WorldWideScience

Sample records for surveys acs reveals

  1. ACS Nearby Galaxy Survey

    Science.gov (United States)

    Dalcanton, Julianne

    2006-07-01

    Existing HST observations of nearby galaxies comprise a sparse and highly non-uniform archive, making comprehensive comparative studies among galaxies essentially impossible. We propose to secure HST's lasting impact on the study of nearby galaxies by undertaking a systematic, complete, and carefully crafted imaging survey of ALL galaxies in the Local Universe outside the Local Group. The resulting images will allow unprecedented measurements of: {1} the star formation history {SFH} of a >100 Mpc^3 volume of the Universe with a time resolution of Delta[log{t}]=0.25; {2} correlations between spatially resolved SFHs and environment; {3} the structure and properties of thick disks and stellar halos; and {4} the color distributions, sizes, and specific frequencies of globular and disk clusters as a function of galaxy mass and environment. To reach these goals, we will use a combination of wide-field tiling and pointed deep imaging to obtain uniform data on all 72 galaxies within a volume-limited sample extending to 3.5 Mpc, with an extension to the M81 group. For each galaxy, the wide-field imaging will cover out to 1.5 times the optical radius and will reach photometric depths of at least 2 magnitudes below the tip of the red giant branch throughout the limits of the survey volume. One additional deep pointing per galaxy will reach SNR 10 for red clump stars, sufficient to recover the ancient SFH from the color-magnitude diagram. This proposal will produce photometric information for 100 million stars {comparable to the number in the SDSS survey} and uniform multi-color images of half a square degree of sky. The resulting archive will establish the fundamental optical database for nearby galaxies, in preparation for the shift of high-resolution imaging to the near-infrared.

  2. 7 CFR 1737.31 - Area Coverage Survey (ACS).

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 11 2010-01-01 2010-01-01 false Area Coverage Survey (ACS). 1737.31 Section 1737.31... Studies-Area Coverage Survey and Loan Design § 1737.31 Area Coverage Survey (ACS). (a) The Area Coverage Survey (ACS) is a market forecast of service requirements of subscribers in a proposed service area. (b...

  3. The ACS Nearby Galaxy Survey Treasury: Overview

    Science.gov (United States)

    Dalcanton, Julianne

    2006-12-01

    The ACS Nearby Galaxy Survey Treasury program (ANGST) consists of a carefully crafted imaging survey of a volume-limited sample of galaxies in the Local Universe outside the Local Group. The resulting images will allow unprecedented measurements of: (1) the SFH of a >100 Mpc3 volume of the Universe with a time resolution of Delta[log(t)]=0.25; (2) correlations between spatially resolved SFHs and environment; (3) the structure and properties of thick disks and stellar halos; and (4) the color distributions, sizes, and specific frequencies of globular and disk clusters as a function of galaxy mass and environment. To reach these goals, we are using a combination of wide-field tiling, pointed deep imaging, and archival data to carry out a uniform analysis of the ancient and recent star formation histories of 70 galaxies within a volume-limited sample extending to 3.5 Mpc, with an extension to the M81 group. For all galaxies, a radial strip of imaging will cover out to beyond the optical radius and will reach photometric depths of at least 2 magnitudes below the tip of the red giant branch throughout the limits of the survey volume. Additional deep pointings will reach SNR 10 for red clump stars, sufficient to recover the ancient star formation history (SFH) from the color-magnitude diagram for the galaxies that provide more than 99% of the star formation in the local volume. The resulting analysis will produce photometric information for several million stars.

  4. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    NARCIS (Netherlands)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift

  5. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  6. Final Report for the Advanced Camera for Surveys (ACS)

    Science.gov (United States)

    2004-01-01

    ACS was launched aboard the Space Shuttle Columbia just before dawn on March 1, 2002. At the time of liftoff, the Hubble Space Telescope (HST) was reflecting the early morning sun as it moved across the sky. After successfully docking with HST, several components were replaced. One of the components was the Advanced Camera for Surveys built by Ball Aerospace & Technologies Corp. (BATC) in Boulder, Colorado. Over the life of the HST contract at BATC, hundreds of employees had the pleasure of working on the concept, design, fabrication, assembly, and test of ACS. Those employees thank NASA - Goddard Space Flight Center and the science team at Johns Hopkins University (JHU) for the opportunity to participate in building a great science instrument for HST.

  7. Working with the American Community Survey in R a guide to using the acs package

    CERN Document Server

    Glenn, Ezra Haber

    2016-01-01

    This book serves as a hands-on guide to the "acs" R package for demographers, planners, and other researchers who work with American Community Survey (ACS) data. It gathers the most common problems associated with using ACS data and implements functions as a package in the R statistical programming language. The package defines a new "acs" class object (containing estimates, standard errors, and metadata for tables from the ACS) with methods to deal appropriately with common tasks (e.g., creating and combining subgroups or geographies, automatic fetching of data via the Census API, mathematical operations on estimates, tests of significance, plots of confidence intervals).

  8. The Sloan Lens ACS Survey. XIII. Discovery of 40 New Galaxy-scale Strong Lenses

    NARCIS (Netherlands)

    Shu, Yiping; Brownstein, Joel R.; Bolton, Adam S.; Koopmans, Léon V. E.; Treu, Tommaso; Montero-Dorta, Antonio D.; Auger, Matthew W.; Czoske, Oliver; Gavazzi, Raphaël; Marshall, Philip J.; Moustakas, Leonidas A.

    2017-01-01

    We present the full sample of 118 galaxy-scale strong-lens candidates in the Sloan Lens ACS (SLACS) Survey for the Masses (S4TM) Survey, which are spectroscopically selected from the final data release of the Sloan Digital Sky Survey. Follow-up Hubble Space Telescope (HST) imaging observations

  9. The Sloan Lens ACS Survey. XII. Extending Strong Lensing to Lower Masses

    NARCIS (Netherlands)

    Shu, Yiping; Bolton, Adam S.; Brownstein, Joel R.; Montero-Dorta, Antonio D.; Koopmans, Léon V. E.; Treu, Tommaso; Gavazzi, Raphaël; Auger, Matthew W.; Czoske, Oliver; Marshall, Philip J.; Moustakas, Leonidas A.

    We present observational results from a new Hubble Space Telescope (HST) Snapshot program to extend the methods of the Sloan Lens ACS (SLACS) Survey to lower lens-galaxy masses. We discover 40 new galaxy-scale strong lenses, which we supplement with 58 previously discovered SLACS lenses. In

  10. Puerto Rico Revealed Preference Survey Data 2004

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Revealed preference models provide insights into recreational angler behavior and the economic value of recreational fishing trips. Revealed preference data is...

  11. VizieR Online Data Catalog: HST/ACS Coma Cluster Survey. X. (den Brok+, 2014)

    NARCIS (Netherlands)

    den Brok, M.; Peletier, R. F.; Seth, A.; Balcells, M.; Dominguez, L.; Graham, A. W.; Carter, D.; Erwin, P.; Ferguson, H. C.; Goudfrooij, P.; Guzman, R.; Hoyos, C.; Jogee, S.; Lucey, J.; Phillipps, S.; Puzia, T.; Valentijn, E.; Kleijn, G. V.; Weinzirl, T.

    2014-01-01

    The Coma ACS Survey (Carter et al., 2008ApJS..176..424C) provides data in two passbands for 25 fields pointed at the core of the Coma cluster and at the outskirts. The exposure times in the two passbands, F814W and F475W (which are roughly equivalent to the IC and g band) were ~1400 and ~2600s. The

  12. The Sloan Lens ACS Survey. I. A Large Spectroscopically Selected Sample of Massive Early-Type Lens Galaxies

    Science.gov (United States)

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Moustakas, Leonidas A.

    2006-01-01

    The Sloan Lens ACS (SLACS) Survey is an efficient Hubble Space Telescope (HST) Snapshot imaging survey for new galaxy-scale strong gravitational lenses. The targeted lens candidates are selected spectroscopically from the Sloan Digital Sky Survey (SDSS) database of galaxy spectra for having multiple nebular emission lines at a redshift significantly higher than that of the SDSS target galaxy. The SLACS survey is optimized to detect bright early-type lens galaxies with faint lensed sources in order to increase the sample of known gravitational lenses suitable for detailed lensing, photometric, and dynamical modeling. In this paper, the first in a series on the current results of our HST Cycle 13 imaging survey, we present a catalog of 19 newly discovered gravitational lenses, along with nine other observed candidate systems that are either possible lenses, nonlenses, or nondetections. The survey efficiency is thus >=68%. We also present Gemini 8 m and Magellan 6.5 m integral-field spectroscopic data for nine of the SLACS targets, which further support the lensing interpretation. A new method for the effective subtraction of foreground galaxy images to reveal faint background features is presented. We show that the SLACS lens galaxies have colors and ellipticities typical of the spectroscopic parent sample from which they are drawn (SDSS luminous red galaxies and quiescent MAIN sample galaxies), but are somewhat brighter and more centrally concentrated. Several explanations for the latter bias are suggested. The SLACS survey provides the first statistically significant and homogeneously selected sample of bright early-type lens galaxies, furnishing a powerful probe of the structure of early-type galaxies within the half-light radius. The high confirmation rate of lenses in the SLACS survey suggests consideration of spectroscopic lens discovery as an explicit science goal of future spectroscopic galaxy surveys.

  13. The HST/ACS Coma Cluster Survey. II. Data Description and Source Catalogs

    Science.gov (United States)

    Hammer, Derek; Kleijn, Gijs Verdoes; Hoyos, Carlos; Den Brok, Mark; Balcells, Marc; Ferguson, Henry C.; Goudfrooij, Paul; Carter, David; Guzman, Rafael; Peletier, Reynier F.; hide

    2010-01-01

    The Coma cluster, Abell 1656, was the target of a HST-ACS Treasury program designed for deep imaging in the F475W and F814W passbands. Although our survey was interrupted by the ACS instrument failure in early 2007, the partially-completed survey still covers approximately 50% of the core high density region in Coma. Observations were performed for twenty-five fields with a total coverage area of 274 aremin(sup 2), and extend over a wide range of cluster-centric radii (approximately 1.75 Mpe or 1 deg). The majority of the fields are located near the core region of Coma (19/25 pointings) with six additional fields in the south-west region of the cluster. In this paper we present SEXTRACTOR source catalogs generated from the processed images, including a detailed description of the methodology used for object detection and photometry, the subtraction of bright galaxies to measure faint underlying objects, and the use of simulations to assess the photometric accuracy and completeness of our catalogs. We also use simulations to perform aperture corrections for the SEXTRACTOR Kron magnitudes based only on the measured source flux and its half-light radius. We have performed photometry for 76,000 objects that consist of roughly equal numbers of extended galaxies and unresolved objects. Approximately two-thirds of all detections are brighter than F814W=26.5 mag (AB), which corresponds to the 10sigma, point-source detection limit. We estimate that Coma members are 5-10% of the source detections, including a large population of compact objects (primarily GCs, but also cEs and UCDs), and a wide variety of extended galaxies from cD galaxies to dwarf low surface brightness galaxies. The initial data release for the HST-ACS Coma Treasury program was made available to the public in August 2008. The images and catalogs described in this study relate to our second data release.

  14. The Sloan Lens ACS survey. IV. The mass density profile of early-type galaxies out to 100 effective radii

    NARCIS (Netherlands)

    Gavazzi, Raphael; Treu, Tommaso; Rhodes, Jason D.; Koopmans, Leon V. E.; Bolton, Adam S.; Burles, Scott; Massey, Richard J.; Moustakas, Leonidas A.

    2007-01-01

    We present a weak-lensing analysis of 22 early-type (strong) lens galaxies, based on deep HST images obtained as part of the Sloan Lens ACS Survey. Using advanced techniques to control systematic uncertainties, we show that weak-lensing signal is detected out to similar to 300 h(-1) kpc (at the mean

  15. Design and Specification of Optical Bandpass Filters for Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS)

    Science.gov (United States)

    Leviton, Douglas B.; Tsevetanov, Zlatan; Woodruff, Bob; Mooney, Thomas A.

    1998-01-01

    Advanced optical bandpass filters for the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) have been developed on a filter-by-filter basis through detailed studies which take into account the instrument's science goals, available optical filter fabrication technology, and developments in ACS's charge-coupled-device (CCD) detector technology. These filters include a subset of filters for the Sloan Digital Sky Survey (SDSS) which are optimized for astronomical photometry using today's charge-coupled-devices (CCD's). In order for ACS to be truly advanced, these filters must push the state-of-the-art in performance in a number of key areas at the same time. Important requirements for these filters include outstanding transmitted wavefront, high transmittance, uniform transmittance across each filter, spectrally structure-free bandpasses, exceptionally high out of band rejection, a high degree of parfocality, and immunity to environmental degradation. These constitute a very stringent set of requirements indeed, especially for filters which are up to 90 mm in diameter. The highly successful paradigm in which final specifications for flight filters were derived through interaction amongst the ACS Science Team, the instrument designer, the lead optical engineer, and the filter designer and vendor is described. Examples of iterative design trade studies carried out in the context of science needs and budgetary and schedule constraints are presented. An overview of the final design specifications for the ACS bandpass and ramp filters is also presented.

  16. The Sloan Lens ACS Survey. XIII. Discovery of 40 New Galaxy-scale Strong Lenses

    Science.gov (United States)

    Shu, Yiping; Brownstein, Joel R.; Bolton, Adam S.; Koopmans, Léon V. E.; Treu, Tommaso; Montero-Dorta, Antonio D.; Auger, Matthew W.; Czoske, Oliver; Gavazzi, Raphaël; Marshall, Philip J.; Moustakas, Leonidas A.

    2017-12-01

    We present the full sample of 118 galaxy-scale strong-lens candidates in the Sloan Lens ACS (SLACS) Survey for the Masses (S4TM) Survey, which are spectroscopically selected from the final data release of the Sloan Digital Sky Survey. Follow-up Hubble Space Telescope (HST) imaging observations confirm that 40 candidates are definite strong lenses with multiple lensed images. The foreground-lens galaxies are found to be early-type galaxies (ETGs) at redshifts 0.06–0.44, and background sources are emission-line galaxies at redshifts 0.22–1.29. As an extension of the SLACS Survey, the S4TM Survey is the first attempt to preferentially search for strong-lens systems with relatively lower lens masses than those in the pre-existing strong-lens samples. By fitting HST data with a singular isothermal ellipsoid model, we find that the total projected mass within the Einstein radius of the S4TM strong-lens sample ranges from 3 × 1010 M ⊙ to 2 × 1011 M ⊙. In Shu et al., we have derived the total stellar mass of the S4TM lenses to be 5 × 1010 M ⊙ to 1 × 1012 M ⊙. Both the total enclosed mass and stellar mass of the S4TM lenses are on average almost a factor of 2 smaller than those of the SLACS lenses, which also represent the typical mass scales of the current strong-lens samples. The extended mass coverage provided by the S4TM sample can enable a direct test, with the aid of strong lensing, for transitions in scaling relations, kinematic properties, mass structure, and dark-matter content trends of ETGs at intermediate-mass scales as noted in previous studies. Based on observations made with the NASA/ESA Hubble Space Telescope (HST), obtained at the Space Telescope Science Institute, which is operated by AURA, Inc., under NASA contract NAS 5-26555. These observations are associated with HST program #12210.

  17. Technical Aspects of the Advanced Camera For Surveys Repair (ACS-R)

    Science.gov (United States)

    Rinehart, Stephen; Cheng, Edward S.; Sirianni, Marco

    2008-01-01

    The ACS Repair (ACS-R) team includes contributors from NASA's Goddard Space Flight Center, Ball Aerospace, and Teledyne Imaging Sensors; It determined that all of the capabilities of the ACS could be restored and created a concept for the ACS-R component of SN4. ACSR will restore the WFC of ACS by replacing the existing CCD Electronics Box (CEB) with the CEB-Replacement (CEB-R) and providing power from a new Low Voltage Power Supply Replacement (LVPS-8). The new LVPS-R will also attempt to restore the HRC function by providing power through the original power bus. In this presentation, we faeus on the concept and technical aspects of the ACS-R.

  18. A Survey of Electronic Serials Managers Reveals Diversity in Practice

    Directory of Open Access Journals (Sweden)

    Laura Costello

    2014-09-01

    Full Text Available A Review of: Branscome, B. A. (2013. Management of electronic serials in academic libraries: The results of an online survey. Serials Review, 39(4, 216-226. http://dx.doi.org/10.1016/j.serrev.2013.10.004 Abstract Objective – To examine industry standards for the management of electronic serials and measure the adoption of electronic serials over print. Design – Survey questionnaire. Setting – Email lists aimed at academic librarians working in serials management. Subjects – 195 self-selected subscribers to serials email lists. Methods – The author created a 20 question survey that consisted primarily of closed-ended questions pertaining to the collection demographics, staff, budget, and tools of serials management groups in academic libraries. The survey was conducted via Survey Monkey and examined using the analytical features of the tool. Participants remained anonymous and the survey questions did not ask them to reveal identifiable information about their libraries. Main Results – Collection demographics questions revealed that 78% of surveyed librarians estimated that print-only collections represented 40% or fewer of their serials holdings. The author observed diversity in the factors that influence print to digital transitions in academic libraries. However 71.5% of participants indicated that publisher technology support like IP authentication was required before adopting digital subscriptions. A lack of standardization also marked serials workflows, department responsibilities, and department titles. The author did not find a correlation between serials budget and the enrollment size of the institution. Participants reported that they used tools from popular serials management vendors like Serials Solutions, Innovative Interfaces, EBSCO, and Ex Libris, but most indicated that they used more than one tool for serials management. Participants specified 52 unique serials management products used in their libraries. Conclusion

  19. Metabolic Network Analysis and Metatranscriptomics Reveal Auxotrophies and Nutrient Sources of the Cosmopolitan Freshwater Microbial Lineage acI.

    Science.gov (United States)

    Hamilton, Joshua J; Garcia, Sarahi L; Brown, Brittany S; Oyserman, Ben O; Moya-Flores, Francisco; Bertilsson, Stefan; Malmstrom, Rex R; Forest, Katrina T; McMahon, Katherine D

    2017-01-01

    An explosion in the number of available genome sequences obtained through metagenomics and single-cell genomics has enabled a new view of the diversity of microbial life, yet we know surprisingly little about how microbes interact with each other or their environment. In fact, the majority of microbial species remain uncultivated, while our perception of their ecological niches is based on reconstruction of their metabolic potential. In this work, we demonstrate how the "seed set framework," which computes the set of compounds that an organism must acquire from its environment (E. Borenstein, M. Kupiec, M. W. Feldman, and E. Ruppin, Proc Natl Acad Sci U S A 105:14482-14487, 2008, https://doi.org/10.1073/pnas.0806162105), enables computational analysis of metabolic reconstructions while providing new insights into a microbe's metabolic capabilities, such as nutrient use and auxotrophies. We apply this framework to members of the ubiquitous freshwater actinobacterial lineage acI, confirming and extending previous experimental and genomic observations implying that acI bacteria are heterotrophs reliant on peptides and saccharides. We also present the first metatranscriptomic study of the acI lineage, revealing high expression of transport proteins and the light-harvesting protein actinorhodopsin. Putative transport proteins complement predictions of nutrients and essential metabolites while providing additional support of the hypothesis that members of the acI are photoheterotrophs. IMPORTANCE The metabolic activity of uncultivated microorganisms contributes to numerous ecosystem processes, ranging from nutrient cycling in the environment to influencing human health and disease. Advances in sequencing technology have enabled the assembly of genomes for these microorganisms, but our ability to generate reference genomes far outstrips our ability to analyze them. Common approaches to analyzing microbial metabolism require reconstructing the entirety of an organism

  20. The new galaxy evolution paradigm revealed by the Herschel surveys

    Science.gov (United States)

    Eales, Stephen; Smith, Dan; Bourne, Nathan; Loveday, Jon; Rowlands, Kate; van der Werf, Paul; Driver, Simon; Dunne, Loretta; Dye, Simon; Furlanetto, Cristina; Ivison, R. J.; Maddox, Steve; Robotham, Aaron; Smith, Matthew W. L.; Taylor, Edward N.; Valiante, Elisabetta; Wright, Angus; Cigan, Philip; De Zotti, Gianfranco; Jarvis, Matt J.; Marchetti, Lucia; Michałowski, Michał J.; Phillipps, Steven; Viaene, Sebastien; Vlahakis, Catherine

    2018-01-01

    The Herschel Space Observatory has revealed a very different galaxyscape from that shown by optical surveys which presents a challenge for galaxy-evolution models. The Herschel surveys reveal (1) that there was rapid galaxy evolution in the very recent past and (2) that galaxies lie on a single Galaxy Sequence (GS) rather than a star-forming 'main sequence' and a separate region of 'passive' or 'red-and-dead' galaxies. The form of the GS is now clearer because far-infrared surveys such as the Herschel ATLAS pick up a population of optically red star-forming galaxies that would have been classified as passive using most optical criteria. The space-density of this population is at least as high as the traditional star-forming population. By stacking spectra of H-ATLAS galaxies over the redshift range 0.001 < z < 0.4, we show that the galaxies responsible for the rapid low-redshift evolution have high stellar masses, high star-formation rates but, even several billion years in the past, old stellar populations - they are thus likely to be relatively recent ancestors of early-type galaxies in the Universe today. The form of the GS is inconsistent with rapid quenching models and neither the analytic bathtub model nor the hydrodynamical EAGLE simulation can reproduce the rapid cosmic evolution. We propose a new gentler model of galaxy evolution that can explain the new Herschel results and other key properties of the galaxy population.

  1. Optical Metrology for the Filter Set for the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS)

    Science.gov (United States)

    Leviton, Douglas B.; Boucarut, Rene A.; Content, David A.; Keski-Kuha, Ritva A.; Krebs, Carolyn A.; Miner, Linda A.; Norton, Todd A.; Mehalick, Kimberly; Petrone, Peter; Bush, Frank D.; hide

    1998-01-01

    The Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) will employ a wide variety of spectral filtration components including narrow band, medium band, wide band, and far ultraviolet (FUV) long pass filters, spatially- variable filters (ramp filters), VIS/IR polarizers, NUV polarizers, FUV prisms, and a grism. These components are spread across ACS's Wide Field, High Resolution, and Solar Blind channels which provide diffraction-limited imaging of astronomical targets using aberration-correcting optics which remove most aberrations from HST's Optical Telescope Assembly (OTA). In order for ACS to be truly advanced, these filters must push the state-of-the-art in performance in a number of key areas at the same time. Important requirements which these filters must meet include outstanding transmitted wavefront, high transmittance, uniform transmittance across each filter, spectrally structure-free bandpasses, exceptionally high out of band rejection, and a high degree of parfocality. These constitute a very stringent set of requirements indeed, especially for filters which are up to 90 mm in diameter. The development of optical metrology stations used to demonstrate that each ACS filter will meet its design specifications is discussed. Of particular note are specially-designed spectral transmissometers and interferometers.

  2. The HST/ACS Grism Parallel Survey: II. First Results and a Catalog of Faint Emission-Line Galaxies at z < 1.6

    OpenAIRE

    Drozdovsky, Igor; Yan, Lin; Chen, Hsiao-Wen; Stern, Daniel; Kennicutt Jr., Robert; Spinrad, Hyron; Dawson, Steve

    2005-01-01

    We present the first results from the HST/ACS Grism Parallel Survey, a large program obtaining deep, slitless ACS grism spectroscopy of high-latitude HST parallel fields. We report on 11 high Galactic latitude fields here, each with grism integration times >12 ks. We identify 601 compact emission line galaxies at z 5 E-18 ergs/cm^2/s (3 sigma). We determine redshifts by cross correlation of the target spectra with template spectra, followed ...

  3. Novel acsF Gene Primers Revealed a Diverse Phototrophic Bacterial Population, Including Gemmatimonadetes, in Lake Taihu (China)

    DEFF Research Database (Denmark)

    Huang, Yili; Zeng, Yanhua; Lu, Hang

    2016-01-01

    a diverse community of phototrophic Gemmatimonadetes forming 30 operational taxonomic units. These species represented 10.5 and 17.3% of the acsF reads in the upper semiaerobic sediment and anoxic sediment, whereas their abundance in the water column was ...Seq sequencing of the 16S rRNA, pufM, and bchY genes was carried out to assess the diversity of local phototrophic communities. In addition, we designed new degenerate primers of aerobic cyclase gene acsF, which serves as a convenient marker for both phototrophic Gemmatimonadetes and phototrophic Proteobacteria...... fundamental biological processes on Earth. Recently, the presence of photosynthetic reaction centers has been reported from a rarely studied bacterial phylum, Gemmatimonadetes, but almost nothing is known about the diversity and environmental distribution of these organisms. The newly designed acsF primers...

  4. The ACS survey of Galactic globular clusters - XIV. Bayesian single-population analysis of 69 globular clusters

    Science.gov (United States)

    Wagner-Kaiser, R.; Sarajedini, A.; von Hippel, T.; Stenning, D. C.; van Dyk, D. A.; Jeffery, E.; Robinson, E.; Stein, N.; Anderson, J.; Jefferys, W. H.

    2017-06-01

    We use Hubble Space Telescope (HST) imaging from the ACS Treasury Survey to determine fits for single population isochrones of 69 Galactic globular clusters. Using robust Bayesian analysis techniques, we simultaneously determine ages, distances, absorptions and helium values for each cluster under the scenario of a 'single' stellar population on model grids with solar ratio heavy element abundances. The set of cluster parameters is determined in a consistent and reproducible manner for all clusters using the Bayesian analysis suite BASE-9. Our results are used to re-visit the age-metallicity relation. We find correlations with helium and several other parameters such as metallicity, binary fraction and proxies for cluster mass. The helium abundances of the clusters are also considered in the context of carbon, nitrogen, and oxygen abundances and the multiple population scenario.

  5. THE HST/ACS COMA CLUSTER SURVEY. VIII. BARRED DISK GALAXIES IN THE CORE OF THE COMA CLUSTER

    Energy Technology Data Exchange (ETDEWEB)

    Marinova, Irina; Jogee, Shardha; Weinzirl, Tim [Department of Astronomy, University of Texas at Austin, Austin, TX (United States); Erwin, Peter [Max-Planck-Insitut fuer extraterrestrische Physik, Giessenbachstrasse, 85748 Garching (Germany); Trentham, Neil [Institute of Astronomy, Madingley Road, Cambridge, CB3 0HA (United Kingdom); Ferguson, Henry C.; Goudfrooij, Paul [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Hammer, Derek [Department of Physics and Astronomy, Johns Hopkins, Baltimore, MD 21218 (United States); Den Brok, Mark; Peletier, Reynier F.; Kleijn, Gijs V. [Kapteyn Astronomical Institute, University of Groningen, Groningen (Netherlands); Graham, Alister W. [Centre for Astrophysics and Supercomputing, Swinburne University, Hawthorn (Australia); Carter, David; Mouhcine, Mustapha [Astrophysics Research Institute, Liverpool John Moores University, Birkenhead (United Kingdom); Balcells, Marc [Instituto de Astrofisica de Canarias, 38200 La Laguna, Tenerife (Spain); Guzman, Rafael; Hoyos, Carlos [Department of Astronomy, University of Florida, Gainesville, FL 32611 (United States); Mobasher, Bahram [Department of Physics and Astronomy, University of California, Riverside, CA 92521 (United States); Peng, Eric W., E-mail: marinova@astro.as.utexas.edu, E-mail: sj@astro.as.utexas.edu [Department of Astronomy, Peking University, Beijing 100871 (China)

    2012-02-20

    We use high-resolution ({approx}0.''1) F814W Advanced Camera for Surveys (ACS) images from the Hubble Space Telescope ACS Treasury survey of the Coma cluster at z {approx} 0.02 to study bars in massive disk galaxies (S0s), as well as low-mass dwarf galaxies in the core of the Coma cluster, the densest environment in the nearby universe. Our study helps to constrain the evolution of bars and disks in dense environments and provides a comparison point for studies in lower density environments and at higher redshifts. Our results are: (1) we characterize the fraction and properties of bars in a sample of 32 bright (M{sub V} {approx}< -18, M{sub *} > 10{sup 9.5} M{sub Sun }) S0 galaxies, which dominate the population of massive disk galaxies in the Coma core. We find that the measurement of a bar fraction among S0 galaxies must be handled with special care due to the difficulty in separating unbarred S0s from ellipticals, and the potential dilution of the bar signature by light from a relatively large, bright bulge. The results depend sensitively on the method used: the bar fraction for bright S0s in the Coma core is 50% {+-} 11%, 65% {+-} 11%, and 60% {+-} 11% based on three methods of bar detection, namely, strict ellipse fit criteria, relaxed ellipse fit criteria, and visual classification. (2) We compare the S0 bar fraction across different environments (the Coma core, A901/902, and Virgo) adopting the critical step of using matched samples and matched methods in order to ensure robust comparisons. We find that the bar fraction among bright S0 galaxies does not show a statistically significant variation (within the error bars of {+-}11%) across environments which span two orders of magnitude in galaxy number density (n {approx} 300-10,000 galaxies Mpc{sup -3}) and include rich and poor clusters, such as the core of Coma, the A901/902 cluster, and Virgo. We speculate that the bar fraction among S0s is not significantly enhanced in rich clusters compared to

  6. THE ACS NEARBY GALAXY SURVEY TREASURY. XI. THE REMARKABLY UNDISTURBED NGC 2403 DISK

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Benjamin F.; Dalcanton, Julianne J.; Stilp, Adrienne; Radburn-Smith, David [Department of Astronomy, Box 351580, University of Washington, Seattle, WA 98195 (United States); Dolphin, Andrew [Raytheon, 1151 E. Hermans Road, Tucson, AZ 85706 (United States); Skillman, Evan D., E-mail: ben@astro.washington.edu, E-mail: jd@astro.washington.edu, E-mail: adrienne@astro.washington.edu, E-mail: dolphin@raytheon.com, E-mail: skillman@astro.umn.edu [Department of Astronomy, University of Minnesota, 116 Church St. SE, Minneapolis, MN 55455 (United States)

    2013-03-10

    We present detailed analysis of color-magnitude diagrams of NGC 2403, obtained from a deep (m {approx}< 28) Hubble Space Telescope (HST) Wide Field Planetary Camera 2 observation of the outer disk of NGC 2403, supplemented by several shallow (m {approx}< 26) HST Advanced Camera for Surveys fields. We derive the spatially resolved star formation history of NGC 2403 out to 11 disk scale lengths. In the inner portions of the galaxy, we compare the recent star formation rates (SFRs) we derive from the resolved stars with those measured using GALEX FUV + Spitzer 24{mu} fluxes, finding excellent agreement between the methods. Our measurements also show that the radial gradient in recent SFR mirrors the disk exponential profile to 11 scale lengths with no break, extending to SFR densities a factor of {approx}100 lower than those that can be measured with GALEX and Spitzer ({approx}2 Multiplication-Sign 10{sup -6} M{sub Sun} yr{sup -1} kpc{sup -2}). Furthermore, we find that the cumulative stellar mass of the disk was formed at similar times at all radii. We compare these characteristics of NGC 2403 to those of its ''morphological twins'', NGC 300 and M 33, showing that the structure and age distributions of the NGC 2403 disk are more similar to those of the relatively isolated system NGC 300 than to those of the Local Group analog M 33. We also discuss the environments and HI morphologies of these three nearby galaxies, comparing them to integrated light studies of larger samples of more distant galaxy disks. Taken together, the physical properties and evolutionary history of NGC 2403 suggest that the galaxy has had no close encounters with other M 81 group members and may be falling into the group for the first time.

  7. THE ACS VIRGO CLUSTER SURVEY. XVII. THE SPATIAL ALIGNMENT OF GLOBULAR CLUSTER SYSTEMS WITH EARLY-TYPE HOST GALAXIES

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qiushi; Peng, Eric W. [Department of Astronomy, Peking University, Beijing 100871 (China); Blakeslee, John P.; Cote, Patrick; Ferrarese, Laura [Herzberg Institute of Astrophysics, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Jordan, Andres [Departamento de Astronomia y Astrofisica, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Mei, Simona [University of Paris 7 Denis Diderot, F-75205 Paris Cedex 13 (France); West, Michael J., E-mail: peng@pku.edu.cn [Maria Mitchell Observatory, 4 Vestal Street, Nantucket, MA 02554 (United States)

    2013-06-01

    We study the azimuthal distribution of globular clusters (GCs) in early-type galaxies and compare them to their host galaxies using data from the ACS Virgo Cluster Survey. We find that in host galaxies with visible elongation ({epsilon} > 0.2) and intermediate to high luminosities (M{sub z} < -19), the GCs are preferentially aligned along the major axis of the stellar light. The red (metal-rich) GC subpopulations show strong alignment with the major axis of the host galaxy, which supports the notion that these GCs are associated with metal-rich field stars. The metal-rich GCs in lenticular galaxies show signs of being more strongly associated with disks rather than bulges. Surprisingly, we also find that the blue (metal-poor) GCs can also show the same correlation. If the metal-poor GCs are part of the early formation of the halo and built up through mergers, then our results support a picture where halo formation and merging occur anisotropically, and that the present-day major axis is an indicator of the preferred merging axis.

  8. The ACS Virgo Cluster Survey XV. The Formation Efficiencies of Globular Clusters in Early-Type Galaxies: The Effects of Mass and Environment

    OpenAIRE

    Peng, Eric W.; Jordan, Andres; Cote, Patrick; Takamiya, Marianne; West, Michael J.; Blakeslee, John P.; Chen, Chin-Wei; Ferrarese, Laura; Mei, Simona; Tonry, John L.; West, Andrew A.

    2008-01-01

    The fraction of stellar mass contained in globular clusters (GCs), also measured by number as the specific frequency, is a fundamental quantity that reflects both a galaxy's early star formation and its entire merging history. We present specific frequencies, luminosities, and mass fractions for the globular cluster systems of 100 early-type galaxies in the ACS Virgo Cluster Survey, the largest homogeneous catalog of its kind. We find that 1) GC mass fractions can be high in both giants and d...

  9. Study of a twisted ATLAS SCT Barrel deformation as revealed by a photogrammetric survey

    CERN Document Server

    Dobson, E; Heinemann, F; Karagoz-Unel, M

    2007-01-01

    A photogrammetry survey on the SCT barrels was performed as an engineering check on the structure of the ATLAS Semiconductor Tracker (SCT) shortly after construction. Analysis of the data obtained revealed small scale elliptical deformation as well as a twist of the structure. The results of the survey are presented as well as interpolation of the measured targets to the module positions and a comparison with track based alignment measurements.

  10. Survey reveals public open to ban on hand-held cell phone use and texting.

    Science.gov (United States)

    2013-01-01

    A study performed by the Bureau of Transportation Statistics : (BTS) reveals that the public is open to a ban on : hand-held cell phone use while driving. The study is based : on data from 2009s Omnibus Household Survey (OHS), : which is administe...

  11. The Hubble Space Telescope UV Legacy Survey of Galactic Globular Clusters. XIII. ACS/WFC Parallel-Field Catalogues★

    Science.gov (United States)

    Simioni, M.; Bedin, L. R.; Aparicio, A.; Piotto, G.; Milone, A. P.; Nardiello, D.; Anderson, J.; Bellini, A.; Brown, T. M.; Cassisi, S.; Cunial, A.; Granata, V.; Ortolani, S.; van der Marel, R. P.; Vesperini, E.

    2018-01-01

    As part of the Hubble Space Telescope UV Legacy Survey of Galactic Globular Clusters, 110 parallel fields were observed with the Wide Field Channel of the Advanced Camera for Surveys, in the outskirts of 48 globular clusters, plus the open cluster NGC 6791. Totalling about 0.3 square degrees of observed sky, this is the largest homogeneous Hubble Space Telescope photometric survey of Galalctic globular clusters outskirts to date. In particular, two distinct pointings have been obtained for each target on average, all centred at about 6.5 arcmin from the cluster centre, thus covering a mean area of about 23 arcmin2 for each globular cluster. For each field, at least one exposure in both F475W and F814W filters was collected. In this work, we publicly release the astrometric and photometric catalogues and the astrometrised atlases for each of these fields.

  12. The sloan lens acs survey. II. Stellar populations and internal structure of early-type lens galaxies

    NARCIS (Netherlands)

    Treu, Tommaso; Koopmans, Léon V.; Bolton, Adam S.; Burles, Scott; Moustakas, Leonidas A.

    2006-01-01

    We use HST images to derive effective radii and effective surface brightnesses of 15 early-type (E+S0) lens galaxies identified by the SLACS Survey. Our measurements are combined with stellar velocity dispersions from the SDSS database to investigate for the first time the distribution of lens

  13. Lidar surveys reveal eruptive volumes and rates at Etna, 2007-2010

    Science.gov (United States)

    Behncke, Boris; Fornaciai, Alessandro; Neri, Marco; Favalli, Massimiliano; Ganci, Gaetana; Mazzarini, Francesco

    2016-05-01

    The quantification of eruptive activity represents one major challenge in volcanology. Digital comparison of lidar-based elevation models of Etna (Italy) was made to quantify the volumes of volcanics emitted in 2007-2010. During this period, Etna produced several summit paroxysms followed by a flank eruption. We integrated the total volume difference resulting from the subtraction of the 2007 and 2010 digital elevation models with volumes of eruptive products based on field and aerial surveys to attribute volumes with hitherto unrealized precision to poorly constrained eruptions. The total erupted volume of 2007-2010 is >86 × 106 m3, most (~74 × 106 m3) of which is made up by the lava flows of the 2008-2009 flank eruption. The survey also reveals the high lava volume (5.73 × 106 m3) and average eruption rate (~400 m3 s-1) of the 10 May 2008 paroxysm, whose flow front stopped 6.2 km from the vent, not far from the town of Zafferana Etnea.

  14. Volcanic Processes, and Possible Precursors of Eruptions at Etna and Stromboli Volcanoes Revealed by Thermal Surveys

    Science.gov (United States)

    Calvari, S.

    2007-05-01

    Thermal imaging has recently been introduced in volcanology to analyze a number of different volcanic processes. This system allows us to detect magma movements within the summit conduits of volcanoes, and then to reveal volcanic activity within the craters even through the thick curtain of gases usually released by active volcanoes such as Mt Etna and Stromboli. Thermal mapping is essential during effusive eruptions, since it distinguishes lava flows of different age and concealed lava tubes' path, improving hazard evaluation. Recently, thermal imaging has also been applied to reveal failure planes and instability on the flanks of active volcanoes. Excellent results have been obtained in terms of volcanic prediction during the eruptions of Mt Etna and Stromboli occurred in 2002-2003. On Etna, thermal images monthly recorded on the summit of the volcano revealed the opening of fissure systems several months in advance. At Stromboli, helicopter-borne thermal surveys allowed us to recognize the opening of fractures one hour before the large failure that caused severe destruction on the island on 30 December 2002. The INGV - Sezione di Catania started in 2001 to monitor active volcanoes using a hand-held thermal camera. This instrument was used in field and from helicopter to detect any thermal anomaly recorded on the surface of active volcanoes, and has since been applied to a number of eruptions and eruptive processes. After the two major eruptions at Etna and Stromboli, fixed thermal cameras have been installed on Stromboli, Etna and Vulcano, allowing us to keep under control the eruptive activity, flank stability and ash emission. On Etna, we have monitored the 2002-03, 2004-05, July 2006 and August-December 2006 eruptions. On Stromboli, thermal surveys from helicopter allowed us to follow the propagation of ephemeral vents and thus the path of hidden lava tubes, as well as the stages of inflation and deflation of the upper lava flow field. Thermal cameras have

  15. Village energy survey reveals missing rural raw coal in northern China: Significance in science and policy.

    Science.gov (United States)

    Zhi, Guorui; Zhang, Yayun; Sun, Jianzhong; Cheng, Miaomiao; Dang, Hongyan; Liu, Shijie; Yang, Junchao; Zhang, Yuzhe; Xue, Zhigang; Li, Shuyuan; Meng, Fan

    2017-04-01

    Burning coal for winter heating has been considered a major contributor to northern China's winter haze, with the district heating boilers holding the balance. However a decade of intensive efforts on district heating boilers brought few improvements to northern China's winter air quality, arousing a speculation that the household heating stoves mainly in rural area rather than the district heating boilers mainly in urban area dominate coal emissions in winter. This implies an extreme underestimation of rural household coal consumption by the China Energy Statistical Yearbooks (CESYs), although direct evidence supporting this speculation is lacking. A village energy survey campaign was launched to gather the firsthand information on household coal consumption in the rural areas of two cities, Baoding (in Hebei province) and Beijing (the capital of China). The survey data show that the rural raw coal consumption in Baoding (5.04 × 103 kt) was approximately 6.5 times the value listed in the official CESY 2013 and exceeded the rural total of whole Hebei Province (4668 kt), revealing a huge amount of raw coal missing from the current statistical system. More importantly, rural emissions of particulate matter (PM) and SO2 from raw coal, which had never been included in widely distributing environmental statistical reports, were found higher than those from industrial and urban household sectors in the two cities in 2013, which highlights the importance of rural coal burning in creating northern China's heavy haze and helps to explain why a number of modeling predictions on ambient pollutant concentrations based on normal emission inventories were more bias-prone in winter season than in other seasons. We therefore recommend placing greater emphasis on the "missing" rural raw coal to help China in its long-term ambition to achieve clean air in the context of rapid economic development. Copyright © 2017 Elsevier Ltd. All rights reserved.

  16. A prospective survey of the characteristics, treatments and outcomes of patients with acute coronary syndromes in Europe and the Mediterranean basin; the Euro Heart Survey of Acute Coronary Syndromes (Euro Heart Survey ACS)

    NARCIS (Netherlands)

    D. Hasdai (David); S. Behar (Solomon); L.C. Wallentin (Lars); N. Danchin (Nicolas); A.K. Gitt (Anselm); P.M. Fioretti (Paolo); M.L. Simoons (Maarten); A. Battler (Alexander); H. Boersma (Eric)

    2002-01-01

    textabstractAIMS: To better delineate the characteristics, treatments, and outcomes of patients with acute coronary syndromes (ACS) in representative countries across Europe and the Mediterranean basin, and to examine adherence to current guidelines. METHODS AND RESULTS: We performed a prospective

  17. ROV advanced magnetic survey for revealing archaeological targets and estimating medium magnetization

    Science.gov (United States)

    Eppelbaum, Lev

    2013-04-01

    Magnetic survey is one of most applied geophysical method for searching and localization of any objects with contrast magnetic properties (for instance, in Israel detailed magneric survey has been succesfully applied at more than 60 archaeological sites (Eppelbaum, 2010, 2011; Eppelbaum et al., 2011, 2010)). However, land magnetic survey at comparatively large archaeological sites (with observation grids 0.5 x 0.5 or 1 x 1 m) may occupy 5-10 days. At the same time the new Remote Operation Vehicle (ROV) generation - small and maneuvering vehicles - can fly at levels of few (and even one) meters over the earth's surface (flowing the relief forms or straight). Such ROV with precise magnetic field measurements (with a frequency of 20-25 observations per second) may be performed during 10-30 minutes, moreover at different levels over the earth's surface. Such geophysical investigations should have an extremely low exploitation cost. Finally, measurements of geophysical fields at different observation levels could provide new unique geophysical-archaeological information (Eppelbaum, 2005; Eppelbaum and Mishne, 2011). The developed interpretation methodology for magnetic anomalies advanced analysis (Khesin et al., 1996; Eppelbaum et al., 2001; Eppelbaum et al., 2011) may be successfully applied for ROV magnetic survey for delineation of archaeological objects and estimation averaged magnetization of geological medium. This methodology includes: (1) non-conventional procedure for elimination of secondary effect of magnetic temporary variations, (2) calculation of rugged relief influence by the use of a correlation method, (3) estimation of medium magnetization, (4) application of various informational and wavelet algorithms for revealing low anomalous effects against the strong noise background, (5) advanced procedures for magnetic anomalies quantitative analysis (they are applicable in conditions of rugged relief, inclined magnetization, and an unknown level of the total

  18. Bees for development: Brazilian survey reveals how to optimize stingless beekeeping.

    Science.gov (United States)

    Jaffé, Rodolfo; Pope, Nathaniel; Torres Carvalho, Airton; Madureira Maia, Ulysses; Blochtein, Betina; de Carvalho, Carlos Alfredo Lopes; Carvalho-Zilse, Gislene Almeida; Freitas, Breno Magalhães; Menezes, Cristiano; Ribeiro, Márcia de Fátima; Venturieri, Giorgio Cristino; Imperatriz-Fonseca, Vera Lucia

    2015-01-01

    Stingless bees are an important asset to assure plant biodiversity in many natural ecosystems, and fulfill the growing agricultural demand for pollination. However, across developing countries stingless beekeeping remains an essentially informal activity, technical knowledge is scarce, and management practices lack standardization. Here we profited from the large diversity of stingless beekeepers found in Brazil to assess the impact of particular management practices on productivity and economic revenues from the commercialization of stingless bee products. Our study represents the first large-scale effort aiming at optimizing stingless beekeeping for honey/colony production based on quantitative data. Survey data from 251 beekeepers scattered across 20 Brazilian States revealed the influence of specific management practices and other confounding factors over productivity and income indicators. Specifically, our results highlight the importance of teaching beekeepers how to inspect and feed their colonies, how to multiply them and keep track of genetic lineages, how to harvest and preserve the honey, how to use vinegar traps to control infestation by parasitic flies, and how to add value by labeling honey containers. Furthermore, beekeeping experience and the network of known beekeepers were found to be key factors influencing productivity and income. Our work provides clear guidelines to optimize stingless beekeeping and help transform the activity into a powerful tool for sustainable development.

