Lambda$CDM model of structure formation, a stellar spheroid grows by the assembly of smaller galaxies, the so-called building blocks. Combining the Munich-Groningen semi-analytical model of galaxy formation with the high resolution Aquarius simulations of dark matter haloes, we study the

  9. Environmental sensor networks and continuous data quality assurance to manage salinity within a highly regulated river basin

    Energy Technology Data Exchange (ETDEWEB)

    Quinn, N.W.T.; Ortega, R.; Holm, L.

    2010-01-05

    This paper describes a new approach to environmental decision support for salinity management in the San Joaquin Basin of California that focuses on web-based data sharing using YSI Econet technology and continuous data quality management using a novel software tool, Aquarius.

  10. Epilogue for Star Charts

    Indian Academy of Sciences (India)

    You will also notice that Mars which was in Scorpius/Ophicus in August 2001 is now in Taurus after travelling through Sagittarius, Capricorn, Aquarius, Pisces and Aries. It also executed a retrograde motion during this period. It would be interesting to keep a record of the positions of the currently visible planets, Mars, Jupiter, ...

  11. Salt Transport in the Near-Surface Layer in the Monsoon-Influenced Indian Ocean Using HYCOM

    Science.gov (United States)

    2010-08-04

    collection of information if it does not display a currently valid OMB control number. PLEASE DO NOT RETURN YOUR FORM TO THE ABOVE ORGANIZATION. 1...Salinity (SMOS) and NASA and Space Agency of Argentina’s (Comision Nacional de Actividades Espaciales, CONAE) Aquarius/SAC-D satellite missions. The

  12. A two-point correlation function for Galactic halo stars

    NARCIS (Netherlands)

    Cooper, A. P.; Cole, S.; Frenk, C. S.; Helmi, A.

    2011-01-01

    We describe a correlation function statistic that quantifies the amount of spatial and kinematic substructure in the stellar halo. We test this statistic using model stellar halo realizations constructed from the Aquarius suite of six high-resolution cosmological N-body simulations, in combination

  13. Galactic stellar haloes in the CDM model

    NARCIS (Netherlands)

    Cooper, A. P.; Cole, S.; Frenk, C. S.; White, S. D. M.; Helly, J.; Benson, A. J.; De Lucia, G.; Helmi, A.; Jenkins, A.; Navarro, J. F.; Springel, V.; Wang, J.

    2010-01-01

    We present six simulations of galactic stellar haloes formed by the tidal disruption of accreted dwarf galaxies in a fully cosmological setting. Our model is based on the Aquarius project, a suite of high-resolution N-body simulations of individual dark matter haloes. We tag subsets of particles in

  14. EST Table: BY916679 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 84 %/206 aa gnl|Amel|GB19403-PA 10/09/10 84 %/206 aa gi|91085659|ref|XP_971350.1| PREDICTED: similar to Intron-binding protein aquari...us (Intron-binding protein of 160 kDa) (IBP160) [Tribolium castaneum] BY916679 Nnor ...

  15. What do we know about the phylogeny of the semi-aquatic bugs (Hemiptera: Heteroptera: Gerromorpha)?

    DEFF Research Database (Denmark)

    Damgaard, Jakob

    2012-01-01

    and Metrobatini, and even well-known genera, such as Aquarius, Limnometra, Tenagogonus and Halobates, are not monophyletic. As taxonomic classifications should be based on observable morphological characters, and at the same time reflect phylogenetic relationships, a considerable task lays ahead in obtaining...

  16. Uued albumid / Lennart Hiir

    Index Scriptorium Estoniae

    Hiir, Lennart

    2000-01-01

    Plaaditutvustus: sealhulgas JMKE "Õhtumaa viimased tunnid", "Kuumad Eesti Hitid" 9/10, Camille& The Band "Worldwide" Plaadiarvustused: Aqua "Aquarius", William Orbit "Pieces In A Modern Style", Modern Talking "Year Of The Dragon", AC/DC "Stiff Upper Lip", Smashing Pumpkins "Machina/The Machines Of God", Kittie "Spit", Bone Thugs-N-Harmony "Btnresurrection", DJ Krush "Code 4109"

  17. Spaceborne L-band Radiometers: Push-broom or Synthetic Aperture?

    DEFF Research Database (Denmark)

    Skou, Niels

    2004-01-01

    L-band radiometers can measure ocean salinity and soil moisture from space. A synthetic aperture radiometer system, SMOS, is under development by ESA for launch in 2007. A real aperture push-broom system, Aquarius, has been approved by NASA for launch in 2008. Pros et cons of the two fundamentally...