  19. A Molecular Survey of Ulva (Chlorophyta) in Temperate Australia Reveals Enhanced Levels of Cosmopolitanism.

    Science.gov (United States)

    Kirkendale, Lisa; Saunders, Gary W; Winberg, Pia

    2013-02-01

    The green algal genus Ulva includes a speciose group of marine macroalgae inhabiting shallow seas worldwide. Although algal blooms in Asia highlight the opportunistic nature of several "nuisance" species, recent research clearly reveals important positive benefits of Ulva. Applied research requires accurate, reliable, and rapid identification, however, identification of Ulva spp. has met with con-siderable difficulty. Consequently, many have turned to molecular markers to aid in taxonomy. Previous studies of plants and algae have relied heavily on ITS and rbcL. Recently, tufA has been presented as a suitable barcoding gene to facilitate species-level identification of green macroalgae and it is used here to explore the diversity of Ulva spp. in temperate Australia. Ninety Ulva specimens collected from 38 sites across five states were sequenced for this gene region with exemplars from each genetic group also sequenced for rbcL to test for congruence. Collections of Australian Ulva spp. were compared to samples from Asia and North America and exhibited trends consistent with recent studies in terms of species relationships. Results support an overwhelmingly cosmopolitan flora in temperate Australia that contrasts with other Australasian surveys of Ulva that report a greater number of endemics and new species. Four new records, as well as numerous range extensions for taxa already known from the country, are documented. Evidence for three nonindigenous Ulva species in temperate Australia is discussed. © 2012 Phycological Society of America.

  20. A SURVEY OF BANGIALES (RHODOPHYTA) BASED ON MULTIPLE MOLECULAR MARKERS REVEALS CRYPTIC DIVERSITY(1).

    Science.gov (United States)

    Kucera, Hana; Saunders, Gary W

    2012-08-01

    The Bangiales is a diverse order consisting of 28 species in Canada. Morphological simplicity and similarity among species has led to taxonomic confusion and the need for molecular techniques for species identification. This study is the first to employ the standardized DNA barcode marker COI-5P in a broad floristic survey of the Bangiales in Canadian marine waters. A total of 37 species were ultimately sequenced, 29 of which occurred in Canada. Molecular results led to the synonymization of Wildemania cuneiformis with W. amplissima, as well as the description of two new species: Porphyra corallicola sp. nov. and Pyropia peggicovensis sp. nov., and discovery of another five putative new species. Comparison of the performance of COI-5P as a species identification tool relative to rbcL (large subunit of ribulose-1,5-bisphosphate carboxylase oxygenase) and the UPA (universal plastid amplicon) revealed that, although each marker had strengths and weaknesses, the COI-5P showed the highest species-discriminatory power due to its high level of interspecific variation. The rbcL was further used to place the new species into a phylogenetic context, whereas UPA was not recommended for species identification in the Bangiales owing to within-individual heterogeneity between the two copies present in the plastid genomes in some lineages. © 2012 Phycological Society of America.

  1. Bees for development: Brazilian survey reveals how to optimize stingless beekeeping.

    Directory of Open Access Journals (Sweden)

    Rodolfo Jaffé

    Full Text Available Stingless bees are an important asset to assure plant biodiversity in many natural ecosystems, and fulfill the growing agricultural demand for pollination. However, across developing countries stingless beekeeping remains an essentially informal activity, technical knowledge is scarce, and management practices lack standardization. Here we profited from the large diversity of stingless beekeepers found in Brazil to assess the impact of particular management practices on productivity and economic revenues from the commercialization of stingless bee products. Our study represents the first large-scale effort aiming at optimizing stingless beekeeping for honey/colony production based on quantitative data. Survey data from 251 beekeepers scattered across 20 Brazilian States revealed the influence of specific management practices and other confounding factors over productivity and income indicators. Specifically, our results highlight the importance of teaching beekeepers how to inspect and feed their colonies, how to multiply them and keep track of genetic lineages, how to harvest and preserve the honey, how to use vinegar traps to control infestation by parasitic flies, and how to add value by labeling honey containers. Furthermore, beekeeping experience and the network of known beekeepers were found to be key factors influencing productivity and income. Our work provides clear guidelines to optimize stingless beekeeping and help transform the activity into a powerful tool for sustainable development.

  2. The LBT/WISSH quasar survey: revealing powerful winds in the most luminous AGN

    Science.gov (United States)

    Vietri, Giustina

    2017-01-01

    The systematic, multi-frequency investigation of hyper-luminous quasars shining at the golden epoch of AGN activity offers the unique opportunity of studying the power and the effect of AGN feedback at its extreme.The WISE/SDSS selected hyper-luminous (WISSH) quasar survey is an extensive multi-band observing program (from millimeter wavelengths to hard X rays) designed to accurately probe the role of nuclear activity in SMBH-galaxy self-regulated growth via extended outflows.Our on-going project aims at constraining both AGN and host galaxy ISM and star-formation properties in a large sample of ~ 90 broad-line quasars at the brightest end of the AGN luminosity function (L_bol > 1e14 L_sun), and at the peak of their number density (z ~ 2.5 - 3.5).I will review the most important results of the near-IR spectroscopic follow-up of WISSH quasars (available for ~40% of the total sample) performed with the LUCI at LBT. These observations were carried out to obtain a reliable Hbeta-based estimate of the SMBH masses and a census of the ionized outflows in these hyper-luminous quasars.We found that WISSH AGN are typically powered by highly accreting (0.3-3 Ledd), ten billion solar masses SMBHs, demonstrating that WISSH provides a simple and valuable tool to complete the census of the extreme SMBH population in the universe.We also succeeded in discovering [OIII] emission lines with a broad, skewed profile and exceptional luminosities (> 6e44 erg/s), tracing very powerful ionized outflows (up to ~4% of L_bol) in ~30% of the sample.Remarkably, the remaining 70% of quasars lacks [OIII] emission but shows strong winds traced by 3,000-8,000 km/s blueshifts of the high-ionization (CIV) with respect to low-ionization (Hbeta) broad emission lines, revealing strong radiatively driven winds that dominate the BLR kinematics.I will discuss the possible origins of this intriguing dichotomy which involves fundamental parameters such as bolometric luminosity, SMBH mass, Eddington ratio

  3. A Stacked aquifer system controlling the Vence landslide site (French Alps) revealed by hydrogeophysical surveying

    Science.gov (United States)

    Loock, Sebastien; Lebourg, Thomas; Zerate, Swann

    2010-05-01

    Since 2006, a temporal imagery of water circulation in a landslide was conducted by an Electrical Resistivity Tomography (ERT), rainfalls records and a piezometric survey to quantify the coupling between groundwater supply and circulation and landslide displacements recorded by tiltmetry since 2009. This work is based on a multi-scale experimental approach applied on the 'Vence' landslide (South-eastern France, Mediterranean climate) which is characterised by a sandy-clay sliding mass of Lower Eocene. It is considered as a translational landslide including 1.2×106m3 of material. This landslide affects an inhabited area about 250 m large by 350 m long, with an average slope of 12° /14° . The present day landslide activity is underlined by a variety of failure surfaces appearing in the landscape morphology: tension cracks, scarps, disorders affecting human activity and particularly the deviation of the 'Lubiane' river at the foot of the slope. The interpretation of the ERT profiles correlated with the field information confirm us the presence of the sliding surface towards 12 m depth i.e. at the contact between sliding sands and clays of Lower Eocene and Cretaceous calcareous formation. Moreover, ERT profiles display, under the sliding plane, vertical 'pits' with low resistivity, i.e. groundwater circulation, in the calcareous formation. Their occurrences on each ERT profiles were interpreted as NW-SE fault zones, typical of the regional fault network. After each precipitation, the piezometric level in the sandy-clay sliding aquifer increases gently (of the order of some cm in few days) except in December 2006, January 2008 and February 2009 where the water table increased around 150cm in few days accompanied with the strongest tiltmetric variations in 2009 and then fluctuated gently again after each precipitation. Thus the groundwater in the sliding aquifer comes from two different origins: (1) direct infiltration from precipitation on the aquifer explaining the

  4. The Zodiacal Dust Cloud Revealed by the AKARI IRC All-Sky Survey

    Science.gov (United States)

    Pyo, J.; Hong, S. S.; Kwon, S. M.; Ueno, M.; Ishiguro, M.; Usui, F.; Ootsubo, T.; Ishihara, D.; Mukai, T.

    2009-12-01

    From the AKARI mid-infrared survey observations, we have constructed all-sky brightness maps of the zodiacal emission (ZE) at 9 and 18 μm, and applied Fourier filtering to the maps. The filtered maps clearly demonstrate the asteroidal dust bands already discovered by IRAS and display new band features as well. For some of the broken, diffuse bands, the filtered ZE maps of AKARI are shown to deliver more detailed and clearer features than the ones of IRAS. This is because the AKARI survey covers the entire range of ecliptic longitude in both leading and trailing directions.

  5. Survey reveals marketers' belief that they're better prepared now

    Energy Technology Data Exchange (ETDEWEB)

    1990-10-01

    While a majority (57%) of LP-gas marketers have reported making noteworthy changes in their business during the last year in preparation for winter demand, it seems that fewer than one-third have increased their storage capacity. Furthermore, only 37% have contracted with additional suppliers, according to the survey presented.

  6. Survey of the Huntington's Disease Patient and Caregiver Community Reveals Most Impactful Symptoms and Treatment Needs.

    Science.gov (United States)

    Simpson, Jennifer A; Lovecky, Debra; Kogan, Jane; Vetter, Louise A; Yohrling, George J

    2016-12-15

    In preparation for a meeting with the U.S. Food and Drug Administration (FDA) on Patient-Focused Drug Development in Huntington's disease, the Huntington's Disease Society of America (HDSA) created and distributed two comprehensive surveys on the symptom experience and treatment approaches for Huntington's disease. The objective of these surveys was to identify the specific symptoms that most impact the daily lives of individuals with Huntington's disease/Juvenile Huntington's disease (HD/JHD) and their caregivers and to solicit input on the types of treatments desired by HD affected families. The data were shared with the FDA to offer background and insight in preparation for the patient-focused meeting, as well as to ensure representation by the community in a manner that would complement those who attended in person. Two distinct surveys were created using SurveyMonkey to capture patient and caregiver perspectives on HD symptoms and current treatments. HDSA distributed the surveys to the HD community in August and September 2014 and collected responses through January 2015. More than 3,600 responses to the two surveys were received. The data showed that both caregivers and individuals with HD were severely impacted by the cognitive and behavioral symptoms of HD with HD patients reporting problems with executive functioning and cognitive decline as most impactful to them. However, 30 percent of caregivers reported that chorea was the most impactful symptom compared to 17 percent of people with HD. Across all the symptom categories, patients reported a lower occurrence of symptoms than were reported by their caregivers. With only one drug approved for treatment of a symptom of Huntington's disease and no disease modifying treatments available, there is a critical need for new medicines to treat the cognitive, psychiatric and motor symptoms associated with HD. While the surveys did not capture risk/benefit data, the data collected do provide new insights around the

  7. Revealing Victimization: The Impact of Methodological Features in the National Crime Victimization Survey.

    Science.gov (United States)

    Owens, Jennifer Gatewood

    2017-08-01

    This study examines the impact of methodological features of the National Crime Victimization Survey (NCVS) on respondent willingness to report violent, serious violent, and property victimizations to the NCVS. Bounded and unbounded data from the 1999-2005 NCVS are used to create a longitudinal file of respondents, and survey-weighted logistic regression models are used to assess the factors associated with the reporting of victimization. Net of sociodemographic control variables, unbounded interviews produced higher estimates of serious violence (72%), violence (66%), and property victimization (67%). Mobile respondents reported higher estimates than nonmobile respondents of serious violence (48%), violence (35%), and property victimization (15%). Compared with in-person interviews, interviewing by telephone increased reporting for serious violence (7%), violence (12%), and property victimization (17%). This study highlights the importance of controlling for these factors in both longitudinal and cross-sectional analyses to estimate victimization risk.

  8. Survey of commercial Rhodiola products revealed species diversity and potential safety issues

    OpenAIRE

    Tianyi Xin; Xiaojin Li; Hui Yao; Yulin Lin; Xiaochong Ma; Ruiyang Cheng; Jingyuan Song; Lianghong Ni; Congzhao Fan; Shilin Chen

    2015-01-01

    The adulteration of herbal products is a threat to consumer safety. Here we surveyed the species composition of commercial Rhodiola products using DNA barcoding as a supervisory method. A Rhodiola dietary supplement DNA barcode database was successfully constructed using 82 voucher samples from 10 Rhodiola species. Based on the DNA barcoding standard operating procedure (SOP), we used this database to identify 100 Rhodiolae Crenulatae Radix et Rhizoma decoction piece samples that were purchas...

  9. Long-Term Survey Is Necessary to Reveal Various Shifts of Microbial Composition in Corals

    Directory of Open Access Journals (Sweden)

    Shan-Hua Yang

    2017-06-01

    Full Text Available The coral holobiont is the assemblage of coral host and its microbial symbionts, which functions as a unit and is responsive to host species and environmental factors. Although monitoring surveys have been done to determine bacteria associated with coral, none have persisted for >1 year. Therefore, potential variations in minor or dominant community members that occur over extended intervals have not been characterized. In this study, 16S rRNA gene amplicon pyrosequencing was used to investigate the relationship between bacterial communities in healthy Stylophora pistillata in tropical and subtropical Taiwan over 2 years, apparently one of the longest surveys of coral-associated microbes. Dominant bacterial genera in S. pistillata had disparate changes in different geographical setups, whereas the constitution of minor bacteria fluctuated in abundance over time. We concluded that dominant bacteria (Acinetobacter, Propionibacterium, and Pseudomonas were stable in composition, regardless of seasonal and geographical variations, whereas Endozoicomonas had a geographical preference. In addition, by combining current data with previous studies, we concluded that a minor bacteria symbiont, Ralstonia, was a keystone species in coral. Finally, we concluded that long-term surveys for coral microbial communities were necessary to detect compositional shifts, especially for minor bacterial members in corals.

  10. What do consumer surveys and experiments reveal and conceal about consumer preferences for genetically modified foods?

    Science.gov (United States)

    Colson, Gregory; Rousu, Matthew C

    2013-01-01

    Assessing consumer perceptions and willingness to pay for genetically modified (GM) foods has been one of the most active areas of empirical research in agricultural economics. Researchers over the past 15 years have delivered well over 100 estimates of consumers' willingness to pay for GM foods using surveys and experimental methods. In this review, we explore a number of unresolved issues related to three questions that are critical when considering the sum of the individual contributions that constitute the evidence on consumer preferences for GM foods.

  11. California Condors AC2 and AC3

    African Journals Online (AJOL)

    AC8 4 Female of the Agua Blanca. Pair, taken into captivity on 6 June. 1986, released at Hopper Ranch on. 28 March 2000, shot by pig hunter on. Tejon Ranch in February 2003. SB#. 12. 4. AC9 - First chick ever seen hatched by the newly formed Condor Research. Center in 1980, captured for captive breeding on 19 April ...

  12. Continent-wide survey reveals massive decline in African savannah elephants

    Directory of Open Access Journals (Sweden)

    Michael J. Chase

    2016-08-01

    Full Text Available African elephants (Loxodonta africana are imperiled by poaching and habitat loss. Despite global attention to the plight of elephants, their population sizes and trends are uncertain or unknown over much of Africa. To conserve this iconic species, conservationists need timely, accurate data on elephant populations. Here, we report the results of the Great Elephant Census (GEC, the first continent-wide, standardized survey of African savannah elephants. We also provide the first quantitative model of elephant population trends across Africa. We estimated a population of 352,271 savannah elephants on study sites in 18 countries, representing approximately 93% of all savannah elephants in those countries. Elephant populations in survey areas with historical data decreased by an estimated 144,000 from 2007 to 2014, and populations are currently shrinking by 8% per year continent-wide, primarily due to poaching. Though 84% of elephants occurred in protected areas, many protected areas had carcass ratios that indicated high levels of elephant mortality. Results of the GEC show the necessity of action to end the African elephants’ downward trajectory by preventing poaching and protecting habitat.

  13. Continent-wide survey reveals massive decline in African savannah elephants.

    Science.gov (United States)

    Chase, Michael J; Schlossberg, Scott; Griffin, Curtice R; Bouché, Philippe J C; Djene, Sintayehu W; Elkan, Paul W; Ferreira, Sam; Grossman, Falk; Kohi, Edward Mtarima; Landen, Kelly; Omondi, Patrick; Peltier, Alexis; Selier, S A Jeanetta; Sutcliffe, Robert

    2016-01-01

    African elephants (Loxodonta africana) are imperiled by poaching and habitat loss. Despite global attention to the plight of elephants, their population sizes and trends are uncertain or unknown over much of Africa. To conserve this iconic species, conservationists need timely, accurate data on elephant populations. Here, we report the results of the Great Elephant Census (GEC), the first continent-wide, standardized survey of African savannah elephants. We also provide the first quantitative model of elephant population trends across Africa. We estimated a population of 352,271 savannah elephants on study sites in 18 countries, representing approximately 93% of all savannah elephants in those countries. Elephant populations in survey areas with historical data decreased by an estimated 144,000 from 2007 to 2014, and populations are currently shrinking by 8% per year continent-wide, primarily due to poaching. Though 84% of elephants occurred in protected areas, many protected areas had carcass ratios that indicated high levels of elephant mortality. Results of the GEC show the necessity of action to end the African elephants' downward trajectory by preventing poaching and protecting habitat.

  14. A physician survey reveals differences in management of idiopathic pulmonary hemosiderosis.

    Science.gov (United States)

    Chin, Chana I C; Kohn, Shirleen Loloyan; Keens, Thomas G; Margetis, Monique F; Kato, Roberta M

    2015-08-20

    Idiopathic pulmonary hemosiderosis (IPH) is a rare disorder of unknown etiology characterized by chronic pulmonary hemorrhage and presents with a triad of anemia, hemoptysis and pulmonary infiltrates. IPH is a diagnosis of exclusion with a variable and disparate clinical course. Despite existing therapies, few children achieve full remission while others have recurrent hemorrhage, progressive lung damage, and premature death. We surveyed physicians who care for patients with IPH via a web-based survey to assess the most common practices. 88 providers responded, caring for 274 IPH patients from five continents. 63.3 % of respondents had patients that were initially misdiagnosed with anemia (60.0 %) or gastrointestinal bleed (18.2 %). Respondents varied in diagnostic tools used for evaluation. The key difference was in the use of lung biopsy (51.9 %) for diagnosis. Common medications respondents used for treatment at initial presentation and chronic maintenance therapy were corticosteroids (98.7 and 84.0 %, initial and chronic therapy respectively), hydroxychloroquine (33.3 and 64.0 %), azathioprine (8.0 and 37.3 %), and cyclophosphamide (4.0 and 16.0 %). There was agreement on the use of corticosteroids for exacerbation amongst all respondents. Reported deaths before adulthood occurred in 7.3 % of patients. We conclude that there were common features and specific variations in physician management of IPH. Respondents were divided on whether to perform lung biopsy for diagnosis. Despite the availability of various immunomodulators, corticosteroids remained the primary therapy. We speculate that the standardization of care for diffuse alveolar hemorrhage will improve patient outcomes.

  15. Baseline reef health surveys at Bangka Island (North Sulawesi, Indonesia reveal new threats

    Directory of Open Access Journals (Sweden)

    Massimo Ponti

    2016-10-01

    Full Text Available Worldwide coral reef decline appears to be accompanied by an increase in the spread of hard coral diseases. However, whether this is the result of increased direct and indirect human disturbances and/or an increase in natural stresses remains poorly understood. The provision of baseline surveys for monitoring coral health status lays the foundations to assess the effects of any such anthropogenic and/or natural effects on reefs. Therefore, the objectives of this present study were to provide a coral health baseline in a poorly studied area, and to investigate possible correlations between coral health and the level of anthropogenic and natural disturbances. During the survey period, we recorded 20 different types of coral diseases and other compromised health statuses. The most abundant were cases of coral bleaching, followed by skeletal deformations caused by pyrgomatid barnacles, damage caused by fish bites, general pigmentation response and galls caused by cryptochirid crabs. Instances of colonies affected by skeletal eroding bands, and sedimentation damage increased in correlation to the level of bio-chemical disturbance and/or proximity to villages. Moreover, galls caused by cryptochirid crabs appeared more abundant at sites affected by blast fishing and close to a newly opened metal mine. Interestingly, in the investigated area the percentage of corals showing signs of ‘common’ diseases such as black band disease, brown band disease, white syndrome and skeletal eroding band disease were relatively low. Nevertheless, the relatively high occurrence of less common signs of compromised coral-related reef health, including the aggressive overgrowth by sponges, deserves further investigation. Although diseases appear relatively low at the current time, this area may be at the tipping point and an increase in activities such as mining may irredeemably compromise reef health.

  16. THE VVV SURVEY REVEALS CLASSICAL CEPHEIDS TRACING A YOUNG AND THIN STELLAR DISK ACROSS THE GALAXY’S BULGE

    Energy Technology Data Exchange (ETDEWEB)

    Dékány, I. [Instituto Milenio de Astrofísica, Santiago (Chile); Minniti, D. [Departamento de Física, Facultad de Ciencias Exactas, Universidad Andres Bello, República 220, Santiago (Chile); Majaess, D. [Saint Mary’s University, Halifax, Nova Scotia (Canada); Zoccali, M.; Hajdu, G.; Catelan, M. [Instituto de Astrofísica, Facultad de Física, Pontificia Universidad Católica de Chile, Av. Vicuña Mackenna 4860, Santiago (Chile); Alonso-García, J. [Unidad de Astronomía, Fac. Cs. Básicas, Universidad de Antofagasta, Avda. U. de Antofagasta 02800, Antofagasta (Chile); Gieren, W. [Departamento de Astronomía, Universidad de Concepción, Casilla 160-C, Concepción (Chile); Borissova, J., E-mail: idekany@astro.puc.cl [Instituto de Física y Astronomía, Universidad de Valparaíso, Av. Gran Bretaña 1111, Valparaso (Chile)

    2015-10-20

    Solid insight into the physics of the inner Milky Way is key to understanding our Galaxy’s evolution, but extreme dust obscuration has historically hindered efforts to map the area along the Galactic mid-plane. New comprehensive near-infrared time-series photometry from the VVV Survey has revealed 35 classical Cepheids, tracing a previously unobserved component of the inner Galaxy, namely a ubiquitous inner thin disk of young stars along the Galactic mid-plane, traversing across the bulge. The discovered period (age) spread of these classical Cepheids implies a continuous supply of newly formed stars in the central region of the Galaxy over the last 100 million years.

  17. A molecular survey of acute febrile illnesses reveals Plasmodium vivax infections in Kedougou, southeastern Senegal.

    Science.gov (United States)

    Niang, Makhtar; Thiam, Laty Gaye; Sow, Abdourahmane; Loucoubar, Cheikh; Bob, Ndeye Sakha; Diop, Fode; Diouf, Babacar; Niass, Oumy; Mansourou, Annick; Varela, Marie Louise; Perraut, Ronald; Sall, Amadou A; Toure-Balde, Aissatou

    2015-07-19

    Control efforts towards malaria due to Plasmodium falciparum significantly decreased the incidence of the disease in many endemic countries including Senegal. Surprisingly, in Kedougou (southeastern Senegal) P. falciparum malaria remains highly prevalent and the relative contribution of other Plasmodium species to the global malaria burden is very poorly documented, partly due to the low sensitivity of routine diagnostic tools. Molecular methods offer better estimate of circulating Plasmodium species in a given area. A molecular survey was carried out to document circulating malaria parasites in Kedougou region. A total of 263 long-term stored sera obtained from patients presenting with acute febrile illness in Kedougou between July 2009 and July 2013 were used for malaria parasite determination. Sera were withdrawn from a collection established as part of a surveillance programme of arboviruses infections in the region. Plasmodium species were characterized by a nested PCR-based approach targeting the 18S small sub-unit ribosomal RNA genes of Plasmodium spp. Of the 263 sera screened in this study, Plasmodium genomic DNA was amplifiable by nested PCR from 62.35% (164/263) of samples. P. falciparum accounted for the majority of infections either as single in 85.97% (141/164) of Plasmodium-positive samples or mixed with Plasmodium ovale (11.58%, 19/164) or Plasmodium vivax (1.21%, 2/164). All 19 (11.58%) P. ovale-infected patients were mixed with P. falciparum, while no Plasmodium malariae was detected in this survey. Four patients (2.43%) were found to be infected by P. vivax, two of whom were mixed with P. falciparum. P. vivax infections originated from Bandafassi and Ninefesha villages and concerned patients aged 4, 9, 10, and 15 years old, respectively. DNA sequences alignment and phylogenetic analysis demonstrated that sequences from Kedougou corresponded to P. vivax, therefore confirming the presence of P. vivax infections in Senegal. The results confirm the

  18. Revealing the AGN-Host Galaxy Connection: Preliminary Results from an Arecibo Survey of HI Absorption in AGN

    Science.gov (United States)

    Jones, Kristen M.

    2018-01-01

    The presence of an Active Galactic Nucleus (AGN) can have an extensive effect on a host galaxy, most notably through powerful outflows or jets that it produces. Such outflows often deposit kinetic energy into the interstellar medium of the host galaxy at sub-kpc, kpc, and 10s of kpc scales. While this can ionize the gaseous material, studies of absorption of neutral hydrogen (HI) have also detected kinematic outflows with velocities ranging from 100s to 1000s of km/s. Such outflows can be difficult to detect due to the diffuse nature of the HI gas, especially in galaxies with low radio brightnesses. The sensitivity of the Arecibo Observatory 305m, however, makes such a study feasible. We present preliminary results of a survey of AGN-dominated sources in the Arecibo sky that has revealed complex HI absorption structures in several objects, revealing complex HI absorption structures in several objects.

  19. Benthic surveys of the historic pearl oyster beds of Qatar reveal a dramatic ecological change.

    Science.gov (United States)

    Smyth, D; Al-Maslamani, I; Chatting, M; Giraldes, B

    2016-12-15

    The study aimed to confirm the presence of historic oyster banks of Qatar and code the biotopes present. The research also collated historical records and scientific publications to create a timeline of fishery activity. The oyster banks where once an extremely productive economic resource however, intense overfishing, extreme environmental conditions and anthropogenic impacts caused a fishery collapse. The timeline highlighted the vulnerability of ecosystem engineering bivalves if overexploited. The current status of the oyster banks meant only one site could be described as oyster dominant. This was unexpected as the sites were located in areas which once supported a highly productive oyster fishery. The research revealed the devastating effect that anthropogenic impacts can have on a relatively robust marine habitat like an oyster bed and it is hoped these findings will act as a driver to investigate and map other vulnerable habitats within the region before they too become compromised. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Parasitological and malacological surveys reveal urogenital schistosomiasis on Mafia Island, Tanzania to be an imported infection.

    Science.gov (United States)

    Stothard, J Russell; Ameri, Haji; Khamis, I Simba; Blair, Lynsey; Nyandindi, Ursuline S; Kane, Richard A; Johnston, David A; Webster, Bonnie L; Rollinson, David

    2013-11-01

    To confirm the local endemicity of Schistosoma haematobium on Mafia Island, Tanzania, conjoint parasitological and malacological surveys were undertaken in July 2006 with parasitological investigations supplemented with case-history questionnaires. A total of 238 children (125 girls and 113 boys, mean age of 13.9 years) across 9 primary schools were examined. The prevalence of micro-haematuria and egg-patent infection was 18.1% (CI95=9.6-33.6) and 4.2% (CI95=1.9-7.6), respectively but a strong female bias was observed for micro-haematuria (5.6F:1M) contrasting with a strong male bias for the presence of eggs (1F:4M). All egg-patent infections were of light-intensity (Mafia and Unguja islands as well as DNA barcoding of snails and schistosomes. B. nasutus was shown refractory to infection. With the substantial travel to and from Mafia, the refractory nature of local snails and evidence from DNA barcoding in schistosomes and snails, we conclude that urogenital schistosomiasis is an imported infection. Copyright © 2012 Elsevier B.V. All rights reserved.

  1. Survey of large protein complexes D. vulgaris reveals great structural diversity

    Energy Technology Data Exchange (ETDEWEB)

    Han, B.-G.; Dong, M.; Liu, H.; Camp, L.; Geller, J.; Singer, M.; Hazen, T. C.; Choi, M.; Witkowska, H. E.; Ball, D. A.; Typke, D.; Downing, K. H.; Shatsky, M.; Brenner, S. E.; Chandonia, J.-M.; Biggin, M. D.; Glaeser, R. M.

    2009-08-15

    An unbiased survey has been made of the stable, most abundant multi-protein complexes in Desulfovibrio vulgaris Hildenborough (DvH) that are larger than Mr {approx} 400 k. The quaternary structures for 8 of the 16 complexes purified during this work were determined by single-particle reconstruction of negatively stained specimens, a success rate {approx}10 times greater than that of previous 'proteomic' screens. In addition, the subunit compositions and stoichiometries of the remaining complexes were determined by biochemical methods. Our data show that the structures of only two of these large complexes, out of the 13 in this set that have recognizable functions, can be modeled with confidence based on the structures of known homologs. These results indicate that there is significantly greater variability in the way that homologous prokaryotic macromolecular complexes are assembled than has generally been appreciated. As a consequence, we suggest that relying solely on previously determined quaternary structures for homologous proteins may not be sufficient to properly understand their role in another cell of interest.

  2. Survey of commercial Rhodiola products revealed species diversity and potential safety issues.

    Science.gov (United States)

    Xin, Tianyi; Li, Xiaojin; Yao, Hui; Lin, Yulin; Ma, Xiaochong; Cheng, Ruiyang; Song, Jingyuan; Ni, Lianghong; Fan, Congzhao; Chen, Shilin

    2015-02-09

    The adulteration of herbal products is a threat to consumer safety. Here we surveyed the species composition of commercial Rhodiola products using DNA barcoding as a supervisory method. A Rhodiola dietary supplement DNA barcode database was successfully constructed using 82 voucher samples from 10 Rhodiola species. Based on the DNA barcoding standard operating procedure (SOP), we used this database to identify 100 Rhodiolae Crenulatae Radix et Rhizoma decoction piece samples that were purchased from drug stores and hospitals. The results showed that only 36 decoction piece sequences (40%) were authentic R. crenulata, which is recorded in Chinese Pharmacopeia, whereas the other samples were all adulterants and may indicate a potential safety issue. Among the adulterants, 35 sequences (38.9%) were authenticated as R. serrata, nine sequences (10%) were authenticated as R. rosea, which is documented in the United States Pharmacopeia, and the remaining samples were authenticated as other three Rhodiola species. This result indicates decoction pieces that are available in the market have complex origins and DNA barcoding is a convenient tool for market supervision.

  3. Survey of commercial Rhodiola products revealed species diversity and potential safety issues

    Science.gov (United States)

    Xin, Tianyi; Li, Xiaojin; Yao, Hui; Lin, Yulin; Ma, Xiaochong; Cheng, Ruiyang; Song, Jingyuan; Ni, Lianghong; Fan, Congzhao; Chen, Shilin

    2015-01-01

    The adulteration of herbal products is a threat to consumer safety. Here we surveyed the species composition of commercial Rhodiola products using DNA barcoding as a supervisory method. A Rhodiola dietary supplement DNA barcode database was successfully constructed using 82 voucher samples from 10 Rhodiola species. Based on the DNA barcoding standard operating procedure (SOP), we used this database to identify 100 Rhodiolae Crenulatae Radix et Rhizoma decoction piece samples that were purchased from drug stores and hospitals. The results showed that only 36 decoction piece sequences (40%) were authentic R. crenulata, which is recorded in Chinese Pharmacopeia, whereas the other samples were all adulterants and may indicate a potential safety issue. Among the adulterants, 35 sequences (38.9%) were authenticated as R. serrata, nine sequences (10%) were authenticated as R. rosea, which is documented in the United States Pharmacopeia, and the remaining samples were authenticated as other three Rhodiola species. This result indicates decoction pieces that are available in the market have complex origins and DNA barcoding is a convenient tool for market supervision. PMID:25661009

  4. World Color Survey color naming reveals universal motifs and their within-language diversity.

    Science.gov (United States)

    Lindsey, Delwin T; Brown, Angela M

    2009-11-24

    We analyzed the color terms in the World Color Survey (WCS) (www.icsi.berkeley.edu/wcs/), a large color-naming database obtained from informants of mostly unwritten languages spoken in preindustrialized cultures that have had limited contact with modern, industrialized society. The color naming idiolects of 2,367 WCS informants fall into three to six "motifs," where each motif is a different color-naming system based on a subset of a universal glossary of 11 color terms. These motifs are universal in that they occur worldwide, with some individual variation, in completely unrelated languages. Strikingly, these few motifs are distributed across the WCS informants in such a way that multiple motifs occur in most languages. Thus, the culture a speaker comes from does not completely determine how he or she will use color terms. An analysis of the modern patterns of motif usage in the WCS languages, based on the assumption that they reflect historical patterns of color term evolution, suggests that color lexicons have changed over time in a complex but orderly way. The worldwide distribution of the motifs and the cooccurrence of multiple motifs within languages suggest that universal processes control the naming of colors.

  5. Global metagenomic survey reveals a new bacterial candidate phylum in geothermal springs.

    Science.gov (United States)

    Eloe-Fadrosh, Emiley A; Paez-Espino, David; Jarett, Jessica; Dunfield, Peter F; Hedlund, Brian P; Dekas, Anne E; Grasby, Stephen E; Brady, Allyson L; Dong, Hailiang; Briggs, Brandon R; Li, Wen-Jun; Goudeau, Danielle; Malmstrom, Rex; Pati, Amrita; Pett-Ridge, Jennifer; Rubin, Edward M; Woyke, Tanja; Kyrpides, Nikos C; Ivanova, Natalia N

    2016-01-27

    Analysis of the increasing wealth of metagenomic data collected from diverse environments can lead to the discovery of novel branches on the tree of life. Here we analyse 5.2 Tb of metagenomic data collected globally to discover a novel bacterial phylum ('Candidatus Kryptonia') found exclusively in high-temperature pH-neutral geothermal springs. This lineage had remained hidden as a taxonomic 'blind spot' because of mismatches in the primers commonly used for ribosomal gene surveys. Genome reconstruction from metagenomic data combined with single-cell genomics results in several high-quality genomes representing four genera from the new phylum. Metabolic reconstruction indicates a heterotrophic lifestyle with conspicuous nutritional deficiencies, suggesting the need for metabolic complementarity with other microbes. Co-occurrence patterns identifies a number of putative partners, including an uncultured Armatimonadetes lineage. The discovery of Kryptonia within previously studied geothermal springs underscores the importance of globally sampled metagenomic data in detection of microbial novelty, and highlights the extraordinary diversity of microbial life still awaiting discovery.

  6. Conserved S-Layer-Associated Proteins Revealed by Exoproteomic Survey of S-Layer-Forming Lactobacilli

    Science.gov (United States)

    Johnson, Brant R.; Hymes, Jeffrey; Sanozky-Dawes, Rosemary; Henriksen, Emily DeCrescenzo

    2015-01-01

    The Lactobacillus acidophilus homology group comprises Gram-positive species that include L. acidophilus, L. helveticus, L. crispatus, L. amylovorus, L. gallinarum, L. delbrueckii subsp. bulgaricus, L. gasseri, and L. johnsonii. While these bacteria are closely related, they have varied ecological lifestyles as dairy and food fermenters, allochthonous probiotics, or autochthonous commensals of the host gastrointestinal tract. Bacterial cell surface components play a critical role in the molecular dialogue between bacteria and interaction signaling with the intestinal mucosa. Notably, the L. acidophilus complex is distinguished in two clades by the presence or absence of S-layers, which are semiporous crystalline arrays of self-assembling proteinaceous subunits found as the outermost layer of the bacterial cell wall. In this study, S-layer-associated proteins (SLAPs) in the exoproteomes of various S-layer-forming Lactobacillus species were proteomically identified, genomically compared, and transcriptionally analyzed. Four gene regions encoding six putative SLAPs were conserved in the S-layer-forming Lactobacillus species but not identified in the extracts of the closely related progenitor, L. delbrueckii subsp. bulgaricus, which does not produce an S-layer. Therefore, the presence or absence of an S-layer has a clear impact on the exoproteomic composition of Lactobacillus species. This proteomic complexity and differences in the cell surface properties between S-layer- and non-S-layer-forming lactobacilli reveal the potential for SLAPs to mediate intimate probiotic interactions and signaling with the host intestinal mucosa. PMID:26475115

  7. Redshift Evolution of Galactic Outflows Revealed with Spectra of Large Surveys

    Science.gov (United States)

    Sugahara, Yuma

    2017-07-01

    We present observational results of galactic outflows from star-forming galaxies at z 0-2 based on optical spectra with absorption lines of NaID, MgI, MgII, CII, and CIV. The spectra of galaxies at z 0, 1, and 2 are taken from the large-survey data sets of SDSS DR7, DEEP2 DR4, and Erb et al. 2006, respectively. To remove possible systematics of galaxy samples at different redshifts, we carefully construct large and homogeneous samples with similar stellar mass distributions ranging from 10^9 to 10^11.5 solar mass. We stack the galaxy spectra in our galaxy samples, and perform the multi-component fitting of model absorption lines and stellar continua to the stacked spectra. We thus obtain the central (v_out) and maximum (v_max) outflow velocities and estimate the mass loading factors (eta) that are defined by the ratio of the mass outflow rate to the star formation rate (SFR). Because our optical spectra do not cover all of the absorption lines at each redshift, for investigating the redshift evolution, we compare galactic outflow velocities of different redshifts with the absorption lines of atoms and ions whose ionization energies (IEs) are similar: NaID and MgI at z 0-1 (IE 5-8 eV) and MgII and CII at z 1-2 (IE 20 eV). We identify, for the first time, that the average value of v_out (v_max) monotonically increases. Moreover, based on the absorption lines of NaID at z 0, MgI at z 1, and CII at z 2, we find that the mass loading factor increases from z 0 to 2 by a factor of (1+z)^{1.3 +/- 0.5} at a given halo circular velocity (v_cir), albeit with a potential systematics caused by model parameter choices. The redshift evolution of v_out (v_max) and eta are probably explained by high gas fractions in high-redshift massive galaxies, which is supported by recent radio observations.

  8. Survey of traditional Dai medicine reveals species confusion and potential safety concerns: a case study on Radix Clerodendri Japonicum.

    Science.gov (United States)

    Duan, Bao-Zhong; Fang, Hai-Lan; Li, Xi-Wen; Huang, Lin-Fang; Ping, Wang; Chen, Shi-Lin

    2017-06-01

    The adulteration of herbal products is a threat to consumer safety. In the present study, we surveyed the species composition of commercial Radix Clerodendri Japonicum products using DNA barcoding as a supervisory method. A reference database for plant-material DNA-barcode was successfully constructed with 48 voucher samples from 12 Clerodendrum species. The database was used to identify 27 Radix Clerodendri Japonicum decoction piece samples purchased from drug stores and hospitals. The DNA sequencing results revealed that only 1 decoction piece (3.70%) was authentic C. japonicum, as recorded in the Dai Pharmacopeia, whereas the other samples were all adulterants, indicating a potential safety issue. The results indicate that decoction pieces that are available in the market have complex origins and that DNA barcoding is a suitable tool for regulation of Dai medicines. Copyright © 2017 China Pharmaceutical University. Published by Elsevier B.V. All rights reserved.

  9. A primary survey on bryophyte species reveals two novel classes of nucleotide-binding site (NBS genes.

    Directory of Open Access Journals (Sweden)

    Jia-Yu Xue

    Full Text Available Due to their potential roles in pathogen defense, genes encoding nucleotide-binding site (NBS domain have been particularly surveyed in many angiosperm genomes. Two typical classes were found: one is the TIR-NBS-LRR (TNL class and the other is the CC-NBS-LRR (CNL class. It is seldom known, however, what kind of NBS-encoding genes are mainly present in other plant groups, especially the most ancient groups of land plants, that is, bryophytes. To fill this gap of knowledge, in this study, we mainly focused on two bryophyte species: the moss Physcomitrella patens and the liverwort Marchantia polymorpha, to survey their NBS-encoding genes. Surprisingly, two novel classes of NBS-encoding genes were discovered. The first novel class is identified from the P. patens genome and a typical member of this class has a protein kinase (PK domain at the N-terminus and a LRR domain at the C-terminus, forming a complete structure of PK-NBS-LRR (PNL, reminiscent of TNL and CNL classes in angiosperms. The second class is found from the liverwort genome and a typical member of this class possesses an α/β-hydrolase domain at the N-terminus and also a LRR domain at the C-terminus (Hydrolase-NBS-LRR, HNL. Analysis on intron positions and phases also confirmed the novelty of HNL and PNL classes, as reflected by their specific intron locations or phase characteristics. Phylogenetic analysis covering all four classes of NBS-encoding genes revealed a closer relationship among the HNL, PNL and TNL classes, suggesting the CNL class having a more divergent status from the others. The presence of specific introns highlights the chimerical structures of HNL, PNL and TNL genes, and implies their possible origin via exon-shuffling during the quick lineage separation processes of early land plants.

  10. Magnitude and extent of land subsidence in central Mexico revealed by regional InSAR ALOS time-series survey

    Science.gov (United States)

    Chaussard, E.; Wdowinski, S.; Amelung, F.; Cabral-Cano, E.

    2013-05-01

    Massive groundwater extraction is very common in Mexico and is well known to result in land subsidence. However, most surveys dedicated to land subsidence focus on one single city, mainly Mexico City, and thus fail to provide a comprehensive picture of the problem. Here we use a space-based radar remote sensing technique, known as Interferometric Synthetic Aperture Radar (InSAR) to detect land subsidence in the entire central Mexico area. We used data from the Japanese satellite ALOS, processed over 600 SAR images acquired between 2007-2011 and produced over 3000 interferograms to cover and area of 200,000 km2 in central Mexico. We identify land subsidence in twenty-one areas, including seventeen cities, namely from east to west, Puebla, Mexico city, Toluca de Lerdo, Queretaro, San Luis de la Paz, south of San Luis de la Paz, Celaya, south of Villa de Reyes, San Luis Potosi, west of Villa de Arista, Morelia, Salamanca, Irapuato, Silao, Leon, Aguascalientes, north of Aguascalientes, Zamora de Hidalgo, Guadalajara, Ahuacatlan, and Tepic. Subsidence rates of 30 cm/yr are observed in Mexico City, while in the other locations typical rates of 5-10 cm/yr are noticed. Regional surveys of this type are necessary for the development of hazard mitigation plans and efficient use of ground-based monitoring. We additionally correlate subsidence with land use, surface geology, and faults distribution and suggest that groundwater extraction for agricultural, urban, and industrial uses are the main causes of land subsidence. We also reveal that the limits of the subsiding areas often correlate with existing faults, motion on these faults being driven by water extraction rather than by tectonic activity. In all the subsiding locations we observe high ground velocity gradients emphasizing the significant risks associated with land subsidence in central Mexico. Averaged 2007-2011 ground velocity map from ALOS InSAR time-series in central Mexico, revealing land subsidence in 21

  11. AcEST: DK950971 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3...todon GN=DM... 37 1.1 tr|B1ACT4|B1ACT4_LISBO DMP1 (Fragment) OS=Lissodelphis borealis ... 37 1.1 tr|B1ACS2|B...SSSEEEIQSKNTEMESRRLTVDAY 160 >tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis GN=DMP1 PE=4 S

  12. Fluid circulation and reservoir conditions of the Los Humeros Geothermal Field (LHGF), Mexico, as revealed by a noble gas survey

    Science.gov (United States)

    Pinti, Daniele L.; Castro, M. Clara; Lopez-Hernandez, Aida; Han, Guolei; Shouakar-Stash, Orfan; Hall, Chris M.; Ramírez-Montes, Miguel

    2017-03-01

    Los Humeros Geothermal Field (LHGF) is one of four geothermal fields currently operating in Mexico, in exploitation since 1990. Located in a caldera complex filled with very low-permeability rhyolitic ignimbrites that are the reservoir cap-rock, recharge of the geothermal field is both limited and localized. Because of this, planning of any future geothermal exploitation must be based on a clear understanding of the fluid circulation. To this end, a first noble gas survey was carried out in which twenty-two production wells were sampled for He, Ne, Ar, Kr, and Xe isotope analysis. Air-corrected 3He/4He ratios (Rc) measured in the fluid, normalized to the helium atmospheric ratio (Ra; 1.384 × 10- 6), are consistently high across the field, with an average value of 7.03 ± 0.40 Ra. This value is close to that of the sub-continental upper mantle, indicating that LHGF mines heat from an active magmatic system. Freshwater recharge does not significantly affect He isotopic ratios, contributing 1-10% of the total fluid amount. The presence of radiogenic 40Ar* in the fluid suggests a fossil fluid component that might have circulated within the metacarbonate basement with radiogenic argon produced from detrital dispersed illite. Solubility-driven elemental fractionation of Ne/Ar, Kr/Ar, and Xe/Ar confirm extreme boiling in the reservoir. However, a combined analysis of these ratios with 40Ar/36Ar reveals mixing with an air component, possibly introduced by re-injected geothermal fluids.

  13. http://spilplus.journals.ac.za/

    African Journals Online (AJOL)

    deficiency, but to boorishness or ill-will. While grammatical error may reveal a speaker to be a less than proficient language- http://spilplus.journals.ac.za/ .... problems of meanlng, language use and the various linguistic aspects of interaction... contrastive analysis without a pragmalinguistic dimension is inadequate.".

  14. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    The depression parameter reveals the electrical equivalent circuit for the biopolymers. The AC electrical conductivity in the biopolymers follows the universal power law. From this, it is observed that the AC conductivity is frequency dependent and the biopolymer papain obeys large polaron tunnelling model, gum acacia and ...

  15. ACS Data Handbook v.6.0

    Science.gov (United States)

    Gonzaga, S.; et al.

    2011-03-01

    ACS was designed to provide a deep, wide-field survey capability from the visible to near-IR using the Wide Field Camera (WFC), high resolution imaging from the near-UV to near-IR with the now-defunct High Resolution Camera (HRC), and solar-blind far-UV imaging using the Solar Blind Camera (SBC). The discovery efficiency of ACS's Wide Field Channel (i.e., the product of WFC's field of view and throughput) is 10 times greater than that of WFPC2. The failure of ACS's CCD electronics in January 2007 brought a temporary halt to CCD imaging until Servicing Mission 4 in May 2009, when WFC functionality was restored. Unfortunately, the high-resolution optical imaging capability of HRC was not recovered.

  16. Tevatron AC dipole system

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; Kopp, S.E.; /Texas U.; Jansson, A.; Syphers, M.J.; /Fermilab

    2007-06-01

    The AC dipole is an oscillating dipole magnet which can induce large amplitude oscillations without the emittance growth and decoherence. These properties make it a good tool to measure optics of a hadron synchrotron. The vertical AC dipole for the Tevatron is powered by an inexpensive high power audio amplifier since its operating frequency is approximately 20 kHz. The magnet is incorporated into a parallel resonant system to maximize the current. The use of a vertical pinger magnet which has been installed in the Tevatron made the cost relatively inexpensive. Recently, the initial system was upgraded with a more powerful amplifier and oscillation amplitudes up to 2-3{sigma} were achieved with the 980 GeV proton beam. This paper discusses details of the Tevatron AC dipole system and also shows its test results.

  17. AC/RF Superconductivity

    CERN Document Server

    Ciovati, G.

    2014-07-17

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  18. AC/RF Superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  19. SURVEY

    DEFF Research Database (Denmark)

    SURVEY er en udbredt metode og benyttes inden for bl.a. samfundsvidenskab, humaniora, psykologi og sundhedsforskning. Også uden for forskningsverdenen er der mange organisationer som f.eks. konsulentfirmaer og offentlige institutioner samt marketingsafdelinger i private virksomheder, der arbejder...

  20. Survey of 800+ datasets from human tissue and body fluid reveals XenomiRs are likely artifacts

    DEFF Research Database (Denmark)

    Kang, Wenjing; Bang-Berthelsen, Claus Heiner; Holm, Anja

    2017-01-01

    -study in the field, surveying the presence and abundances of cross-species miRNAs (xenomiRs) in 824 sequencing datasets from various human tissues and body fluids. We find that xenomiRs are commonly present in tissues (17%) and body fluids (69%), however the abundances are low, comprising 0.001% of host human mi...

  1. Survey revealed a lack of clarity about recommended methods for meta-analysis of diagnostic accuracy data

    NARCIS (Netherlands)

    Ochodo, Eleanor A.; Reitsma, Johannes B.; Bossuyt, Patrick M.; Leeflang, Mariska M. G.

    2013-01-01

    To collect reasons for selecting the methods for meta-analysis of diagnostic accuracy from authors of systematic reviews and improve guidance on recommended methods. Online survey in authors of recently published meta-analyses of diagnostic accuracy. We identified 100 eligible reviews, of which 40

  2. Ground-penetrating radar survey on the island of Pantelleria (Italy) reveals an ancient architectural complex with likely Punic and Roman components

    Science.gov (United States)

    Urban, Thomas M.; Murray, Carrie Ann; Vella, Clive; Lahikainen, Amanda

    2015-12-01

    A ground-penetrating radar (GPR) survey conducted on the small volcanic island of Pantelleria, in the Strait of Sicily, south-central Mediterranean, revealed an apparent complex of Punic/Roman architecture. The survey focused on the Lago di Venere area, where a previously investigated ritual Punic site was built alongside a brackish volcanic lake. The site also exhibits evidence of earlier Eneolithic components and later Roman components. The full extent of the site has remained undetermined, however, with only the small area of the Punic ritual complex having been excavated from 1996 to 2002. The GPR survey was intended to explore whether additional architecture remained unseen in surrounding areas, thus taking a first step toward determining the site's full spatial extent and archaeological potential. This survey revealed a complex of architectural ruins beneath an active agricultural field immediately west of the previously excavated features, and extending to a depth of approximately 2 m. These newly discovered features expand the known architectural footprint of the immediate site by three-fold. This GPR study is the first published archaeo-geophysical investigation on the island.

  3. Updated MDRIZTAB Parameters for ACS/WFC

    Science.gov (United States)

    Hoffman, S. L.; Avila, R. J.

    2017-03-01

    The Mikulski Archive for Space Telescopes (MAST) pipeline performs geometric distortion corrections, associated image combinations, and cosmic ray rejections with AstroDrizzle. The MDRIZTAB reference table contains a list of relevant parameters that controls this program. This document details our photometric analysis of Advanced Camera for Surveys Wide Field Channel (ACS/WFC) data processed by AstroDrizzle. Based on this analysis, we update the MDRIZTAB table to improve the quality of the drizzled products delivered by MAST.

  4. Vector-Enabled Metagenomic (VEM Surveys Using Whiteflies (Aleyrodidae Reveal Novel Begomovirus Species in the New and OldWorlds

    Directory of Open Access Journals (Sweden)

    Karyna Rosario

    2015-10-01

    Full Text Available Whitefly-transmitted viruses belonging to the genus Begomovirus (family Geminiviridae represent a substantial threat to agricultural food production. The rapid evolutionary potential of these single-stranded DNA viruses combined with the polyphagous feeding behavior of their whitefly vector (Bemisia tabaci can lead to the emergence of damaging viral strains. Therefore, it is crucial to characterize begomoviruses circulating in different regions and crops globally. This study utilized vector-enabled metagenomics (VEM coupled with high-throughput sequencing to survey begomoviruses directly from whiteflies collected in various locations (California (USA, Guatemala, Israel, Puerto Rico, and Spain. Begomoviruses were detected in all locations, with the highest diversity identified in Guatemala where up to seven different species were identified in a single field. Both bipartite and monopartite viruses were detected, including seven new begomovirus species from Guatemala, Puerto Rico, and Spain. This begomovirus survey extends the known diversity of these highly damaging plant viruses. However, the new genomes described here and in the recent literature appear to reflect the outcome of interactions between closely-related species, often resulting from recombination, instead of unique, highly divergent species.

  5. Spatially Extensive Standardized Surveys Reveal Widespread, Multi-Decadal Increase in East Antarctic Adélie Penguin Populations.

    Science.gov (United States)

    Southwell, Colin; Emmerson, Louise; McKinlay, John; Newbery, Kym; Takahashi, Akinori; Kato, Akiko; Barbraud, Christophe; DeLord, Karine; Weimerskirch, Henri

    2015-01-01

    Seabirds are considered to be useful and practical indicators of the state of marine ecosystems because they integrate across changes in the lower trophic levels and the physical environment. Signals from this key group of species can indicate broad scale impacts or response to environmental change. Recent studies of penguin populations, the most commonly abundant Antarctic seabirds in the west Antarctic Peninsula and western Ross Sea, have demonstrated that physical changes in Antarctic marine environments have profound effects on biota at high trophic levels. Large populations of the circumpolar-breeding Adélie penguin occur in East Antarctica, but direct, standardized population data across much of this vast coastline have been more limited than in other Antarctic regions. We combine extensive new population survey data, new population estimation methods, and re-interpreted historical survey data to assess decadal-scale change in East Antarctic Adélie penguin breeding populations. We show that, in contrast to the west Antarctic Peninsula and western Ross Sea where breeding populations have decreased or shown variable trends over the last 30 years, East Antarctic regional populations have almost doubled in abundance since the 1980's and have been increasing since the earliest counts in the 1960's. The population changes are associated with five-year lagged changes in the physical environment, suggesting that the changing environment impacts primarily on the pre-breeding age classes. East Antarctic marine ecosystems have been subject to a number of changes over the last 50 years which may have influenced Adélie penguin population growth, including decadal-scale climate variation, an inferred mid-20th century sea-ice contraction, and early-to-mid 20th century exploitation of fish and whale populations.

  6. Spatially Extensive Standardized Surveys Reveal Widespread, Multi-Decadal Increase in East Antarctic Adélie Penguin Populations.

    Directory of Open Access Journals (Sweden)

    Colin Southwell

    Full Text Available Seabirds are considered to be useful and practical indicators of the state of marine ecosystems because they integrate across changes in the lower trophic levels and the physical environment. Signals from this key group of species can indicate broad scale impacts or response to environmental change. Recent studies of penguin populations, the most commonly abundant Antarctic seabirds in the west Antarctic Peninsula and western Ross Sea, have demonstrated that physical changes in Antarctic marine environments have profound effects on biota at high trophic levels. Large populations of the circumpolar-breeding Adélie penguin occur in East Antarctica, but direct, standardized population data across much of this vast coastline have been more limited than in other Antarctic regions. We combine extensive new population survey data, new population estimation methods, and re-interpreted historical survey data to assess decadal-scale change in East Antarctic Adélie penguin breeding populations. We show that, in contrast to the west Antarctic Peninsula and western Ross Sea where breeding populations have decreased or shown variable trends over the last 30 years, East Antarctic regional populations have almost doubled in abundance since the 1980's and have been increasing since the earliest counts in the 1960's. The population changes are associated with five-year lagged changes in the physical environment, suggesting that the changing environment impacts primarily on the pre-breeding age classes. East Antarctic marine ecosystems have been subject to a number of changes over the last 50 years which may have influenced Adélie penguin population growth, including decadal-scale climate variation, an inferred mid-20th century sea-ice contraction, and early-to-mid 20th century exploitation of fish and whale populations.

  7. The HDUV Survey: Six Lyman Continuum Emitter Candidates at z ˜ 2 Revealed by HST UV Imaging

    Science.gov (United States)

    Naidu, R. P.; Oesch, P. A.; Reddy, N.; Holden, B.; Steidel, C. C.; Montes, M.; Atek, H.; Bouwens, R. J.; Carollo, C. M.; Cibinel, A.; Illingworth, G. D.; Labbé, I.; Magee, D.; Morselli, L.; Nelson, E. J.; van Dokkum, P. G.; Wilkins, S.

    2017-09-01

    We present six galaxies at z˜ 2 that show evidence of Lyman continuum (LyC) emission based on the newly acquired UV imaging of the Hubble Deep UV legacy survey (HDUV) conducted with the WFC3/UVIS camera on the Hubble Space Telescope (HST). At the redshift of these sources, the HDUV F275W images partially probe the ionizing continuum. By exploiting the HST multiwavelength data available in the HDUV/GOODS fields, models of the UV spectral energy distributions, and detailed Monte Carlo simulations of the intergalactic medium absorption, we estimate the absolute ionizing photon escape fractions of these galaxies to be very high—typically > 60 % (> 13 % for all sources at 90% likelihood). Our findings are in broad agreement with previous studies that found only a small fraction of galaxies with high escape fraction. These six galaxies compose the largest sample yet of LyC leaking candidates at z˜ 2 whose inferred LyC flux has been observed at HST resolution. While three of our six candidates show evidence of hosting an active galactic nucleus, two of these are heavily obscured and their LyC emission appears to originate from star-forming regions rather than the central nucleus. Extensive multiwavelength data in the GOODS fields, especially the near-IR grism spectra from the 3D-HST survey, enable us to study the candidates in detail and tentatively test some recently proposed indirect methods to probe LyC leakage. High-resolution spectroscopic follow-up of our candidates will help constrain such indirect methods, which are our only hope of studying f esc at z˜ 5-9 in the JWST era. Based on observations made with the NASA/ESA Hubble Space Telescope, obtained from the data archive at the Space Telescope Science Institute. STScI is operated by the Association of Universities for Research in Astronomy, Inc., under NASA contract NAS 5-26555.

  8. Predicting Where a Radiation Will Occur: Acoustic and Molecular Surveys Reveal Overlooked Diversity in Indian Ocean Island Crickets (Mogoplistinae: Ornebius.

    Directory of Open Access Journals (Sweden)

    Ben H Warren

    Full Text Available Recent theory suggests that the geographic location of island radiations (local accumulation of species diversity due to cladogenesis can be predicted based on island area and isolation. Crickets are a suitable group for testing these predictions, as they show both the ability to reach some of the most isolated islands in the world, and to speciate at small spatial scales. Despite substantial song variation between closely related species in many island cricket lineages worldwide, to date this characteristic has not received attention in the western Indian Ocean islands; existing species descriptions are based on morphology alone. Here we use a combination of acoustics and DNA sequencing to survey these islands for Ornebius crickets. We uncover a small but previously unknown radiation in the Mascarenes, constituting a three-fold increase in the Ornebius species diversity of this archipelago (from two to six species. A further new species is detected in the Comoros. Although double archipelago colonisation is the best explanation for species diversity in the Seychelles, in situ cladogenesis is the best explanation for the six species in the Mascarenes and two species of the Comoros. Whether the radiation of Mascarene Ornebius results from intra- or purely inter- island speciation cannot be determined on the basis of the phylogenetic data alone. However, the existence of genetic, song and ecological divergence at the intra-island scale is suggestive of an intra-island speciation scenario in which ecological and mating traits diverge hand-in-hand. Our results suggest that the geographic location of Ornebius radiations is partially but not fully explained by island area and isolation. A notable anomaly is Madagascar, where our surveys are consistent with existing accounts in finding no Ornebius species present. Possible explanations are discussed, invoking ecological differences between species and differences in environmental history between

  9. High performance AC drives

    CERN Document Server

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  10. Context based computational analysis and characterization of ARS consensus sequences (ACS of Saccharomyces cerevisiae genome

    Directory of Open Access Journals (Sweden)

    Vinod Kumar Singh

    2016-09-01

    Full Text Available Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS requires an essential consensus sequence (ACS for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC denoted as ORC-ACS and non-replicating ACS sequences (nrACS, that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme.

  11. Parallel ac-ac converters using master-slave control

    Science.gov (United States)

    Taufik

    The objective of this study is to develop a parallel ac-ac converter that can be implemented as a means of connecting ac generators in parallel. The most important goal of the parallel converter in this study is to obtain equal current sharing performance among the paralleled generators such that an economically optimal solution for production cost of electricity can be accomplished. At the same time, voltage regulation and stability of the parallel system upon changes of different sizes and load types are to be maintained. Use of the available parallel converter method and voltage inversion technique leads to the formulation of a new solution technique for parallel operation of ac generators. The proposed parallel ac-ac converter involves Sinusoidal Pulse Width Modulation inverter combined with a control scheme called the Stationary Master-Slave control that uses voltage feedback loop and designates one generator unit as the master. The study involves numerous computer simulations to verify the feasibility of the parallel ac-ac converters. In doing so, as many as five models are considered including Current Control Current Source model, PI model, PI-PWM model, PI-PWM model with MOSFETs, and PI-PWM model with real MOSFET model. The results of the simulations show that the parallel ac-ac converter not only successfully provides the current sharing property among the paralleled units but also maintains system stability during changes in load demand. Further research work is suggested to address extensions to parallel ac-dc and dc-ac systems, hardware setup of at least two turbogenerators to test and verify the proposed approach, dynamic analysis to ensure system stability, and implementations of other types of Master-Slave control schemes to improve redundancy.

  12. Single-Phase Direct Boost AC-AC Converter

    Directory of Open Access Journals (Sweden)

    URSARU, O.

    2017-11-01

    Full Text Available This paper introduces and studies a boost AC-AC converter circuit that can be used to supply power to the 220V receivers in the 110V grids or to increase and adjust voltage at the end of long lines. High frequency AC-AC converters have better specifications than alternative voltage phase control drives with thyristors or TRIACs. When frequency exceeds 20kHz, noise is eliminated, filters are smaller and efficiency is higher. The current waveform is much better, the output voltage can be higher than the input voltage and voltage control is more accurate.

  13. Structural characteristics around the frontal thrust along the Nankai Trough revealed by bathymetric and seismic reflection survey

    Science.gov (United States)

    Yamashita, M.; Nakanishi, A.; Moore, G. F.; Kodaira, S.; Nakamura, Y.; Miura, S.; Kaneda, Y.

    2016-12-01

    Great earthquakes with tsunamis with recurrence intervals of 100-200 years have occurred along the Nankai Trough near central Japan where the Shikoku Basin is subducting with thick sediments on the Philippine Sea plate. To predict the exact height of the tsunami on the coast region generated by these large ruptures, it is important to estimate the vertical deformation that occurs on the seaward end of the rupture area. Recent drilling results have also yielded evidence not only of splay faults that generate tsunamigenic rupture, but also new evidence of tsunamigenic rupture along the frontal thrust at the trench axis in the Nankai Trough. In order to understand the deformation around the frontal thrust at the trench axis, we conducted a dense high-resolution seismic reflection survey with 10-20 km spacing over 1500 km of line length during 2013 and 2014. Clear seismic reflection images of frontal thrusts in the accretionary prism and subducting Shikoku Basin, image deformation along the trench axis between off Muroto Cape and off Ashizuri Cape. The cumulative displacement along the frontal thrust and second thrust are measured from picked distinct reflectors in depth-converted profiles. The average value of cumulative displacement of the frontal thrust is more than 100 m within 2 km depth beneath the seafloor. The location of highest displacement of 300 m displacement agree with the seaward end of slip distribution of the 1946 Nankai event calculated by numerical simulations. We also evaluate the seaward structure for understanding the future rupture distribution. The protothrust zone (PTZ) consisting of many incipient thrusts is identifiable in the portion of trough-fill sediments seaward of the frontal thrust. In order to emphasize the characteristics of frontal thrust and PTZ, we construct the detailed relief image for focusing on the lineated slope of the PTZ at the trough axis. Although our surveys covered a part of Nankai seismogenic zone, it is important to

  14. Within-person analysis of welfare transitions in a longitudinal panel survey reveals change in mental health service use.

    Science.gov (United States)

    Pymont, C; Schofield, T P; Butterworth, P

    2017-12-01

    While international research shows that receipt of welfare benefits is associated with poor mental health, less is known about the relationship between welfare receipt and mental health service use. We investigate whether within-person change in welfare recipient status is associated with change in mental health service use. Analysis of two waves of data from an Australian national household survey. Random- and fixed-effect models considered the effect of change in welfare receipt status, and assessed whether change in mental health service use differed by type of welfare benefit or the direction of welfare transition. Individuals were more likely to report greater mental health service use at times of welfare receipt. These associations were attenuated, but remained significant, after adjusting for mental health. Increased health service use was not tied to specific types of welfare benefits. The increase in mental health service use associated with a transition onto welfare benefits was much greater than the decline in service use associated with the transition off benefits. Within individuals, welfare receipt is associated with greater mental health service use. While this does reflect poorer mental health at the time of welfare receipt, other factors seem to facilitate health service use.

  15. AC Electrokinetics: Applications for Nanotechnology

    OpenAIRE

    Hughes, MP

    2000-01-01

    The phenomena of dielectrophoresis and electrorotation, collectively referred to as AC electrokinetics, have been used for many years to study, manipulate and separate particles on the nanotechnology, that is the precise manipulation of particles on the nanometre scale. In this paper we present the principles of AC electrokinetics for particle manipulation, review the current state of AC Electrokinetic techniques for the manipulation of particles on the nanometre scale, and consid...

  16. Legacies of stream channel modification revealed using General Land Office surveys, with implications for water temperature and aquatic life

    Directory of Open Access Journals (Sweden)

    Seth M. White

    2017-02-01

    Full Text Available Land use legacies can have a discernible influence in present-day watersheds and should be accounted for when designing conservation strategies for riverine aquatic life. We describe the environmental history of three watersheds within the Grande Ronde subbasin of the Columbia River using General Land Office survey field notes from the 19th century. In the two watersheds severely impacted by Euro-American land use, stream channel widths—a metric representing habitat simplification—increased from an average historical width of 16.8 m to an average present width of 20.8 m in large streams; 4.3 m to 5.5 m in small, confined or partly confined streams; and 3.5 m to 6.5 m in small, laterally unconfined steams. Conversely, we did not detect significant change in stream widths in an adjacent, wilderness stream with minimal human impact. Using a mechanistic water temperature model and restoration scenarios based on the historical condition, we predicted that stream restoration in the impacted watersheds could notably decrease average water temperatures—especially when channel narrowing is coupled with riparian restoration—up to a 6.6°C reduction in the upper Grande Ronde River and 3.0°C in Catherine Creek. These reductions in water temperature translated to substantial changes in the percentage of stream network habitable to salmon and steelhead migration (from 29% in the present condition to 79% in the fully restored scenario and to core juvenile rearing (from 13% in the present condition to 36% in the fully restored scenario. We conclude that land use legacies leave an important footprint on the present landscape and are critical for understanding historic habitat-forming processes as a necessary first step towards restoration.

  17. Survey of Ixodes pacificus Ticks in California Reveals a Diversity of Microorganisms and a Novel and Widespread Anaplasmataceae Species.

    Directory of Open Access Journals (Sweden)

    Mark W Eshoo

    Full Text Available Ixodes pacificus ticks can harbor a wide range of human and animal pathogens. To survey the prevalence of tick-borne known and putative pathogens, we tested 982 individual adult and nymphal I. pacificus ticks collected throughout California between 2007 and 2009 using a broad-range PCR and electrospray ionization mass spectrometry (PCR/ESI-MS assay designed to detect a wide range of tick-borne microorganisms. Overall, 1.4% of the ticks were found to be infected with Borrelia burgdorferi, 2.0% were infected with Borrelia miyamotoi and 0.3% were infected with Anaplasma phagocytophilum. In addition, 3.0% were infected with Babesia odocoilei. About 1.2% of the ticks were co-infected with more than one pathogen or putative pathogen. In addition, we identified a novel Anaplasmataceae species that we characterized by sequencing of its 16S rRNA, groEL, gltA, and rpoB genes. Sequence analysis indicated that this organism is phylogenetically distinct from known Anaplasma species with its closest genetic near neighbors coming from Asia. The prevalence of this novel Anaplasmataceae species was as high as 21% at one site, and it was detected in 4.9% of ticks tested statewide. Based upon this genetic characterization we propose that this organism be called 'Candidatus Cryptoplasma californiense'. Knowledge of this novel microbe will provide awareness for the community about the breadth of the I. pacificus microbiome, the concept that this bacterium could be more widely spread; and an opportunity to explore whether this bacterium also contributes to human or animal disease burden.

  18. Cooling Floor AC Systems

    Science.gov (United States)

    Jun, Lu; Hao, Ding; Hong, Zhang; Ce, Gao Dian

    The present HVAC equipments for the residential buildings in the Hot-summer-and-Cold-winter climate region are still at a high energy consuming level. So that the high efficiency HVAC system is an urgently need for achieving the preset government energy saving goal. With its advantage of highly sanitary, highly comfortable and uniform of temperature field, the hot-water resource floor radiation heating system has been widely accepted. This paper has put forward a new way in air-conditioning, which combines the fresh-air supply unit and such floor radiation system for the dehumidification and cooling in summer or heating in winter. By analyze its advantages and limitations, we found that this so called Cooling/ Heating Floor AC System can improve the IAQ of residential building while keep high efficiency quality. We also recommend a methodology for the HVAC system designing, which will ensure the reduction of energy cost of users.

  19. Hydrophysical and hydrochemical features of Lake Issyk-Kul (Kyrgyzstan) as revealed by field survey of June, 2015

    Science.gov (United States)

    Zavialov, Peter; Makkaveev, Petr; Rimskiy-Korsakov, Nikolay; Alymkulov, Salmor; Izhitskiy, Alexander

    2016-04-01

    Lake Issyk-Kul is a major (volume 1700 km3, depth 668 m) terminal lake in Kyrgyzstan, Central Asia. The lake has a longstanding history of research and recently attracted international attention, in particular, as a potentially promising site for scientific drilling and reconstructing paleo-climate variability (e.g., Oberhansli and Molnar, 2012). However, the in situ hydrophysical and hydrochemical data collected from Issyk-Kul are still limited, and those available are somewhat outdated, given that the most recent field campaign reported in the literature dates back to about 15 years ago. A new field survey was conducted in June, 2015. The measurements included CTD profiling and water sampling at 19 stations in all parts of the lake, as well as continuous measurements by a pump-through system and an ultraviolet lidar along the ship's track. The water samples were analyzed for a variety of hydrochemical indicators, including nutrients, dissolved oxygen and methane. In addition, velocity meters were deployed at 3 mooring stations to investigate the synoptic variability of currents. The nitrates, nitrites, phosphorus and silica exhibited elevated surface concentrations in the central part of the lake, which is likely to be associated with the upwelling induced by the basin-wide cyclonic circulation gyre evident from the current measurements. At the same time, the coastal waters were characterized by very low content of nutrients, except the southeastern part of the lake exposed to significant continental discharges from the Tyup and the Dzhergalan rivers. In the areas of continental water influence, concentration of dissolved silica attained minimum values in the surface and intermediate layers. On the other hand, silica concentrations grew steadily from the depth of about 100 m down to the bottom. In general, concentrations of principal biogenic elements in the euphotic layer were relatively low - albeit not low enough to be a limiting factor for phytoplankton life

  20. Seafloor geodetic survey revealed partial creep of North Anatolian Fault at the western part of the Sea of Marmara, Turkey

    Science.gov (United States)

    Kido, Motoyuki; Yamamoto, Ryusuke; Ohta, Yusaku; Takahashi, Narumi; Yamamoto, Yujiro; Kalafat, Dogan; Pinar, Ali; Ozener, Haluk; Ozeren, Sinan; Kaneda, Yoshiyuki

    2017-04-01

    exponential decay, but is still visible even after 20 months. Taken together all of these information, we obtained change rate of each baselines and their projections or direction cosines to the fault strike were 9-14 mm/yr indicating right-lateral movement. There still remain a few mm/yr uncertainty in the slip rate, it is obvious that coupling rate of NAF at this site is roughly a half at least near the surface compared to the regional rate of 22-25 mm/year. Looking at onshore GNSS data along a perpendicular line to NAF including the Western High, slight decay of displacement rate at northern and southern innermost sites compared to the regional rate gives some information on the depth extent of the partial coupling. We have extended two additional GNSS site along the line closer to NAF than above sites for more strong constraint on the depth extent in the future, which can be discussed with seismicity distribution obtained by repeated OBS survey.

  1. Electricity-AC versus DC

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 2; Issue 10. Electricity - AC versus DC. D P Sen Gupta. General Article Volume 2 Issue 10 October 1997 pp 46-53. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/002/10/0046-0053. Author Affiliations.

  2. Cloning of the Aegiceras corniculatum class I chitinase gene (AcCHI I) and the response of AcCHI I mRNA expression to cadmium stress.

    Science.gov (United States)

    Wang, Li-Ying; Wang, You-Shao; Cheng, Hao; Zhang, Jing-Ping; Yeok, Foong Swee

    2015-10-01

    Chitinases in terrestrial plants have been reported these are involved in heavy metal tolerance/detoxification. This is the first attempt to reveal chitinase gene (AcCHI I) and its function on metal detoxification in mangroves Aegiceras corniculatum. RT-PCR and RACE techniques were used to clone AcCHI I, while real-time quantitative PCR was employed to assess AcCHI I mRNA expressions in response to Cadmium (Cd). The deduced AcCHI I protein consists of 316 amino acids, including a signal peptide region, a chitin-binding domain (CBD) and a catalytic domain. Protein homology modeling was performed to identify potential features in AcCHI I. The CBD structure of AcCHI I might be critical for metal tolerance/homeostasis of the plant. Clear tissue-specific differences in AcCHI I expression were detected, with higher transcript levels detected in leaves. Results demonstrated that a short duration of Cd exposure (e.g., 3 days) promoted AcCHI I expression in roots. Upregulated expression was also detected in leaves under 10 mg/kg Cd concentration stress. The present study demonstrates that AcCHI I may play an important role in Cd tolerance/homeostasis in the plant. Further studies of the AcCHI I protein, gene overexpression, the promoter and upstream regulation will be necessary for clarifying the functions of AcCHI I.

  3. Introduction to AC machine design

    CERN Document Server

    Lipo, Thomas A

    2018-01-01

    AC electrical machine design is a key skill set for developing competitive electric motors and generators for applications in industry, aerospace, and defense. This book presents a thorough treatment of AC machine design, starting from basic electromagnetic principles and continuing through the various design aspects of an induction machine. Introduction to AC Machine Design includes one chapter each on the design of permanent magnet machines, synchronous machines, and thermal design. It also offers a basic treatment of the use of finite elements to compute the magnetic field within a machine without interfering with the initial comprehension of the core subject matter. Based on the author's notes, as well as after years of classroom instruction, Introduction to AC Machine Design: * Brings to light more advanced principles of machine design--not just the basic principles of AC and DC machine behavior * Introduces electrical machine design to neophytes while also being a resource for experienced designers * ...

  4. Loss of ACS7 confers abiotic stress tolerance by modulating ABA sensitivity and accumulation in Arabidopsis.

    Science.gov (United States)

    Dong, Hui; Zhen, Zhiqin; Peng, Jinying; Chang, Li; Gong, Qingqiu; Wang, Ning Ning

    2011-10-01

    The phytohormones ethylene and abscisic acid (ABA) play essential roles in the abiotic stress adaptation of plants, with both cross-talk of ethylene signalling and ABA biosynthesis and signalling reported. Any reciprocal effects on each other's biosynthesis, however, remain elusive. ACC synthase (ACS) acts as the key enzyme in ethylene biosynthesis. A pilot study on changes in ACS promoter activities in response to abiotic stresses revealed the unique involvement in abiotic stress responses of the only type 3 ACC synthase, ACS7, among all nine ACSs of Arabidopsis. Hence an acs7 mutant was characterized and its abiotic stress responses were analysed. The acs7 mutant germinated slightly faster than the wild type and subsequently maintained a higher growth rate at the vegetative growth stage. Ethylene emission of acs7 was merely one-third of that of the wild type. acs7 exhibited enhanced tolerance to salt, osmotic, and heat stresses. Furthermore, acs7 seeds were hypersensitive to both ABA and glucose during germination. Transcript analyses revealed that acs7 had elevated transcript levels of the stress-responsive genes involved in the ABA-dependent pathway under salt stress. The ABA level was also higher in acs7 following salt treatment. Our data suggest that ACS7 acts as a negative regulator of ABA sensitivity and accumulation under stress and appears as a node in the cross-talk between ethylene and ABA.

  5. ACS CCD Stability Monitor

    Science.gov (United States)

    Grogin, Norman

    2012-10-01

    A moderately crowded stellar field in the cluster 47 Tuc {6 arcmin West of the cluster core} is observed every four months with the WFC. The first visit exercises the full suite of broad and narrow band imaging filters and sub-array modes; following visits observe with only the six most popular Cycle 18 filters in full-frame mode. The positions and magnitudes of objects will be used to monitor local and large scale variations in the plate scale and the sensitivity of the detectors and to derive an independent measure of the detector CTE. One exposure in each sub-array mode with the WFC will allow us to verify that photometry obtained in full-frame and in sub-array modes are repeatable to better than 1%. This test is important for the ACS Photometric Cross-Calibration program, which uses sub-array exposures. This program may receive additional orbits to investigate ORIENT-dependent geometric distortion, which motivates the ORIENT and BETWEEN requirement on the first visit.

  6. Field resistance to the Bacillus thuringiensis protein Cry1Ac expressed in Bollgard(®) hybrid cotton in pink bollworm, Pectinophora gossypiella (Saunders), populations in India.

    Science.gov (United States)

    Mohan, Komarlingam S; Ravi, Kadanur C; Suresh, Pennadam J; Sumerford, Douglas; Head, Graham P

    2016-04-01

    Bollgard(®) cotton, expressing Cry1Ac insecticidal protein, was approved for commercial planting in India in 2002, and by 2009 constituted 87% of the Indian crop, reducing losses from lepidopteran pests, including pink bollworm (PBW), Pectinophora gossypiella. Inadequate control of PBW in fields of single-gene Bollgard cotton was reported in 2009; surveys revealed heavy infestations of PBW in Bollgard, restricted to Gujarat state, but not elsewhere in India. Bioassays of PBW strains from Bollgard bolls showed that, while susceptible PBW could not complete development to third and later instar at 10.0 µg Cry1Ac mL(-1) , 66.1% of larvae from Gujarat Bollgard strains could. A field-resistant strain, further selected in the laboratory, had susceptibility to Cry1Ac reduced by >2000-fold. Resistance to Cry1Ac did not confer cross-resistance to the Cry2Ab2 protein. In 2010, Bollgard fields in Gujarat continued to be infested with PBW, and many Bollgard fields in the adjoining states of Maharashtra and Madhya Pradesh showed high-level infestation by PBW. Inadequate planting of refuges for PBW is the likely explanation for the field resistance to Bt cotton observed in Gujarat. These findings underscore the higher vulnerability of single-gene Bt products relative to dual-gene products expressing Cry1Ac and Cry2Ab2, and the increased risk of resistance evolution with low refuge compliance. © 2015 Society of Chemical Industry.

  7. Using AC Motors in Robotics

    Directory of Open Access Journals (Sweden)

    Hosein Marzi

    2008-11-01

    Full Text Available It has been proven that fuzzy controllers are capable of controlling non-linear systems where it is cumbersome to develop conventional controllers based on mathematical modeling. This paper describes designing fuzzy controllers for an AC motor run mechanism. It also compares performance of two controllers designed based on Mamdani and Takagi-Sugeno with the conventional control scheme in a short track length, following a high disturbance. Fine and rapid control of AC motors have been a challenge and the main obstacle in gaining popularity in use of AC motors in robots actuators. This chapter reviews how use of intelligent control scheme can help to solve this problem.

  8. Ac45 silencing mediated by AAV-sh-Ac45-RNAi prevents both bone loss and inflammation caused by periodontitis.

    Science.gov (United States)

    Zhu, Zheng; Chen, Wei; Hao, Liang; Zhu, Guochun; Lu, Yun; Li, Sheng; Wang, Lin; Li, Yi-Ping

    2015-07-01

    Periodontitis induced by oral pathogens leads to severe periodontal tissue damage and osteoclast-mediated bone resorption caused by inflammation. On the basis of the importance of Ac45 in osteoclast formation and function, we performed this study to evaluate the therapeutic potential of periodontitis by local adeno-associated virus (AAV)-mediated Ac45 gene knockdown. We used AAV-mediated short hairpin RNAi knockdown of Ac45 gene expression (AAV-sh-Ac45) to inhibit bone erosion and gingival inflammation simultaneously in a well-established periodontitis mouse model induced by Porphyromonas gingivalis W50. Histological studies were performed to evaluate the bone protection of AAV-sh-Ac45. Immunochemistry, ELISA and qRT-PCR were performed to reveal the role of Ac45 knockdown on inflammation, immune response and expression of cytokine. We found that Ac45 knockdown impaired osteoclast-mediated extracellular acidification and bone resorption in vitro and in vivo. Furthermore, local administration of AAV-sh-Ac45 protected mice from bone erosion by >85% and attenuated inflammation and decreased infiltration of T cells, dendritic cells and macrophages in the periodontal lesion. Notably, the expression of pro-inflammatory cytokines was also reduced. Local AAV-sh-Ac45 gene therapy efficiently protects against periodontal tissue damage and bone erosion through both inhibition of osteoclast function and attenuating inflammation, and may represent a powerful new treatment strategy for periodontitis. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  9. Regal phylogeography: Range-wide survey of the marine angelfish Pygoplites diacanthus reveals evolutionary partitions between the Red Sea, Indian Ocean, and Pacific Ocean

    KAUST Repository

    Coleman, Richard R.

    2016-04-08

    The regal angelfish (Pygoplites diacanthus; family Pomacanthidae) occupies reefs from the Red Sea to the central Pacific, with an Indian Ocean/Rea Sea color morph distinct from a Pacific Ocean morph. To assess population differentiation and evaluate the possibility of cryptic evolutionary partitions in this monotypic genus, we surveyed mtDNA cytochrome b and two nuclear introns (S7 and RAG2) in 547 individuals from 15 locations. Phylogeographic analyses revealed four mtDNA lineages (d = 0.006 – 0.015) corresponding to the Pacific Ocean, the Red Sea, and two admixed lineages in the Indian Ocean, a pattern consistent with known biogeographical barriers. Christmas Island in the eastern Indian Ocean had both Indian and Pacific lineages. Both S7 and RAG2 showed strong population-level differentiation between the Red Sea, Indian Ocean, and Pacific Ocean (ΦST = 0.066 – 0.512). The only consistent population sub-structure within these three regions was at the Society Islands (French Polynesia), where surrounding oceanographic conditions may reinforce isolation. Coalescence analyses indicate the Pacific (1.7 Ma) as the oldest extant lineage followed by the Red Sea lineage (1.4 Ma). Results from a median-joining network suggest radiations of two lineages from the Red Sea that currently occupy the Indian Ocean (0.7 – 0.9 Ma). Persistence of a Red Sea lineage through Pleistocene glacial cycles suggests a long-term refuge in this region. The affiliation of Pacific and Red Sea populations, apparent in cytochrome b and S7 (but equivocal in RAG2) raises the hypthosis that the Indian Ocean was recolonized from the Red Sea, possibly more than once. Assessing the genetic architecture of this widespread monotypic genus reveals cryptic evolutionary diversity that merits subspecific recognition.

  10. Possible Factors Promoting Car Evacuation in the 2011 Tohoku Tsunami Revealed by Analysing a Large-Scale Questionnaire Survey in Kesennuma City

    Directory of Open Access Journals (Sweden)

    Fumiyasu Makinoshima

    2017-11-01

    Full Text Available Excessive car evacuation can cause severe traffic jams that can lead to large numbers of casualties during tsunami disasters. Investigating the possible factors that lead to unnecessary car evacuation can ensure smoother tsunami evacuations and mitigate casualty damages in future tsunami events. In this study, we quantitatively investigated the possible factors that promote car evacuation, including both necessary and unnecessary usages, by statistically analysing a large amount of data on actual tsunami evacuation behaviours surveyed in Kesennuma, where devastating damage occurred during the 2011 Tohoku Tsunami. A straightforward statistical analysis revealed a high percentage of car evacuations (approx. 50%; however, this fraction includes a high number of unnecessary usage events that were distinguished based on mode choice reasons. In addition, a binary logistic regression was conducted to quantitatively evaluate the effects of several factors and to identify the dominant factor that affected evacuation mode choice. The regression results suggested that the evacuation distance was the dominant factor for choosing car evacuation relative to other factors, such as age and sex. The cross-validation test of the regression model demonstrated that the considered factors were useful for decision making and the prediction of evacuation mode choice in the target area.

  11. VVCF AC-AC Converters Using Single Bridge Circuit

    Science.gov (United States)

    Neba, Yasuhiko; Matsumoto, Hirokazu; Itoh, Ryozo; Ishizaka, Kouichi

    Single-phase and three-phase voltage source converters with variable voltage and constant frequency ac-ac conversion are presented. These converters are a single bridge circuit of two legs for single-phase conversion and of three legs for three-phase, respectively. Both the power source and the load are connected to bridge legs. The normal PWM methods with the sinusoidal modulating and the triangular carrier waves are used for the converters. The experimental results confirm that the PWM converters can generate the sinusoidal input/output currents.