  18. Behaviour of streams in angle and frequency spaces in different potentials

    NARCIS (Netherlands)

    Buist, Hans J. T.; Helmi, Amina

    We have studied the behaviour of stellar streams in the Aquarius fully cosmological N-body simulations of the formation of Milky Way haloes. In particular, we have characterised the streams in angle and frequency spaces derived using an approximate but generally well-fitting spherical potential. We

  19. Command History 1970. Volume 4

    Science.gov (United States)

    1970-01-01

    Xuyen Province (En: 17 KIA, 23 Det, 4 IW; Frd: 1 WIA). USN EC-121 Constellation crashes while landing at Danang Airbase. Of 31 crew m11em1bers, 22 are...USSR), III 20 Fire Support Base Activities, E 5, 6, 8, 85 Construction, G 1 Planning, G I Purpose, G I Fire Support Bases Airborne, G o Aquarius , E 55

  20. Saturn Nebula (NGC 7009)

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    A planetary nebula in the constellation Aquarius, position RA 21 h 04.4 m, dec. -11° 22'. It measures 25'' and shines with a greenish hue. It is of eighth magnitude and for a planetary nebula has a high surface brightness. Two small lobes on either side give it the appearance of the planet Saturn....

  1. Delta Aquarids

    Science.gov (United States)

    Murdin, P.

    2000-11-01

    A meteor shower that takes place in late July and early August. There are two radiants in the constellation Aquarius, one at dec. -17° coming to maximum on 29 July, and the other, slightly weaker, at dec. -10° and coming to maximum around 6 August. The parent body of this shower is unknown....

  2. The population of Milky Way satellites in the Λ cold dark matter cosmology

    NARCIS (Netherlands)

    Font, A. S.; Benson, A. J.; Bower, R. G.; Frenk, C. S.; Cooper, A.; DeLucia, G.; Helly, J. C.; Helmi, A.; Li, Y. -S.; McCarthy, I. G.; Navarro, J. F.; Springel, V.; Starkenburg, E.; Wang, J.; White, S. D. M.

    2011-01-01

    We present a model for the satellites of the Milky Way in which galaxy formation is followed using semi-analytic techniques applied to the six high-resolution N-body simulations of galactic haloes of the Aquarius project. The model, calculated using the GALFORM code, incorporates improved treatments

  3. Behaviour of streams in angle and frequency spaces in different potentials

    Science.gov (United States)

    Buist, Hans J. T.; Helmi, Amina

    2017-05-01

    We have studied the behaviour of stellar streams in the Aquarius fully cosmological N-body simulations of the formation of Milky Way haloes. In particular, we have characterised the streams in angle and frequency spaces derived using an approximate but generally well-fitting spherical potential. We have also run several test-particle simulations to understand and guide our interpretation of the different features we see in the Aquarius streams. Our goal is both to establish which deviations of the expected action-angle behaviour of streams exist because of the approximations made on the potential, but also to derive to what degree we can use these coordinates to model streams reliably. We have found that many of the Aquarius streams wrap in angle space along relatively straight lines, and distribute themselves along linear structures also in frequency space. On the other hand, from our controlled simulations we have been able to establish that deviations from spherical symmetry, the use of incorrect potentials and the inclusion of self-gravity lead to streams in angle space to still be along relatively straight lines but also to depict wiggly behaviour whose amplitude increases as the approximation to the true potential becomes worse. In frequency space streams typically become thicker and somewhat distorted. Therefore, our analysis explains most of the features seen in the approximate angle and frequency spaces for the Aquarius streams with the exception of their somewhat "noisy" and "patchy" morphologies. These are likely due to the interactions with the large number of dark matter subhaloes present in the cosmological simulations. Since the measured angle-frequency misalignments of the Aquarius streams can largely be attributed to using the wrong (spherical) potential, the determination of the mass growth history of these haloes will only be feasible once (and if) the true potential has been determined robustly.

  4. Markets and authorities

    DEFF Research Database (Denmark)

    Lorentzen, Jochen; Cecco, Marcello de

    This text addresses the relationship between market authority and political authority - a favourite theme of Susan Strange, to whom the book is dedicated. From a survey of the bias against capital liberalization in economic thought to an analysis of the US role in global monetary affairs, it disc......This text addresses the relationship between market authority and political authority - a favourite theme of Susan Strange, to whom the book is dedicated. From a survey of the bias against capital liberalization in economic thought to an analysis of the US role in global monetary affairs...

  5. Rehabilitation R&D Progress Reports 1996, Volume 34, May 1997

    Science.gov (United States)

    1997-05-01

    Cherney LR, Halper AS, Drimmer DP. Brain Lang 1995:51(l):51-3. 129 Head Trauma and Stroke [138] COMORBIDITIES AND COMPLICATIONS IN STROKE...persons with PD. [189] BIOCHEMICAL AND MYOELECTRIC EVENTS DURING FATIGUE Serge H. Roy, ScD; Edward Kupa, MS; Carlo J. De Luca, PhD; Susan C...R&D Progress Reports 1996 [190] EFFECTS OF MUSCLE FIBER SIZE ON EMG PARAMETERS Edward Kupa, MS; Serge H. Roy, ScD; Susan C. Kandarian, PhD; Carlo J

  6. Fantastiske forbindelser relationer i undervisning og læringssamvær

    DEFF Research Database (Denmark)

    Antologiens artikler er lavet af en række anerkendte forskere og ide-folk fra Danmark, Norge, Holland, England og USA. Herunder Peter Lang, Daniel Stern, Maria Aarts, Thomas Armstrong, Maria Aarts, Jan Tønnesvang, Stein Bråten, Jesper Juul og Susan Hart......Antologiens artikler er lavet af en række anerkendte forskere og ide-folk fra Danmark, Norge, Holland, England og USA. Herunder Peter Lang, Daniel Stern, Maria Aarts, Thomas Armstrong, Maria Aarts, Jan Tønnesvang, Stein Bråten, Jesper Juul og Susan Hart...

  7. Race, Feminine Power, and the Vietnam War in Philip Red Eagle's "Red Earth"

    Science.gov (United States)

    Andrews, Scott

    2004-01-01

    In her book "The Remasculinization of America," Susan Jeffords discusses the dynamics of how differences such as race and class are erased in filmic and literary representations of the Vietnam War. She asserts that one difference is not overcome by the battlefield: gender, a barrier that is depicted in the literature as natural and…

  8. Imagining Patriarchy

    Science.gov (United States)

    Tubbs, David L.

    2004-01-01

    If there was one theme essential to the historical scholarship of Stanford professor Susan Moller Okin, it was the oppression of females. In imbuing political theory with feminism, Okin wrote, for instance, that modern American women are "second-class" citizens in a society where biological differences should count for nothing. Such declarations…

  9. Browse Title Index

    African Journals Online (AJOL)

    Issue, Title. Vol 70 (2007), UKIMWISHAJI wa Utanzu wa Fashihi: Mifano kutoka Methali za Tanzania, Abstract. Aldin K. Mutembei. Vol 70 (2007), A minimalist approach to Kiswahili Syntax, Abstract. Alice Mwihaki. Vol 80, No 1 (2017), A Morphological Classification of Kiswahili, Abstract. Susan C. Choge. Vol 74, No 1 (2011) ...

  10. The effects of educational context on the understanding of linguistic ...

    African Journals Online (AJOL)

    Erna Kinsey

    covering the two OBE learning areas of 1) Language, Literacy & Com- munication, and 2) Mathematical .... 'deep' or rural standard varieties in comparison to the urban variety. Results and discussion. The results ..... This article is dedicated to the memory of the late Susan H. Suzman, with gratitude for her dedication, support ...

  11. Author Details

    African Journals Online (AJOL)

    Purchase, Susan. Vol 15, No 3 (2016) - Articles Keeping kids in care: virological failure in a paediatric antiretroviral clinic and suggestions for improving treatment outcomes. Abstract. ISSN: 1608-5906. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors. OTHER RESOURCES.

  12. Human Systems Engineering and Program Success - A Retrospective Content Analysis

    Science.gov (United States)

    2016-01-01

    generic program. It is not intended to reflect the time dedicated to associated phase activity. LEGEND : = Decision Point CDD = Capability Development...Beverly G. Knapp. Also, Dr. Holly A. H. Handley and Jeffrey Thomas provided techniques, data, and advice. Former col- leagues Susan Archer, Chris Plott

  13. 75 FR 60749 - Policy on Payment System Risk

    Science.gov (United States)

    2010-10-01

    ... revisions explicitly recognize the role of the central bank in providing intraday credit to healthy... Director (202) 452-2360, Susan Foley, Deputy Associate Director (202) 452-3596, or Jeffrey Walker, Manager... system, while also helping to mitigate credit exposures of the Federal Reserve Banks (Reserve Banks) from...