  12. Hopping models and ac universality

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2002-01-01

    Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA) is the h......Some general relations for hopping models are established. We proceed to discuss the universality of the ac conductivity which arises in the extreme disorder limit of the random barrier model. It is shown that the relevant dimension entering into the diffusion cluster approximation (DCA......) is the harmonic (fracton) dimension of the diffusion cluster. The temperature scaling of the dimensionless frequency entering into the DCA is discussed. Finally, some open problems regarding ac universality are listed....

  13. Nuclear structure of $^{231}$Ac

    CERN Document Server

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  14. AcEST: BP920378 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Actin OS=Histriculus cavicola PE=3 SV=2 55 1e-07 sp|P26182|ACT_ACHBI Actin OS=Ac...V=1 55 1e-07 sp|P17128|ACT_KLULA Actin OS=Kluyveromyces lactis GN=ACT PE=3 SV=2 55 1e-07 sp|O00937|ACT_HISCA

  15. AcEST: BP918420 [AcEST

    Lifescience Database Archive (English)

    Full Text Available D 180 >sp|A8AC98|APGM_IGNH4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase OS=Ignicoccus hosp...italis (strain KIN4/I / DSM 18386 / JCM 14125) GN=apgM PE=3 SV=1 Length = 416 Score

  16. AcEST: BP921278 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ac... 30 2.9 sp|Q01042|IE68_SHV21 Immediate-early protein OS=Saimiriine herpe... 30 2.9 sp|Q8CFW7|C2D2A_MOUS...PSPAPSLEES---HRPGSQTSSHPSSSVSSSPSQMDHHSE 418 >sp|Q01042|IE68_SHV21 Immediate-earl

  17. Conventional and technical diving surveys reveal elevated biomass and differing fish community composition from shallow and upper mesophotic zones of a remote United States coral reef.

    Directory of Open Access Journals (Sweden)

    Roldan C Muñoz

    surveys of the upper mesophotic and shallow-water coral reef have revealed valuable information concerning the reef fish community in the northern Gulf of Mexico, with implications for the conservation of apex predators, oceanic coral reefs, and the future management of FGBNMS.

  18. Sinkholes, subsidence and subrosion on the eastern shore of the Dead Sea as revealed by a close-range photogrammetric survey

    Science.gov (United States)

    Al-Halbouni, Djamil; Holohan, Eoghan P.; Saberi, Leila; Alrshdan, Hussam; Sawarieh, Ali; Closson, Damien; Walter, Thomas R.; Dahm, Torsten

    2017-05-01

    Ground subsidence and sinkhole collapse are phenomena affecting regions of karst geology worldwide. The rapid development of such phenomena around the Dead Sea in the last four decades poses a major geological hazard to the local population, agriculture and industry. Nonetheless many aspects of this hazard are still incompletely described and understood, especially on the eastern Dead Sea shore. In this work, we present a first low altitude (digital surface model (5 cm px-1) and orthophoto of this area (2.1 km2). We also outline the factors affecting the quality and accuracy of this approach. Our analysis reveals a kilometer-scale sinuous depression bound partly by flexure and partly by non-tectonic faults. The estimated minimum volume loss of this subsided zone is 1.83 ṡ 106 m3 with an average subsidence rate of 0.21 m yr-1 over the last 25 years. Sinkholes in the surveyed area are localized mainly within this depression. The sinkholes are commonly elliptically shaped (mean eccentricity 1.31) and clustered (nearest neighbor ratio 0.69). Their morphologies and orientations depend on the type of sediment they form in: in mud, sinkholes have a low depth to diameter ratio (0.14) and a long-axis azimuth of NNE-NE. In alluvium, sinkholes have a higher ratio (0.4) and are orientated NNW-N. From field work, we identify actively evolving artesian springs and channelized, sediment-laden groundwater flows that appear locally in the main depression. Consequently, subrosion, i.e. subsurface mechanical erosion, is identified as a key physical process, in addition to dissolution, behind the subsidence and sinkhole hazard. Furthermore, satellite image analysis links the development of the sinuous depression and sinkhole formation at Ghor Al-Haditha to preferential groundwater flow paths along ancient and current wadi riverbeds.

  19. Upregulation of PP2Ac predicts poor prognosis and contributes to aggressiveness in hepatocellular carcinoma

    Science.gov (United States)

    Gong, Shao-Juan; Feng, Xiao-Jun; Song, Wei-Hua; Chen, Jian-Ming; Wang, Shou-Mei; Xing, Dong-Juan; Zhu, Ming-Hua; Zhang, Shu-Hui; Xu, Ai-Min

    2016-01-01

    ABSTRACT Protein phosphatase 2A (PP2A) is a heterotrimeric protein phosphatase consisting of a 36-kD catalytic C subunit (PP2Ac). This study aimed to explore the prognostic and biological significance of PP2Ac in human hepatocellular carcinoma (HCC). High PP2Ac expression was significantly (P < 0.01) associated with serum hepatitis B surface antigen positivity, serum hepatitis B e antigen positivity, liver cirrhosis, moderate to poor differentiation grade, advanced disease stage, intrahepatic metastasis, and early recurrence in HCC. Multivariate analysis revealed PP2Ac as an independent prognostic factor for overall survival. Enforced expression of hepatitis B virus X protein (HBx) and its carboxyl-terminal truncated isoform induced PP2Ac expression in HCC cells. Co-immunoprecipitation assay revealed a direct interaction between PP2Ac and HBx. Small interfering RNA-mediated knockdown of PP2Ac significantly inhibited in vitro cell proliferation, colony formation, migration, and invasion and reduced tumor growth in an xenograft mouse model. In contrast, overexpression of PP2Ac promoted HCC cell proliferation, colony formation, and tumorigenesis. Additionally, silencing of PP2Ac impaired the growth-promoting effects on HepG2 HCC cells elicited by overexpression of carboxyl-terminal truncated HBx. Gene expression profiling analysis showed that PP2Ac downregulation modulated the expression of numerous genes involved in cell cycle and apoptosis regulation. Collectively, PP2Ac upregulation has a poor prognostic impact on the overall survival of HCC patients and contributes to the aggressiveness of HCC. PP2Ac may represent a potential therapeutic target for HCC. PMID:26618405

  20. Burkina Faso - Roads Baseline Survey

    Data.gov (United States)

    Millennium Challenge Corporation — NOTE !!!This survey data was not used for any independent evaluation reports!!! Impaq worked with the data collection firms NSCE-MCG-AC3E [the Group] to conduct...

  1. STIMULATION OF RENIN SECRETION BY CATECHOLAMINES IS DEPENDENT ON ADENYLYL CYCLASES AC5 AND AC6

    Science.gov (United States)

    Aldehni, Fadi; Tang, Tong; Madsen, Kirsten; Plattner, Michael; Schreiber, Andrea; Friis, Ulla G.; Hammond, H. Kirk; Han, Pyung Lim; Schweda, Frank

    2011-01-01

    The sympathetic nervous system stimulates renin release from juxtaglomerular cells via the ß-adrenoreceptor - cAMP pathway. Recent in vitro studies have suggested that the calcium-inhibited adenylyl cyclases AC5 and AC6 possess key roles in the control of renin exocytosis. In order to investigate the relative contribution of AC5 and AC6 to the regulation of renin release in vivo we performed experiments using AC5 and AC6 knockout mice. Male AC5−/− mice exhibited normal plasma renin concentrations (PRC), renal renin synthesis (mRNA and renin content), urinary volume and systolic blood pressure. In male AC6−/− mice, PRC (AC6−/−: 732 ± 119, AC6 +/+: 436 ± 78 ng angI/h*ml, p renin synthesis were stimulated associated with an increased excretion of dilute urine (1.55-fold, p renin release from isolated perfused kidneys were attenuated to a higher extent in AC6−/− (−51 to −98% vs. AC6+/+) than in AC5−/− (−31 to 46% vs. AC5+/+). In conclusion, both AC5 and AC6 are involved in the stimulation of renin secretion in vivo, and AC6 is the dominant isoforms in this process. PMID:21282557

  2. AcEST: DK955839 [AcEST

    Lifescience Database Archive (English)

    Full Text Available Heat shock protein 70 OS=Cucumis sativus ... 320 3e-86 tr|Q8GSN4|Q8GSN4_CUCMA Non-cell-autonomous... MVLIKMREIAEAYLGSNIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMR 174 >tr|Q8GSN3|Q8GSN3_CUCMA Non-cell-autonomous heat sho...3|Q8GSN3_CUCMA Non-cell-autonomous heat shock cognate pr... 324 3e-87 tr|Q67BD0|Q67BD0_TOBAC Heat shock prot...iva subs... 324 2e-87 tr|B8AC06|B8AC06_ORYSI Putative uncharacterized protein OS=Oryza... 324 2e-87 tr|Q8GSN

  3. Distributed AC power flow method for AC and AC-DC hybrid ...

    African Journals Online (AJOL)

    The proposed DPFM can be used for AC low voltage (LV) autonomous microgrid systems with added advantages of remedying the dependency on voltage level and R/X ratio in the formulation itself. DPFM is applied on a 10 bus, low voltage, microgrid system giving a better voltage profile.. Keywords: Microgrid (MG) ...

  4. Recent Trends in Veteran Unemployment as Measured in the Current Population Survey and the American Community Survey

    National Research Council Canada - National Science Library

    Savych, Bogdan; Klerman, Jacob A; Loughran, David S

    2008-01-01

    This technical report explores recent trends in the unemployment of recent veterans as estimated from two nationally representative surveys, the Current Population Survey "CPS" and the American Community Survey "ACS...

  5. AcEST: DK954361 [AcEST

    Lifescience Database Archive (English)

    Full Text Available in 5-4 OS=Homo sap... 33 1.1 sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|Q...86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=... 33 1.4 sp|O55188|DMP1_MOUSE Dentin matrix ac

  6. Modeling and Correcting the Time-Dependent ACS PSF

    Science.gov (United States)

    Rhodes, Jason; Massey, Richard; Albert, Justin; Taylor, James E.; Koekemoer, Anton M.; Leauthaud, Alexie

    2006-01-01

    The ability to accurately measure the shapes of faint objects in images taken with the Advanced Camera for Surveys (ACS) on the Hubble Space Telescope (HST) depends upon detailed knowledge of the Point Spread Function (PSF). We show that thermal fluctuations cause the PSF of the ACS Wide Field Camera (WFC) to vary over time. We describe a modified version of the TinyTim PSF modeling software to create artificial grids of stars across the ACS field of view at a range of telescope focus values. These models closely resemble the stars in real ACS images. Using 10 bright stars in a real image, we have been able to measure HST s apparent focus at the time of the exposure. TinyTim can then be used to model the PSF at any position on the ACS field of view. This obviates the need for images of dense stellar fields at different focus values, or interpolation between the few observed stars. We show that residual differences between our TinyTim models and real data are likely due to the effects of Charge Transfer Efficiency (CTE) degradation. Furthermore, we discuss stochastic noise that is added to the shape of point sources when distortion is removed, and we present MultiDrizzle parameters that are optimal for weak lensing science. Specifically, we find that reducing the MultiDrizzle output pixel scale and choosing a Gaussian kernel significantly stabilizes the resulting PSF after image combination, while still eliminating cosmic rays/bad pixels, and correcting the large geometric distortion in the ACS. We discuss future plans, which include more detailed study of the effects of CTE degradation on object shapes and releasing our TinyTim models to the astronomical community.

  7. Aperture measurements with AC dipole

    CERN Document Server

    Fuster Martinez, Nuria; Dilly, Joschua Werner; Nevay, Laurence James; Bruce, Roderik; Tomas Garcia, Rogelio; Redaelli, Stefano; Persson, Tobias Hakan Bjorn; CERN. Geneva. ATS Department

    2018-01-01

    During the MDs performed on the 15th of September and 29th of November 2017, we measured the LHC global aperture at injection with a new AC dipole method as well as using the Transverse Damper (ADT) blow-up method used during the 2017 LHC commissioning for benchmarking. In this note, the MD procedure is presented as well as the analysis of the comparison between the two methods. The possible benefits of the new method are discussed.

  8. Simultaneous distribution of AC and DC power

    Science.gov (United States)

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  9. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  10. Comparison of Reef Fish Survey Data Gathered by Open and Closed Circuit SCUBA Divers Reveals Differences in Areas With Higher Fishing Pressure.

    Directory of Open Access Journals (Sweden)

    Andrew E Gray

    Full Text Available Visual survey by divers using open-circuit (OC SCUBA is the most widely used approach to survey coral reef fishes. Therefore, it is important to quantify sources of bias in OC surveys, such as the possibility that avoidance of OC divers by fishes can lead to undercounting in areas where targeted species have come to associate divers with a risk of being speared. One potential way to reduce diver avoidance is to utilize closed circuit rebreathers (CCRs, which do not produce the noise and bubbles that are a major source of disturbance associated with OC diving. For this study, we conducted 66 paired OC and CCR fish surveys in the Main Hawaiian Islands at locations with relatively high, moderate, and light fishing pressure. We found no significant differences in biomass estimates between OC and CCR surveys when data were pooled across all sites, however there were differences at the most heavily fished location, Oahu. There, biomass estimates from OC divers were significantly lower for several targeted fish groups, including surgeonfishes, targeted wrasses, and snappers, as well as for all targeted fishes combined, with mean OC biomass between 32 and 68% of mean CCR biomass. There were no clear differences between OC and CCR biomass estimates for these groups at sites with moderate or low fishing pressure, or at any location for other targeted fish groups, including groupers, parrotfishes, and goatfishes. Bias associated with avoidance of OC divers at heavily fished locations could be substantially reduced, or at least calibrated for, by utilization of CCR. In addition to being affected by fishing pressure, the extent to which avoidance of OC divers is problematic for visual surveys varies greatly among taxa, and is likely to be highly influenced by the survey methodology and dimensions used.

  11. AcEST: DK949342 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 31 ACYNCGESGHLARDCPSE 84 AC+NCGESGH A DCP++ Sbjct: 741 A...270 Score = 37.0 bits (84), Expect = 0.030 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame...= 36.6 bits (83), Expect = 0.040 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = +1 Query: 34 CYNC... (79), Expect = 0.12 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 34 CYNCGESGHLARDCPS...6 (62%), Positives = 15/16 (93%) Frame = +1 Query: 34 CYNCGESGHLARDCPS 81 CY CG++GH++RDCP+ Sbjct: 170 CYKCGD

  12. AC electrothermal technique in microchannels

    Science.gov (United States)

    Salari, Alinaghi; Navi, Maryam; Dalton, Colin

    2017-02-01

    Electrokinetic techniques have a wide range of applications in droplet, particle, and fluid manipulation systems. In general, they can be categorized into different subgroups including electroosmosis, electrothermal, electrophoresis, dielectrophoresis, etc. The AC electrothermal (ACET) technique has been shown to be very effective in applications which involve high conductivity fluids, such as blood, which are typically used in biomedical applications. In the past few years, the ACET effect has received considerable attention. Unlike AC electroosmosis (ACEO), the ACET effect shows plateaus in force in a wide frequency range. In other words, with electrothermal force, velocity is more steady and predictable at different frequencies, compared to ACEO and dielectrophoresis (DEP). Although electrothermal microflows form as a result of Joule heating in the fluid, due to high conduction of heat to the ambience, the temperature rise in the fluid is not so high as to threaten the nature of the biofluids. The average temperature rise resulting from the ACET effect is below 5 °K. In order to generate high strength AC electric fields, microfabricated electrode arrays are commonly used in microchannels. For pumping applications, it is essential to create asymmetry in the electric field, typically by having asymmetrical electrode pairs. There is no defined border between many electrokinetic techniques, and as such the point where electrothermal processes interferes with other electrokinetic techniques is not clear in the literature. In addition, there have been comprehensive reviews on micropumps, electrokinetics, and their subcategories, but the literature lacks a detailed up-to-date review on electrothermal microdevices. In this paper, a brief review is made specifically on electric fields in ACET devices, in order to provide an insight for the reader about the importance of this aspect of ACET devices and the improvements made to date.

  13. Primary structure determination of five sialylated oligosaccharides derived from bronchial mucus glycoproteins of patients suffering from cystic fibrosis. The occurrence of the NeuAc alpha(2----3)Gal beta(1----4)[Fuc alpha(1----3)] GlcNAc beta(1----.) structural element revealed by 500-MHz 1H NMR spectroscopy.

    Science.gov (United States)

    Lamblin, G; Boersma, A; Klein, A; Roussel, P; van Halbeek, H; Vliegenthart, J F

    1984-07-25

    The structure of sialylated carbohydrate units of bronchial mucins obtained from cystic fibrosis patients was investigated by 500-MHz 1H NMR spectroscopy in conjunction with sugar analysis. After subjecting the mucins to alkaline borohydride degradation, sialylated oligosaccharide-alditols were isolated by anion-exchange chromatography and fractionated by high performance liquid chromatography. Five compounds could be obtained in a rather pure state; their structures were established as the following: A-1, NeuAc alpha(2----3)Gal beta(1----4) [Fuc alpha(1----3)]GlcNAc beta(1----3)Gal-NAc-ol; A-2, NeuAc alpha(2----3)Gal beta(1----4)GlcNAc beta(1----6)-[GlcNAc beta (1----3)]GalNAc-o1; A-3, NeuAc alpha(2----3)Gal beta-(1----4)[Fuc alpha(1----3)]GlcNAc beta(1----3)Gal beta(1----3) GalNAc-o1; A-4, NeuAc alpha(2----3)Gal beta(1----4)[Fuc alpha(1----3)]Glc-NAc NAc beta(1----6)[GlcNAc beta(1----3)]GalNAc-o1; A-6,NeuAc alpha-(2----3) Gal beta(1----4)[Fuc alpha(1----3)]GlcNAc beta(1----6)[Gal beta-(1----4) GlcNAc beta(1----3)]GalNAc-o1. The simultaneous presence of sialic acid in alpha(2----3)-linkage to Gal and fucose in alpha(1----3)-linkage to GlcNAc of the same N-acetyllactosamine unit could be adequately proved by high resolution 1H NMR spectroscopy. This sequence constitutes a novel structural element for mucins.

  14. Off-road sampling reveals a different grassland bird community than roadside sampling: implications for survey design and estimates to guide conservation

    Directory of Open Access Journals (Sweden)

    Troy I. Wellicome

    2014-06-01

    Full Text Available Grassland bird species continue to decline steeply across North America. Road-based surveys such as the North American Breeding Bird Survey (BBS are often used to estimate trends and population sizes and to build species distribution models for grassland birds, although roadside survey counts may introduce bias in estimates because of differences in habitats along roadsides and in off-road surveys. We tested for differences in land cover composition and in the avian community on 21 roadside-based survey routes and in an equal number of adjacent off-road walking routes in the grasslands of southern Alberta, Canada. Off-road routes (n = 225 point counts had more native grassland and short shrubs and less fallow land and road area than the roadside routes (n = 225 point counts. Consequently, 17 of the 39 bird species differed between the two route types in frequency of occurrence and relative abundance, measured using an indicator species analysis. Six species, including five obligate grassland species, were more prevalent at off-road sites; they included four species listed under the Canadian federal Species At Risk Act or listed by the Committee on the Status of Endangered Wildlife in Canada: Sprague's Pipit (Anthus spragueii, Baird's Sparrow (Ammodramus bairdii, the Chestnut-collared Longspur (Calcarius ornatus, and McCown's Longspur (Rhynchophanes mccownii. The six species were as much as four times more abundant on off-road sites. Species more prevalent along roadside routes included common species and those typical of farmland and other human-modified habitats, e.g., the European Starling (Sturnus vulgaris, the Black-billed Magpie (Pica hudsonia, and the House Sparrow (Passer domesticus. Differences in avian community composition between roadside and off-road surveys suggest that the use of BBS data when generating population estimates or distribution models may overestimate certain common species and underestimate others of conservation

  15. Universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual non......-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally, model predictions...

  16. Demographics for US Census Tracts - 2012 (American Community Survey 2008-2012 Derived Summary Tables)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This map service displays data derived from the 2008-2012 American Community Survey (ACS). Values derived from the ACS and used for this map service include: Total...

  17. Demographics for US Census Tracts - 2010 (American Community Survey 2006-2010 Derived Summary Tables)

    Data.gov (United States)

    U.S. Environmental Protection Agency — This map service displays data derived from the 2006-2010 American Community Survey (ACS). Values derived from the ACS and used for this map service include: Total...

  18. imulation Results of Single Stage AC- AC Converter for Induction Heating

    OpenAIRE

    S. ARUMUGAM; S.Rama Reddy

    2010-01-01

    This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBT...

  19. Influence of SDBD plasma aerodynamic actuation on flow control by AC power supply and AC-DC power supply

    Science.gov (United States)

    Hu, Xu; Gao, Chao; Hao, Jiangnan

    2018-01-01

    In this paper, the excitation effect of single dielectric barrier discharge plasma actuator (SDBD) is compared by using AC power supply and AC-DC power supply. AC-DC power supply is based on the AC power supply, just adding DC component. The flow measurement is carried out by PIV technique. Results show that the excitation effect of AC power supply and AC-DC power supply increases by the increase of voltage, the range of speed field excited by AC power is greater than that of AC-DC power supply. For x direction maximum speed, excited by AC power supply is close to AC-DC, and for y direction maximum speed, AC power supply is greater than AC-DC power supply. So the excitation effect of AC power supply is better than that of AC-DC power supply for SDBD.

  20. Analysis of four studies in a comparative framework reveals: health linkage consent rates on British cohort studies higher than on UK household panel surveys.

    Science.gov (United States)

    Knies, Gundi; Burton, Jonathan

    2014-11-27

    A number of cohort studies and longitudinal household panel studies in Great Britain have asked for consent to link survey data to administrative health data. We explore commonalities and differences in the process of collecting consent, achieved consent rates and biases in consent with respect to socio-demographic, socio-economic and health characteristics. We hypothesise that British cohort studies which are rooted within the health sciences achieve higher consent rates than the UK household longitudinal studies which are rooted within the social sciences. By contrast, the lack of a specific health focus in household panel studies means there may be less selectivity in consent, in particular, with respect to health characteristics. Survey designs and protocols for collecting informed consent to health record linkage on two British cohort studies and two UK household panel studies are systematically compared. Multivariate statistical analysis is then performed on information from one cohort and two household panel studies that share a great deal of the data linkage protocol but vary according to study branding, survey design and study population. We find that consent is higher in the British cohort studies than in the UK household panel studies, and is higher the more health-focused the study is. There are no systematic patterns of consent bias across the studies and where effects exist within a study or study type they tend to be small. Minority ethnic groups will be underrepresented in record linkage studies on the basis of all three studies. Systematic analysis of three studies in a comparative framework suggests that the factors associated with consent are idiosyncratic to the study. Analysis of linked health data is needed to establish whether selectivity in consent means the resulting research databases suffer from any biases that ought to be considered.

  1. What Does a Hospital Survey on Patient Safety Reveal About Patient Safety Culture of Surgical Units Compared With That of Other Units?

    Science.gov (United States)

    Shu, Qin; Cai, Miao; Tao, Hong-Bing; Cheng, Zhao-Hui; Chen, Jing; Hu, Yin-Huan; Li, Gang

    2015-07-01

    The objective of this study was to examine the strengths and weaknesses of surgical units as compared with other units, and to provide an opportunity to improve patient safety culture in surgical settings by suggesting targeted actions using Hospital Survey on Patient Safety Culture (HSOPSC) investigation.A Hospital Survey on Patient Safety questionnaire was conducted to physicians and nurses in a tertiary hospital in Shandong China. 12 patient safety culture dimensions and 2 outcome variables were measured.A total of 23.5% of respondents came from surgical units, and 76.5% worked in other units. The "overall perceptions of safety" (48.1% vs 40.4%, P safety grade" to be good/excellent. Three dimensions were considered as strengths, whereas 5 other dimensions were considered to be weaknesses in surgical units. Six dimensions have potential to aid in improving events reporting and patient safety grade. Appropriate working times will also contribute to ensuring patient safety. Medical staff with longer years of experience reported more events.Surgical units outperform the nonsurgical ones in overall perception of safety and the number of events reported but underperform in the openness of communication. Four strategies, namely deepening the understanding about patient safety of supervisors, narrowing the communication gap within and across clinical units, recruiting more workers, and employing the event reporting system and building a nonpunitive culture, are recommended to improve patient safety in surgical units in the context of 1 hospital.

  2. Genome-Wide Survey of Pseudomonas aeruginosa PA14 Reveals a Role for the Glyoxylate Pathway and Extracellular Proteases in the Utilization of Mucin.

    Science.gov (United States)

    Flynn, Jeffrey M; Phan, Chi; Hunter, Ryan C

    2017-08-01

    Chronic airway infections by the opportunistic pathogen Pseudomonas aeruginosa are a major cause of mortality in cystic fibrosis (CF) patients. Although this bacterium has been extensively studied for its virulence determinants, biofilm growth, and immune evasion mechanisms, comparatively little is known about the nutrient sources that sustain its growth in vivo Respiratory mucins represent a potentially abundant bioavailable nutrient source, although we have recently shown that canonical pathogens inefficiently use these host glycoproteins as a growth substrate. However, given that P. aeruginosa, particularly in its biofilm mode of growth, is thought to grow slowly in vivo, the inefficient use of mucin glycoproteins may be relevant to its persistence within the CF airways. To this end, we used whole-genome fitness analysis, combining transposon mutagenesis with high-throughput sequencing, to identify genetic determinants required for P. aeruginosa growth using intact purified mucins as a sole carbon source. Our analysis reveals a biphasic growth phenotype, during which the glyoxylate pathway and amino acid biosynthetic machinery are required for mucin utilization. Secondary analyses confirmed the simultaneous liberation and consumption of acetate during mucin degradation and revealed a central role for the extracellular proteases LasB and AprA. Together, these studies describe a molecular basis for mucin-based nutrient acquisition by P. aeruginosa and reveal a host-pathogen dynamic that may contribute to its persistence within the CF airways. Copyright © 2017 American Society for Microbiology.

  3. Facial cellulitis revealing choreo-acanthocytosis: a case report.

    Science.gov (United States)

    Samia, Younes; Yosra, Cherif; Foued, Bellazreg; Mouna, Aissi; Olfa, Berriche; Jihed, Souissi; Hammadi, Braham; Mahbouba, Frih-Ayed; Amel, Letaief; Habib, Sfar Mohamed

    2014-01-01

    We report a 62 year-old-man with facial cellulitis revealing choreo-acanthocytosis (ChAc). He showed chorea that started 20 years ago. The orofacial dyskinisia with tongue and cheek biting resulted in facial cellulitis. The peripheral blood smear revealed acanthocytosis of 25%. The overall of chorea, orofacial dyskinetic disorder, peripheral neuropathy, disturbed behavior, acanthocytosis and the atrophy of caudate nuclei was suggestive of a diagnosis of ChAc. To our knowledge no similar cases of facial cellulitis revealing choreo-acanthocytosis (ChAc) were found in a review of the literature.

  4. AC-tabsmodeller for superledende kabelledere

    DEFF Research Database (Denmark)

    Østergaard, Jacob; Holm (fratrådt), Jesper; Understrup (fratrådt), Henriette

    1996-01-01

    I denne rapport opstilles tre modeller for beregning af AC-tab (vekselstrømstab) i superledende kabelledere. Beregning af tabenes størrelse er væsentlig i forbindelse med vurdering af superlederteknologiens anvendelighed til AC-applikationer. Viden om tabenes natur giver desuden et vigtigt...

  5. Bioinformatics and Astrophysics Cluster (BinAc)

    Science.gov (United States)

    Krüger, Jens; Lutz, Volker; Bartusch, Felix; Dilling, Werner; Gorska, Anna; Schäfer, Christoph; Walter, Thomas

    2017-09-01

    BinAC provides central high performance computing capacities for bioinformaticians and astrophysicists from the state of Baden-Württemberg. The bwForCluster BinAC is part of the implementation concept for scientific computing for the universities in Baden-Württemberg. Community specific support is offered through the bwHPC-C5 project.

  6. Cloning and expression of chondroitinase AC from Bacteroides stercoris HJ-15.

    Science.gov (United States)

    Shim, Kyu-Woong; Kim, Dong-Hyun

    2008-04-01

    Enzymes that degrade glycosaminoglycans (GAGs) can help reveal the biological roles, structure, and mechanisms of GAGs. We cloned chondroitinase AC, which can degrade chondroitin sulfates A and C, from the genomic library of Bacteroides stercoris HJ-15 isolated from human intestine. The probe (1.4 kb) for the chondroitinase AC gene was prepared from the PCR product of the primers produced using two internal amino acid sequences of chondroitinase AC purified from B. stercoris HJ-15. Using this probe, a chondroitinase AC-positive, 4 kb DNA fragment was selected from pKF3 vector gene libraries containing 2.5-4.5 kb DNA fragments digested with HindIII. The amino acid sequence of the cloned chondroitinase AC showed 41% homology to that of Flavobacterium heparinum. The cloned chondroitinase AC gene was expressed under the T7 promoter of the expression vector, pET-26b+, in Escherichia coli BL21(DE3) and purified using His bind column chromatography. The expressed chondroitinase AC potently degraded chondroitin sulfates A and C.

  7. Land subsidence, structures and processes at the Dead Sea shoreline as revealed by a near-field photogrammetry survey at Ghor Haditha, Jordan

    Science.gov (United States)

    Al-Halbouni, Djamil; Holohan, Eoghan P.; Walter, Thomas; Alrshdan, Hussam; Sawarieh, Ali; Dahm, Torsten

    2015-04-01

    Rapid recession of the Dead Sea in the last few decades has led to an increasing rate of sinkhole formation around the lake shore. The development of these sinkholes and other land subsidence phenomena poses a major geological hazard to the local population, agriculture and industry. For a better understanding of the underlying physical processes and for determining current and future areas of sinkhole hazard, we conducted field investigations and a first low altitude ("near-field") aerial photogrammetric survey with a Helikite Balloon at Ghor Haditha, Jordan, in October 2014. From the near-field photogrammetry, we generated a high resolution Digital Elevation Model of the surveyed area. This enables a detailed quantification of sinkhole sizes and distribution as well of morphological parameters such as the sinkhole depth/diameter ratio (D). Values of the latter are generally greater in the mechanically stronger alluvial fan sediments (D = 3.0 - 0.4) than in the weaker muds of the former Dead Sea lakebed (D = 0.3 - 0.1). Importantly, the point of emanation of a very recent and sediment-laden stream at c. 10m below the former floor of the Dead Sea can be structurally and morphologically connected to the main sinkhole area. This provides evidence for channelised subterranean groundwater flows beneath this area. From our observations, two processes were identified as key factors for the development of large land subsidence structures and local sinkhole clusters: (1) Subrosion of weak material due to groundwater following preferred flow paths of ancient and current wadi riverbeds and (2) rapid dissolution of soluble material (salt) in this aragonite-rich mud. The heterogeneous geology and alternation of aquifers (alluvial fan sediments) and aquicludes (mud-flats) lead to the formation of complex subsurface flow channels that represent the secondary porosity of the internal structure of karst aquifers. As a consequence of these subterranean channels, local bending and

  8. A survey of DNA methylation across social insect species, life stages, and castes reveals abundant and caste-associated methylation in a primitively social wasp

    Science.gov (United States)

    Weiner, Susan A.; Galbraith, David A.; Adams, Dean C.; Valenzuela, Nicole; Noll, Fernando B.; Grozinger, Christina M.; Toth, Amy L.

    2013-08-01

    DNA methylation plays an important role in the epigenetic control of developmental and behavioral plasticity, with connections to the generation of striking phenotypic differences between castes (larger, reproductive queens and smaller, non-reproductive workers) in honeybees and ants. Here, we provide the first comparative investigation of caste- and life stage-associated DNA methylation in several species of bees and vespid wasps displaying different levels of social organization. Our results reveal moderate levels of DNA methylation in most bees and wasps, with no clear relationship to the level of sociality. Strikingly, primitively social Polistes dominula paper wasps show unusually high overall DNA methylation and caste-related differences in site-specific methylation. These results suggest DNA methylation may play a role in the regulation of behavioral and physiological differences in primitively social species with more flexible caste differences.

  9. 21 CFR 886.4440 - AC-powered magnet.

    Science.gov (United States)

    2010-04-01

    ... DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4440 AC-powered magnet. (a) Identification. An AC-powered magnet is an AC-powered device that generates a magnetic field intended to find and remove...

  10. Exenatide: AC 2993, AC002993, AC2993A, exendin 4, LY2148568.

    Science.gov (United States)

    2004-01-01

    Exenatide [AC002993, AC2993A, AC 2993, LY2148568, exendin 4], a glucagon-like peptide-1 (GLP-1) agonist, is a synthetic exendin 4 compound under development with Amylin Pharmaceuticals for the treatment of type 2 diabetes. Both exendin 4 and its analogue, exendin 3, are 39-amino acid peptides isolated from Heloderma horridum lizard venom that have different amino acids at positions 2 and 3, respectively. Exendins are able to stimulate insulin secretion in response to rising blood glucose levels, and modulate gastric emptying to slow the entry of ingested sugars into the bloodstream. Amylin Pharmaceuticals acquired exclusive patent rights for the two exendin compounds (exendin 3 and exendin 4) from the originator, Dr John Eng (Bronx, NY, US). On 20 September 2002, Amylin and Eli Lilly signed a collaborative agreement for the development and commercialisation of exenatide for type 2 diabetes. Under the terms of the agreement, Eli Lilly has paid Amylin a licensing fee of 80 million US dollars and bought Amylin's stock worth 30 million US dollars at 18.69 US dollars a share. After the initial payment, Eli Lilly will pay Amylin up to 85 US dollars million upon reaching certain milestones and also make an additional payment of up to 130 million US dollars upon global commercialisation of exenatide. Both companies will share the US development and commercialisation costs, while Eli Lilly will pick up up to 80% of development costs and all commercialisation costs outside the US. Amylin and Eli Lilly will equally share profit from sales in the US, while Eli Lilly will get 80% of the profit outside the US and Amylin will get the rest. This agreement has also enabled Amylin to train its sales force to co-promote Lilly's human growth hormone Humatrope. Alkermes will receive research and development funding and milestone payments, and also a combination of royalty payments and manufacturing fees based on product sales. Alkermes undertakes the responsibility for the development

  11. A socioeconomic and behavioral survey of patients with difficult-to-control type 2 diabetes mellitus reveals an association between diabetic retinopathy and educational attainment

    Directory of Open Access Journals (Sweden)

    Emoto N

    2016-10-01

    Full Text Available Naoya Emoto,1,2 Fumitaka Okajima,1,2 Hitoshi Sugihara,2 Rei Goto3 1Department of Endocrinology, Nippon Medical School Chiba-Hokusoh Hospital, Chiba, 2Department of Endocrinology, Diabetes and Metabolism, Graduate School of Medicine, Nippon Medical School, Tokyo, 3Graduate School of Business Administration, Keio University, Kanagawa, Japan Background: We have recently reported that the attitude of patients toward risk could be a factor in the progression of diabetic complications. In general, risk preference is closely related to socioeconomic status (SES, which includes factors such as age, sex, income, and educational attainment.Objective: We aimed to determine the effect of SES and behavioral propensity on the progress of diabetic complications in patients with type 2 diabetes mellitus (T2DM.Methods: We conducted a survey of 238 patients with difficult-to-control T2DM treated at a hospital in Japan using a modified behavioral economics questionnaire that included questions related to SES. The patients had been referred by general practitioners or other departments in the hospital because of poor metabolic control or unstable complications.Results: Educational attainment was significantly associated with progression of retinopathy in patients <65 years of age. Educational attainment of a high school diploma (12 years of education or lower was a significant risk factor, but there were no differences among levels of attainment beyond high school (13–16 years or more of education. Behavioral propensities were also weakly associated with complications, but not as much as educational attainment. Personal income level and economic status did not show an association with the retinopathy levels.Conclusion: Lower educational attainment is a strong risk factor for diabetic retinopathy, and it is independent of the economic status. The result suggests that cognitive function may play an important role in the progression of diabetic retinopathy in

  12. AC Electrokinetic Phenomena Generated by Microelectrode Structures

    Science.gov (United States)

    Hart, Robert; Oh, Jonghyun; Capurro, Jorge; Noh, Hongseok (Moses)

    2008-01-01

    The field of AC electrokinetics is rapidly growing due to its ability to perform dynamic fluid and particle manipulation on the micro- and nano-scale, which is essential for Lab-on-a-Chip applications. AC electrokinetic phenomena use electric fields to generate forces that act on fluids or suspended particles (including those made of dielectric or biological material) and cause them to move in astonishing ways1, 2. Within a single channel, AC electrokinetics can accomplish many essential on-chip operations such as active micro-mixing, particle separation, particle positioning and micro-pattering. A single device may accomplish several of those operations by simply adjusting operating parameters such as frequency or amplitude of the applied voltage. Suitable electric fields can be readily created by micro-electrodes integrated into microchannels. It is clear from the tremendous growth in this field that AC electrokinetics will likely have a profound effect on healthcare diagnostics3-5, environmental monitoring6 and homeland security7. In general, there are three AC Electrokinetic phenomena (AC electroosmosis, dielectrophoresis and AC electrothermal effect) each with unique dependencies on the operating parameters. A change in these operating parameters can cause one phenomena to become dominant over another, thus changing the particle or fluid behavior. It is difficult to predict the behavior of particles and fluids due to the complicated physics that underlie AC electrokinetics. It is the goal of this publication to explain the physics and elucidate particle and fluid behavior. Our analysis also covers how to fabricate the electrode structures that generate them, and how to interpret a wide number of experimental observations using several popular device designs. This video article will help scientists and engineers understand these phenomena and may encourage them to start using AC Electrokinetics in their research. PMID:19066515

  13. Low-frequency ac transport in silicene nanosystem with normal-metal electrodes

    Science.gov (United States)

    Sun, Yun-Lei; Ye, En-Jia

    2017-08-01

    Low-frequency ac transport properties are investigated theoretically in the zigzag silicene nanosystem with normal-metal electrode/silicene nanoribbon/normal-metal electrode (NSN) structure. Based on the tight-binding approach and ac transport theory, we numerically compute the dc conductance and ac emittance in the nanosystem, by considering the nearest-neighbor hopping, second-nearest-neighbor spin-orbit interaction (SOI) and external electric field. The results show that the anti-resonance effect, caused by the interface scattering between the silicene ribbon and the normal-metal electrodes, is offset by the relatively strong SOI. The SOI induces a quantum phase transition and establishes a topological edge channel in the real space revealed by the local density of states (LDOS), resulting in a constant dc conductance and a vanishing ac emittance around the Dirac point. Further study suggests that the transport property is topologically protected by the SOI from the geometrical size change of the nanosystem.

  14. AC magnetic-field response of the ferromagnetic superconductor UGe2 with different magnetized states

    Science.gov (United States)

    Tanaka, Hiroyuki; Yamaguchi, Akira; Kawasaki, Ikuto; Sumiyama, Akihiko; Motoyama, Gaku; Yamamura, Tomoo

    2018-01-01

    We have performed parallel measurements of dc-magnetization and ac-magnetic susceptibility for a ferromagnetic superconductor, UGe2, in the ferromagnetic-superconducting phase. dc-magnetization measurements revealed that adequate demagnetizing of the sample allows for the preparation of various magnetized states with different zero-field residual magnetization. We observed that these states exhibit varying ac superconducting response at large ac-field amplitudes. The amount of ac flux penetration is less in the demagnetized state involving many domain walls. This result seems to contradict the theory that considers the domain walls as weak links. Moreover, the ferromagnetic domain walls enforce the shielding capability of superconductivity. This observation sheds light on the role of the domain walls on superconductivity, which has been a controversial issue for several decades. Two possible scenarios are presented to explain the enhancement of the shielding capability by the domain walls.

  15. Comparative venom gland transcriptome surveys of the saw-scaled vipers (Viperidae: Echis) reveal substantial intra-family gene diversity and novel venom transcripts.

    Science.gov (United States)

    Casewell, Nicholas R; Harrison, Robert A; Wüster, Wolfgang; Wagstaff, Simon C

    2009-11-30

    Venom variation occurs at all taxonomical levels and can impact significantly upon the clinical manifestations and efficacy of antivenom therapy following snakebite. Variation in snake venom composition is thought to be subject to strong natural selection as a result of adaptation towards specific diets. Members of the medically important genus Echis exhibit considerable variation in venom composition, which has been demonstrated to co-evolve with evolutionary shifts in diet. We adopt a venom gland transcriptome approach in order to investigate the diversity of toxins in the genus and elucidate the mechanisms which result in prey-specific adaptations of venom composition. Venom gland transcriptomes were created for E. pyramidum leakeyi, E. coloratus and E. carinatus sochureki by sequencing approximately 1000 expressed sequence tags from venom gland cDNA libraries. A standardised methodology allowed a comprehensive intra-genus comparison of the venom gland profiles to be undertaken, including the previously described E. ocellatus transcriptome. Blast annotation revealed the presence of snake venom metalloproteinases, C-type lectins, group II phopholipases A2, serine proteases, L-amino oxidases and growth factors in all transcriptomes throughout the genus. Transcripts encoding disintegrins, cysteine-rich secretory proteins and hyaluronidases were obtained from at least one, but not all, species. A representative group of novel venom transcripts exhibiting similarity to lysosomal acid lipase were identified from the E. coloratus transcriptome, whilst novel metallopeptidases exhibiting similarity to neprilysin and dipeptidyl peptidase III were identified from E. p. leakeyi and E. coloratus respectively. The comparison of Echis venom gland transcriptomes revealed substantial intrageneric venom variation in representations and cluster numbers of the most abundant venom toxin families. The expression profiles of established toxin groups exhibit little obvious association

  16. Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.

    Science.gov (United States)

    Hu, Wenhuo; Hu, Guocheng; Han, Bin

    2009-04-01

    Heat shock proteins (Hsps) are molecular chaperons, which function in protein folding and assembly, protein intracellular localization and secretion, and degradation of misfolded and truncated proteins. Heat shock factors (Hsfs) are the transcriptional activators of Hsps. It has been reported that Hsps and Hsfs are widely involved in response to various abiotic stresses such as heat, drought, salinity and cold. To elucidate the function and regulation of rice Hsp and Hsf genes, we examined a global expression profiling with heat stressed rice seedling, and then compared our results with the previous rice data under cold, drought and salt stresses. The comparison revealed that, while most Hsfs and Hsps had highly similar and overlapped response and regulation patterns under different stresses, some of those genes showed significantly specific response to distinct stress. We also found that heat-responsive gene profiling differed largely from those under cold/drought/salt stresses, and that drought treatment was more effective to up-regulate Hsf expression in rice than in Arabidopsis. Overall, our data suggests that Hsps and Hsfs might be important elements in cross-talk of different stress signal transduction networks. Copyright © 2009 Elsevier Ireland Ltd. All rights reserved.

  17. A tsetse and tabanid fly survey of African great apes habitats reveals the presence of a novel trypanosome lineage but the absence of Trypanosoma brucei.