  14. Valuing Difference in Students' Culture and Experience in School Science Lessons

    Science.gov (United States)

    Banner, Indira

    2016-01-01

    Susan Harper writes about how a cross-cultural learning community can be formed where people from different cultures are not simply assimilated into a school science community but are seen and heard. This makes learning reciprocal and meaningful for both recent refugees and the dominant population. Although maybe not refugees, students from poorer…

  15. Air Force Space Command Satellite Orbit Predictor Using Parallel Virtual Machines

    Science.gov (United States)

    1993-12-01

    MASTER OF SCIENCE IN APPLIED MXTHZM& TICS from the NAVAL POSTGRADUATE SCHOOL December 1993 Author: 2/ Susan Kay (blatusiak) Brewer Approved by: \\L ’>C...School Montrey, Califomia 93943 4. Commander U.S. Naval Space Command Dahigtrn, VA 22448-5170 5. Profesor B. Neta, Code MA/Nd 2 Depwtment of

  16. Political Economy in Applied Linguistics Research

    Science.gov (United States)

    Block, David

    2017-01-01

    This state-of-the-art review is based on the fundamental idea that political economy should be adopted as a frame for research and discussion in applied linguistics as part of a general social turn which has taken hold in the field over the past three decades. It starts with Susan Gal's (1989) early call for such a move in sociolinguistics and…

  17. 78 FR 41314 - Review of Foreign Ownership Policies for Common Carrier and Aeronautical Radio Licensees

    Science.gov (United States)

    2013-07-10

    ... Ball, Policy Division, International Bureau, FCC, (202) 418-1460 or via the Internet at Susan.OConnell... document also is available for download over the Internet at http://transition.fcc.gov/Daily_Releases/Daily... voting interests--unless the Commission finds that such ownership is inconsistent with the public...

  18. Nime võimust : naine või artishokk / Leena Kurvet-Käosaar

    Index Scriptorium Estoniae

    Kurvet-Käosaar, Leena, 1969-

    2003-01-01

    Tagasivaade naisrežissööride filmifestivalile Helsingis. Lähemalt 4 mängufilmist : itaallanna Monica Stambrini "Benzina" (2001), inglanna Lynne Ramsay "Morvern Callar" (2002), prantslanna Sophie Tatscheffi "Baarilett" (1997) ja iraani päritolu rootsi režissööri Susan Taslimi "All Hell Let Loose" (2002)

  19. USCS and the USDA Soil Classification System: Development of a Mapping Scheme

    Science.gov (United States)

    2015-03-01

    Development of a Mapping Scheme Co ld R eg io ns R es ea rc h an d En gi ne er in g La bo ra to ry Rubén A. García-Gaines and Susan...important to human daily living. A variety of disciplines ( geology , agriculture, engineering, etc.) require a sys- tematic categorization of soil, detailing

  20. hydroprocessing processing processing microalgae derived h

    African Journals Online (AJOL)

    eobe

    Hydrothermal Gasification. Bachelor Degree Thesis,. Chemical Engineering Department, University of. Arizona. [28] Fortier, Marie-Odile P.; Roberts, Griffin W.; Stagg-. Williams, Susan M.; Sturm, Belinda S.M. (2014) Life cycle assessment of bio-jet fuel from hydrothermal liquefaction of microalgae, Appl.Energy, Vol. 122,.

  1. A guide to innovation in informal settings | CRDI - Centre de ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rapid economic growth in developing countries has deepened income inequalities, drawing increased attention to the need for equitable development. The concept of Innovation for Inclusive Development explores possible solutions to this problem. Innovation in Informal Settings: A Research Agenda by Susan Cozzens ...

  2. 30 ABSTRACT CASE REPORT

    African Journals Online (AJOL)

    World report on child injury and prevention. WHO(2008)Global Burden of Disease:2004 update. 2. Michael, Y., Wang, K., Anthony Kim, Pamela, M.,. Griffith, Susan, S. et al. Injuries from fall in pediatric population: An analsis of 729 cases. J Pediat Surg. 2001: 36(10); 1528-1534. 3. Lallier, M., Bouchard, S., Sti-vil, D., Dupont, ...

  3. Journal of Child and Adolescent Mental Health - Vol 22, No 2 (2010)

    African Journals Online (AJOL)

    Journal of Child and Adolescent Mental Health. ... Research Paper Bullying boys: the traumatic effects of bullying in male adolescent learners · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Susan Louise Penning, Anil Bhagwanjee, Kaymarlin Govender.

  4. Identification, transmission and genomic characterization of a new member of the family Caulimoviridae causing a flower distortion disease of Rudbeckia hirta

    Science.gov (United States)

    A disease of Rudbeckia hirta (Black-eyed Susan), characterized by severe flower deformation, was observed in Minnesota during 20010-2016. A previously undescribed virus, named Rudbeckia flower distortion virus (RuFDV), was determined to be the causal agent of the disease. Symptoms induced by RuFDV i...

  5. Health promotion settings: principles and practice

    National Research Council Canada - National Science Library

    Scriven, Angela; Hodgins, Margaret

    2012-01-01

    ... Hodgins 2012 Chapters 1 and 4 and Introduction to Part I © Angela Scriven Chapter 2 © Mark Dooris Chapter 3 © Margaret Hodgins and John Griffiths Chapters 5 and 11 © Jane South and James Woodall Chapter 6 © Susan Biddle and Martin Seymour Chapter 7 © Sally Fawkes, Colin Fudge and Katrin Engelhardt Chapter 8 © Trevor Hancock Cha...

  6. SubJournal: For Personnel Responsible for Substitute Teaching. Volume 5, Number 2, Fall 2004

    Science.gov (United States)

    Smith, Geoffrey G., Ed.; Tippetts, Zach, Ed.

    2004-01-01

    This issue of "SubJournal" focuses on research and reports relating to substitute teaching, teacher absenteeism, and classroom management. Articles included within this issue are as follows: (1) No Substitute for Quality: A Time Series Quasi-Experimental Study of the Effects of a Pay for Performance Remedy for Teacher Absenteeism (Susan Lugo); (2)…

  7. Place recognition using color region analysis

    Science.gov (United States)

    Zollei, Lilla; Fennema, Claude L., Jr.

    1999-08-01

    In 1990, Mount Holyoke College began an AI project centered around a mobile robot the students have named 'Susan B.' One of the research threads in this project is what has been called the 'Where am I.' problem, namely, the study of how to determine the robot's location using Computer Vision. This paper describes our current approach to this problem.

  8. ORIGINAL ARTICLE Detection of human telomerase reverse ...

    African Journals Online (AJOL)

    salah

    messenger RNA in urine of high risk patients as a non invasive molecular diagnostic tool for urinary bladder cancer in Egyptians. Susan F. Helal1, Heba SH. Kassem1,2, Wael M. Sameh3 and Samar N. El-. Achy1. 1Pathology department, 2Clinical Genomics Centre, 3Urology Department,. Faculty of Medicine, University of ...

  9. Are introverts better at partnership brokering? Exploring brokering skills across the introvert-extrovert continuum

    NARCIS (Netherlands)

    Brouwer, J.H.

    2013-01-01

    This article raises the question of whether it matters if a partnership broker is introverted or extroverted[1], [2]. A recent public discussion about Susan Cain’s book ‘Quiet: The power of introverts in a world that can’t stop talking’ has highlighted the importance of recognising one’s temperament

  10. 77 FR 41045 - Airworthiness Directives; The Boeing Company Airplanes

    Science.gov (United States)

    2012-07-12

    ... FURTHER INFORMATION CONTACT: Susan Monroe, Aerospace Engineer, Cabin Safety and Environmental Systems... the effectivity that have had certain changes incorporated in production, update warranty information... response to each comment. Support for the NPRM (77 FR 6518, February 8, 2012) The Air Line Pilots...

  11. African Journal of AIDS Research - Vol 13, No 4 (2014)

    African Journals Online (AJOL)

    Effects of an exercise programme with people living with HIV: research in a disadvantaged setting · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Clemens Ley, Lloyd Leach, María Rato Barrio, Susan Bassett. http://dx.doi.org/10.2989/16085906.2014.961937 ...