    Science.gov (United States)

    Votýpka, Jan; Rádrová, Jana; Skalický, Tomáš; Jirků, Milan; Jirsová, Dagmar; Mihalca, Andrei D; D'Amico, Gianluca; Petrželková, Klára J; Modrý, David; Lukeš, Julius

    2015-10-01

    Tsetse and tabanid flies transmit several Trypanosoma species, some of which are human and livestock pathogens of major medical and socioeconomic impact in Africa. Recent advances in molecular techniques and phylogenetic analyses have revealed a growing diversity of previously unidentified tsetse-transmitted trypanosomes potentially pathogenic to livestock and/or other domestic animals as well as wildlife, including African great apes. To map the distribution, prevalence and co-occurrence of known and novel trypanosome species, we analyzed tsetse and tabanid flies collected in the primary forested part of the Dzanga-Sangha Protected Areas, Central African Republic, which hosts a broad spectrum of wildlife including primates and is virtually devoid of domestic animals. Altogether, 564 tsetse flies and 81 tabanid flies were individually screened for the presence of trypanosomes using 18S rRNA-specific nested PCR. Herein, we demonstrate that wildlife animals are parasitized by a surprisingly wide range of trypanosome species that in some cases may circulate via these insect vectors. While one-third of the examined tsetse flies harbored trypanosomes either from the Trypanosoma theileri, Trypanosoma congolense or Trypanosoma simiae complex, or one of the three new members of the genus Trypanosoma (strains 'Bai', 'Ngbanda' and 'Didon'), more than half of the tabanid flies exclusively carried T. theileri. To establish the putative vertebrate hosts of the novel trypanosome species, we further analyzed the provenance of blood meals of tsetse flies. DNA individually isolated from 1033 specimens of Glossina spp. and subjected to high-throughput library-based screening proved that most of the examined tsetse flies engorged on wild ruminants (buffalo, sitatunga, bongo), humans and suids. Moreover, they also fed (albeit more rarely) on other vertebrates, thus providing indirect but convincing evidence that trypanosomes can be transmitted via these vectors among a wide range of

  18. Here Be Dragons: Characterization of ACS/WFC Scattered Light Anomalies

    Science.gov (United States)

    Porterfield, B.; Coe, D.; Gonzaga, S.; Anderson, J.; Grogin, N.

    2016-11-01

    We present a study characterizing scattered light anomalies that occur near the edges of Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) images. We inspected all 8,573 full-frame ACS/WFC raw images with exposure times longer than 350 seconds obtained in the F606W and F814W filters from 2002 to October 2013. We visually identified two particular scattered light artifacts known as "dragon's breath" and edge glow. Using the 2MASS point source catalog and Hubble Guide Star Catalog (GSC II), we identified the stars that caused these artifacts. The stars are all located in narrow bands ( 3" across) just outside the ACS/WFC field of view (2" - 16" away). We provide a map of these risky areas around the ACS/WFC detectors - users should avoid positioning bright stars in these regions when designing ACS/WFC imaging observations. We also provide interactive webpages which display all the image artifacts we identified, allowing users to see examples of the severity of artifacts they might expect for a given stellar magnitude at a given position relative to the ACS/WFC field of view. On average, 10th (18th) magnitude stars produce artifacts about 1,000 (100) pixels long. But the severity of these artifacts can vary strongly with small positional shifts (∼ 1"). The results are similar for both filters (F606W and F814W) when expressed in total fluence, or flux multiplied by exposure time.

  19. Cooperative Frequency Control for Autonomous AC Microgrids

    DEFF Research Database (Denmark)

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... not require measuring the system frequency as compared to the other presented methods. An ac Microgrid with four sources is used to verify the performance of the proposed control methodology....

  20. AC-DC Power Processor, Type I.

    Science.gov (United States)

    1979-11-01

    output vol taqv S ice the out put rectifiers drop is a 1 arqe percentaote of the output voltate value. F i ure 24 Ows5 the out put impedance of the AC-I)C...65- TABLE XII- AC-DC POWER PROCESSOR TEMPERATURE PROFILE AT 83"F AMBIENT (COMPONENT AND UNIT TEMPERATURES AT END OF 72 HOUR TESI ) T.C. NO. LOCATION

  1. Microtubule alignment and manipulation using AC electrokinetics.

    Science.gov (United States)

    Uppalapati, Maruti; Huang, Ying-Ming; Jackson, Thomas N; Hancock, William O

    2008-09-01

    The kinesin-microtubule system plays an important role in intracellular transport and is a model system for integrating biomotor-driven transport into microengineered devices. AC electrokinetics provides a novel tool for manipulating and organizing microtubules in solution, enabling new experimental geometries for investigating and controlling the interactions of microtubules and microtubule motors in vitro. By fabricating microelectrodes on glass substrates and generating AC electric fields across solutions of microtubules in low-ionic-strength buffers, bundles of microtubules are collected and aligned and the electrical properties of microtubules in solution are measured. The AC electric fields result in electro-osmotic flow, electrothermal flow, and dielectrophoresis of microtubules, which can be controlled by varying the solution conductivity, AC frequency, and electrode geometry. By mapping the solution conductivity and AC frequency over which positive dielectrophoresis occurs, the apparent conductivity of taxol-stabilized bovine-brain microtubules in PIPES buffer is measured to be 250 mS m(-1). By maximizing dielectrophoretic forces and minimizing electro-osmotic and electrothermal flow, microtubules are assembled into opposed asters. These experiments demonstrate that AC electrokinetics provides a powerful new tool for kinesin-driven transport applications and for investigating the role of microtubule motors in development and maintenance of the mitotic spindle.

  2. Proportional-Integral-Resonant AC Current Controller

    Directory of Open Access Journals (Sweden)

    STOJIC, D.

    2017-02-01

    Full Text Available In this paper an improved stationary-frame AC current controller based on the proportional-integral-resonant control action (PIR is proposed. Namely, the novel two-parameter PIR controller is applied in the stationary-frame AC current control, accompanied by the corresponding parameter-tuning procedure. In this way, the proportional-resonant (PR controller, common in the stationary-frame AC current control, is extended by the integral (I action in order to enable the AC current DC component tracking, and, also, to enable the DC disturbance compensation, caused by the voltage source inverter (VSI nonidealities and by nonlinear loads. The proposed controller parameter-tuning procedure is based on the three-phase back-EMF-type load, which corresponds to a wide range of AC power converter applications, such as AC motor drives, uninterruptible power supplies, and active filters. While the PIR controllers commonly have three parameters, the novel controller has two. Also, the provided parameter-tuning procedure needs only one parameter to be tuned in relation to the load and power converter model parameters, since the second controller parameter is directly derived from the required controller bandwidth value. The dynamic performance of the proposed controller is verified by means of simulation and experimental runs.

  3. imulation Results of Single Stage AC- AC Converter for Induction Heating

    Directory of Open Access Journals (Sweden)

    S. ARUMUGAM

    2010-12-01

    Full Text Available This paper presents simulation of single stage Induction heating system with series Load Resonance. Low frequency AC is converted in to High Frequency Ac using newly developed ZVS-PWM high frequency inverter. This High Frequency is used for Induction Heating .Single stage AC-AC converter system is modeled and simulated using Matlab Simulink. The simulation results of ZVS-PWM high frequency system are presented. The effectiveness of this UFAC-to-HFAC direct power frequency converter using IGBTs for consumer high-frequency IH appliances is evaluated and proved on the basis of simulation results.

  4. Genetic variation and geographical differentiation revealed using ...

    Indian Academy of Sciences (India)

    [Zhang L., Lu S., Sun D., and Peng J. 2015 Genetic variation and geographical differentiation revealed using ISSR markers in tung tree,. Vernicia fordii. J. Genet. 94, e5–e9. Online only: http://www.ias.ac.in/jgenet/OnlineResources/94/e5.pdf]. Introduction. Tung tree, Vernicia fordii is an oil-bearing woody plant species of ...

  5. Commentary: Revealing the workings of universal grammar

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 28; Issue 5. Commentary: Revealing the workings of universal grammar. Mohinish Shukla. Volume 28 Issue 5 September 2003 pp 535-537. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/jbsc/028/05/0535-0537. Author Affiliations.

  6. Effects of AC Electric Field on Small Laminar Nonpremixed Flames

    KAUST Repository

    Xiong, Yuan

    2015-04-01

    baseline case, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. By varying applied AC in a wide range of frequency and voltage, several insta- bility modes were observed, including flicking flames, partial pinch-off of flames, and spinning flames. High speed imaging together with Mie scattering techniques were combined to reveal the flame dynamics as well as the flow structure inside the flames. Original steady toroidal vortices triggered by AC were noted to exhibit axisymmetric axial instability in the flicking and partial pinch-off modes and non-axisymmetric azimuthal instability in the spinning mode. Electrical measurements were also conducted simultaneously to identify the voltage, current, and electrical power responses. Integrated power was noted to be sensitive to indicate subtle variation of flames properties and to the occurrence of axial instability. Under low frequency AC forcing with electrical conditions not generating toroidal vortices, responses of flames were further investigated. Several nonlinear flame responses, including frequency doubling and tripling phenomena, were identified. Spectral analysis revealed that such nonlinear responses were attributed to the combined effects of triggering buoyancy-induced oscillation of the flame as well as the Lorenz force generated by applying AC. Phase delay behaviors between the applied voltage and the heat release rate (or flame size) were also studied to explore the potential of applying AC in controlling flame instability. It was found that the phase delay had large variations for AC frequency smaller than

  7. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-01

    ... No. 812-14066] ACS Wireless, Inc.; Notice of Application AGENCY: Securities and Exchange Commission... (``Act''). Summary of Application: ACS Wireless, Inc. (``ACS Wireless'') seeks an order under section 3(b..., reinvesting, owning, holding or trading in securities. ACS Wireless is primarily engaged in providing wireless...

  8. Microwave-induced crystallization of AC/TiO{sub 2} for improving the performance of rhodamine B dye degradation

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Fei [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Wu, Zhansheng, E-mail: wuzhans@126.com [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Chen, Qiuyu; Yan, Yujun [School of Chemistry and Chemical Engineering, Shihezi University, Shihezi 832003 (China); Cravotto, Giancarlo; Wu, Zhilin [Dipartimento di Scienza e Tecnologia del Farmaco, University of Turin, Torino 10125 (Italy)

    2015-10-01

    Graphical abstract: - Highlights: • Mixed phase titania coated with AC was obtained by microwave irradiation method. • The TiO{sub 2} nanoparticles were spherical and well distributed on the surface of AC. • The light absorption edges of AC/TiO{sub 2} showed red-shift compared to the pure TiO{sub 2}. • Higher surface and TiO{sub 2} content of AC/TiO{sub 2} could improve photocatalytic efficiency. - Abstract: Titanium dioxide (TiO{sub 2}) deposition on activated carbon (AC) is widely used for pollutant photodegradation. In this study, a simple and efficient method for preparing AC/TiO{sub 2} composites under microwave irradiation was developed for photocatalytic degradation of rhodamine B (RhB) under UV light. Results of X-ray diffraction, scanning electron microscopy, and transmission electron microscopy revealed that TiO{sub 2} nanoparticles are anatase and rutile, with a spherical shape and a particle size of 20–50 nm and are well distributed on the AC surface. The UV–vis spectrum of TiO{sub 2} coated on AC showed an evident red-shift and exhibited stronger optical absorption capacity than pure TiO{sub 2}. The AC/TiO{sub 2} nanoparticles prepared at a microwave power of 700 W for 15 min exhibited 98% efficiency in removing RhB dye under UV irradiation for 30 min. The high photocatalytic activity of AC/TiO{sub 2}-700 W could be mainly attributed to the high sorption capacity of the mesoporous carbon material and high TiO{sub 2} content, which could produce higher quantity of ·OH. This study provides a rapid synthesis technique to prepare AC/TiO{sub 2} and a novel method to improve photocatalytic efficiency via synergistic effect for other catalytic systems.

  9. Anesthesiologists' familiarity with the ASA and ACS guidelines on Advance Directives in the perioperative setting.

    Science.gov (United States)

    Nurok, Michael; Green, Douglas S T; Chisholm, Mary F; Fins, Joseph J; Liguori, Gregory A

    2014-05-01

    To assess anesthesiologists' familiarity with the American Society of Anesthesiologists (ASA) and American College of Surgeons (ACS) guidelines on Advance Directives in the perioperative setting. Single-center, 4-question anonymous survey. Urban academic medical center. Up to 34 subjects responded to each question. Familiarity with the ASA and ACS guidelines on Advance Directives in the perioperative setting ranged from 45% to 100%. There was inadequate familiarity with components of the ASA and ACS guidelines on advance directives in the perioperative setting. Larger studies are required to assess anesthesiologists' familiarity with national society guidelines that directly affect patient care. Future work should investigate best practices for guideline implementation, and consequences of poor adherence to national guidelines. Copyright © 2014 Elsevier Inc. All rights reserved.

  10. ac propulsion system for an electric vehicle

    Science.gov (United States)

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  11. Mapa acústico parcial de Benetusser

    OpenAIRE

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental. Morilla Castellanos, E. (2012). Mapa acústico parcial de Benetusser. http://h...

  12. Nuclear structure of {sup 231}Ac

    Energy Technology Data Exchange (ETDEWEB)

    Boutami, R. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); Borge, M.J.G. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain)], E-mail: borge@iem.cfmac.csic.es; Mach, H. [Department of Radiation Sciences, ISV, Uppsala University, SE-751 21 Uppsala (Sweden); Kurcewicz, W. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Fraile, L.M. [Departamento Fisica Atomica, Molecular y Nuclear, Facultad CC. Fisicas, Universidad Complutense, E-28040 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland); Gulda, K. [Department of Physics, University of Warsaw, Pl-00 681 Warsaw (Poland); Aas, A.J. [Department of Chemistry, University of Oslo, PO Box 1033, Blindern, N-0315 Oslo (Norway); Garcia-Raffi, L.M. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Lovhoiden, G. [Department of Physics, University of Oslo, PO Box 1048, Blindern, N-0316 Oslo (Norway); Martinez, T.; Rubio, B.; Tain, J.L. [Instituto de Fisica Corpuscular, CSIC - Universidad de Valencia, Apdo. 22805, E-46071 Valencia (Spain); Tengblad, O. [Instituto de Estructura de la Materia, CSIC, Serrano 113 bis, E-28006 Madrid (Spain); ISOLDE, PH Department, CERN, CH-1211 Geneva 23 (Switzerland)

    2008-10-15

    The low-energy structure of {sup 231}Ac has been investigated by means of {gamma} ray spectroscopy following the {beta}{sup -} decay of {sup 231}Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a MINI-ORANGE electron spectrometer. The decay scheme of {sup 231}Ra {yields}{sup 231}Ac has been constructed for the first time. The Advanced Time Delayed {beta}{gamma}{gamma}(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  13. Multi-phase AC/AC step-down converter for distribution systems

    Science.gov (United States)

    Aeloiza, Eddy C.; Burgos, Rolando P.

    2017-10-25

    A step-down AC/AC converter for use in an electric distribution system includes at least one chopper circuit for each one of a plurality of phases of the AC power, each chopper circuit including a four-quadrant switch coupled in series between primary and secondary sides of the chopper circuit and a current-bidirectional two-quadrant switch coupled between the secondary side of the chopper circuit and a common node. Each current-bidirectional two-quadrant switch is oriented in the same direction, with respect to the secondary side of the corresponding chopper circuit and the common node. The converter further includes a control circuit configured to pulse-width-modulate control inputs of the switches, to convert a first multiphase AC voltage at the primary sides of the chopper circuits to a second multiphase AC voltage at the secondary sides of the chopper circuits, the second multiphase AC voltage being lower in voltage than the first multiphase AC voltage.

  14. The Effects of the Toxic Cyanobacterium Limnothrix (Strain AC0243) on Bufo marinus Larvae

    Science.gov (United States)

    Daniels, Olivia; Fabbro, Larelle; Makiela, Sandrine

    2014-01-01

    Limnothrix (strain AC0243) is a cyanobacterium, which has only recently been identified as toxin producing. Under laboratory conditions, Bufo marinus larvae were exposed to 100,000 cells mL−1 of Limnothrix (strain AC0243) live cultures for seven days. Histological examinations were conducted post mortem and revealed damage to the notochord, eyes, brain, liver, kidney, pancreas, gastrointestinal tract, and heart. The histopathological results highlight the toxicological impact of this strain, particularly during developmental stages. Toxicological similarities to β-N-Methylamino-l-alanine are discussed. PMID:24662524

  15. Exothermic reaction in zeolite hemostatic dressings: QuikClot ACS and ACS+.

    Science.gov (United States)

    Arnaud, Françoise; Tomori, Toshiki; Carr, Walter; McKeague, Anne; Teranishi, Kohsuke; Prusaczyk, Keith; McCarron, Richard

    2008-10-01

    Zeolites have hemostatic properties used to stop bleeding in severe hemorrhage. Manufactured QuikClot is an approved zeolite-based hemostatic agent for battlefield use. The exothermic reaction associated with QuikClot as loose granules or as granules packaged in a mesh bag has potential burn effects; this led to the development of a formulation of "cooler" non-exothermic QuikClot. The goal of this study was to compare the elevation of temperature of these formulations upon contact with blood. Following full transection of the femoral vasculature, anesthetized Yorkshire pigs (n = 15) (28.8 +/- 1.5 kg) were hemorrhaged for 2 min and treated with 100 g of bagged QuikClot (Advanced Clotting Sponge (ACS) (n = 4)) or a modified non-exothermic formulation (ACS+ (n = 11)). Vital signs and temperature at the dressing/tissue interface were continuously recorded for 3 h. Additional procedures were used to examine effects of different ratios of blood to zeolite on temperature elevation. Total post-treatment blood loss was comparable for ACS+_E and ACS_E groups (overall average: 18.6 +/- 10.5% EBV). Temperature recorded at the dressing/tissue interface was significantly lower with ACS+ vs. ACS (40.3 +/- 1.8 vs. 61.4 +/- 10.7 degrees C, respectively, p < 0.01) and was 3.2 +/- 2.6 degrees C higher than rectal temperature (38.0 +/- 0.7 degrees C, p < 0.01). Survival at endpoint (7/11 vs. 4/4) and average survival time (134 +/- 64 vs. 180 min) were greater for both ACS+ and ACS in comparison to Standard Dressing. The wound temperature with ACS was reduced with greater blood to product ratios and this pattern was paralleled with in vitro measurements. The lower heat release with ACS+ compared to ACS was confirmed in an animal model and ACS+ had similar efficacy in arresting bleeding when compared to Standard Dressing.

  16. A Ser/Thr protein kinase phosphorylates MA-ACS1 (Musa acuminata 1-aminocyclopropane-1-carboxylic acid synthase 1) during banana fruit ripening.

    Science.gov (United States)

    Choudhury, Swarup Roy; Roy, Sujit; Sengupta, Dibyendu N

    2012-08-01

    1-Aminocyclopropane-1-carboxylic acid synthase (ACS) catalyzes the rate-limiting step in ethylene biosynthesis during ripening. ACS isozymes are regulated both transcriptionally and post-translationally. However, in banana, an important climacteric fruit, little is known about post-translational regulation of ACS. Here, we report the post-translational modification of MA-ACS1 (Musa acuminata ACS1), a ripening inducible isozyme in the ACS family, which plays a key role in ethylene biosynthesis during banana fruit ripening. Immunoprecipitation analyses of phospholabeled protein extracts from banana fruit using affinity-purified anti-MA-ACS1 antibody have revealed phosphorylation of MA-ACS1, particularly in ripe fruit tissue. We have identified the induction of a 41-kDa protein kinase activity in pulp at the onset of ripening. The 41-kDa protein kinase has been identified as a putative protein kinase by MALDI-TOF/MS analysis. Biochemical analyses using partially purified protein kinase fraction from banana fruit have identified the protein kinase as a Ser/Thr family of protein kinase and its possible involvement in MA-ACS1 phosphorylation during ripening. In vitro phosphorylation analyses using synthetic peptides and site-directed mutagenized recombinant MA-ACS1 have revealed that serine 476 and 479 residues at the C-terminal region of MA-ACS1 are phosphorylated. Overall, this study provides important novel evidence for in vivo phosphorylation of MA-ACS1 at the molecular level as a possible mechanism of post-translational regulation of this key regulatory protein in ethylene signaling pathway in banana fruit during ripening.

  17. Meso Mechanical Analysis of AC Mixture Response

    NARCIS (Netherlands)

    Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.

    2012-01-01

    Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work

  18. Control of Power Converters in AC Microgrids

    DEFF Research Database (Denmark)

    Rocabert, Joan; Luna, Alvaro; Blaabjerg, Frede

    2012-01-01

    The enabling of ac microgrids in distribution networks allows delivering distributed power and providing grid support services during regular operation of the grid, as well as powering isolated islands in case of faults and contingencies, thus increasing the performance and reliability of the ele...

  19. Operating experience with factory-made air-insulated 1AC/2AC switchgear systems; Erste Betriebserfahrungen mit fabrikgefertigten, luftisolierten 1AC-/2AC-Schaltanlagen

    Energy Technology Data Exchange (ETDEWEB)

    Northe, J. [Balfour Beatty Rail GmbH, Offenbach (Germany); Loenard, D. [Bombardier Transportation GmbH, Mannheim (Germany)

    2007-07-01

    Today, factory-made air-insulated switchgear systems of the type TracFeed {sup registered} are available for all supply versions of 16.7 Hz and 50 Hz a.c. railways. These are supported by auxiliary equipment to ensure reliable railway operation through specific protective functions and a simplified line test. (orig.)

  20. Meso Mechanical Analysis of AC Mixture Response

    NARCIS (Netherlands)

    Woldekidan, M.F.; Huurman, M.; Vaccari, E.; Poot, M.

    Ongoing research into performance modeling of Asphalt Concrete (AC) mixtures using meso mechanics approaches is being undertaken at Delft University of Technology (TUD). The approach has already been successfully employed for evaluating the long term performance of porous asphalt concrete. The work

  1. Total synthesis of chaetoquadrins A-C.

    Science.gov (United States)

    Kim, U Bin; Furkert, Daniel P; Brimble, Margaret A

    2013-02-01

    The first total synthesis of the monoamine oxidase inhibitors chaetoquadrins A-C has been accomplished. Key steps in the synthesis include an aromatic Claisen rearrangement, asymmetric boron aldol reaction and acid-mediated spiroketalization. Comparison of spectral data for the synthetic spiroketals confirmed the proposed structure for these natural products.

  2. AC power generation from microbial fuel cells

    Science.gov (United States)

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  3. Organic magnetoresistance under resonant ac drive

    Science.gov (United States)

    Roundy, R. C.; Raikh, M. E.

    2013-09-01

    Motivated by a recent experiment, we develop a theory of organic magnetoresistance (OMAR) in the presence of a resonant ac drive. To this end, we perform a thorough analysis of the dynamics of ac-driven electron-hole polaron pair in magnetic field, which is a sum of external and random hyperfine fields. Resonant ac drive affects the OMAR by modifying the singlet content of the eigenmodes. This, in turn, leads to the change of recombination rate, and ultimately, to the change of the spin-blocking that controls the current. Our analysis demonstrates that, upon increasing the drive amplitude, the blocking eigenmodes of the triplet type acquire a singlet admixture and become unblocking. Most surprisingly, the opposite process goes in parallel: new blocking modes emerge from nonblocking precursors as the drive increases. These emergent blocking modes are similar to subradiant modes in the Dicke effect. A nontrivial evolution of eigenmodes translates into a nontrivial behavior of OMAR with the amplitude of the ac drive: it is initially linear, then passes through a maximum, drops, and finally saturates.

  4. Production of transgenic kiwifruit plants harboring the SbtCry1Ac gene.

    Science.gov (United States)

    Zhang, H Y; Liu, H M; Liu, X Z

    2015-07-28

    The kiwifruit (Actinidia chinensis Planch.) is an economically and nutritionally important fruit crop that has a remarkably high vitamin C content and is popular throughout the world. However, kiwifruit plants are vulnerable to attack from pests, and effective pest control is urgently required. Transgenic kiwifruit plants containing the synthetic chimeric gene SbtCry1Ac that encodes the insecticidal protein btCrylAc were obtained through an Agrobacterium-mediated transformation of kiwifruit leaf discs. The kanamycin resistance of the transgenic plants was then analyzed. Results from polymerase chain reactions and genomic DNA Southern blot analyses indicated that SbtCrylAc had been integrated into the genomes of these plants. The results of insect bioassays revealed that the average Oraesia excavate inhibition rate of plants tested at 10 days post-infestation was 75.2%. To our knowledge, this is the first study that has developed insect-resistant transgenic kiwifruit plants.

  5. Heterogeneous nuclear ribonucleoprotein (HnRNP) K genome-wide binding survey reveals its role in regulating 3'-end RNA processing and transcription termination at the early growth response 1 (EGR1) gene through XRN2 exonuclease.

    Science.gov (United States)

    Mikula, Michal; Bomsztyk, Karol; Goryca, Krzysztof; Chojnowski, Krzysztof; Ostrowski, Jerzy

    2013-08-23

    The heterogeneous nuclear ribonucleoprotein K (hnRNPK) is a nucleic acid-binding protein that acts as a docking platform integrating signal transduction pathways to nucleic acid-related processes. Given that hnRNPK could be involved in other steps that compose gene expression the definition of its genome-wide occupancy is important to better understand its role in transcription and co-transcriptional processes. Here, we used chromatin immunoprecipitation followed by deep sequencing (ChIP-Seq) to analyze the genome-wide hnRNPK-DNA interaction in colon cancer cell line HCT116. 9.1/3.6 and 7.0/3.4 million tags were sequenced/mapped, then 1809 and 642 hnRNPK binding sites were detected in quiescent and 30-min serum-stimulated cells, respectively. The inspection of sequencing tracks revealed inducible hnRNPK recruitment along a number of immediate early gene loci, including EGR1 and ZFP36, with the highest densities present at the transcription termination sites. Strikingly, hnRNPK knockdown with siRNA resulted in increased pre-RNA levels transcribed downstream of the EGR1 polyadenylation (A) site suggesting altered 3'-end pre-RNA degradation. Further ChIP survey of hnRNPK knockdown uncovered decreased recruitment of the 5'-3' exonuclease XRN2 along EGR1 and downstream of the poly(A) signal without altering RNA polymerase II density at these sites. Immunoprecipitation of hnRNPK and XRN2 from intact and RNase A-treated nuclear extracts followed by shotgun mass spectrometry revealed the presence of hnRNPK and XRN2 in the same complexes along with other spliceosome-related proteins. Our data suggest that hnRNPK may play a role in recruitment of XRN2 to gene loci thus regulating coupling 3'-end pre-mRNA processing to transcription termination.

  6. Digital model for harmonic interactions in AC/DC/AC systems

    Energy Technology Data Exchange (ETDEWEB)

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  7. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  8. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    OpenAIRE

    S. Arumugam S. Ramareddy M. Sridhar

    2011-01-01

    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  9. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  10. Ag incorporated Mn3O4/AC nanocomposite based supercapacitor devices with high energy density and power density.

    Science.gov (United States)

    Nagamuthu, S; Vijayakumar, S; Muralidharan, G

    2014-12-14

    Silver incorporated Mn3O4/amorphous carbon (AC) nanocomposites are synthesized by a green chemistry method. X-ray diffraction studies revealed the structural changes in Mn3O4/AC nanocomposites attributable to the addition of silver. Cyclic voltammetry, charge-discharge and ac-impedance studies indicated that the Ag-Mn3O4/AC-5 electrode was the most suitable candidate for supercapacitor applications. From the galvanostatic charge-discharge studies, a higher specific capacitance of 981 F g(-1) at a specific current of 1 A g(-1) was obtained. An Ag-Mn3O4/AC-symmetric supercapacitor consisting of an Ag-incorporated Mn3O4/AC composite as an anode as well as a cathode, and an asymmetric supercapacitor consisting of an Ag-incorporated Mn3O4/AC composite as a cathode and an activated carbon as an anode have been fabricated. The symmetric device exhibits a specific cell capacitance of 72 F g(-1) at a specific current of 1 A g(-1) whereas the asymmetric device delivers a specific cell capacitance of 180 F g(-1) at a high current rate of 10 A g(-1). The asymmetric supercapacitor device yields a high energy density of 81 W h kg(-1). This is higher than that of lead acid batteries and comparable with that of nickel hydride batteries.

  11. UARS PEM Level 2 VMAG AC V001

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  12. Nutrition, Physical Activity, and Obesity - American Community Survey

    Data.gov (United States)

    U.S. Department of Health & Human Services — This dataset includes select data from the U.S. Census Bureau's American Community Survey (ACS) on the percent of adults who bike or walk to work. This data is used...

  13. Pittsburgh American Community Survey Data 2015 - Household Types

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — The data on relationship to householder were derived from answers to Question 2 in the 2015 American Community Survey (ACS), which was asked of all people in...

  14. Facial cellulitis revealing choreo-acanthocytosis: A case report ...

    African Journals Online (AJOL)

    We report a 62 year-old-man with facial cellulitis revealing choreo-acanthocytosis (ChAc). He showed chorea that started 20 years ago. The orofacial dyskinisia with tongue and cheek biting resulted in facial cellulitis. The peripheral blood smear revealed acanthocytosis of 25%. The overall of chorea, orofacial dyskinetic ...

  15. AC Electrokinetics of Physiological Fluids for Biomedical Applications

    OpenAIRE

    Lu, Yi; Liu,Tingting; Lamanda, Ariana C.; Sin, Mandy L. Y.; Gau, Vincent; Liao, Joseph C.; Wong, Pak Kin

    2014-01-01

    AC electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration and separation, makes it possible to develop integrated systems for clinical diagnostics in non-traditional healthcare settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics based dia...

  16. CEC/ICMC'99. Superconduction. AC loss; Koryu sonshitsu

    Energy Technology Data Exchange (ETDEWEB)

    Amamiya, Naoyuki [Yokohama National University, Yokohama (Japan)

    1999-09-25

    Ten presentations of studies on AC loss of superconductive materials are outlined, which include theoretical expression for AC loss analysis in superconducting cable, frequency dependency of AC loss, effect of aspect ratio and sectional structure by magnetising loss measurement, and effect of base metal resistivity and twist pitch by numerical analysis. Presentations on AC superconduction for commercial frequency were almost all ones concerning to oxide superconductors. (NEDO)

  17. A simple technique for a.c. conductivity measurements

    Indian Academy of Sciences (India)

    Unknown

    A.c. conductivity; complex impedance spectroscopy; bulk resistance; grain boundaries. 1. Introduction. A.c. conductivity is one of the studies done on solids in order to characterize the bulk resistance of the crystalline sample. Measurement of a.c. .... If Zs is purely resistive, there will be change in the amplitude. But if Zs is ...

  18. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    DEFF Research Database (Denmark)

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær

    2012-01-01

    was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...

  19. 21 CFR 880.5500 - AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or other...

  20. Methods for Addressing Missing Data with Applications from ACS Exams

    Science.gov (United States)

    Brandriet, Alexandra; Holme, Thomas

    2015-01-01

    As part of the ACS Examinations Institute (ACS-EI) national norming process, student performance data sets are collected from professors at colleges and universities from around the United States. Because the data sets are collected on a volunteer basis, the ACS-EI often receives data sets with only students' total scores and without the students'…

  1. Evaluation of ac conductivity of rubber ferrite composites from ...

    Indian Academy of Sciences (India)

    They were then incorporated into a butyl rubber matrix according to a specific recipe. The a.c. electrical conductivity (a.c.) calculations were carried out by using the data available from dielectric measurements and by employing a simple relationship. The a.c. conductivity values were found to be of the order of 10–3 S/m.

  2. HST/ACS Coronagraphic Observations of the HD 163296 Circumstellar Disk: Evidence of Time-Variable Self-Shadowing?

    Science.gov (United States)

    Wisniewski, J.; Dowling, Lorraine; Clampin, Mark; Grady, C.; Ardila, D.; Golimowski, D.; Illingworth, G.; Krist, J.

    2007-01-01

    We present Hubble Space Telescope Advanced Camera for Surveys (HST/ACS) coronagraphic observations of the Herbig Ae star HD 163296. HD 163296's scattered light disk was resolved in the F606W and F814W filters in observations obtained In 2003 and in the F435W filter in observations obtained in 2004. Analysis of single-epoch data indicates that the disk (V-I) color is redder than the observed stellar (V-I) color. This spatially uniform red disk color might be indicative of either an evolution in the grain size distribution (i.e. grain growth) and/or composition. Both of these processes would be consistent with the observed flat geometry of the outer disk, as diagnosed by the observed r$(exp -3)$ power law behavior of its median azimuthally averaged disk surface brightness, which suggest that grain evolution is occurring. Comparison of ACS and STIS epoch scattered light data reveals differences in the observed disk surface brightnesses, of order 1 mag arcsec$(exp -2)$, in both V and white-light filter bandpasses. Along with the observed variability in the visibility and surface brightness of the ansa(e) in the disk, and spectropolarimetric variability of the system, these results suggest that the resolved scattered light disk is variable, a phenomenon not previously observed in any other Herbig protoplanetary system We speculate that the observed behavior might be attributable to the variable inflation of the scale height of the inner disk wall, which results in variable self-shadowing of the outer disk.

  3. HST/ACS observations of shell galaxies: inner shells, shell colours and dust

    Science.gov (United States)

    Sikkema, G.; Carter, D.; Peletier, R. F.; Balcells, M.; Del Burgo, C.; Valentijn, E. A.

    2007-06-01

    Context: Shells in Elliptical Galaxies are faint, sharp-edged features, believed to provide evidence for a merger event. Accurate photometry at high spatial resolution is needed to learn on presence of inner shells, population properties of shells, and dust in shell galaxies. Aims: Learn more about the origin of shells and dust in early type galaxies. Methods: V-I colours of shells and underlying galaxies are derived, using HST Advanced Camera for Surveys (ACS) data. A galaxy model is made locally in wedges and subtracted to determine shell profiles and colours. We applied Voronoi binning to our data to get smoothed colour maps of the galaxies. Comparison with N-body simulations from the literature gives more insight to the origin of the shell features. Shell positions and dust characteristics are inferred from model galaxy subtracted images. Results: The ACS images reveal shells well within the effective radius in some galaxies (at 0.24 re = 1.7 kpc in the case of NGC 5982). In some cases, strong nuclear dust patches prevent detection of inner shells. Most shells have colours which are similar to the underlying galaxy. Some inner shells are redder than the galaxy. All six shell galaxies show out of dynamical equilibrium dust features, like lanes or patches, in their central regions. Our detection rate for dust in the shell ellipticals is greater than that found from HST archive data for a sample of normal early-type galaxies, at the 95% confidence level. Conclusions: The merger model describes better the shell distributions and morphologies than the interaction model. Red shell colours are most likely due to the presence of dust and/or older stellar populations. The high prevalence and out of dynamical equilibrium morphologies of the central dust features point towards external influences being responsible for visible dust features in early type shell galaxies. Inner shells are able to manifest themselves in relatively old shell systems. Based on observations made

  4. Evaluation of 225Ac decay data.

    Science.gov (United States)

    Xiaolong, Huang; Baosong, Wang

    2007-06-01

    Evaluation of the complete decay scheme and data for (225)Ac including new measurements are presented in this report; literature data available up to March 2006 are included. The half-life is determined to be 10.0+/-0.1 days. All known measured gamma-ray relative intensities have been examined; the gamma-ray emission probability of the reference gamma-ray line of 150.04 keV is recommended to be 0.693+/-0.012%. The calculated internal conversion coefficients and their uncertainties have been used to obtain the complete decay intensity balance. The other decay characteristics are calculated using the ENSDF analysis program. Finally, the new decay scheme for (225)Ac is presented.

  5. The LHC AC Dipole system: an introduction

    CERN Document Server

    Serrano, J; CERN. Geneva. BE Department

    2010-01-01

    The LHC AC Dipole is an instrument to study properties of the LHC lattice by inducing large transverse displacements in the beam. These displacements are generated by exciting the beam with an oscillating magnetic field at a frequency close to the tune. This paper presents the system requirements and the technical solution chosen to meet them, based of high-power audio amplifiers and a resonant parallel RLC circuit.

  6. CTE Corrections for WFPC2 and ACS

    Science.gov (United States)

    Dolphin, Andrew

    2003-07-01

    The error budget for optical broadband photometry is dominated by three factors: CTE corrections, long-short anomaly corrections, and photometric zero points. Questions about the dependencies of the CTE have largely been resolved, and my CTE corrections have been included in the WFPC2 handbook and tutorial. What remains to be done is the determination of the "final" CTE correction at the end of the WFPC2 mission, which will increase the accuracy of photometry obtained in the final few cycles. The long-short anomaly is still the subject of much debate, as it remains unclear whethere or not this effect is real and, if so, what its size and nature is. Photometric zero points have likewise varied by over 0.05 magnitudes in the literature, and will likely remain unresolved until the long-short anomaly is addressed {given that most calibration exposures are short while most science exposures are long}. It is also becoming apparent that similar issues will affect the accuracy of ACS photometry, and consequently that an ACS CTE study analogous to my WFPC2 work would significantly improve the calibration of ACS. I therefore propose to use archival WFPC2 images of omega Cen and ACS images of 47 Tuc to continue my HST calibration work. I also propose to begin work on "next-generation" CTE corrections, in which corrections are applied to the images based on accurate charge-trapping models rather than to the reduced photometry. This technique will allow for more accurate CTE corrections in certain cases {such as a star above a bright star or on a variable background}, improved PSF-fitting photometry of faint stars, and image restoration for accurate analysis of extended objects.

  7. Direct amplitude detuning measurement with ac dipole

    Science.gov (United States)

    White, S.; Maclean, E.; Tomás, R.

    2013-07-01

    In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning). The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  8. Direct amplitude detuning measurement with ac dipole

    Directory of Open Access Journals (Sweden)

    S. White

    2013-07-01

    Full Text Available In circular machines, nonlinear dynamics can impact parameters such as beam lifetime and could result in limitations on the performance reach of the accelerator. Assessing and understanding these effects in experiments is essential to confirm the accuracy of the magnetic model and improve the machine performance. A direct measurement of the machine nonlinearities can be obtained by characterizing the dependency of the tune as a function of the amplitude of oscillations (usually defined as amplitude detuning. The conventional technique is to excite the beam to large amplitudes with a single kick and derive the tune from turn-by-turn data acquired with beam position monitors. Although this provides a very precise tune measurement it has the significant disadvantage of being destructive. An alternative, nondestructive way of exciting large amplitude oscillations is to use an ac dipole. The perturbation Hamiltonian in the presence of an ac dipole excitation shows a distinct behavior compared to the free oscillations which should be correctly taken into account in the interpretation of experimental data. The use of an ac dipole for direct amplitude detuning measurement requires careful data processing allowing one to observe the natural tune of the machine; the feasibility of such a measurement is demonstrated using experimental data from the Large Hadron Collider. An experimental proof of the theoretical derivations based on measurements performed at injection energy is provided as well as an application of this technique at top energy using a large number of excitations on the same beam.

  9. Topologically protected ac transport in zigzag silicene nanosystem

    Science.gov (United States)

    Ye, En-Jia; Sun, Yun-Lei; Yang, Guo-Feng; Chen, Guo-Qing

    2017-04-01

    The linear ac transport properties are investigated theoretically in zigzag silicene nanoribbon and nanojunction systems. Based on the tight-binding approach and ac response theory, we compute the dc conductance and ac emittance. The topologically protected edge states and eliminated ac emittance are presented around the Dirac point. Emittances as functions of the strength of spin-orbital interaction (SOI) and geometric size of the silicene systems are studied. The results show that the eliminated ac response behavior is induced by the strong SOI and is topologically protected against the size variation.

  10. AC Electrokinetics of Physiological Fluids for Biomedical Applications.

    Science.gov (United States)

    Lu, Yi; Liu, Tingting; Lamanda, Ariana C; Sin, Mandy L Y; Gau, Vincent; Liao, Joseph C; Wong, Pak Kin

    2015-12-01

    Alternating current (AC) electrokinetics is a collection of processes for manipulating bulk fluid mass and embedded objects with AC electric fields. The ability of AC electrokinetics to implement the major microfluidic operations, such as pumping, mixing, concentration, and separation, makes it possible to develop integrated systems for clinical diagnostics in nontraditional health care settings. The high conductivity of physiological fluids presents new challenges and opportunities for AC electrokinetics-based diagnostic systems. In this review, AC electrokinetic phenomena in conductive physiological fluids are described followed by a review of the basic microfluidic operations and the recent biomedical applications of AC electrokinetics. The future prospects of AC electrokinetics for clinical diagnostics are presented. © 2014 Society for Laboratory Automation and Screening.

  11. Transcranial Alternating Current Stimulation (tACS Mechanisms and Protocols

    Directory of Open Access Journals (Sweden)

    Amir V. Tavakoli

    2017-09-01

    Full Text Available Perception, cognition and consciousness can be modulated as a function of oscillating neural activity, while ongoing neuronal dynamics are influenced by synaptic activity and membrane potential. Consequently, transcranial alternating current stimulation (tACS may be used for neurological intervention. The advantageous features of tACS include the biphasic and sinusoidal tACS currents, the ability to entrain large neuronal populations, and subtle control over somatic effects. Through neuromodulation of phasic, neural activity, tACS is a powerful tool to investigate the neural correlates of cognition. The rapid development in this area requires clarity about best practices. Here we briefly introduce tACS and review the most compelling findings in the literature to provide a starting point for using tACS. We suggest that tACS protocols be based on functional brain mechanisms and appropriate control experiments, including active sham and condition blinding.

  12. Measuring Residential Segregation With the ACS: How the Margin of Error Affects the Dissimilarity Index.

    Science.gov (United States)

    Napierala, Jeffrey; Denton, Nancy

    2017-02-01

    The American Community Survey (ACS) provides valuable, timely population estimates but with increased levels of sampling error. Although the margin of error is included with aggregate estimates, it has not been incorporated into segregation indexes. With the increasing levels of diversity in small and large places throughout the United States comes a need to track accurately and study changes in racial and ethnic segregation between censuses. The 2005-2009 ACS is used to calculate three dissimilarity indexes (D) for all core-based statistical areas (CBSAs) in the United States. We introduce a simulation method for computing segregation indexes and examine them with particular regard to the size of the CBSAs. Additionally, a subset of CBSAs is used to explore how ACS indexes differ from those computed using the 2000 and 2010 censuses. Findings suggest that the precision and accuracy of D from the ACS is influenced by a number of factors, including the number of tracts and minority population size. For smaller areas, point estimates systematically overstate actual levels of segregation, and large confidence intervals lead to limited statistical power.

  13. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    OpenAIRE

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  14. Comportamento Acústico de Fachadas: Isolamento Acústico versus Permeabilidade ao Ar

    OpenAIRE

    Ferreira, Diogo Miguel do Rosário

    2016-01-01

    Nos dias de hoje, o conforto acústico dos edifícios revela-se como um factor muito importante no contexto da comodidade global dos seus habitantes. Para tanto, contribui de forma relevante o isolamento sonoro que as fachadas dos edifícios possam assegurar. Sendo as fachadas constituídas por uma parte opaca e uma outra translúcida, é esta última a que mais condiciona o isolamento acústico que o elemento fachada proporciona, o qual é influenciado tanto pela janela propriamente dita, como pelas ...

  15. Ac susceptibility study of CaCl2 doped copper–zinc ferrite system

    Indian Academy of Sciences (India)

    Polycrystalline soft ferrites, Zn x Cu 1 – x Fe2O4 ( = 0.30, 0.50, 0.70, 0.80 and 0.90), doped with controlled amount of calcium chloride (CaCl2) were prepared by standard ceramic route and studied for a.c. susceptibility. X-ray diffraction studies of the compositions reveal formation of single-phase cubic spinel. The values of ...