  12. Prolonged Cycle Times and Schedule Growth in Defense Acquisition: A Literature Review

    Science.gov (United States)

    2014-01-01

    Glennan, Thomas K., Susan J. Bodilly, Frank Camm, Kenneth R. Mayer, and Tim Webb, Barriers to Managing Risk in Large Scale Weapons System Development...2020Mar2012.pdf Lapham, Mary Ann, Ray Williams, Charles (Bud) Hammons, Daniel Burton , and Alfred Schenker, Considerations for Using Agile in DoD

  13. Can We Talk?

    Science.gov (United States)

    Engel, Susan

    2015-01-01

    "One of the most powerful educational tools available to students and teachers lies hidden in plain sight, in every classroom--conversation," writes Susan Engel. The conversational exchanges that happen naturally between parents and young children are full of questions that can lead to learning. Within the context of these casual…

  14. characterisation of bacterial isolates from patients wounds and ...

    African Journals Online (AJOL)

    2013-12-12

    Dec 12, 2013 ... nurses' station is located in the middle of the unit. There is only one entrance to .... Skin grafting and ankle arthrodesis both accounted for 1.72 % ..... –Surgical Nursing. Susan Beyers. 1977. 2. Kolmos HJ, Svendsen RN, Nielsen SV. The surgical team as a source of postoperative wound infections caused by ...

  15. Book Reviews

    Science.gov (United States)

    Holeinger, Philip R.; And Others

    1986-01-01

    Presents and review six books. Topics include earth science topics (Philip R. Holzinger, 1985), the wild horse controversy (Richard Symanski, 1985), historical Dutch geography (Audrey M. Lambert, 1985), urban geography (Susan L. Cutter, 1985), a geopolitical atlas (Gerard Chaliand and Jean-Pierre Rageau, 1985), and remote sensing (Robert K. Holz,…

  16. Sources and Levels of Stress among 70th Intelligence, Surveillance, and Reconnaissance Wing Intelligence Operators and Support Personnel

    Science.gov (United States)

    2013-03-01

    SIGNATURE// //SIGNATURE// _____________________________________ ___________________________________ LT COL SUSAN DUKES DR...Arch Gen Psychiatry. 2005; 62(6):617-627. 17. Lambert MJ, Gregersen AT, Burlingame GM. The Outcome Questionnaire-45. In: Maruish ME, editor. The use...18. Lambert MJ. Administration and scoring manual for the OQ-45.2 (Outcome Questionnaire). Salt Lake City (UT): OQ Measures, LLC; 2011. 19. Ouma

  17. Phenotype-gene: 72 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available iency for trait of male fertility during process named fertilization for AT2G43790 Bush Susan M et al. 2007....fficiency for trait of male fertility during process named fertilization http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u649i AT2G43790

  18. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. NANDINI AGGARWAL. Articles written in Sadhana. Volume 41 Issue 12 December 2016 pp 1393-1406. Image coding based on maximum entropy partitioning for identifying improbable intensities related to facial expressions · SEBA SUSAN NANDINI AGGARWAL SHEFALI CHAND AYUSH ...

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 301 - 325 of 1840 ... Kelly J. Brown, Colleen T. Downs. Vol 46, No 2 (2011), Bee food: the chemistry and nutritional value of nectar, pollen and mixtures of the two, Abstract. Susan W. Nicolson. Vol 8, No 2 (1973), Behaviour and Breeding in Captivity of the Namaqua Gerbil Desmodillus Auricularis (Cricetidae: Gerbillinae) ...

  20. Norms and Mathematical Proficiency

    Science.gov (United States)

    Kastberg, Signe E.; Frye, R. Scott

    2013-01-01

    To challenge students' reasoning and to align with a physical fitness unit that students were studying, teachers and authors, Scott Frye and Signe Kastberg adapted a ratio comparison problem from Susan Lamon, "Ratio and Proportion: Connecting Content and Children's Thinking," (1994) to include athletes and doctors who share…

  1. 77 FR 14766 - Patents for Humanity Program (Formerly Humanitarian Program)

    Science.gov (United States)

    2012-03-13

    ... United States Patent and Trademark Office Patents for Humanity Program (Formerly Humanitarian Program...- 0066 Patents for Humanity Program comment'' in the subject line of the message. Mail: Susan K. Fawcett... Office (USPTO) is conducting a voluntary pilot program to incentivize the distribution of patented...

  2. Uued ja vanad ruumimängud / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    1998-01-01

    Inglise-eesti ühisnäitus 'Private views : taas/avastatud ruum Eesti ja Briti kaasaegses kunstis' Rotermanni soolalaos. Kuraatorid Mare Tralla, Pam Skelton. Feminismist kui tähenduslikust ruumist. Eve Kiileri, Mari Koorti, Liina Siibi, Susan Brindi, Ene-Liis Semperi, Anu Juuraku, Naomi Dinesi, rühmituse F.F.F.F., kuraatorite esinemisest.