  16. DC injection into low voltage AC networks

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  17. Flexible AC transmission systems modelling and control

    CERN Document Server

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  18. Composite Based EHV AC Overhead Transmission Lines

    DEFF Research Database (Denmark)

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV...... and analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  19. Experimental investigation of SDBD plasma actuator driven by AC high voltage with a superimposed positive pulse bias voltage

    Science.gov (United States)

    Qi, Xiao-Hua; Yan, Hui-Jie; Yang, Liang; Hua, Yue; Ren, Chun-Sheng

    2017-08-01

    In this work, a driven voltage consisting of AC high voltage with a superimposed positive pulse bias voltage ("AC+ Positive pulse bias" voltage) is adopted to study the performance of a surface dielectric barrier discharge plasma actuator under atmospheric conditions. To compare the performance of the actuator driven by single-AC voltage and "AC+ Positive pulse bias" voltage, the actuator-induced thrust force and power consumption are measured as a function of the applied AC voltage, and the measured results indicate that the thrust force can be promoted significantly after superimposing the positive pulse bias voltage. The physical mechanism behind the thrust force changes is analyzed by measuring the optical properties, electrical characteristics, and surface potential distribution. Experimental results indicate that the glow-like discharge in the AC voltage half-cycle, next to the cycle where a bias voltage pulse has been applied, is enhanced after applying the positive pulse bias voltage, and this perhaps is the main reason for the thrust force increase. Moreover, surface potential measurement results reveal that the spatial electric field formed by the surface charge accumulation after positive pulse discharge can significantly affect the applied external electric field, and this perhaps can be responsible for the experimental phenomenon that the decrease of thrust force is delayed by pulse bias voltage action after the filament discharge occurs in the glow-like discharge region. The schlieren images further verify that the actuator-induced airflow velocity increases with the positive pulse voltage.

  20. Distribution and Metabolism of Bt-Cry1Ac Toxin in Tissues and Organs of the Cotton Bollworm, Helicoverpa armigera

    Directory of Open Access Journals (Sweden)

    Zhuoya Zhao

    2016-07-01

    Full Text Available Crystal (Cry proteins derived from Bacillus thuringiensis (Bt have been widely used in transgenic crops due to their toxicity against insect pests. However, the distribution and metabolism of these toxins in insect tissues and organs have remained obscure because the target insects do not ingest much toxin. In this study, several Cry1Ac-resistant strains of Helicoverpa armigera, fed artificial diets containing high doses of Cry1Ac toxin, were used to investigate the distribution and metabolism of Cry1Ac in their bodies. Cry1Ac was only detected in larvae, not in pupae or adults. Also, Cry1Ac passed through the midgut into other tissues, such as the hemolymph and fat body, but did not reach the larval integument. Metabolic tests revealed that Cry1Ac degraded most rapidly in the fat body, followed by the hemolymph, peritrophic membrane and its contents. The toxin was metabolized slowly in the midgut, but was degraded in all locations within 48 h. These findings will improve understanding of the functional mechanism of Bt toxins in target insects and the biotransfer and the bioaccumulation of Bt toxins in arthropod food webs in the Bt crop ecosystem.

  1. Identification and preliminary characterization of acsF, a Putative Ni-insertase used in the biosynthesis of acetyl-CoA synthase from Clostridium thermoaceticum

    Energy Technology Data Exchange (ETDEWEB)

    Huay-Keng Loke; Paul A. Lindahl

    2003-01-01

    OAK-B135 The acsABCDE genes in the Clostridium thermoaceticum genome are used for autotrophic acetyl-CoA synthesis using the Wood/Ljungdahl pathway. A 2.8 kb region between acsC and acsD was cloned and sequenced. Two open reading frames, orf7 ({approx} 1.9 kb) and acsF ({approx} 0.7 kb) were identified. orf7 appears to encode an Fe-S protein, in that it contains 5 conserved cysteine residues, 3 of which are present in a motif (CXXXXXCXXC) commonly used to coordinate Fe-S clusters. However, Orf7 is probably not involved in autotrophic acetyl-CoA synthesis, as homologous genes are present in organisms that do not utilize this pathway and are absent in many that do. In contrast, acsF is probably involved in this pathway. Sequence alignment of AcsF and 11 homologs reveals a number of conserved regions, including a P-loop that binds nucleoside triphosphates and catalyzes their hydrolysis. One homolog is CooC, an ATPase/GTPase that inserts Ni into a precursor form of the C-cluster of the carbon monoxide dehydrogenase (CODH) from Rhodospirillum rubrum. Purified AcsF lacked Ni and Fe, and slowly catalyzed the hydrolysis of ATP. Such similarities to CooC suggest that AcsF may function to insert Ni into a Ni-deficient form of the bifunctional acetyl-CoA synthase/CODH from C. thermoaceticum (ACSCt). However, this could not be established, as expression of acsF did not effect activation of recombinant AcsAB expressed in E. coli. Also, E. coli cells defective in hypB retained the ability to synthesize active recombinant AcsAB. Rather, the concentration of extracellular Ni2+ ions was critical to activation.

  2. Engineering cotton (Gossypium hirsutum L.) for resistance to cotton leaf curl disease using viral truncated AC1 DNA sequences.

    Science.gov (United States)

    Hashmi, Jamil A; Zafar, Yusuf; Arshad, Muhammad; Mansoor, Shahid; Asad, Shaheen

    2011-04-01

    Several important biological processes are performed by distinct functional domains found on replication-associated protein (Rep) encoded by AC1 of geminiviruses. Two truncated forms of replicase (tAC1) gene, capable of expressing only the N-terminal 669 bp (5'AC1) and C-terminal 783 bp (3'AC1) nucleotides cloned under transcriptional control of the CaMV35S were introduced into cotton (Gossypium hirsutum L.) using LBA4404 strain of Agrobacterium tumefaciens to make use of an interference strategy for impairing cotton leaf curl virus (CLCuV) infection in transgenic cotton. Compared with nontransformed control, we observed that transgenic cotton plants overexpressing either N-terminal (5'AC1) or C-terminal (3'AC1) sequences confer resistance to CLCuV by inhibiting replication of viral genomic and β satellite DNA components. Molecular analysis by Northern blot hybridization revealed high transgene expression in early and late growth stages associated with inhibition of CLCuV replication. Of the eight T(1) transgenic lines tested, six had delayed and minor symptoms as compared to nontransformed control lines which developed disease symptoms after 2-3 weeks of whitefly-mediated viral delivery. Virus biological assay and growth of T(2) plants proved that transgenic cotton plants overexpressing 5'- and 3'AC1 displayed high resistance level up to 72, 81%, respectively, as compared to non-transformed control plants following inoculation with viruliferous whiteflies giving significantly high cotton seed yield. Progeny analysis of these plants by polymerase chain reaction (PCR), Southern blotting and virus biological assay showed stable transgene, integration, inheritance and cotton leaf curl disease (CLCuD) resistance in two of the eight transgenic lines having single or two transgene insertions. Transgenic cotton expressing partial AC1 gene of CLCuV can be used as virus resistance source in cotton breeding programs aiming to improve virus resistance in cotton crop.

  3. AC signal characterization for optimization of a CMOS single-electron pump

    Science.gov (United States)

    Murray, Roy; Perron, Justin K.; Stewart, M. D., Jr.; Zimmerman, Neil M.

    2018-02-01

    Pumping single electrons at a set rate is being widely pursued as an electrical current standard. Semiconductor charge pumps have been pursued in a variety of modes, including single gate ratchet, a variety of 2-gate ratchet pumps, and 2-gate turnstiles. Whether pumping with one or two AC signals, lower error rates can result from better knowledge of the properties of the AC signal at the device. In this work, we operated a CMOS single-electron pump with a 2-gate ratchet style measurement and used the results to characterize and optimize our two AC signals. Fitting this data at various frequencies revealed both a difference in signal path length and attenuation between our two AC lines. Using this data, we corrected for the difference in signal path length and attenuation by applying an offset in both the phase and the amplitude at the signal generator. Operating the device as a turnstile while using the optimized parameters determined from the 2-gate ratchet measurement led to much flatter, more robust charge pumping plateaus. This method was useful in tuning our device up for optimal charge pumping, and may prove useful to the semiconductor quantum dot community to determine signal attenuation and path differences at the device.

  4. Modeling and reliability analysis of three phase z-source AC-AC converter

    Directory of Open Access Journals (Sweden)

    Prasad Hanuman

    2017-12-01

    Full Text Available This paper presents the small signal modeling using the state space averaging technique and reliability analysis of a three-phase z-source ac-ac converter. By controlling the shoot-through duty ratio, it can operate in buck-boost mode and maintain desired output voltage during voltage sag and surge condition. It has faster dynamic response and higher efficiency as compared to the traditional voltage regulator. Small signal analysis derives different control transfer functions and this leads to design a suitable controller for a closed loop system during supply voltage variation. The closed loop system of the converter with a PID controller eliminates the transients in output voltage and provides steady state regulated output. The proposed model designed in the RT-LAB and executed in a field programming gate array (FPGA-based real-time digital simulator at a fixedtime step of 10 μs and a constant switching frequency of 10 kHz. The simulator was developed using very high speed integrated circuit hardware description language (VHDL, making it versatile and moveable. Hardware-in-the-loop (HIL simulation results are presented to justify the MATLAB simulation results during supply voltage variation of the three phase z-source ac-ac converter. The reliability analysis has been applied to the converter to find out the failure rate of its different components.

  5. single-phase dc phase dc-ac boost converter ac boost converter

    African Journals Online (AJOL)

    User

    This paper describes a new power conversion circuit dc-dc boost converter. It boost converter. It boost converter. It comprises an H comprises an H. Change of load .... A full-wave rectified signal is used to produce an AC reference voltage v* o. The outer voltage loop generates the reference current command i* f. A common.

  6. Interaction with mycorrhiza helper bacterium Streptomyces sp. AcH 505 modifies organisation of actin cytoskeleton in the ectomycorrhizal fungus Amanita muscaria (fly agaric).

    Science.gov (United States)

    Schrey, Silvia D; Salo, Vanamo; Raudaskoski, Marjatta; Hampp, Rüdiger; Nehls, Uwe; Tarkka, Mika T

    2007-08-01

    The actin cytoskeleton (AC) of fungal hyphae is a major determinant of hyphal shape and morphogenesis, implicated in controlling tip structure and secretory vesicle delivery. Hyphal growth of the ectomycorrhizal fungus Amanita muscaria and symbiosis formation with spruce are promoted by the mycorrhiza helper bacterium Streptomyces sp. AcH 505 (AcH 505). To investigate structural requirements of growth promotion, the effect of AcH 505 on A. muscaria hyphal morphology, AC and actin gene expression were studied. Hyphal diameter and mycelial density decreased during dual culture (DC), and indirect immunofluorescence microscopy revealed that the dense and polarised actin cap in hyphal tips of axenic A. muscaria changes to a loosened and dispersed structure in DC. Supplementation of growth medium with cell-free bacterial supernatant confirmed that reduction in hyphal diameter and AC changes occurred at the same stage of growth. Transcript levels of both actin genes isolated from A. muscaria remained unaltered, indicating that AC changes are regulated by reorganisation of the existing actin pool. In conclusion, the AC reorganisation appears to result in altered hyphal morphology and faster apical extension. The thus improved spreading of hyphae and increased probability to encounter plant roots highlights a mechanism behind the mycorrhiza helper effect.

  7. Djungle power. A more remote AC bus

    Energy Technology Data Exchange (ETDEWEB)

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  8. HST/ACS DIRECT AGES OF THE DWARF ELLIPTICAL GALAXIES NGC 147 AND NGC 185

    Energy Technology Data Exchange (ETDEWEB)

    Geha, M. [Astronomy Department, Yale University, New Haven, CT 06520 (United States); Weisz, D. [Astronomy Department, Box 351580, University of Washington, Seattle, WA 98195 (United States); Grocholski, A. [Department of Physics and Astronomy, Louisiana State University, Baton Rouge, LA 70803 (United States); Dolphin, A. [Raytheon, 1151 E. Hermans Road, Tucson, AZ 85756 (United States); Marel, R. P. van der [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Guhathakurta, P., E-mail: marla.geha@yale.edu [UCO/Lick Observatory, University of California, Santa Cruz, 1156 High Street, Santa Cruz, CA 95064 (United States)

    2015-10-01

    We present the deepest optical photometry for any dwarf elliptical (dE) galaxy based on Hubble Space Telescope Advanced Camera for Surveys (ACS) observations of the Local Group dE galaxies NGC 147 and NGC 185. Our F606W and F814W color–magnitude diagrams are the first to reach below the oldest main sequence turnoff in a dE galaxy, allowing us to determine full star formation histories in these systems. The ACS fields are located roughly ∼1.5 effective radii from the galaxy center to avoid photometric crowding. While both ACS fields show unambiguous evidence for old and intermediate age stars, the mean age of NGC 147 is ∼4–5 Gyr younger as compared to NGC 185. In NGC 147, only 40% of stars were in place 12.5 Gyr ago (z ∼ 5), with the bulk of the remaining stellar population forming between 5 to 7 Gyr. In contrast, 70% of stars were formed in NGC 185 prior to 12.5 Gyr ago with the majority of the remaining population forming between 8 to 10 Gyr ago. Star formation has ceased in both ACS fields for at least 3 Gyr. Previous observations in the central regions of NGC 185 show evidence for star formation as recent as 100 Myr ago, and a strong metallicity gradient with radius. This implies a lack of radial mixing between the center of NGC 185 and our ACS field. The lack of radial gradients in NGC 147 suggests that our inferred SFHs are more representative of its global history. We interpret the inferred differences in star formation histories to imply an earlier infall time into the M31 environment for NGC 185 as compared to NGC 147.

  9. Calibration free method for measurement of the AC magnetization loss

    Energy Technology Data Exchange (ETDEWEB)

    Souc, Jan [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Goemoery, Fedor [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Vojenciak, Michal [Department of Power Electrical Systems, University of Zilina, Vel' ky diel, 010 26 Zilina (Slovakia)

    2005-05-01

    A calibration free measurement method for determination of the magnetization loss of superconducting samples exposed to the external AC magnetic field is presented. The idea is based on the measurement of the part of the power which is supplied by the AC source to the AC magnet generating the magnetic field, in which the sample is located. It uses a coil wound in parallel to the AC field magnet as the measurement coil. To achieve the necessary sensitivity, two identical systems are used, each consisting of an AC magnet and a measurement coil, one of them containing the sample and the other left empty. No measurement and/or calculation of the calibration constant is required. To confirm the suitability of this method, the loss of a Cu sample with known dissipation was measured. The applicability to the AC magnetization loss measurements of superconducting tapes is presented.

  10. A catechol oxidase AcPPO from cherimoya (Annona cherimola Mill.) is localized to the Golgi apparatus.

    Science.gov (United States)

    Olmedo, Patricio; Moreno, Adrián A; Sanhueza, Dayan; Balic, Iván; Silva-Sanzana, Christian; Zepeda, Baltasar; Verdonk, Julian C; Arriagada, César; Meneses, Claudio; Campos-Vargas, Reinaldo

    2018-01-01

    Cherimoya (Annona cherimola) is an exotic fruit with attractive organoleptic characteristics. However, it is highly perishable and susceptible to postharvest browning. In fresh fruit, browning is primarily caused by the polyphenol oxidase (PPO) enzyme catalyzing the oxidation of o-diphenols to quinones, which polymerize to form brown melanin pigment. There is no consensus in the literature regarding a specific role of PPO, and its subcellular localization in different plant species is mainly described within plastids. The present work determined the subcellular localization of a PPO protein from cherimoya (AcPPO). The obtained results revealed that the AcPPO- green fluorescent protein co-localized with a Golgi apparatus marker, and AcPPO activity was present in Golgi apparatus-enriched fractions. Likewise, transient expression assays revealed that AcPPO remained active in Golgi apparatus-enriched fractions obtained from tobacco leaves. These results suggest a putative function of AcPPO in the Golgi apparatus of cherimoya, providing new perspectives on PPO functionality in the secretory pathway, its effects on cherimoya physiology, and the evolution of this enzyme. Copyright © 2017. Published by Elsevier B.V.

  11. Effect of a single injection of autologous conditioned serum (ACS) on tendon healing in equine naturally occurring tendinopathies.

    Science.gov (United States)

    Geburek, Florian; Lietzau, Maren; Beineke, Andreas; Rohn, Karl; Stadler, Peter M

    2015-06-26

    Autologous blood-derived biologicals, including autologous conditioned serum (ACS), are frequently used to treat tendinopathies in horses despite limited evidence for their efficacy. The purpose of this study was to describe the effect of a single intralesional injection of ACS in naturally occurring tendinopathies of the equine superficial digital flexor tendon (SDFT) on clinical, ultrasonographic, and histological parameters. Fifteen horses with 17 naturally occurring tendinopathies of forelimb SDFTs were examined clinically and ultrasonographically (day 0). Injured tendons were randomly assigned to the ACS-treated group (n = 10) receiving a single intralesional ACS injection or included as controls (n = 7) which were either untreated or injected with saline on day 1. All horses participated in a gradually increasing exercise programme and were re-examined nine times at regular intervals until day 190. Needle biopsies were taken from the SDFTs on days 0, 36 and 190 and examined histologically and for the expression of collagen types I and III by immunohistochemistry. In ACS-treated limbs lameness decreased significantly until day 10 after treatment. Swelling (scores) of the SDFT region decreased within the ACS group between 50 and 78 days after treatment. Ultrasonographically, the percentage of the lesion in the tendon was significantly lower and the echogenicity of the lesion (total echo score) was significantly higher 78 and 106 days after intralesional ACS injection compared to controls. Histology revealed that, compared to controls, tenocyte nuclei were more spindle-shaped 36 days after ACS injection. Immunohistochemistry showed that collagen type I expression significantly increased between days 36 and 190 after ACS injection. Single intralesional ACS injection of equine SDFTs with clinical signs of acute tendinopathy contributes to an early significant reduction of lameness and leads to temporary improvement of ultrasonographic parameters of repair tissue

  12. Enhancement of Bacillus thuringiensis insecticidal activity by combining Cry1Ac and bi-functional toxin HWTX-XI from spider.

    Science.gov (United States)

    Sun, Yunjun; Fu, Zujiao; He, Xiaohong; Yuan, Chunhua; Ding, Xuezhi; Xia, Liqiu

    2016-03-01

    In order to assess the potency of bi-functional HWTX-XI toxin from spider Ornithoctonus huwena in improving the insecticidal activity of Bacillus thuringiensis, a fusion gene of cry1Ac and hwtx-XI was constructed and expressed in an acrystalliferous B. thuringiensis strain Cry(-)B. Western blot analysis and microscopic observation revealed that the recombinant strain could express 140-kDa Cry1Ac-HWTX-XI fusion protein and produce parasporal inclusions during sporulation. Bioassay using the larvae of Helicoverpa armigera and Spodoptera exigua showed that the Cry1Ac-HWTX-XI fusion was more toxic than the control Cry1Ac protoxin, as revealed by 95% lethal concentration. Our study indicated that the HWTX-XI from spider might be a candidate for enhancing the toxicity of B. thuringiensis products. Copyright © 2015 Elsevier Inc. All rights reserved.

  13. AC electric motors control advanced design techniques and applications

    CERN Document Server

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  14. Non-vanishing ponderomotive AC electrophoretic effect for particle trapping

    Energy Technology Data Exchange (ETDEWEB)

    Guan, Weihau [Yale University; Park, Jae Hyun nmn [ORNL; Krstic, Predrag S [ORNL; Reed, Mark A [Yale University

    2011-01-01

    We present here a study on overlooked aspects of alternating current (AC) electrokinetics AC electrophoretic (ACEP) phenomena. The dynamics of a particle with both polarizability and net charges in a non-uniform AC electric trapping field is investigated. It is found that either electrophoretic (EP) or dielectrophoretic (DEP) effects can dominate the trapping dynamics, depending on experimental conditions. A dimensionless parameter gamma is developed to predict the relative strength of EP and DEP effects in a quadrupole AC field. An ACEP trap is feasible for charged particles in salt-free or low salt concentration solutions. In contrast to DEP traps, an ACEP trap favors the downscaling of the particle size.

  15. AC Dielectrophoresis Using Elliptic Electrode Geometry

    Directory of Open Access Journals (Sweden)

    S. M. Rezaul Hasan

    2011-01-01

    Full Text Available This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of specimen in a dielectrophoretic cage is also being reported. Using an actuating signal between 1 kHz and 1 MHz, successful trapping of 45 μm polystyrene beads suspended in distilled water was demonstrated due to negative dielectrophoresis near 100 kHz using the novel elliptic electrode.

  16. Sub-Kelvin ac magnetic susceptometry.

    Science.gov (United States)

    Schmidt, M A; Silevitch, D M; Woo, N; Rosenbaum, T F

    2013-01-01

    Designing an apparatus for experiments that operate deep into the milliKelvin regime requires a careful selection of materials and construction techniques, and often entails balancing mutually contradictory requirements. In the case of magnetic susceptibility measurements, this involves choosing materials that realize both high thermal conductivity for good heat sinking and low electrical conductivity for minimal eddy-current heating. A coil mounting system with a completely nonmetallic construction, achieved through the use of a sapphire skeleton and a machined carbon-fiber body, resolves this dilemma. This system permits the use of large ac magnetic field amplitudes at kHz frequencies and above, opening the door to studies of the nonlinear dynamics of a wide variety of magnetic systems that were previously inaccessible.

  17. Combined AC-STEM and FIB-SEM Characterization of Shale

    Science.gov (United States)

    Dewers, T. A.; Heath, J. E.; Kotula, P.; Yoon, H.; Gardner, P.

    2013-12-01

    We examine shale samples with state-of-the-art aberration corrected scanning transmission electron microscopy (AC-STEM) and focused ion beam-scanning electron (FIB-SEM) microscopy. Three-dimensional reconstruction of pore space incorporates electron tomography using the AC-TEM and serial sectioning by FIB-SEM. Chemical analysis by X-ray energy dispersive microscopy reveals composition of pore-lining phases at ~ 1 nm resolution. Our methods reveal the left tail of the pore size distribution that FIB-SEM techniques typically do not capture (pore sizes < 7 nm). Water in pores of this size will deviate from those of bulk water, which can influence non-Darcy flow and mechanical response. The impact of these small pores on fluid and coupled tracer transport is examined by computation fluid dynamics using 3D pore reconstructions. Sandia National Laboratories is a multi-program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000.

  18. CD133 Expression Is Not Synonymous to Immunoreactivity for AC133 and Fluctuates throughout the Cell Cycle in Glioma Stem-Like Cells.

    Directory of Open Access Journals (Sweden)

    Alonso Barrantes-Freer

    Full Text Available A transmembrane protein CD133 has been implicated as a marker of stem-like glioma cells and predictor for therapeutic response in malignant brain tumours. CD133 expression is commonly evaluated by using antibodies specific for the AC133 epitope located in one of the extracellular domains of membrane-bound CD133. There is conflicting evidence regarding the significance of the AC133 epitope as a marker for identifying stem-like glioma cells and predicting the degree of malignancy in glioma cells. The reasons for discrepant results between different studies addressing the role of CD133/AC133 in gliomas are unclear. A possible source for controversies about CD133/AC133 is the widespread assumption that expression patterns of the AC133 epitope reflect linearly those of the CD133 protein. Consequently, the readouts from AC133 assessments are often interpreted in terms of the CD133 protein. The purpose of this study is to determine whether and to what extent do the readouts obtained with anti-AC133 antibody correspond to the level of CD133 protein expressed in stem-like glioma cells. Our study reveals for the first time that CD133 expressed on the surface of glioma cells is poorly immunoreactive for AC133. Furthermore, we provide evidence that the level of CD133 occupancy on the surface of glioma cells fluctuates during the cell cycle. Our results offer a new explanation for numerous inconsistencies regarding the biological and clinical significance of CD133/AC133 in human gliomas and call for caution in interpreting the lack or presence of AC133 epitope in glioma cells.

  19. CD133 Expression Is Not Synonymous to Immunoreactivity for AC133 and Fluctuates throughout the Cell Cycle in Glioma Stem-Like Cells.

    Science.gov (United States)

    Barrantes-Freer, Alonso; Renovanz, Mirjam; Eich, Marcus; Braukmann, Alina; Sprang, Bettina; Spirin, Pavel; Pardo, Luis A; Giese, Alf; Kim, Ella L

    2015-01-01

    A transmembrane protein CD133 has been implicated as a marker of stem-like glioma cells and predictor for therapeutic response in malignant brain tumours. CD133 expression is commonly evaluated by using antibodies specific for the AC133 epitope located in one of the extracellular domains of membrane-bound CD133. There is conflicting evidence regarding the significance of the AC133 epitope as a marker for identifying stem-like glioma cells and predicting the degree of malignancy in glioma cells. The reasons for discrepant results between different studies addressing the role of CD133/AC133 in gliomas are unclear. A possible source for controversies about CD133/AC133 is the widespread assumption that expression patterns of the AC133 epitope reflect linearly those of the CD133 protein. Consequently, the readouts from AC133 assessments are often interpreted in terms of the CD133 protein. The purpose of this study is to determine whether and to what extent do the readouts obtained with anti-AC133 antibody correspond to the level of CD133 protein expressed in stem-like glioma cells. Our study reveals for the first time that CD133 expressed on the surface of glioma cells is poorly immunoreactive for AC133. Furthermore, we provide evidence that the level of CD133 occupancy on the surface of glioma cells fluctuates during the cell cycle. Our results offer a new explanation for numerous inconsistencies regarding the biological and clinical significance of CD133/AC133 in human gliomas and call for caution in interpreting the lack or presence of AC133 epitope in glioma cells.

  20. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin

    2009-01-01

    of semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype......This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can produce the correct volt...

  1. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    DEFF Research Database (Denmark)

    Blaabjerg, Frede; Loh, Poh Chiang; Gao, Feng

    2007-01-01

    a low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper.......This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled...... to switch with a three-level output voltage, where the middle neutral potential is uniquely tapped from the star-point of a wye-connected capacitive filter placed before the front-end diode rectifier for input current filtering. Through careful control, the resulting converter can accurately produce...

  2. Wind-powered asynchronous AC/DC/AC converter system. [for electric power supply regulation

    Science.gov (United States)

    Reitan, D. K.

    1973-01-01

    Two asynchronous ac/dc/ac systems are modelled that utilize wind power to drive a variable or constant hertz alternator. The first system employs a high power 60-hertz inverter tie to the large backup supply of the power company to either supplement them from wind energy, storage, or from a combination of both at a preset desired current; rectifier and inverter are identical and operate in either mode depending on the silicon control rectifier firing angle. The second system employs the same rectification but from a 60-hertz alternator arrangement; it provides mainly dc output, some sinusoidal 60-hertz from the wind bus and some high harmonic content 60-hertz from an 800-watt inverter.

  3. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Directory of Open Access Journals (Sweden)

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  4. Trajectory Control of Self-Propelled Micromotors Using AC Electrokinetics.

    Science.gov (United States)

    Yoshizumi, Yoshitaka; Honegger, Thibault; Berton, Kevin; Suzuki, Hiroaki; Peyrade, David

    2015-11-11

    3D control of the motion of self-powered micromotors is demonstrated using AC electrokinetics by applying an AC electric field on indium tin oxide transparent electrodes. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Science.gov (United States)

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  6. Flexible AC transmission systems: the state of the art

    Energy Technology Data Exchange (ETDEWEB)

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  7. Estimation of the Thurstonian model for the 2-AC protocol

    DEFF Research Database (Denmark)

    Christensen, Rune Haubo Bojesen; Lee, Hye-Seong; Brockhoff, Per B.

    2012-01-01

    . This relationship makes it possible to extract estimates and standard errors of δ and τ from general statistical software, and furthermore, it makes it possible to combine standard regression modelling with the Thurstonian model for the 2-AC protocol. A model for replicated 2-AC data is proposed using cumulative...

  8. Low frequency ac conduction and dielectric relaxation in poly (N ...

    Indian Academy of Sciences (India)

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity.

  9. Transgenic Sugarcane with a cry1Ac Gene Exhibited Better Phenotypic Traits and Enhanced Resistance against Sugarcane Borer.

    Directory of Open Access Journals (Sweden)

    Shiwu Gao

    Full Text Available We developed sugarcane plants with improved resistance to the sugarcane borer, Diatraea saccharalis (F. An expression vector pGcry1Ac0229, harboring the cry1Ac gene and the selectable marker gene, bar, was constructed. This construct was introduced into the sugarcane cultivar FN15 by particle bombardment. Transformed plantlets were identified after selection with Phosphinothricin (PPT and Basta. Plantlets were then screened by PCR based on the presence of cry1Ac and 14 cry1Ac positive plantlets were identified. Real-time quantitative PCR (RT-qPCR revealed that the copy number of cry1Ac gene in the transgenic lines varied from 1 to 148. ELISA analysis showed that Cry1Ac protein levels in 7 transgenic lines ranged from 0.85 μg/FWg to 70.92 μg/FWg in leaves and 0.04 μg/FWg to 7.22 μg/FWg in stems, and negatively correlated to the rate of insect damage that ranged from 36.67% to 13.33%, respectively. Agronomic traits of six transgenic sugarcane lines with medium copy numbers were similar to the non-transgenic parental line. However, phenotype was poor in lines with high or low copy numbers. Compared to the non-transgenic control plants, all transgenic lines with medium copy numbers had relatively equal or lower sucrose yield and significantly improved sugarcane borer resistance, which lowered susceptibility to damage by insects. This suggests that the transgenic sugarcane lines harboring medium copy numbers of the cry1Ac gene may have significantly higher resistance to sugarcane borer but the sugarcane yield in these lines is similar to the non-transgenic control thus making them superior to the control lines.

  10. Mortality after clopidogrel in the non-invasive PLATO cohort and TRILOGY ACS trial: another mismatched death paradox.

    Science.gov (United States)

    Serebruany, Victor L; DiNicolantonio, James J; Can, Mehmet Mustafa; Dukhanin, Alexander; Tomek, Ales

    2013-09-30

    Excess mortality especially in the clopidogrel arm of the PLATO trial raise concerns of data integrity, and call for independent verification of vital records in the national death registries. Recently published data focused on outcomes in patients after non-invasive strategies yielded from the PLATO (PLATO-NIS) and TRILOGY ACS trials allowing comparison of all cause mortality (ACM) between trials. To compare the prorated over follow-up duration rates of ACM in the clopidogrel arms of PLATO-NIS cohort and TRILOGY ACS trial. The background clinical characteristics indicate similar if not higher mortality should be expected in TRILOGY ACS. PLATO trial was almost half the duration with a mean follow-up of 277 days compared to TRILOGY ACS (513 days). Matching prorated over follow-up duration of ACM rates in the clopidogrel arm revealed 0.027/day or 9.86% yearly mortality in PLATO-NIS cohort (195 fatalities among 2615 patients enrolled). The ACM rates in TRILOGY ACS (409/4663) were only 0.017/day or 6.2% annually after clopidogrel, suggesting that the risk to die in the control PLATO-NIS group was 63% higher and barely missed significance (p=0.051) compared to TRILOGY ACS. Prorated over length of follow-up PLATO-NIS mortality rates after clopidogrel far exceeded those observed in a similar medically managed patients in a TRILOGY ACS trial. The background clinical differences between trials are not responsible for the elevated PLATO-NIS mortality numbers. These data further challenge the death paradox reported in the overall PLATO trial and call for the urgent independent verification of vital records. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  11. Development of YBCO HTS cable with low AC loss

    Energy Technology Data Exchange (ETDEWEB)

    Yagi, M. [Energy Transmission Research Department Ecology and Energy Laboratory, Furukawa Electric Co., Ltd., 6, Yawata-Kaigandori, Ichihara, Chiba 290-8555 (Japan)], E-mail: m-yagi@ch.furukawa.co.jp; Mukoyama, S. [Energy Transmission Research Department Ecology and Energy Laboratory, Furukawa Electric Co., Ltd., 6, Yawata-Kaigandori, Ichihara, Chiba 290-8555 (Japan); Amemiya, N. [Yokohama National University, 79-5, Tokiwadai, Hodogaya, Yokohama 240-8501 (Japan); Nagaya, S.; Kashima, N. [Chubu Electric Power Co., Inc., 20-1, Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan); Shiohara, Y. [Superconductivity Research Laboratory, 1-10-13, Shinonome, Koto-ku, Tokyo 135-0062 (Japan)

    2008-09-15

    High temperature superconducting (HTS) cables using YBCO tapes are expected to be more economical because AC losses will be much smaller than conventional cables. To reduce AC loss, 10 mm wide YBCO tapes were divided into five strips using a YAG laser. Using narrower strips and optimizing the space between the strips were effective in reducing AC loss. A 1 m conductor was fabricated, and AC loss was 0.048 W/m at 1 kA and 50 Hz. Based on the successful AC loss reduction in the 1 m conductor, we will fabricate a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield and cupper protection layer for overcurrent. In addition, we have developed a prototype of the HTS cable joint that can withstand an overcurrent condition of 31.5 kA for 2 s.

  12. Characterisation of AC1: a naturally decaffeinated coffee

    Directory of Open Access Journals (Sweden)

    Luciana Benjamim Benatti

    2012-01-01

    Full Text Available We compared the biochemical characteristics of the beans of a naturally decaffeinated Arabica coffee (AC1 discovered in 2004 with those of the widely grown Brazilian Arabica cultivar "Mundo Novo" (MN. Although we observed differences during fruit development, the contents of amino acids, organic acids, chlorogenic acids, soluble sugars and trigonelline were similar in the ripe fruits of AC1 and MN. AC1 beans accumulated theobromine, and caffeine was almost entirely absent. Tests on the supply of [2-14C] adenine and enzymatic analysis of theobromine synthase and caffeine synthase in the endosperm of AC1 confirmed that, as in the leaves, caffeine synthesis is blocked during the methylation of theobromine to caffeine. The quality of the final coffee beverage obtained from AC1 was similar to that of MN.

  13. The use of low frequency AC for offshore wind power

    Energy Technology Data Exchange (ETDEWEB)

    Schuette, T.; Stroem, M.; Gustavsson, Bo [Balfour Beatty Rail AB, Vaesteraas (Sweden)

    2001-07-01

    Low frequency AC, that means AC with a frequency well below the usual frequencies 50 or 60 Hz, has today its main use in single phase AC electrified railways in a number of European countries (16 2/3 Hz), USA (25 Hz) and Costa Rica (20 Hz). Offshore wind power is well suited to 'join the club' as low frequency AC has a number of advantages for that use: Low frequency AC better fits the low revolution frequency of wind power rotors. This can either be used for reduction of pole number for direct generation machines or for a reduction of the gear ratio for conventional machines, resulting in simpler, lighter and more reliable gearboxes. Low frequency AC gives rise to lower charging current/reactive power production, which restricts the maximum cable length for 50 - 60 Hz heavily due to the high specific capacitance of power cables. For low frequency AC, cables longer than 100 km are possible, which is necessary for many future offshore wind power sites. Low frequency AC enables for the use of (air insulated) transmission lines at loads well above their characteristic power, often up to their thermal maximum load. This means that weak 50 or 60 Hz lines between the shore and consumers or stronger parts of a national grid can transfer more power when operated with low frequency AC. On all aspects of low frequency AC, profound knowledge has been accumulated the last century in the railway sector and can be made available for wind power.

  14. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    Science.gov (United States)

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning tests...

  15. Prospectively surveying health-related quality of life and symptom relief in a lot-based sample of medical cannabis-using patients in urban Washington State reveals managed chronic illness and debility.

    Science.gov (United States)

    Aggarwal, S K; Carter, G T; Sullivan, M D; Zumbrunnen, C; Morrill, R; Mayer, J D

    2013-09-01

    To characterize health-related quality of life (HRQoL) in medical cannabis patients. Short Form 36 (SF-36) Physical Health Component Score and Mental Health Component Score (MCS) surveys as well has CDC (Centers for Disease Control) HRQoL-14 surveys were completed by 37 qualified patients. Mean SF-36 PCS and MCS, normalized at 50, were 37.4 and 44.2, respectively. Eighty percent of participants reported activity/functional limitations secondary to impairments or health problems. Patients reported using medical cannabis to treat a wide array of symptoms across multiple body systems with relief ratings consistently in the 7-10/10 range. The HRQoL results in this sample of medical cannabis-using patients are comparable with published norms in other chronically ill populations. Data presented provide insight into medical cannabis-using patients' self-rated health, HRQoL, disease incidences, and cannabis-related symptom relief.

  16. Neurinoma central do nervo acústico

    Directory of Open Access Journals (Sweden)

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  17. Broadband Interferometer for Measuring Transmitted Wavefronts of Optical Bandpass Filters for HST (ACS)

    Science.gov (United States)

    Boucarut, R. A.; Leviton, D. B.

    1998-01-01

    The transmitted wavefronts of optical filters for the Hubble Space Telescope (HST) Advanced Camera for Surveys (ACS) are characterized using the Wildly and Openly Modified Broadband Achromatic Twyman Green (WOMBAT) Interferometer developed in the NASA/GSFC Optics Branch's Diffraction Grating Evaluation Facility (DGEF). Because only four of thirty-three of ACS's optical bandpass filters transmit the 633 nm light of most commercial interferometers, a broadband interferometer is required to verify specified transmitted wavefront of ACS filters. WOMBAT's design is a hybrid of the BAT interferometer developed by JPL used for HST Wide Field and Planetary Camera 2 (WFPC-2) filters and a WYKO 400 phase shifting interferometer. It includes a broadband light source, monochromator, off-axis, parabolic collimating and camera mirrors, an aluminum-coated fused silica beam splitter, flat retroreflecting mirrors for the test and reference arms, and a LTV-sensitive CCD camera. An outboarded, piezo-electric phase shifter holds the flat mirror in the interferometer's reference arm. The interferometer is calibrated through interaction between the WYKO system's software and WONMAT hardware for the test wavelength of light entering the beam splitter. Phase-shifted interferograms of the filter mounted in the test arm are analyzed using WYKO's Vision' software. Filters as large as 90 mm in diameter have been measured over a wavelength range from 200 to 1100 nm with a sensitivity of lambda/200 rms at lambda = 633 nm. Results of transmitted wavefront measurements are shown for ACS fixed band pass and spatially-variable bandpass filters for a variety of wavelengths.

  18. Measurement of AC loss of superconductors by vaporizing method

    Energy Technology Data Exchange (ETDEWEB)

    Wakabayashi, Hiroshi; Isono, Takaaki; Matsui, Kunihiro; Fujisaki, Reishi; Nunoya, Yoshihiko; Koizumi, Norikiyo; Takahashi, Yoshikazu; Tsuji, Hiroshi [Japan Atomic Energy Research Inst., Naka, Ibaraki (Japan). Naka Fusion Research Establishment

    1995-07-01

    In Japan Atomic Energy Research Institute, the development of superconducting pulse conductors for next period nuclear fusion reactors has been carried out. For these conductors, the rated current of 46 kA and the rated magnetic field of 13T are demanded. When the pulse excitation of superconductors is carried out, AC loss arises, and the temperature of the superconductors rises, and when it exceeds a certain value, the superconducting state cannot be maintained. Therefore, the AC loss of pulse conductors must be limited to a low value. It is difficult to evaluate the AC loss of superconductors by calculation, therefore, it is evaluated by actual measurement. There are magnetizing method and vaporizing method for measuring the AC loss. This time, the equipment for measuring the AC loss of 40 kA class superconductors by vaporizing method which measures the helium gas quantity vaporizing at the time of AC loss occurrence was designed and manufactured for the first time. The method of measuring the AC loss, the structure of the measuring equipment, the helium gas recovering part and the measuring part, the countermeasures for preventing helium gas leakage, the resistance heater for calibration, and the results of measurement are reported. (K.I.)

  19. Investigation of AC losses in horizontally parallel HTS tapes

    Science.gov (United States)

    Shen, Boyang; Li, Jing; Geng, Jianzhao; Fu, Lin; Zhang, Xiuchang; Zhang, Heng; Li, Chao; Grilli, Francesco; Coombs, T. A.

    2017-07-01

    This paper presents an AC loss study of horizontally parallel HTS tapes. We proposed to use three parallel HTS tapes as an example. The AC losses of the middle and end tape of three parallel tapes have been measured using the electrical method and compared to those of an individual tape. The effect of the interaction between tapes on AC losses has been analysed, and compared with finite-element method (FEM) simulations using the 2D H -formulation implemented in COMSOL Multiphysics. By using FEM simulations, the cases of increasing number of parallel tapes have been considered, and the normalised ratio between the total average AC losses per tape and the AC losses of an individual single tape has been calculated for different gap distances. We proposed a new parameter, Ns , a turning point for number of tapes, to divide Stage 1 and Stage 2 for the AC loss study of horizontally parallel tapes. For Stage 1, N Ns , the total average losses per tape decrease with the increasing number of tapes. The analysis demonstrates that horizontally parallel HTS tapes could be potentially used in superconducting devices like HTS transformers, which could retain or even reduce the total average AC losses per tape with large number of parallel tapes.

  20. Electron transport through ac driven graphene p-n junctions

    Science.gov (United States)

    Zhang, Zhi-Qiang; Kang, Yan-Zhuo; Ding, Kai-He

    2018-02-01

    We study the electronic transport through ac driven graphene p-n junctions under a perpendicular magnetic field. It is found that subject to the transversely or longitudinally polarized ac field, in the p-n region, the conductance versus the on-site energy of the right electrode exhibits a characteristic structure with a zero value plateau and the followed oscillation peaks, whose widths are greatly suppressed by the ac field. In the n-n region, the conductance plateaus at G = (n + 1 / 2) (4e2 / h) (n is an integer) shrink for the transversely polarized ac field, whereas accompanied with the addition of the new quantized plateaus at G = n (4e2 / h) for the longitudinally polarized ac field. The combined influence of the ac field with the disorder can trigger a change in the mixing of the hole and electron states at the p-n interface, which leads to a destruction of the plateaus structure in the conductance versus the disorder strength with the emergence of new ones. The influence of the elliptically and circularly polarized ac field on the conductance is also shown.

  1. Surgical skills curricula in American College of Surgeons Accredited Education Institutes: An international survey.

    Science.gov (United States)

    Ghaderi, Iman; Fitzgibbons, Shimae; Watanabe, Yusuke; Lachapelle, Alexander; Paige, John

    2017-04-01

    A clear understanding of simulation-based curricula in use at American College of Surgeons Accredited Education Institutes (ACS-AEIs) is lacking. A 25-question online survey was sent to ACS-AEIs. The response rate approached 60%. The most frequent specialties to use the ACS-AEIs are general surgery and obstetrics/gynecology (94%). Residents are the main target population for programming/training (96%). Elements of the ACS/Association of Program Directors in Surgery Surgical Skills Curriculum are used by 77% of responding ACS-AEIs. Only 49% of ACS-AEIs implement the entire curriculum and 96% have independently developed their own surgical skills curricula. "Home-grown" simulators have been designed at 71% of ACS-AEIs. Feasibility (80%), evidence of effectiveness (67%), and cost (60%) were reasons for curriculum adoption. All programs use operative assessment tools for resident performance, and 53% use Messick's unitary framework of validity. Most programs (88%) have financial support from their academic institute. Majority of ACS-AEIs had trainees evaluate their faculty instructors (90%), and the main form of such faculty evaluation was postcourse surveys (97%). This study provides specific information regarding simulation-based curricula at ACS-AEIs. Copyright © 2016 Elsevier Inc. All rights reserved.

  2. Advanced DC/AC inverters applications in renewable energy

    CERN Document Server

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  3. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    DEFF Research Database (Denmark)

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the grids......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...

  4. Effect of nanosilica on optical, electric modulus and AC conductivity of polyvinyl alcohol/polyaniline films

    Science.gov (United States)

    El-Sayed, Somyia; Abel-Baset, Tarob; Elfadl, Azza Abou; Hassen, Arafa

    2015-05-01

    Nanosilica (NS) was synthesized by a sol-gel method and mixed with 0.98 polyvinyl alcohol (PVA)/0.02 polyaniline (PANI) in different amounts to produce nanocomposite films. High-resolution transmission electron microscopy (HR-TEM) revealed the average particle size of the NS to be ca. 15 nm. Scanning electron microscopy (SEM) showed that the NS was well-dispersed on the surface of the PVA/PNAI films. The Fourier transform infrared (FTIR) spectra of the samples showed a significant change in the intensity of the characteristic peak of the functional groups in the composite films with the amount of NS added. The absorbance and refractive index (n) of the composites were studied in the UV-vis range, and the optical energy band gap, Eg, and different optical parameters were calculated. The dielectric loss modulus, M″ and ac conductivity, σac, of the samples were studied within 300-425 K and 0.1 kHz-5 MHz, respectively. Two relaxation peaks were observed in the frequency dependence of the dielectric loss modulus, M″. The behavior of σac(f) for the composite films indicated that the conduction mechanism was correlated barrier hopping (CBH). The results of this work are discussed and compared with those of previous studies of similar composites.

  5. High Temperature Microwave Dielectric Properties of JSC-1AC Lunar Simulant

    Science.gov (United States)

    Allan, Shawn M.; Merritt, Brandon J.; Griffin, Brittany F.; Hintze, Paul E.; Shulman, Holly S.

    2011-01-01

    Microwave heating has many potential lunar applications including sintering regolith for lunar surface stabilization and heating regolith for various oxygen production reactors. The microwave properties of lunar simulants must be understood so this technology can be applied to lunar operations. Dielectric properties at microwave frequencies for a common lunar simulant, JSC-1AC, were measured up to 1100 C, which is approximately the melting point. The experimentally determined dielectric properties included real and imaginary permittivity (epsilon', epsilon"), loss tangent (tan delta), and half-power depth, the di stance at which a material absorbs 50% of incident microwave energy. Measurements at 2.45 GHz revealed tan delta of JSC-1A increases from 0.02 at 25 C to 0.31 at 110 C. The corresponding half-power depth decreases from a peak of 286 mm at 110 C, to 13 mm at 1100 C. These data indicate that JSC-1AC becomes more absorbing, and thus a better microwave heater as temperature increases. A half-power depth maximum at 100-200 C presents a barrier to direct microwave heating at low temperatures. Microwave heating experiments confirm the sluggish heating effect of weak absorption below 200 C, and increasingly strong absorption above 200 C, leading to rapid heating and melting of JSC-1AC.

  6. Methoxypropylamino β-cyclodextrin clicked AC regioisomer for enantioseparations in capillary electrophoresis

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Jie; Wang, Yiying; Liu, Yun; Tang, Jian; Tang, Weihua, E-mail: whtang@mail.njust.edu.cn

    2015-04-08

    Highlights: In this paper, we demonstrate: • The click synthesis of a AC regioisomer cationic cyclodextrin (CD) as chiral selector. • The good enantioselectivities (chiral resolution over 5) for acidic racemates. • The strong chiral recognition of new CD by NMR study. • Baseline enantioseparation of some acidic racemates at CD of 0.5 mM. - Abstract: In this work, a novel methoxypropylamino β-cyclodextrin (β-CD) clicked AC regioisomer, 6{sup A}-4-hydroxyethyl-1,2,3-triazolyl-6{sup C}-3-methoxypropylamino β-cyclodextrin (HETz-MPrAMCD), was synthesized via nucleophilic addition and click chemistry. The chiral separation ability of this AC regioisomer cationic CD was evaluated toward 7 ampholytic and 13 acidic racemates by capillary electrophoresis. Dependence of enantioselectivity and resolution on buffer pH (5.5–8.0) and chiral selector concentration (0.5–7.5 mM) was investigated. Enantioselectivities (α ≥ 1.05) could be achieved for most analytes under optimal conditions except dansyl-DL-noreleucine and dansyl-DL-serine. The highest resolutions for 2-chloromandelic acid p-hydroxymandelic acid were 15.6 and 9.7 respectively. The inclusion complexation between HETz-MPrAMCD and each 3-phenyllactic acid enantiomer was also revealed with nuclear magnetic resonance study.

  7. An international survey and modified Delphi process revealed editors' perceptions, training needs, and ratings of competency-related statements for the development of core competencies for scientific editors of biomedical journals.

    Science.gov (United States)

    Galipeau, James; Cobey, Kelly D; Barbour, Virginia; Baskin, Patricia; Bell-Syer, Sally; Deeks, Jonathan; Garner, Paul; Shamseer, Larissa; Sharon, Straus; Tugwell, Peter; Winker, Margaret; Moher, David

    2017-01-01

    Background: Scientific editors (i.e., those who make decisions on the content and policies of a journal) have a central role in the editorial process at biomedical journals. However, very little is known about the training needs of these editors or what competencies are required to perform effectively in this role. Methods: We conducted a survey of perceptions and training needs among scientific editors from major editorial organizations around the world, followed by a modified Delphi process in which we invited the same scientific editors to rate the importance of competency-related statements obtained from a previous scoping review. Results: A total of 148 participants completed the survey of perceptions and training needs. At least 80% of participants agreed on six of the 38 skill and expertise-related statements presented to them as being important or very important to their role as scientific editors. At least 80% agreed on three of the 38 statements as necessary skills they perceived themselves as possessing (well or very well).  The top five items on participants' list of top training needs were training in statistics, research methods, publication ethics, recruiting and dealing with peer reviewers, and indexing of journals. The three rounds of the Delphi were completed by 83, 83, and 73 participants, respectively, which ultimately produced a list of 23 "highly rated" competency-related statements and another 86 "included" items. Conclusion: Both the survey and the modified Delphi process will be critical for understanding knowledge and training gaps among scientific editors when designing curriculum around core competencies in the future.

  8. An international survey and modified Delphi process revealed editors’ perceptions, training needs, and ratings of competency-related statements for the development of core competencies for scientific editors of biomedical journals

    Science.gov (United States)

    Galipeau, James; Cobey, Kelly D.; Barbour, Virginia; Baskin, Patricia; Bell-Syer, Sally; Deeks, Jonathan; Garner, Paul; Shamseer, Larissa; Sharon, Straus; Tugwell, Peter; Winker, Margaret; Moher, David

    2017-01-01

    Background: Scientific editors (i.e., those who make decisions on the content and policies of a journal) have a central role in the editorial process at biomedical journals. However, very little is known about the training needs of these editors or what competencies are required to perform effectively in this role. Methods: We conducted a survey of perceptions and training needs among scientific editors from major editorial organizations around the world, followed by a modified Delphi process in which we invited the same scientific editors to rate the importance of competency-related statements obtained from a previous scoping review. Results: A total of 148 participants completed the survey of perceptions and training needs. At least 80% of participants agreed on six of the 38 skill and expertise-related statements presented to them as being important or very important to their role as scientific editors. At least 80% agreed on three of the 38 statements as necessary skills they perceived themselves as possessing (well or very well).  The top five items on participants’ list of top training needs were training in statistics, research methods, publication ethics, recruiting and dealing with peer reviewers, and indexing of journals. The three rounds of the Delphi were completed by 83, 83, and 73 participants, respectively, which ultimately produced a list of 23 “highly rated” competency-related statements and another 86 “included” items. Conclusion: Both the survey and the modified Delphi process will be critical for understanding knowledge and training gaps among scientific editors when designing curriculum around core competencies in the future. PMID:28979768

  9. An international survey and modified Delphi process revealed editors’ perceptions, training needs, and ratings of competency-related statements for the development of core competencies for scientific editors of biomedical journals [version 1; referees: 2 approved

    Directory of Open Access Journals (Sweden)

    James Galipeau

    2017-09-01

    Full Text Available Background: Scientific editors (i.e., those who make decisions on the content and policies of a journal have a central role in the editorial process at biomedical journals. However, very little is known about the training needs of these editors or what competencies are required to perform effectively in this role. Methods: We conducted a survey of perceptions and training needs among scientific editors from major editorial organizations around the world, followed by a modified Delphi process in which we invited the same scientific editors to rate the importance of competency-related statements obtained from a previous scoping review. Results: A total of 148 participants completed the survey of perceptions and training needs. At least 80% of participants agreed on six of the 38 skill and expertise-related statements presented to them as being important or very important to their role as scientific editors. At least 80% agreed on three of the 38 statements as necessary skills they perceived themselves as possessing (well or very well.  The top five items on participants’ list of top training needs were training in statistics, research methods, publication ethics, recruiting and dealing with peer reviewers, and indexing of journals. The three rounds of the Delphi were completed by 83, 83, and 73 participants, respectively, which ultimately produced a list of 23 “highly rated” competency-related statements and another 86 “included” items. Conclusion: Both the survey and the modified Delphi process will be critical for understanding knowledge and training gaps among scientific editors when designing curriculum around core competencies in the future.

  10. The Pan-STARRS Survey for Transients (PSST)

    Science.gov (United States)

    Huber, Mark; Carter Chambers, Kenneth; Flewelling, Heather; Smartt, Stephen J.; Smith, Ken; Wright, Darryl

    2015-08-01

    The Pan-STARRS1 (PS1) Science Consortium finished the 3Pi survey of the whole sky north of -30 degrees between 2010-2014 in grizy (PS1 specific filters) and the PS1 telescope has been running a wide-field survey for near earth objects, funded by NASA through the NEO Observation Program. This survey takes data in a w-band (wide-band filter spanning g,r,i) in dark time, and combinations of r, i, z and y during bright time. We are now processing these data through the Pan-STARRS IPP difference imaging pipeline and recovering stationary transients. Effectively the 3Pi survey for transients that started during the PS1 Science Consortium is being continued under the new NEO optimized operations mode. The observing procedure in this case is to take a quad of exposures, typically 30-45 seconds separated by 10-20 minutes each, typically revealing high confidence transients (greater than 5-sigma) to depths of i~ 20.7, y~18.3 (AB mags). This cadence may be repeated on subsequent nights in a return pointing.Continuing the public release of the first 880 transients from the PS1 3Pi survey during the search period September 2013 - January 2014, beginning February 2015, the transient events using the data from the the Pan-STARRS NEO Science Consortium are now regularly added. These are mostly supernova candidates, but the list also contains some variable stars, AGN, and nuclear transients. The light curves are too sparsely sampled to be of standalone use, but they may be of use to the community in combining with existing data (e.g. Fraser et al. 2013, ApJ, 779, L8), constraining explosion and rise times (e.g. Nicholl et al. 2013, Nature, 502, 346) as well as many being new discoveries.For additional details visit http://star.pst.qub.ac.uk/ps1threepi/

  11. Accelerated Evolution of the Lyα Luminosity Function at z >~ 7 Revealed by the Subaru Ultra-deep Survey for Lyα Emitters at z = 7.3

    Science.gov (United States)

    Konno, Akira; Ouchi, Masami; Ono, Yoshiaki; Shimasaku, Kazuhiro; Shibuya, Takatoshi; Furusawa, Hisanori; Nakajima, Kimihiko; Naito, Yoshiaki; Momose, Rieko; Yuma, Suraphong; Iye, Masanori

    2014-12-01

    We present the ultra-deep Subaru narrowband imaging survey for Lyα emitters (LAEs) at z = 7.3 in the Subaru/XMM-Newton Deep Survey (SXDS) and Cosmic Evolution Survey (COSMOS) fields (~0.5 deg2) with a total integration time of 106 hr. Exploiting our new sharp bandwidth filter, NB101, installed on the Suprime-Cam, we have reached L(Lyα) = 2.4 × 1042 erg s-1 (5σ) for z = 7.3 LAEs, about four times deeper than previous Subaru z >~ 7 studies, which allows us to reliably investigate the evolution of the Lyα luminosity function (LF) for the first time down to the luminosity limit same as those of Subaru z = 3.1-6.6 LAE samples. Surprisingly, we only find three and four LAEs in the SXDS and COSMOS fields, respectively, while one expects a total of ~65 LAEs by our survey in the case of no Lyα LF evolution from z = 6.6 to 7.3. We identify a decrease of the Lyα LF from z = 6.6 to 7.3 at the >90% confidence level from our z = 7.3 Lyα LF with the best-fit Schechter parameters of L*{Lyα } = 2.7+8.0-1.2 × 1042 {erg} {s}-1 and φ * = 3.7+17.6-3.3 × 10-4 {Mpc}-3 for a fixed α = -1.5. Moreover, the evolution of the Lyα LF is clearly accelerated at z > 6.6 beyond the measurement uncertainties including cosmic variance. Because no such accelerated evolution of the UV-continuum LF or the cosmic star formation rate (SFR) is found at z ~ 7, but suggested only at z > 8, this accelerated Lyα LF evolution is explained by physical mechanisms different from a pure SFR decrease but related to the Lyα production and escape in the process of cosmic reionization. Because a simple accelerating increase of intergalactic medium neutral hydrogen absorbing Lyα cannot be reconciled with Thomson scattering of optical depth measurements from WMAP and Planck, our findings may support new physical pictures suggested by recent theoretical studies, such as the existence of HI clumpy clouds within cosmic ionized bubbles that are selectively absorbing Lyα and the large ionizing photon escape

  12. ISTTOK upgrade towards AC and remote operation

    Science.gov (United States)

    Fernandes, H.; Silva, C.; Carvalho, B.; Sousa, J.; Valcárcel, D.; Neto, A.; Fortunato, J.; Carvalho, I.; Varandas, C. A. F.

    2006-12-01

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed. In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented. The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat.

  13. Spectroscopic Study of the HST/ACS PEARS Emission-line Galaxies

    Science.gov (United States)

    Xia, Lifang; Malhotra, Sangeeta; Rhoads, James; Pirzkal, Norbert; Zheng, Zhenya; Meurer, Gerhardt; Straughn, Amber; Grogin, Norman; Floyd, David

    2011-02-01

    We present spectroscopy of 76 emission-line galaxies (ELGs) in Chandra Deep Field South taken with the LDSS3 spectrograph on the Magellan Telescope. These galaxies are selected because they have emission lines with the Advanced Camera for Surveys (ACS) grism data in the Hubble Space Telescope Probing Evolution and Reionization Spectroscopically (PEARS) grism Survey. The ACS grism spectra cover the wavelength range 6000-9700 Å and most PEARS grism redshifts are based on a single emission line + photometric redshifts from broadband colors; the Magellan spectra cover a wavelength range from 4000 Å to 9000 Å and provide a check on redshifts derived from PEARS data. We find an accuracy of σ z = 0.006 for the ACS grism redshifts with only one catastrophic outlier. We probe for active galactic nuclei (AGNs) in our sample via several different methods. In total, we find 7 AGNs and AGN candidates out of 76 galaxies. Two AGNs are identified from the X-ray full-band luminosity, L X-ray,FB > 1043 erg s-1, the line widths, and the power-law continuum spectra. Two unobscured faint AGN candidates are identified from the X-ray full-band luminosity L X-ray,FB ~ 1041 erg s-1, the hardness ratio and the column density, and the emission-line and X-ray derived SFRs. Two candidates are classified based on the line ratio of [N II]λ6584/Hα versus [O III]λ5007/Hβ(BPT diagram), which are between the empirical and theoretical demarcation curves, i.e., the transition region from star-forming galaxies to AGNs. One AGN candidate is identified from the high-ionization emission line He IIÅ4686.

  14. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Directory of Open Access Journals (Sweden)

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  15. EHV AC undergrounding electrical power performance and planning

    CERN Document Server

    Benato, Roberto

    2014-01-01

    Analytical methods of cable performance in EHV AC electrical power are discussed in this comprehensive reference. Descriptions of energization, power quality, cable safety constraints and more, guide readers in cable planning and power network operations.

  16. Scaling and universality of ac conduction in disordered solids

    DEFF Research Database (Denmark)

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments.......Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac...

  17. Non-vanishing ponderomotive AC electrophoretic effect for particle trapping

    Energy Technology Data Exchange (ETDEWEB)

    Guan Weihua; Reed, Mark A [Department of Electrical Engineering, Yale University, New Haven, CT 06520 (United States); Park, Jae Hyun; Krstic, Predrag S, E-mail: mark.reed@yale.edu [Physics Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States)

    2011-06-17

    We present here a study on overlooked aspects of alternating current (AC) electrokinetics-AC electrophoretic (ACEP) phenomena. The dynamics of a particle with both polarizability and net charges in a non-uniform AC electric trapping field is investigated. It is found that either electrophoretic (EP) or dielectrophoretic (DEP) effects can dominate the trapping dynamics, depending on experimental conditions. A dimensionless parameter {gamma} is developed to predict the relative strength of EP and DEP effects in a quadrupole AC field. An ACEP trap is feasible for charged particles in 'salt-free' or low salt concentration solutions. In contrast to DEP traps, an ACEP trap favors the downscaling of the particle size.

  18. National Fuel Cell Bus Program : Accelerated Testing Report, AC Transit

    Science.gov (United States)

    2009-01-01

    This is an evaluation of hydrogen fuel cell transit buses operating at AC Transit in revenue service since March 20, 2006 compared to similar diesel buses operating from the same depot. This evaluation report includes results from November 2007 throu...

  19. Detection of Genetic Modification 'ac2' in Potato Foodstuffs

    Directory of Open Access Journals (Sweden)

    Petr Kralik

    2009-01-01

    Full Text Available The genetic modification 'ac2' is based on the insertion and expression of ac2 gene, originally found in seeds of amaranth (Amaranthus caudatus, into the genome of potatoes (Solanum tuberosum. The purpose of the present study is to develop a PCR method for the detection of the mentioned genetically modified potatoes in various foodstuffs. The method was used to test twenty different potato-based products; none of them was positive for the genetic modification 'ac2'. The European Union legislation requires labelling of products made of or containing more than 0.9 % of genetically modified organisms. The genetic modification 'ac2' is not allowed on the European Union market. For that reason it is suitable to have detection methods, not only for the approved genetic modifications, but also for the 'unknown' ones, which could still occur in foodstuffs.

  20. Initial tests of an AC dipole for the Tevatron

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, R.; /Texas U.; Jansson, A.; /Fermilab; Kopp, S.; /Texas U.; Syphers, M.; /Fermilab

    2006-06-01

    The AC dipole is a device to diagnose transverse motions of a beam. It can achieve large-amplitude oscillations without two inevitable problems of conventional kicker/pinger magnets: decoherence and emittance growth. While not the first synchrotron to operate with an AC dipole, the Tevatron can now make use of its recently upgraded BPM system, providing unprecedented resolution for use with an AC dipole, to measure both linear and nonlinear properties of the accelerator. Plans are to provide AC dipole systems for both transverse degrees of freedom. Preliminary tests have been done using an audio power amplifier with an existing vertical pinger magnet, producing oscillation amplitudes up to 2{sigma} at 150 GeV. In this paper, we will present the configuration of this system. We also show the analysis of a first few data sets, including the direct measurement of beta functions at BPM locations.

  1. Experimental investigations on moving striations in a 50 Hz ac fluorescent lamp

    Energy Technology Data Exchange (ETDEWEB)

    Liu Yang; Chen Dahua [Institute for Electrical Light Sources, Fudan University, 220 Handan Road, Shanghai 200433 (China); Buso, D; Bhosle, S; Zissis, G [Universite de Toulouse, LAPLACE. CNRS-INP-UPS, 118 route de Narbonne, 31062 Toulouse Cedex 4 (France)], E-mail: georges.zissis@laplace.univ-tlse.fr

    2008-07-07

    Experimental investigations on moving striations in a low frequency ac fluorescent lamp are carried out. Preliminary experimental results reveal that moving striations in the lamp do not originate in the cathode region; rather, they have a close relationship to the cold spot temperature of the tube. Photos from high-speed CCD camera and measurement with monochromator indicate that striations only appear on the rising edge of the light signal from the lamp. Relatively high density of metastable Ar density and correlated step-wise ionization are hereby considered to be the possible reasons for the appearance of striated instabilities.

  2. Experimental investigations on moving striations in a 50 Hz ac fluorescent lamp

    Science.gov (United States)

    Liu, Yang; Chen, Dahua; Buso, D.; Bhosle, S.; Zissis, G.

    2008-07-01

    Experimental investigations on moving striations in a low frequency ac fluorescent lamp are carried out. Preliminary experimental results reveal that moving striations in the lamp do not originate in the cathode region; rather, they have a close relationship to the cold spot temperature of the tube. Photos from high-speed CCD camera and measurement with monochromator indicate that striations only appear on the rising edge of the light signal from the lamp. Relatively high density of metastable Ar density and correlated step-wise ionization are hereby considered to be the possible reasons for the appearance of striated instabilities.

  3. Whole tissue AC susceptibility after superparamagnetic iron oxide contrast agent administration in a rat model

    Energy Technology Data Exchange (ETDEWEB)

    Lazaro, Francisco Jose [Departamento de Ciencia y Tecnologia de Materiales y Fluidos, Universidad de Zaragoza, 50018 Zaragoza (Spain) and Instituto de Nanociencia de Aragon, Universidad de Zaragoza, 50009 Zaragoza (Spain)]. E-mail: osoro@unizar.es; Gutierrez, Lucia [Departamento de Ciencia y Tecnologia de Materiales y Fluidos, Universidad de Zaragoza, 50018 Zaragoza (Spain); Rosa Abadia, Ana [Dept. Farmacologia y Fisiologia, Universidad de Zaragoza, 50013 Zaragoza (Spain); Soledad Romero, Maria [Dept. Medicina y Psiquiatria, Universidad de Zaragoza, 50009 Zaragoza (Spain); Lopez, Antonio [CNAM - Zaragoza, 50009 Zaragoza (Spain); Jesus Munoz, Maria [Dept. Farmacologia y Fisiologia, Universidad de Zaragoza, 50013 Zaragoza (Spain)

    2007-04-15

    A magnetic AC susceptibility characterisation of rat tissues after intravenous administration of superparamagnetic iron oxide (Endorem{sup (R)}), at the same dose as established for Magnetic Resonance Imaging (MRI) contrast enhancement in humans, has been carried out. The measurements reveal the presence of the contrast agent as well as that of physiological ferritin in liver and spleen while no traces have been magnetically detected in heart and kidney. This preliminary work opens suggestive possibilities for future biodistribution studies of any type of magnetic carriers.

  4. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    For a sufficiently strong ac field the dc conductance fluctuations are much stronger for the periodic pumping than in the case of the noise ac field of the same intensity. The reduction factor in a static magnetic field takes the universal value of 2 only for the white-noise pumping. In general may deviate from 2 thus ...

  5. AC magnetic dipole localization by a magnetoelectric sensor

    Science.gov (United States)

    Shen, Y.; McLaughlin, K. L.; Gao, J.; Gray, D.; Shen, L.; Wang, Y.; Li, M.; Berry, D.; Li, J.; Viehland, D.

    2012-06-01

    We report progress towards achievement of a triple-axis magnetoelectric (ME) sensor technology that is capable of localizing an AC magnetic dipole at quasi-static frequencies. Estimation of the location of the AC dipole was realized with the help of a grid search (GS) algorithm. The results show good convergence and accuracy of object location along three orthogonal directions. Through simulation analysis, the major localization errors were found to arise from sensor calibration.

  6. Mixed mobile ion effect on ac conductivity of boroarsenate glasses

    Indian Academy of Sciences (India)

    In this article we report the study of mixed mobile ion effect (MMIE) in boroarsenate glasses. DSC and a.c. electrical conductivity studies have been carried out for MgO–(25−)Li2O–50B2O3–25As2O3 glasses. It is observed that strength of MMIE in a.c. conductivity is less pronounced with increase in temperature and ...

  7. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    DEFF Research Database (Denmark)

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  8. Optimal football strategies: AC Milan versus FC Barcelona

    OpenAIRE

    Papahristodoulou, Christos

    2012-01-01

    In a recent UEFA Champions League game between AC Milan and FC Barcelona, played in Italy (final score 2-3), the collected match statistics, classified into four offensive and two defensive strategies, were in favour of FC Barcelona (by 13 versus 8 points). The aim of this paper is to examine to what extent the optimal game strategies derived from some deterministic, possibilistic, stochastic and fuzzy LP models would improve the payoff of AC Milan at the cost of FC Barcelona.

  9. Stretched exponential relaxation and ac universality in disordered dielectrics

    DEFF Research Database (Denmark)

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are stretc....... Mathematically, our study refers to the expanding area of fractional calculus and we propose a systematic derivation of the fractional relaxation and fractional diffusion equations from the property of ac universality....

  10. ACLY and ACC1 Regulate Hypoxia-Induced Apoptosis by Modulating ETV4 via α-ketoglutarate.

    Directory of Open Access Journals (Sweden)

    Melissa M Keenan

    2015-10-01

    Full Text Available In order to propagate a solid tumor, cancer cells must adapt to and survive under various tumor microenvironment (TME stresses, such as hypoxia or lactic acidosis. To systematically identify genes that modulate cancer cell survival under stresses, we performed genome-wide shRNA screens under hypoxia or lactic acidosis. We discovered that genetic depletion of acetyl-CoA carboxylase (ACACA or ACC1 or ATP citrate lyase (ACLY protected cancer cells from hypoxia-induced apoptosis. Additionally, the loss of ACLY or ACC1 reduced levels and activities of the oncogenic transcription factor ETV4. Silencing ETV4 also protected cells from hypoxia-induced apoptosis and led to remarkably similar transcriptional responses as with silenced ACLY or ACC1, including an anti-apoptotic program. Metabolomic analysis found that while α-ketoglutarate levels decrease under hypoxia in control cells, α-ketoglutarate is paradoxically increased under hypoxia when ACC1 or ACLY are depleted. Supplementation with α-ketoglutarate rescued the hypoxia-induced apoptosis and recapitulated the decreased expression and activity of ETV4, likely via an epigenetic mechanism. Therefore, ACC1 and ACLY regulate the levels of ETV4 under hypoxia via increased α-ketoglutarate. These results reveal that the ACC1/ACLY-α-ketoglutarate-ETV4 axis is a novel means by which metabolic states regulate transcriptional output for life vs. death decisions under hypoxia. Since many lipogenic inhibitors are under investigation as cancer therapeutics, our findings suggest that the use of these inhibitors will need to be carefully considered with respect to oncogenic drivers, tumor hypoxia, progression and dormancy. More broadly, our screen provides a framework for studying additional tumor cell stress-adaption mechanisms in the future.

  11. Lost in follow-up rates in TRACER, ATLAS ACS 2, TRITON and TRA 2P trials: challenging PLATO mortality rates.

    Science.gov (United States)

    DiNicolantonio, James J; Can, Mehmet Mustafa; Serebruany, Victor L

    2013-04-15

    Extreme rates of vascular and all-cause mortality especially in the clopidogrel arm of the Platelet Inhibition and Patient Outcomes (PLATO) non-USA cohort raise concerns of data integrity, and call for independent verification of vital records in the national death registries. Four recent acute coronary syndrome (ACS) trials: Thrombin Receptor Antagonist for Clinical Event Reduction in Acute Coronary Syndrome (TRACER), Anti-Xa therapy to lower cardiovascular events in addition to standard therapy in subjects with acute coronary syndrome (ATLAS-ACS 2), Trial to Assess Improvement in Therapeutic Outcomes by Optimizing Platelet Inhibition with Prasugrel (TRITON), and the Thrombin Receptor Antagonist in Secondary Prevention of Atherothrombotic Ischemic Events (TRA 2P), provide a valuable opportunity to match lost in follow-up (LIFU) with mortality rates among similar ACS studies. To compare the LIFU from PLATO, TRACER, ATLAS-ACS 2, TRITON-TIMI 38 and TRA 2P trials. The disturbingly high (8.9%-14.7%) LIFU in PLATO was no match to LIFU in TRACER (0.1%), ATLAS ACS 2 (0.3%), TRITON (0.1%) and TRA 2P (0.1%). In fact, such an astronomical (49-147 fold higher) PLATO LIFU rate should result in less mortality compared to the other ACS trials since no event can be reported or adjudicated if the patient has been lost. Adjusting LIFU rate revealed that vascular (5.55%) and all cause (6.05%) mortality in PLATO was even more disparate than in TRACER (3.2% and 4.9%), ATLAS-ACS 2 (4.1% and 4.5%), TRITON-TIMI 38 (2.4% and 3.2%) and TRA 2P (3.0% and 5.3%) control arms, respectfully. Moreover, the incomplete CV follow-up in the ATLAS ACS 2 trial was later revealed to be around 12%, which lead to the rejection of rivaroxaban for the treatment of ACS. PLATO's LIFU rate was just as high, if not higher, than seen in ATLAS ACS 2. The chance to die in PLATO far exceeds the mortality risks observed in the clopidogrel arms of four recent ACS trials, which becomes especially evident after

  12. EPRINT ARCHIVE USER SURVEY

    CERN Multimedia

    2001-01-01

    University of Southampton invites the CERN community to participate in a survey Professor Stevan Harnad is conducting on current users and non-users of Eprint Archives. http://www.eprints.org/survey/ The findings will be used to suggest potential enhancements of the services as well as to get a deeper understanding of the very rapid developments in the on-line dissemination and use of scientific and scholarly research. (The survey is anonymous. Revealing your identity is optional and it will be kept confidential.)

  13. Diagnostics of the Fermilab Tevatron using an AC dipole

    Energy Technology Data Exchange (ETDEWEB)

    Miyamoto, Ryoichi [Univ. of Texas, Austin, TX (United States)

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f ~ 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  14. Experimental verification of Faradaic charging in ac electrokinetics.

    Science.gov (United States)

    Ng, Wee Yang; Lam, Yee Cheong; Rodríguez, Isabel

    2009-04-23

    This paper investigates the phenomenon of Faradaic charging in ac electrokinetics. Faradaic reactions were suggested as a key effect responsible for the reversal of pumping direction in ac micropumps. However, this hypothesis has yet to be proven convincingly and directly. Here we present an ion detection strategy to determine the production of ions through Faradaic hydrolytic reactions originating from direct application of voltage to electrolytic solutions during ac electrokinetics. Experiments were performed with symmetrical planar electrodes aligned along a microfluidic channel. Fluorescein, a pH-dependent dye, was employed as the pH indicator for the detection of ion production. Images were captured for analysis at various voltage levels. From analyzing the fluorescence intensity and its distribution, it can be concluded that the production of ions from hydrolytic reactions takes place and increases with the ac voltage. The coefficient of deviation indicates a significant enhancement at ac voltage above 11 V(pp). Lastly, we demonstrate a strategy using dc-biased ac electrokinetics to achieve controllability in direction and magnitude of the net fluid flow in pumping application.

  15. Role of the AcsF protein in Chloroflexus aurantiacus.

    Science.gov (United States)

    Tang, Kuo-Hsiang; Wen, Jianzhong; Li, Xianglu; Blankenship, Robert E

    2009-06-01

    The green phototrophic bacteria contain a unique complement of chlorophyll pigments, which self-assemble efficiently into antenna structures known as chlorosomes with little involvement of protein. The few proteins found in chlorosomes have previously been thought to have a primarily structural function. The biosynthetic pathway of the chlorosome pigments, bacteriochlorophylls c, d, and e, is not well understood. In this report, we used spectroscopic, proteomic, and gene expression approaches to investigate the chlorosome proteins of the green filamentous anoxygenic phototrophic bacterium Chloroflexus aurantiacus. Surprisingly, Mg-protoporphyrin IX monomethyl ester (oxidative) cyclase, AcsF, was identified under anaerobic growth conditions. The AcsF protein was found in the isolated chlorosome fractions, and the proteomics analysis suggested that significant portions of the AcsF proteins are not accessible to protease digestion. Additionally, quantitative real-time PCR studies showed that the transcript level of the acsF gene is not lower in anaerobic growth than in semiaerobic growth. Since the proposed enzymatic activity of AcsF requires molecular oxygen, our studies suggest that the roles of AcsF in C. aurantiacus need to be investigated further.

  16. AC electrophoretic deposition of organic-inorganic composite coatings.

    Science.gov (United States)

    Yoshioka, T; Chávez-Valdez, A; Roether, J A; Schubert, D W; Boccaccini, A R

    2013-02-15

    Alternating current electrophoretic deposition (AC-EPD) of polyacrylic acid (PAA)-titanium oxide (TiO(2)) nanoparticle composites on stainless steel electrodes was investigated in basic aqueous solution. AC square wave with duty cycle of 80% was applied at a frequency of 1 kHz. FTIR-ATR spectra showed that both AC and direct current (DC) EPD successfully deposited PAA-TiO(2) composites. The deposition rate using AC-EPD was lower than that obtained in direct current DC-EPD. However, the microstructure and surface morphology of the deposited composite coatings were different depending on the type of electric field applied. AC-EPD applied for not more than 5 min led to smooth films without bubble formation, while DC-EPD for 1 min or more showed deposits with microstructural defects possibly as result of water electrolysis. AC-EPD was thus for the first time demonstrated to be a suitable technique to deposit organic-inorganic composite coatings from aqueous suspensions, showing that applying a square wave and frequency of 1 kHz leads to uniform PAA-TiO(2) composite coatings on conductive materials. Copyright © 2012 Elsevier Inc. All rights reserved.

  17. Genetic and Biochemical Approach for Characterization of Resistance to Bacillus thuringiensis Toxin Cry1Ac in a Field Population of the Diamondback Moth, Plutella xylostella

    Science.gov (United States)

    Sayyed, Ali H.; Haward, Robert; Herrero, Salvador; Ferré, Juan; Wright, Denis J.

    2000-01-01

    Four subpopulations of a Plutella xylostella (L.) strain from Malaysia (F4 to F8) were selected with Bacillus thuringiensis subsp. kurstaki HD-1, Bacillus thuringiensis subsp. aizawai, Cry1Ab, and Cry1Ac, respectively, while a fifth subpopulation was left as unselected (UNSEL-MEL). Bioassays at F9 found that selection with Cry1Ac, Cry1Ab, B. thuringiensis subsp. kurstaki, and B. thuringiensis subsp. aizawai gave resistance ratios of >95, 10, 7, and 3, respectively, compared with UNSEL-MEL (>10,500, 500, >100, and 26, respectively, compared with a susceptible population, ROTH). Resistance to Cry1Ac, Cry1Ab, B. thuringiensis subsp. kurstaki, and B. thuringiensis subsp. aizawai in UNSEL-MEL declined significantly by F9. The Cry1Ac-selected population showed very little cross-resistance to Cry1Ab, B. thuringiensis subsp. kurstaki, and B. thuringiensis subsp. aizawai (5-, 1-, and 4-fold compared with UNSEL-MEL), whereas the Cry1Ab-, B. thuringiensis subsp. kurstaki-, and B. thuringiensis subsp. aizawai-selected populations showed high cross-resistance to Cry1Ac (60-, 100-, and 70-fold). The Cry1Ac-selected population was reselected (F9 to F13) to give a resistance ratio of >2,400 compared with UNSEL-MEL. Binding studies with 125I-labeled Cry1Ab and Cry1Ac revealed complete lack of binding to brush border membrane vesicles prepared from Cry1Ac-selected larvae (F15). Binding was also reduced, although less drastically, in the revertant population, which indicates that a modification in the common binding site of these two toxins was involved in the resistance mechanism in the original population. Reciprocal genetic crosses between Cry1Ac-reselected and ROTH insects indicated that resistance was autosomal and showed incomplete dominance. At the highest dose of Cry1Ac tested, resistance was recessive while at the lowest dose it was almost completely dominant. The F2 progeny from a backcross of F1 progeny with ROTH was tested with a concentration of Cry1Ac which would kill

  18. Modulation schemes with enhanced switch thermal distribution for single-phase AC-DC-AC reduced-switch converters

    DEFF Research Database (Denmark)

    Qin, Zian; Loh, Poh Chiang; Blaabjerg, Frede

    2015-01-01

    though various topologies have been proposed. The motivation of this paper is to study two promising single-phase ac-dc-ac converters using reduced number of switches, and subsequently proposes new modulation schemes for them. The proposed schemes help the converters to achieve a better thermal spread...... among their switches, while keeping their dc-link voltages low. Single points of failure are thus minimized, allowing the converters to have longer lifetimes. Simulation and experimental results have demonstrated the intended performances and hence verifying the idea.......ulation schemes can significantly change the performance of a power converter in steady state, and they have been extensively studied, but mostly directed to three-phase topologies, where triplen offsets are added. Single-phase systems, including ac-dc-ac systems, are less widely pursued, even...

  19. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Energy Technology Data Exchange (ETDEWEB)

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  20. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    DEFF Research Database (Denmark)

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach...... it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach....

  1. Genome-wide survey and expression analysis of the bHLH-PAS genes in the amphioxus Branchiostoma floridae reveal both conserved and diverged expression patterns between cephalochordates and vertebrates.

    Science.gov (United States)

    Li, Kun-Lung; Lu, Tsai-Ming; Yu, Jr-Kai

    2014-01-01

    The bHLH-PAS transcription factors are found in both protostomes and deuterostomes. They are involved in many developmental and physiological processes, including regional differentiation of the central nervous system, tube-formation, hypoxia signaling, aromatic hydrocarbon sensing, and circadian rhythm regulation. To understand the evolution of these genes in chordates, we analyzed the bHLH-PAS genes of the basal chordate amphioxus (Branchiostoma floridae). From the amphioxus draft genome database, we identified ten bHLH-PAS genes, nine of which could be assigned to known orthologous families. The tenth bHLH-PAS gene could not be assigned confidently to any known bHLH family; however, phylogenetic analysis clustered this gene with arthropod Met family genes and two spiralian bHLH-PAS-containing sequences, suggesting that they may share the same ancestry. We examined temporal and spatial expression patterns of these bHLH-PAS genes in developing amphioxus embryos. We found that BfArnt, BfNcoa, BfSim, and BfHifα were expressed in the central nervous system in patterns similar to those of their vertebrate homologs, suggesting that their functions may be conserved. By contrast, the amphioxus BfAhr and BfNpas4 had expression patterns distinct from those in vertebrates. These results imply that there were changes in gene regulation after the divergence of cephalochordates and vertebrates. We have identified ten bHLH-PAS genes from the amphioxus genome and determined the embryonic expression profiles for these genes. In addition to the nine currently recognized bHLH-PAS families, our survey suggests that the BfbHLHPAS-orphan gene along with arthropod Met genes and the newly identified spiralian bHLH-PAS-containing sequences represent an ancient group of genes that were lost in the vertebrate lineage. In a comparison with the expression patterns of the vertebrate bHLH-PAS paralogs, which are the result of whole-genome duplication, we found that although several members

  2. "Suntelligence" Survey

    Science.gov (United States)

    ... the American Academy of Dermatology's "Suntelligence" sun-smart survey. Please answer the following questions to measure your ... how you incorporate it into your life. The survey will take 5 to 7 minutes to complete. ...

  3. AC susceptibility as a characterization tool for coated conductor tapes

    Science.gov (United States)

    Gömöry, F.; Vojenčiak, M.; Solovyov, M.; Frolek, L.; Šouc, J.; Seiler, E.; Bauer, M.; Falter, M.

    2017-11-01

    The measurement and analysis of magnetic AC susceptibility is a useful tool in the study of superconductor (SC) materials. Exposure of a sample to a magnetic field changing in time generates loops of electrical currents that are detectable in a contactless way with the help of a suitable pick-up system. In this paper the applicability of this technique in the characterization and quality control of coated conductor (CC) tapes is evaluated. First we recollect the essential results of the analytical theory derived for thin SC strips and their extrapolation to strips with finite thickness. From the analytical expressions one can see how the properties of CC tape that are important for application in electric power devices, namely its critical current and AC loss, can be deduced from AC susceptibility data in straightforward way. The main focus of our study is to investigate the influence that various cases of non-uniformities in SC layer exhibit on the magnetic properties examined in an AC regime. Numerical computations were used to explore the consequences of lateral variation in the critical current density. Predictions derived for some model cases were compared with experimental findings. A dedicated experiment was also carried out to demonstrate that a transverse scratch that would be detrimental for DC transport could sneak unobserved through the AC magnetic experiment on a long sample. Our study shows that the analysis of both parts of the complex magnetic susceptibility in place of a mere AC loss determination in a common AC magnetization experiment is worth the additional effort.

  4. System and component design and test of a 10 hp, 18,000 rpm AC dynamometer utilizing a high frequency AC voltage link, part 1

    Science.gov (United States)

    Lipo, Thomas A.; Alan, Irfan

    1991-01-01

    Hard and soft switching test results conducted with one of the samples of first generation MOS-controlled thyristor (MCTs) and similar test results with several different samples of second generation MCT's are reported. A simple chopper circuit is used to investigate the basic switching characteristics of MCT under hard switching and various types of resonant circuits are used to determine soft switching characteristics of MCT under both zero voltage and zero current switching. Next, operation principles of a pulse density modulated converter (PDMC) for three phase (3F) to 3F two-step power conversion via parallel resonant high frequency (HF) AC link are reviewed. The details for the selection of power switches and other power components required for the construction of the power circuit for the second generation 3F to 3F converter system are discussed. The problems encountered in the first generation system are considered. Design and performance of the first generation 3F to 3F power converter system and field oriented induction moter drive based upon a 3 kVA, 20 kHz parallel resonant HF AC link are described. Low harmonic current at the input and output, unity power factor operation of input, and bidirectional flow capability of the system are shown via both computer and experimental results. The work completed on the construction and testing of the second generation converter and field oriented induction motor drive based upon specifications for a 10 hp squirrel cage dynamometer and a 20 kHz parallel resonant HF AC link is discussed. The induction machine is designed to deliver 10 hp or 7.46 kW when operated as an AC-dynamo with power fed back to the source through the converter. Results presented reveal that the proposed power level requires additional energy storage elements to overcome difficulties with a peak link voltage variation problem that limits reaching to the desired power level. The power level test of the second generation converter after the

  5. System and component design and test of a 10 hp, 18,000 rpm AC dynamometer utilizing a high frequency AC voltage link, part 1

    Science.gov (United States)

    Lipo, Thomas A.; Alan, Irfan

    1991-06-01

    Hard and soft switching test results conducted with one of the samples of first generation MOS-controlled thyristor (MCTs) and similar test results with several different samples of second generation MCT's are reported. A simple chopper circuit is used to investigate the basic switching characteristics of MCT under hard switching and various types of resonant circuits are used to determine soft switching characteristics of MCT under both zero voltage and zero current switching. Next, operation principles of a pulse density modulated converter (PDMC) for three phase (3F) to 3F two-step power conversion via parallel resonant high frequency (HF) AC link are reviewed. The details for the selection of power switches and other power components required for the construction of the power circuit for the second generation 3F to 3F converter system are discussed. The problems encountered in the first generation system are considered. Design and performance of the first generation 3F to 3F power converter system and field oriented induction moter drive based upon a 3 kVA, 20 kHz parallel resonant HF AC link are described. Low harmonic current at the input and output, unity power factor operation of input, and bidirectional flow capability of the system are shown via both computer and experimental results. The work completed on the construction and testing of the second generation converter and field oriented induction motor drive based upon specifications for a 10 hp squirrel cage dynamometer and a 20 kHz parallel resonant HF AC link is discussed. The induction machine is designed to deliver 10 hp or 7.46 kW when operated as an AC-dynamo with power fed back to the source through the converter. Results presented reveal that the proposed power level requires additional energy storage elements to overcome difficulties with a peak link voltage variation problem that limits reaching to the desired power level. The power level test of the second generation converter after the

  6. Intra-particle migration of mercury in granular polysulfide-rubber-coated activated carbon (PSR-AC).

    Science.gov (United States)

    Kim, Eun-Ah; Masue-Slowey, Yoko; Fendorf, Scott; Luthy, Richard G

    2012-02-01

    The depth profile of mercuric ion after the reaction with polysulfide-rubber-coated activated carbon (PSR-AC) was investigated using micro-X-ray fluorescence (μ-XRF) imaging techniques and mathematical modeling. The μ-XRF results revealed that mercury was concentrated at 0-100 μm from the exterior of the particle after 3 months of treatment with PSR-AC in 10 ppm HgCl(2) aqueous solution. The μ-X-ray absorption near edge spectroscopic (μ-XANES) analyses indicated HgS as a major mercury species, and suggested that the intra-particle mercury transport involved a chemical reaction with PSR polymer. An intra-particle mass transfer model was developed based on either a Langmuir sorption isotherm with liquid phase diffusion (Langmuir model) or a kinetic sorption with surface diffusion (kinetic sorption model). The Langmuir model predicted the general trend of mercury diffusion, although at a slower rate than observed from the μ-XRF map. A kinetic sorption model suggested faster mercury transport, which overestimated the movement of mercuric ions through an exchange reaction between the fast and slow reaction sites. Both μ-XRF and mathematical modeling results suggest mercury removal occurs not only at the outer surface of the PSR-AC particle but also at some interior regions due to a large PSR surface area within an AC particle. Copyright © 2011 Elsevier Ltd. All rights reserved.