  3. PDF Modeling of Turbulent Combustion

    Science.gov (United States)

    2008-11-30

    APS/DFD Annual Meeting, Salt Lake City, November 18-20, 2007. Delft University, Netherlands, The Burgers Lecture, January 10, 2008. SIAM 12th...he discussed ongoing research with Cam Carter, Mel Roquemore, Doug Davis, Susan Cox-Stouffer, among others. This included discussions on the modeling

  4. Multiple U.S. Agencies Provided Billions of Dollars to Train and Equip Foreign Police Forces

    Science.gov (United States)

    2011-04-27

    Budapest, Hungary; Bangkok, Thailand; Gaborone, Botswana; San Salvador , El Salvador ; and Roswell, New Mexico. The ILEAs received about $16 million...Nevis Barbados Grenada Uruguay Antigua and Barbuda El Salvador Bahamas, The Costa Rica Honduras Trinidad & Tobago Nicaragua Argentina Venezuela Jamaica...Alteriis, Lisa Canini, Susan Czachor, Gena Evans, Etana Finkler, Nicholas Jepson, Maria Mercado , Jaclyn Nelson, Erin Saunders-Rath, and George Taylor

  5. A Study to Determine the Best Model and the Optimal Feasible Method for Reducing No-Show Behavior at a Military Social Work Clinic.

    Science.gov (United States)

    1983-05-01

    Patient-Initiated Phone Confirmation Strategies on Appointment Keeping dt a Hospital Dental Clinic." Journal of Public Health Dentistry 40 (Winter 1980...Susan A. "Attendance Failure at Paediatric Medical Outpatient Clinics." New Zealand Medical Journal 92 (July 1980): 15-17. Lawson, Walter R. "Children

  6. Rootsis tehti maakunsti / Aivi Pargi

    Index Scriptorium Estoniae

    Pargi, Aivi, 1950-

    1998-01-01

    Rakvere kunstnik Anne Kokkov oma käigust rootsi kunstniku Christer Lindé korraldatud maakunsti sümpoosionile Bollnäsi väikelinna lähedal (Rootsi), milles osales tosin kunstnikku Saksamaalt, Rootsist, Eestist, Venemaalt s.h. ka nimekas sakslanna Susan Walke, eestlased Üllar Kallau, Kristel Komp, Urmas Uustal, Anne Tootmaa

  7. Part four: The research dissertation: planning, producing and writing a thesis.

    Science.gov (United States)

    Quick, J; Hall, S

    2015-11-01

    Dissertations have become common inclusions to postgraduate degrees in healthcare. To the novice researcher, undertaking an extensive project of this kind can appear daunting. In this final article in the series 'Spotlight on Research', Julie Quick and Susan Hall advise perioperative practitioners on how to plan, produce and write a research dissertation. Guidance is also given on disseminating the results from research studies.

  8. What's Happening in February?

    Science.gov (United States)

    Weissman, Ron; And Others

    Brief information is given on 12 February events celebrated by Puerto Ricans: Groundhog Day; Candlemas; St. Valentine's Day; Mardi Gras; Ash Wednesday; Black History; and the birthdays of Thomas Alva Edison, Abraham Lincoln, Susan B. Anthony, Julia de Burgos, Luis Munoz Marin, and George Washington. Designed as a teacher resource, the booklet…

  9. Reach for the Stars: Visions for Literacy Coaching Programs

    Science.gov (United States)

    DeFord, Diane

    2012-01-01

    This brief by the Literacy Coaching Clearinghouse is about reaching for the stars--stories of vision and commitment from educators in small and large schools. Everyone knows of people who are held up as "visionaries" throughout history: Leonardo Da Vinci, Mahatma Gandhi, Jules Verne, Thomas Edison, Susan Anthony, or John Dewey, to name a few. The…

  10. The Turn of the Century. Tenth Grade Lesson. Schools of California Online Resources for Education (SCORE): Connecting California's Classrooms to the World.

    Science.gov (United States)

    Bartels, Dede

    In this 10th grade social studies and language arts interdisciplinary unit, students research and report on historical figures from the turn of the 20th century. Students are required to work in pairs to learn about famous and common individuals, including Andrew Carnegie, Samuel Gompers, Susan B. Anthony, Thomas Edison, Theodore Roosevelt, Booker…

  11. The Technology of Unequal Rights for Women: Patent Drawings of a Voting Machine

    Science.gov (United States)

    Hussey, Michael

    2008-01-01

    In 1878, Senator Aaron A. Sargent of California introduced to the Senate an amendment to the Constitution "Conferring upon Women the Right of Suffrage." Drafted by Susan B. Anthony, this same amendment would be introduced on a near-yearly basis until its final passage by Congress on May 19, 1919. Varying degrees of voting rights presented an…

  12. Focusing on Non-Traditional and Underserved Students.

    Science.gov (United States)

    Kolvitz, Marcia, Ed.

    These six conference papers from the Biennial Conference on Postsecondary Education for Persons who are Deaf or Hard of Hearing focus on serving nontraditional students with deafness or hard of hearing. The first paper, "Helping Minority Individuals Navigate through Successful School and Work Transitions" (Glenn B. Anderson and Susan K. McGee),…

  13. When Revision Is Redesign: Key Questions for Digital Scholarship

    Science.gov (United States)

    Delagrange, Susan H.

    2009-01-01

    Q: When the interface of an interactive, digital, scholarly article is designed as an integral part of the article's argument, what are the rhetorical, conceptual, and technical challenges of re-designing the project to better enact that argument? Susan Delagrange offers a behind-the-scenes look at the authorial and editorial processes that led to…

  14. 1 Gender Domination and Domestic Violence in Nigerian Video Films

    African Journals Online (AJOL)

    development of children in the Nigerian society. Children raised in violent homes are known to ... and others, sexual abuse of children, marital rape and traditional practices that are harmful to the partner" (1). .... two fighting, beating and hitting each other with hard objects. She. (Susan) had to seek for solution to save her ...

  15. The Current State of Scholarly Journal Publishing in Africa

    African Journals Online (AJOL)

    susan

    2014-09-28

    Sep 28, 2014 ... This work is licensed under a Creative Commons Attribution-ShareAlike 4.0 International License. Susan Murray ...... publishing efforts. However, despite the optimism, serious concerns are evident as well, often tied to bigger development and infrastructure issues outside of the publishing industry.

  16. 1151-IJBCS-Article-Ayuba Samali

    African Journals Online (AJOL)

    pc

    2,5-Dihydroxy-4,3-di (ß-D-glucopyrano- syloxy)-trans-stilbene from. Morus bombycis Koidzumi root. Phytother. Res.,. 21(7): 605-608. Kathryn LN, Tracy W, Ashley SM, Brown. Susan ED, Graeme JMA. 2010. Hepatocellular carcinoma in patients with chronic hepatitis C virus infection without cirrhosis. World J. Gastroenterol.,.

  17. 78 FR 79650 - Definitions and Reporting Requirements for Shareholders of Passive Foreign Investment Companies

    Science.gov (United States)

    2013-12-31

    ... Federal Register. Drafting Information The principal authors of these proposed regulations are Susan E....1291-1 and 1.1291-9 as follows: Sec. 1.1291-0 Passive foreign investment companies--table of contents... a listing of the paragraph headings for Sec. 1.1298-1 as follows: Sec. 1.1298-0 Table of contents...

  18. Browse Title Index

    African Journals Online (AJOL)

    Issue, Title. Vol 3, No 2 (2016), Usefulness of problem tree, objective tree and logical framework matrix to fix chal-lenges of unemployment and underemployment of higher education graduates in Rwanda, Kenya and Ghana, Abstract PDF. Irénée Ndayambaje, Philothère Ntawiha, Susan Ngigi, Samuel Yaw Ampofo.

  19. Preparing Graduate Students for Virtual World Simulations: Exploring the Potential of an Emerging Technology

    Science.gov (United States)

    Hewitt, Anne M.; Spencer, Susan; Mirliss, Danielle; Twal, Riad

    2009-01-01

    Anne M. Hewitt, Susan Spencer, Danielle Mirliss, and Riad Twal report on a collaborative team initiative to create a virtual world emergency preparedness simulation that focuses on crisis and emergency risk communication (CERC). CERC is a key competency for students enrolled in Seton Hall University's (SHU) Master of Healthcare Administration…

  20. Relative expression of genes related with cold tolerance in ...

    African Journals Online (AJOL)

    For analysis, the Spanish cultivar, Susan, was used as check tolerance and Oryzica 1 as susceptible check. Oxidative stress was measured through lipid peroxidation. To find mechanisms of cold tolerance in Chilean cultivars, we determined the relative expression of genes related with oxidative stress, such as superoxide ...