  7. Dynamics of supercooled liquid and plastic crystalline ethanol: Dielectric relaxation and AC nanocalorimetry distinguish structural α- and Debye relaxation processes.

    Science.gov (United States)

    Chua, Y Z; Young-Gonzales, A R; Richert, R; Ediger, M D; Schick, C

    2017-07-07

    Physical vapor deposition has been used to prepare glasses of ethanol. Upon heating, the glasses transformed into the supercooled liquid phase and then crystallized into the plastic crystal phase. The dynamic glass transition of the supercooled liquid is successfully measured by AC nanocalorimetry, and preliminary results for the plastic crystal are obtained. The frequency dependences of these dynamic glass transitions observed by AC nanocalorimetry are in disagreement with conclusions from previously published dielectric spectra of ethanol. Existing dielectric loss spectra have been carefully re-evaluated considering a Debye peak, which is a typical feature in the dielectric loss spectra of monohydroxy alcohols. The re-evaluated dielectric fits reveal a prominent dielectric Debye peak, a smaller and asymmetrically broadened peak, which is identified as the signature of the structural α-relaxation and a Johari-Goldstein secondary relaxation process. This new assignment of the dielectric processes is supported by the observation that the AC nanocalorimetry dynamic glass transition temperature, Tα, coincides with the dielectric structural α-relaxation process rather than the Debye process. The combined results from dielectric spectroscopy and AC nanocalorimetry on the plastic crystal of ethanol suggest the occurrence of a Debye process also in the plastic crystal phase.

  8. Parasitological and molecular surveys reveal high rates of infection with vector-borne pathogens and clinical anemia signs associated with infection in cattle from two important livestock areas in Colombia.

    Science.gov (United States)

    Jaimes-Dueñez, Jeiczon; Triana-Chávez, Omar; Mejía-Jaramillo, Ana M

    2017-02-01

    In Colombia, vector-borne diseases are one of the most important problems in the livestock industry. The present study reports parasitological and molecular surveys of vector-borne pathogens in cattle from two high-value livestock areas in Colombia. A total of 464 samples (226 from Antioquia and 238 from Arauca) were analyzed. While the blood smear analysis identified 98 (21.1%), 14 (3.0%) and 30 (6.5%) positive samples for Anaplasma spp., Babesia spp. and Trypanosoma spp., respectively, the molecular methods indicated that 275 (59.3%), 146 (31.5%), 64 (13.8%), 236 (50.9%) and 43 (9.3%) of the samples were positive for Anaplasma marginale, Babesia bigemina, Babesia bovis, Trypanosoma theileri and T. evansi, respectively. Mixed infections were detected in 250 (53.9%) samples. Interestingly, animals aged ≤1 year had higher probabilities of being infected with A. marginale and Babesia spp., and lower probabilities of being infected with Trypanosoma spp., while the animals raised under intensive system breeding had higher probabilities of being infected with all pathogens. Additionally, T. theileri infection was found in higher prevalence in anemic animals than animals with normal packed cell volume (PCV). This is the first molecular report that evaluated the infection with three genders of vector-borne pathogens in cattle in Colombia and provides useful information for a better understanding of the epidemiologic aspects, as well as for the management and control, of these diseases. Copyright © 2016 Elsevier GmbH. All rights reserved.

  9. Can training non-physician clinicians/associate clinicians (NPCs/ACs) in emergency obstetric, neonatal care and clinical leadership make a difference to practice and help towards reductions in maternal and neonatal mortality in rural Tanzania? The ETATMBA project.

    Science.gov (United States)

    Ellard, David R; Shemdoe, Aloisia; Mazuguni, Festo; Mbaruku, Godfrey; Davies, David; Kihaile, Paul; Pemba, Senga; Bergström, Staffan; Nyamtema, Angelo; Mohamed, Hamed-Mahfoudh; O'Hare, Joseph Paul

    2016-02-12

    During late 2010, 36 trainees including 19 assistant medical officers (AMOs) 1 senior clinical officer (CO) and 16 nurse midwives/nurses were recruited from districts across rural Tanzania and invited to join the Enhancing Human Resources and Use of Appropriate Technologies for Maternal and Perinatal Survival in the sub-Saharan Africa (ETATMBA) training programme. The ETATMBA project was training associate clinicians (ACs) as advanced clinical leaders in emergency obstetric care. The trainees returned to health facilities across the country with the hope of being able to apply their new skills and knowledge. The main aim of this study was to explore the impact of the ETATMBA training on health outcomes including maternal and neonatal morbidity and mortality in their facilities. Secondly, to explore the challenges faced in working in these health facilities. The study is a pre-examination/postexamination of maternal and neonatal health indicators and a survey of health facilities in rural Tanzania. The facilities surveyed were those in which ETATMBA trainees were placed post-training. The maternal and neonatal indicators were collected for 2011 and 2013 and the survey of the facilities was in early 2014. 16 of 17 facilities were surveyed. Maternal deaths show a non-significant downward trend over the 2 years (282-232 cases/100,000 live births). There were no significant differences in maternal, neonatal and birth complication variables across the time-points. The survey of facilities revealed shortages in key areas and some are a serious concern. This study represents a snapshot of rural health facilities providing maternal and neonatal care in Tanzania. Enhancing knowledge, practical skills, and clinical leadership of ACs may have a positive impact on health outcomes. However, any impact may be confounded by the significant challenges in delivering a service in terms of resources. Thus, training may be beneficial, but it requires an infrastructure that supports it

  10. Temas de Física para Ingeniería: Acústica

    OpenAIRE

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  11. AC propulsion system for an electric vehicle, phase 2

    Science.gov (United States)

    Slicker, J. M.

    1983-01-01

    A second-generation prototype ac propulsion system for a passenger electric vehicle was designed, fabricated, tested, installed in a modified Mercury Lynx vehicle and track tested at the Contractor's site. The system consisted of a Phase 2, 18.7 kw rated ac induction traction motor, a 192-volt, battery powered, pulse-width-modulated, transistorized inverter packaged for under rear seat installation, a 2-axis, 2-speed, automatically-shifted mechanical transaxle and a microprocessor-based powertrain/vehicle controller. A diagnostics computer to assist tuning and fault finding was fabricated. Dc-to-mechanical-system efficiency varied from 78% to 82% as axle speed/torque ranged from 159 rpm/788 nm to 65 rpm/328 nm. Track test efficiency results suggest that the ac system will be equal or superior to dc systems when driving urban cycles. Additional short-term work is being performed under a third contract phase (AC-3) to raise transaxle efficiency to predicted levels, and to improve starting and shifting characteristics. However, the long-term challenge to the system's viability remains inverter cost. A final report on the Phase 2 system, describing Phase 3 modifications, will be issued at the conclusion of AC-3.

  12. Unified Synthesis of Right Halves of Halichondrins A-C.

    Science.gov (United States)

    Yahata, Kenzo; Ye, Ning; Iso, Kentaro; Naini, Santhosh Reddy; Yamashita, Shuji; Ai, Yanran; Kishi, Yoshito

    2017-09-01

    The right halves of halichondrins A-C were synthesized by coupling the common C20-C37 building block 9 with the C1-C19 building blocks 10a-c, respectively. Catalytic, asymmetric Ni/Cr-mediated coupling was used for three C-C bond formations. For all cases, the stereochemistry was controlled with the Cr catalyst prepared from the chiral sulfonamide identified via the toolbox approach. For (3 + 4)-, (6 + 7)-, and (9 + 10)-couplings, the stereoselectivity of 28:1, >40:1, and ∼20:1 was achieved by the Cr catalysts prepared from (S)-H, (S)-I, and (R)-L, respectively. Unlike the first and second couplings, the third coupling used the structurally complex nucleophile. It was demonstrated that the coupling efficiency was excellent even with the electrophile/nucleophile molar ratio = 1.0/1.1. In addition, the third coupling was achieved with the substrate bearing a free hydroxyl group. The products obtained in the Ni/Cr-mediated couplings were converted to the right halves of halichondrins A-C in excellent overall yields. The right halves of halichondrins A-C (1a-c) were synthesized in 28, 24, and 24 steps from commercial d-galactal in 13.4%, 21.1%, and 16.7% overall yield, respectively.

  13. AC losses in circular arrangements of parallel superconducting tapes

    DEFF Research Database (Denmark)

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  14. AC loss of Bi-2212 superconducting ring for limiter

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Y.N.; Wang, J.X.; Li, J.H.; Zong, X.H.; Sun, J

    2003-04-15

    A wattmeter technique is used to measure alternating field loss in Bi-2212 superconducting ring as an element of inductive fault current limiter. Experiment is performed at 77 K. Measurement results show that AC loss P vs. amplitude of sweeping field P follows a power law, P{proportional_to}H{sup n}. When sweeping field is lower than H{sub p} we observe the cubic dependence as predicted by the Bean-London critical state model. With increasing field the exponent initially increases, reaches the maximum of 4 as predicted by the Kim-Anderson critical state model. When the field is higher than H{sub p} the exponent decrease to 1. But AC loss per cycle decreases with the increase of frequency of field when the field is high. This can be explained by heating effect of AC loss. Furthermore, we calculate the AC loss of a full-scale inductive superconductor fault current limiter based on our measurement result. We found that the AC loss of this device is acceptable.

  15. Design and synthesis of {sup 225}Ac radioimmunopharmaceuticals

    Energy Technology Data Exchange (ETDEWEB)

    McDevitt, Michael R.; Ma, Dangshe; Simon, Jim; Frank, R. Keith; Scheinberg, David A. E-mail: d-scheinberg@ski.mskcc.org

    2002-12-01

    The alpha-particle-emitting radionuclides {sup 213}Bi, {sup 211}At, {sup 224}Ra are under investigation for the treatment of leukemias, gliomas, and ankylosing spondylitis, respectively. {sup 213}Bi and {sup 211}At were attached to monoclonal antibodies and used as targeted immunotherapeutic agents while unconjugated {sup 224}Ra chloride selectively seeks bone. {sup 225}Ac possesses favorable physical properties for radioimmunotherapy (10 d half-life and 4 net alpha particles), but has a history of unfavorable radiolabeling chemistry and poor metal-chelate stability. We selected functionalized derivatives of DOTA as the most promising to pursue from out of a group of potential {sup 225}Ac chelate compounds. A two-step synthetic process employing either MeO-DOTA-NCS or 2B-DOTA-NCS as the chelating moiety was developed to attach {sup 225}Ac to monoclonal antibodies. This method was tested using several different IgG systems. The chelation reaction yield in the first step was 93{+-}8% radiochemically pure (n=26). The second step yielded {sup 225}Ac-DOTA-IgG constructs that were 95{+-}5% radiochemically pure (n=27) and the mean percent immunoreactivity ranged from 25% to 81%, depending on the antibody used. This process has yielded several potential novel targeted {sup 225}Ac-labeled immunotherapeutic agents that may now be evaluated in appropriate model systems and ultimately in humans.

  16. Apple MdACS6 Regulates Ethylene Biosynthesis During Fruit Development Involving Ethylene-Responsive Factor.

    Science.gov (United States)

    Li, Tong; Tan, Dongmei; Liu, Zhi; Jiang, Zhongyu; Wei, Yun; Zhang, Lichao; Li, Xinyue; Yuan, Hui; Wang, Aide

    2015-10-01

    Ethylene biosynthesis in plants involves different 1-aminocyclopropane-1-carboxylic acid synthase (ACS) genes. The regulation of each ACS gene during fruit development is unclear. Here, we characterized another apple (Malus×domestica) ACS gene, MdACS6. The transcript of MdACS6 was observed not only in fruits but also in other tissues. During fruit development, MdACS6 was initiated at a much earlier stage, whereas MdACS3a and MdACS1 began to be expressed at 35 d before harvest and immediateley after harvest, respectively. Moreover, the enzyme activity of MdACS6 was significantly lower than that of MdACS3a and MdACS1, accounting for the low ethylene biosynthesis in young fruits. Overexpression of MdACS6 (MdACS6-OE) by transient assay in apple showed enhanced ethylene production, and MdACS3a was induced in MdACS6-OE fruits but not in control fruits. In MdACS6 apple fruits silenced by the virus-induced gene silencing (VIGS) system (MdACS6-AN), neither ethylene production nor MdACS3a transcript was detectable. In order to explore the mechanism through which MdACS3a was induced in MdACS6-OE fruits, we investigated the expression of apple ethylene-responsive factor (ERF) genes. The results showed that the expression of MdERF2 was induced in MdACS6-OE fruits and inhibited in MdACS6-AN fruits. Yeast one-hybrid assay showed that MdERF2 protein could bind to the promoter of MdACS3a. Moreover, down-regulation of MdERF2 in apple flesh callus led to a decrease of MdACS3a expression, demonstrating the regulation of MdERF2 on MdACS3a. The mechanism through which MdACS6 regulates the action of MdACS3a was discussed. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  17. Cadmium-induced ethylene production and responses in Arabidopsis thaliana rely on ACS2 and ACS6 gene expression.

    Science.gov (United States)

    Schellingen, Kerim; Van Der Straeten, Dominique; Vandenbussche, Filip; Prinsen, Els; Remans, Tony; Vangronsveld, Jaco; Cuypers, Ann

    2014-08-01

    Anthropogenic activities cause metal pollution worldwide. Plants can absorb and accumulate these metals through their root system, inducing stress as a result of excess metal concentrations inside the plant. Ethylene is a regulator of multiple plant processes, and is affected by many biotic and abiotic stresses. Increased ethylene levels have been observed after exposure to excess metals but it remains unclear how the increased ethylene levels are achieved at the molecular level. In this study, the effects of cadmium (Cd) exposure on the production of ethylene and its precursor 1-aminocyclopropane-1-carboxylic acid (ACC), and on the expression of the ACC Synthase (ACS) and ACC Oxidase (ACO) multigene families were investigated in Arabidopsis thaliana. Increased ethylene release after Cd exposure was directly measurable in a system using rockwool-cultivated plants; enhanced levels of the ethylene precursor ACC together with higher mRNA levels of ethylene responsive genes: ACO2, ETR2 and ERF1 also indicated increased ethylene production in hydroponic culture. Regarding underlying mechanisms, it was found that the transcript levels of ACO2 and ACO4, the most abundantly expressed members of the ACO multigene family, were increased upon Cd exposure. ACC synthesis is the rate-limiting step in ethylene biosynthesis, and transcript levels of both ACS2 and ACS6 showed the highest increase and became the most abundant isoforms after Cd exposure, suggesting their importance in the Cd-induced increase of ethylene production. Cadmium induced the biosynthesis of ACC and ethylene in Arabidopsis thaliana plants mainly via the increased expression of ACS2 and ACS6. This was confirmed in the acs2-1acs6-1 double knockout mutants, which showed a decreased ethylene production, positively affecting leaf biomass and resulting in a delayed induction of ethylene responsive gene expressions without significant differences in Cd contents between wild-type and mutant plants.

  18. Cadmium-induced ethylene production and responses in Arabidopsis thaliana rely on ACS2 and ACS6 gene expression

    Science.gov (United States)

    2014-01-01

    Background Anthropogenic activities cause metal pollution worldwide. Plants can absorb and accumulate these metals through their root system, inducing stress as a result of excess metal concentrations inside the plant. Ethylene is a regulator of multiple plant processes, and is affected by many biotic and abiotic stresses. Increased ethylene levels have been observed after exposure to excess metals but it remains unclear how the increased ethylene levels are achieved at the molecular level. In this study, the effects of cadmium (Cd) exposure on the production of ethylene and its precursor 1-aminocyclopropane-1-carboxylic acid (ACC), and on the expression of the ACC Synthase (ACS) and ACC Oxidase (ACO) multigene families were investigated in Arabidopsis thaliana. Results Increased ethylene release after Cd exposure was directly measurable in a system using rockwool-cultivated plants; enhanced levels of the ethylene precursor ACC together with higher mRNA levels of ethylene responsive genes: ACO2, ETR2 and ERF1 also indicated increased ethylene production in hydroponic culture. Regarding underlying mechanisms, it was found that the transcript levels of ACO2 and ACO4, the most abundantly expressed members of the ACO multigene family, were increased upon Cd exposure. ACC synthesis is the rate-limiting step in ethylene biosynthesis, and transcript levels of both ACS2 and ACS6 showed the highest increase and became the most abundant isoforms after Cd exposure, suggesting their importance in the Cd-induced increase of ethylene production. Conclusions Cadmium induced the biosynthesis of ACC and ethylene in Arabidopsis thaliana plants mainly via the increased expression of ACS2 and ACS6. This was confirmed in the acs2-1acs6-1 double knockout mutants, which showed a decreased ethylene production, positively affecting leaf biomass and resulting in a delayed induction of ethylene responsive gene expressions without significant differences in Cd contents between wild-type and

  19. Microbial survey of ready-to-eat salad ingredients sold at retail reveals the occurrence and the persistence of Listeria monocytogenes Sequence Types 2 and 87 in pre-packed smoked salmon.

    Science.gov (United States)

    Chau, Man Ling; Aung, Kyaw Thu; Hapuarachchi, Hapuarachchige Chanditha; Lee, Pei Sze Valarie; Lim, Pei Ying; Kang, Joanne Su Lin; Ng, Youming; Yap, Hooi Ming; Yuk, Hyun-Gyun; Gutiérrez, Ramona Alikiiteaga; Ng, Lee Ching

    2017-02-28

    As the preparation of salads involves extensive handling and the use of uncooked ingredients, they are particularly vulnerable to microbial contamination. This study aimed to determine the microbial safety and quality of pre-packed salads and salad bar ingredients sold in Singapore, so as to identify public health risks that could arise from consuming salads and to determine areas for improvement in the management of food safety. The most frequently encountered organism in pre-packed salad samples was B. cereus, particularly in pasta salads (33.3%, 10/30). The most commonly detected organism in salad bar ingredients was L. monocytogenes, in particular seafood ingredients (44.1%, 15/34), largely due to contaminated smoked salmon. Further investigation showed that 21.6% (37/171) of the pre-packed smoked salmon sold in supermarkets contained L. monocytogenes. Significantly higher prevalence of L. monocytogenes and higher Standard Plate Count were detected in smoked salmon at salad bars compared to pre-packed smoked salmon in supermarkets, which suggested multiplication of the organism as the products move down the supply chain. Further molecular analysis revealed that L. monocytogenes Sequence Type (ST) 2 and ST87 were present in a particular brand of pre-packed salmon products over a 4-year period, implying a potential persistent contamination problem at the manufacturing level. Our findings highlighted a need to improve manufacturing and retail hygiene processes as well as to educate vulnerable populations to avoid consuming food prone to L. monocytogenes contamination.

  20. Damaged DNA-binding protein down-regulates epigenetic mark H3K56Ac through histone deacetylase 1 and 2

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Qianzheng; Battu, Aruna; Ray, Alo; Wani, Gulzar; Qian, Jiang; He, Jinshan; Wang, Qi-en [Department of Radiology, The Ohio State University, Columbus, OH 43210 (United States); Wani, Altaf A., E-mail: wani.2@osu.edu [Department of Radiology, The Ohio State University, Columbus, OH 43210 (United States); Department of Molecular and Cellular Biochemistry, The Ohio State University, Columbus, OH 43210 (United States); James Cancer Hospital and Solove Research Institute, The Ohio State University, Columbus, OH 43210 (United States)

    2015-06-15

    Highlights: • HDAC1 and HDAC2 co-localize with UV radiation-induced DNA damage sites. • HDAC1 translocation to chromatin is dependent on DDB2 function. • HDAC1 and HDAC2 are involved in H3K56Ac deacetylation. • H3K56Ac deacetylation requires DDB1 and DDB2 but not XPA or XPC functions. • HDAC1/2 depletion decreases XPC ubiquitination and local γH2AX accumulation. - Abstract: Acetylated histone H3 lysine 56 (H3K56Ac) is one of the reversible histone post-translational modifications (PTMs) responsive to DNA damage. We previously described a biphasic decrease and increase of epigenetic mark H3K56Ac in response to ultraviolet radiation (UVR)-induced DNA damage. Here, we report a new function of UV damaged DNA-binding protein (DDB) in deacetylation of H3K56Ac through specific histone deacetylases (HDACs). We show that simultaneous depletion of HDAC1/2 compromises the deacetylation of H3K56Ac, while depletion of HDAC1 or HDAC2 alone has no effect on H3K56Ac. The H3K56Ac deacetylation does not require functional nucleotide excision repair (NER) factors XPA and XPC, but depends on the function of upstream factors DDB1 and DDB2. UVR enhances the association of DDB2 with HDAC1 and, enforced DDB2 expression leads to translocation of HDAC1 to UVR-damaged chromatin. HDAC1 and HDAC2 are recruited to UVR-induced DNA damage spots, which are visualized by anti-XPC immunofluorescence. Dual HDAC1/2 depletion decreases XPC ubiquitination, but does not affect the recruitment of DDB2 to DNA damage. By contrast, the local accumulation of γH2AX at UVR-induced DNA damage spots was compromised upon HDAC1 as well as dual HDAC1/2 depletions. Additionally, UVR-induced ATM activation decreased in H12899 cells expressing H3K56Ac-mimicing H3K56Q. These results revealed a novel role of DDB in H3K56Ac deacetylation during early step of NER and the existence of active functional cross-talk between DDB-mediated damage recognition and H3K56Ac deacetylation.

  1. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    Directory of Open Access Journals (Sweden)

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  2. Neural network based PWM AC chopper fed induction motor drive

    Directory of Open Access Journals (Sweden)

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  3. Superconducting shielded core reactor with reduced AC losses

    Science.gov (United States)

    Cha, Yung S.; Hull, John R.

    2006-04-04

    A superconducting shielded core reactor (SSCR) operates as a passive device for limiting excessive AC current in a circuit operating at a high power level under a fault condition such as shorting. The SSCR includes a ferromagnetic core which may be either closed or open (with an air gap) and extends into and through a superconducting tube or superconducting rings arranged in a stacked array. First and second series connected copper coils each disposed about a portion of the iron core are connected to the circuit to be protected and are respectively wound inside and outside of the superconducting tube or rings. A large impedance is inserted into the circuit by the core when the shielding capability of the superconducting arrangement is exceeded by the applied magnetic field generated by the two coils under a fault condition to limit the AC current in the circuit. The proposed SSCR also affords reduced AC loss compared to conventional SSCRs under continuous normal operation.

  4. On the Application of TLS Techniques to AC Electrical Drives

    Directory of Open Access Journals (Sweden)

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  5. Particle manipulation using 3D ac electro-osmotic micropumps

    Science.gov (United States)

    Hilber, W.; Weiss, B.; Mikolasek, M.; Holly, R.; Hingerl, K.; Jakoby, B.

    2008-06-01

    We present a novel mechanism of particle manipulation in alternating-current (ac)- driven electro-osmotic micropumps, utilizing the tunable ratio of viscous drag, inertial and dielectrophoretic forces. The latter are induced by three-dimensional (3D) stepped electrode arrays in the channel, which are driven by ac voltages enabling so-called 3D-ac-electro-osmotic pumping, as has been proposed recently. Due to size- and density-dependent differences in polarizability, targeted particles in the fluid stream can be slowed down or even pinned above the electrode structures solely by adjusting the operation parameters of the pump. Hence the presented device, fabricated in SU-8/glass technology, enables simultaneous pumping and manipulation of particles in suspension.

  6. The ac propulsion system for an electric vehicle, phase 1

    Science.gov (United States)

    Geppert, S.

    1981-01-01

    A functional prototype of an electric vehicle ac propulsion system was built consisting of a 18.65 kW rated ac induction traction motor, pulse width modulated (PWM) transistorized inverter, two speed mechanically shifted automatic transmission, and an overall drive/vehicle controller. Design developmental steps, and test results of individual components and the complex system on an instrumented test frame are described. Computer models were developed for the inverter, motor and a representative vehicle. A preliminary reliability model and failure modes effects analysis are given.

  7. ENOSTOPENJSKI DC-AC PRETVORNIK ZA SOLARNE SISTEME

    OpenAIRE

    Konjedic, Tine

    2009-01-01

    V diplomskem delu so predstavljene posamezne komponente fotonapetostnih sistemov, podpore proizvodnji električne energije iz obnovljivih virov in osnove DC-DC ter DC-AC pretvornikov. Opisano je načrtovanje in preizkušanje enostopenjskega DC-AC pretvornika, ki se lahko uporablja kot omrežni razsmernik v sistemu sončne elektrarne. Za proženje stikal je uporabljena pulzno-širinska modulacija, ki je izvedena z uporabo digitalnega signalnega procesorja. Z namenom uvrstitve pretvornika v fotonapeto...

  8. Development of an AC Module System: Final Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Suparna Kadam; Miles Russell

    2012-06-15

    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  9. Droop-free Distributed Control for AC Microgrids

    DEFF Research Database (Denmark)

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.

    2016-01-01

    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A sparse...... guidelines are provided. Steady-state performance analysis shows that the proposed controller can accurately handle the global voltage regulation and proportional load sharing. An AC microgrid prototype is set up, where the controller performance, plug-and-play capability, and resiliency to the failure...

  10. Productos «Celotex» para acondicionamientos Acústicos

    Directory of Open Access Journals (Sweden)

    Editorial, Equipo

    1958-02-01

    Full Text Available Not availableBajo la denominación general «Celotex», que es un nombre registrado, la Casa Americana The Celotex Corporation, cuyo domicilio social es 120 South, La Salle Street, Chicago J. lllinois, fabrica diversos materiales para fines de acondicionamiento acústico elaborados, según los tipos de que se trate, con fibra de caña de azúcar, lanas minerales, acero, amianto, etc., perforados o no y de acuerdo con el efecto estético y acústico que se desee obtener.

  11. El acondicionamiento acústico de una sala de conciertos

    OpenAIRE

    MONTANER SOLBES, SALVADOR

    2012-01-01

    El trabajo que se presenta a continuación se centra en el acondicionamiento acústico de una sala previamente existente, en un edificio de Valencia cuyo fin va a ser albergar un auditorio para música de cámara o grupos musicales de cuerda de tamaño reducido. La sala a diseñar se encuentra en un edificio con unas dimensiones limitadas y situado entre plantas. Se parte de las condiciones visuales y acústicas, para modificar y perfeccionar la geometría de la sala, y después se pasa al revestimie...

  12. Power converters and AC electrical drives with linear neural networks

    CERN Document Server

    Cirrincione, Maurizio

    2012-01-01

    The first book of its kind, Power Converters and AC Electrical Drives with Linear Neural Networks systematically explores the application of neural networks in the field of power electronics, with particular emphasis on the sensorless control of AC drives. It presents the classical theory based on space-vectors in identification, discusses control of electrical drives and power converters, and examines improvements that can be attained when using linear neural networks. The book integrates power electronics and electrical drives with artificial neural networks (ANN). Organized into four parts,

  13. AC and Phase Sensing of Nanowires for Biosensing

    Directory of Open Access Journals (Sweden)

    Marco Crescentini

    2016-04-01

    Full Text Available Silicon nanowires are label-free sensors that allow real-time measurements. They are economical and pave the road for point-of-care applications but require complex readout and skilled personnel. We propose a new model and technique for sensing nanowire sensors using alternating currents (AC to capture both magnitude and phase information from the sensor. This approach combines the advantages of complex impedance spectroscopy with the noise reduction performances of lock-in techniques. Experimental results show how modifications of the sensors with different surface chemistries lead to the same direct-current (DC response but can be discerned using the AC approach.

  14. State and evaluation of accommodation capacities in the Vršac Mountains

    Directory of Open Access Journals (Sweden)

    Gajić Tamara

    2012-01-01

    Full Text Available The development of tourist offer within a certain area can be measured, among other things, with the condition of accommodation capacities. Even though they are located in the nature reserve of the rare natural beauty, accommodation capacities of the Vršac mountains are mostly empty and abandoned, and the spatial disposition is not proportional to the tourists' needs and quality of resources. The topic of this research were the accomodation capacities along the marked tourist paths within the area of The Vršac Mountains. The aim of this paper was the research on the current state of the material base of the mountain tourism and to obtain data on the impact of material base on tourism. During the research, the following methods were used: field research, with the field data gathering techniques: interview, survey, personal experience. The conclusion was reached that the current accommodation capacities are unequally distributed, and, as the importance of accomodation capacities in tourism is specially highlighted, it is clear that the future of mountain tourism depends primarily on the forthcoming steps of the decision makers in the hospitality industry. Since it is complicated to get the building permit in the protected area, the best solution is to rearrange and to reopen the existing accommodation facilities.

  15. Sky Surveys

    OpenAIRE

    Djorgovski, S. G.; Mahabal, A. A.; Drake, A.J.; Graham, M. J.; C. Donalek

    2012-01-01

    Sky surveys represent a fundamental data basis for astronomy. We use them to map in a systematic way the universe and its constituents, and to discover new types of objects or phenomena. We review the subject, with an emphasis on the wide-field imaging surveys, placing them in a broader scientific and historical context. Surveys are the largest data generators in astronomy, propelled by the advances in information and computation technology, and have transformed the ways in which astronomy is...

  16. Ezrin/Exocyst complex regulates mucin 5AC secretion induced by neutrophil elastase in human airway epithelial cells.

    Science.gov (United States)

    Li, Qi; Li, Na; Liu, Chun-Yi; Xu, Rui; Kolosov, Victor P; Perelman, Juliy M; Zhou, Xiang-Dong

    2015-01-01

    Increased mucin secretion is a characteristic feature of many chronic airway diseases, particularly during periods of exacerbation; however, the exact mechanism of mucin secretion remains unclear. Ezrin, which is a specific marker of apical membranes, is predominantly concentrated in exocyst-rich cell surface structures, crosslinking the actin cytoskeleton with the plasma membrane. In the present study, we examined whether Ezrin is involved in mucin 5AC (MUC5AC) secretion after neutrophil elastase (NE) attack, and we investigated the role of the exocyst complex docking protein Sec3 in this process. NE was used as a stimulator in a 16HBE14o- cell culture model. The expression and location of Ezrin and Sec3 were investigated, and the interaction between Ezrin and Sec3 in 16HBE14o-cells was assayed after treatment with NE, Ezrin siRNA, Sec3 siRNA, neomycin or PIP2-Ab. We found that Ezrin was highly expressed in the bronchi of humans with chronic airway diseases. NE induced robust MUC5AC protein secretion. The Ezrin siRNA, Sec3 siRNA, and neomycin treatments led to impaired MUC5AC secretion in cells. Both Ezrin and Sec3 were recruited primarily to the cytoplasmic membrane after NE stimulation, and the neomycin and PIP2-Ab treatments abrogated this effect. Immunoprecipitation analysis revealed that Ezrin and Sec3 combined to form complexes; however, these complexes could not be detected in Ezrin∆1-333 mutant-transfected cells, even when PIP2 was added. These results demonstrate that Ezrin/Sec3 complexes are essential for MUC5AC secretion in NE-stimulated airway epithelial cells and that PIP2 is of critical importance in the formation of these complexes. © 2015 S. Karger AG, Basel.

  17. Ezrin/Exocyst Complex Regulates Mucin 5AC Secretion Induced by Neutrophil Elastase in Human Airway Epithelial Cells

    Directory of Open Access Journals (Sweden)

    Qi Li

    2015-01-01

    Full Text Available Background/Aim: Increased mucin secretion is a characteristic feature of many chronic airway diseases, particularly during periods of exacerbation; however, the exact mechanism of mucin secretion remains unclear. Ezrin, which is a specific marker of apical membranes, is predominantly concentrated in exocyst-rich cell surface structures, crosslinking the actin cytoskeleton with the plasma membrane. In the present study, we examined whether Ezrin is involved in mucin 5AC (MUC5AC secretion after neutrophil elastase (NE attack, and we investigated the role of the exocyst complex docking protein Sec3 in this process. Methods: NE was used as a stimulator in a 16HBE14o- cell culture model. The expression and location of Ezrin and Sec3 were investigated, and the interaction between Ezrin and Sec3 in 16HBE14o-cells was assayed after treatment with NE, Ezrin siRNA, Sec3 siRNA, neomycin or PIP2-Ab. Results: We found that Ezrin was highly expressed in the bronchi of humans with chronic airway diseases. NE induced robust MUC5AC protein secretion. The Ezrin siRNA, Sec3 siRNA, and neomycin treatments led to impaired MUC5AC secretion in cells. Both Ezrin and Sec3 were recruited primarily to the cytoplasmic membrane after NE stimulation, and the neomycin and PIP2-Ab treatments abrogated this effect. Immunoprecipitation analysis revealed that Ezrin and Sec3 combined to form complexes; however, these complexes could not be detected in Ezrin∆1-333 mutant-transfected cells, even when PIP2 was added. Conclusions: These results demonstrate that Ezrin/Sec3 complexes are essential for MUC5AC secretion in NE-stimulated airway epithelial cells and that PIP2 is of critical importance in the formation of these complexes.

  18. Effects of alpha and gamma transcranial alternating current stimulation (tACS) on verbal creativity and intelligence test performance.

    Science.gov (United States)

    Grabner, Roland H; Krenn, Julia; Fink, Andreas; Arendasy, Martin; Benedek, Mathias

    2017-10-31

    Transcranial alternating current stimulation (tACS) is a non-invasive brain stimulation method that allows to directly modulate brain oscillations of a given frequency. Using this method, it was recently shown that increasing alpha (10Hz) oscillations improved creative ideation with figural material and that increasing gamma (40Hz) oscillations speeded up performance in a figural matrices intelligence task. The aim of the present study was to examine whether these findings generalize to verbal creativity and intelligence tasks. In addition, we explored whether the stimulation effects are moderated by individual differences in creative potential and intelligence. Twenty-two adults received 10Hz, 40Hz and sham tACS while they worked on a verbal creativity (alternate uses) task and a verbal intelligence (anagram) task. Analyses revealed that 10Hz stimulation had a marginally significant effect on ideational fluency in the alternate uses task, whereas originality was unaffected. The beneficial effect of stimulation on fluency tended to emerge mainly in the individuals with higher creative potential. In the verbal intelligence task, in contrast, 40Hz stimulation did neither impact on performance nor interacted with individual differences in intelligence. These findings provide first tentative evidence that enhancing alpha oscillations through tACS may improve creative thinking not only in the figural but also in the verbal domain. The previously reported beneficial effect of gamma tACS on figural intelligence, however, could not be observed in a verbal task. In sum, the present study further corroborates the causal link between alpha oscillations and creative thinking and suggests that tACS may be a promising tool to enhance cognitive processes. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Emission-Line Galaxies from the HST PEARS Grism Survey Southern Fields

    Science.gov (United States)

    Straughn, Amber; Pirzkal, N.; Meurer, G.; Cohen, S.; Windhorst, R.; Malhotra, S.; Gardner, J.; Rhoads, J.; Hathi, N.; Xu, C.

    2009-01-01

    We have detected a sample of emission-line galaxies (ELGs) from the PEARS (Probing Evolution And Reionization Spectroscopically) HST/ACS grism survey Southern Fields. The PEARS Southern Fields consist of five ACS pointings (including the Hubble Ultra Deep Field) with the G800L grism for a total of 120 orbits, revealing thousands of faint object spectra in the GOODS-South region of the sky. Using a 2-dimensional detection and extraction procedure, we find 320 emission lines orginating from 230 galaxy ``knots'' within 203 individual galaxies. Line identification results in 118 new grism-spectroscopic redshifts for galaxies in the GOODS-South Field. Our detection method has allowed us to observe emission lines from distinct giant star-forming regions across individual galaxies at redshifts z 0.5. We find that the radial distances of these HII regions generally reside near the galaxies' optical continuum half-light radii, similar to those of giant HII regions in local galaxies.

  20. A New Antifibrotic Target of Ac-SDKP: Inhibition of Myofibroblast Differentiation in Rat Lung with Silicosis

    Science.gov (United States)

    Xu, Hong; Yang, Fang; Sun, Ying; Yuan, Yuan; Cheng, Hua; Wei, Zhongqiu; Li, Shuyu; Cheng, Tan; Brann, Darrell; Wang, Ruimin

    2012-01-01

    Background Myofibroblast differentiation, characterized by α-smooth muscle actin (α-SMA) expression, is a key process in organ fibrosis, and is induced by TGF-β. Here we examined whether an anti-fibrotic agent, N-acetyl-seryl-aspartyl-lysylproline (Ac-SDKP), can regulate induction of TGF-β signaling and myofibroblast differentiation as a potential key component of its anti-fibrotic mechanism in vivo and in vitro. Methodology/Principal Findings Rat pulmonary fibroblasts were cultured in vitro and divided to 4 groups 1) control; 2) TGF-β1; 3) TGF-β1+ LY364947; 4) TGF-β1+Ac-SDKP. For in vivo studies, six groups of animals were utilized 1) control 4w; 2) silicotic 4w; 3) control 8w; 4) silicotic 8w; 5) Ac-SDKP post-treatment; 6)Ac-SDKP pre-treatment. SiO2 powders were douched in the trachea of rat to make the silicotic model. Myofibroblast differentiation was measured by examining expression of α-SMA, as well as expression of serum response factor (SRF), a key regulator of myofibroblast differentiation. The expressions of collagen, TGF-β1 and RAS signaling were also assessed. The results revealed that TGF-β1 strongly induced myofibroblast differentiation and collagen synthesis in vitro, and that pre-treatment with Ac-SDKP markedly attenuated myofibroblast activation, as well as induction of TGF-β1 and its receptor. Similar results were observed in vivo in the pathologically relevant rat model of silicosis. Ac-SDKP treatment in vivo strongly attenuated 1) silicosis-induced increased expressions of TGF-β1 and RAS signaling, 2) myofibroblast differentiation as indicated by a robust decrease of SRF and α-SMA-positive myofibroblast localization in siliconic nodules in the lung, 3) collagen deposition. Conclusion/Significance The results of the present study suggest a novel mechanism of action for Ac-SDKP’s beneficial effect in silicosis, which involves attenuation of TGF-β1 and its receptors, SRF and Ang II type 1 receptor (AT1) expression, collagen

  1. A new antifibrotic target of Ac-SDKP: inhibition of myofibroblast differentiation in rat lung with silicosis.

    Directory of Open Access Journals (Sweden)

    Hong Xu

    Full Text Available BACKGROUND: Myofibroblast differentiation, characterized by α-smooth muscle actin (α-SMA expression, is a key process in organ fibrosis, and is induced by TGF-β. Here we examined whether an anti-fibrotic agent, N-acetyl-seryl-aspartyl-lysylproline (Ac-SDKP, can regulate induction of TGF-β signaling and myofibroblast differentiation as a potential key component of its anti-fibrotic mechanism in vivo and in vitro. METHODOLOGY/PRINCIPAL FINDINGS: Rat pulmonary fibroblasts were cultured in vitro and divided to 4 groups 1 control; 2 TGF-β1; 3 TGF-β1+ LY364947; 4 TGF-β1+Ac-SDKP. For in vivo studies, six groups of animals were utilized 1 control 4w; 2 silicotic 4w; 3 control 8w; 4 silicotic 8w; 5 Ac-SDKP post-treatment; 6Ac-SDKP pre-treatment. SiO(2 powders were douched in the trachea of rat to make the silicotic model. Myofibroblast differentiation was measured by examining expression of α-SMA, as well as expression of serum response factor (SRF, a key regulator of myofibroblast differentiation. The expressions of collagen, TGF-β1 and RAS signaling were also assessed. The results revealed that TGF-β1 strongly induced myofibroblast differentiation and collagen synthesis in vitro, and that pre-treatment with Ac-SDKP markedly attenuated myofibroblast activation, as well as induction of TGF-β1 and its receptor. Similar results were observed in vivo in the pathologically relevant rat model of silicosis. Ac-SDKP treatment in vivo strongly attenuated 1 silicosis-induced increased expressions of TGF-β1 and RAS signaling, 2 myofibroblast differentiation as indicated by a robust decrease of SRF and α-SMA-positive myofibroblast localization in siliconic nodules in the lung, 3 collagen deposition. CONCLUSION/SIGNIFICANCE: The results of the present study suggest a novel mechanism of action for Ac-SDKP's beneficial effect in silicosis, which involves attenuation of TGF-β1 and its receptors, SRF and Ang II type 1 receptor (AT(1 expression, collagen

  2. Converting DC trains to AC operation using converters; Umstellung von DC-Bahnen auf AC-Betrieb mit Umrichtern

    Energy Technology Data Exchange (ETDEWEB)

    Schuette, Thorsten [Atkins Sverige AB, Vaesteraas (Sweden); Behmann, Uwe

    2012-01-15

    Nowadays, powerful DC trains run in interconnected overhead line contact systems. Converting them to AC operation in the conventional way, i.e. using phase-changing substations or even transformers, means new disadvantages to both the trains and the 3AC operators. Among these disad-vantages are power peaks that occur when catching up on speed losses after idling runs in phase separation sections. Static converters now again permit an interconnection of the line systems which allows a conversion to be re-assessed. (orig.)

  3. Regional patterns of Mesozoic-Cenozoic magmatism in western Alaska revealed by new U-Pb and 40Ar/39Ar ages: Chapter D in Studies by the U.S. Geological Survey in Alaska, vol. 15

    Science.gov (United States)

    Bradley, Dwight C.; Miller, Marti L.; Friedman, Richard M.; Layer, Paul W.; Bleick, Heather A.; Jones, James V.; Box, Steven E.; Karl, Susan M.; Shew, Nora B.; White, Timothy S.; Till, Alison B.; Dumoulin, Julie A.; Bundtzen, Thomas K.; O'Sullivan, Paul B.; Ullrich, Thomas D.

    2017-03-02

    In support of regional geologic framework studies, we obtained 50 new argon-40/argon-39 (40Ar/39Ar) ages and 33 new uranium-lead (U-Pb) ages from igneous rocks of southwestern Alaska. Most of the samples are from the Sleetmute and Taylor Mountains quadrangles; smaller collections or individual samples are from the Bethel, Candle, Dillingham, Goodnews Bay, Holy Cross, Iditarod, Kantishna River, Lake Clark, Lime Hills, McGrath, Medfra, Talkeetna, and Tanana quadrangles.A U-Pb zircon age of 317.7±0.6 million years (Ma) reveals the presence of Pennsylvanian intermediate igneous (probably volcanic) rocks in the Tikchik terrane, Bethel quadrangle. A U-Pb zircon age of 229.5±0.2 Ma from gabbro intruding the Rampart Group of the Angayucham-Tozitna terrane, Tanana quadrangle, confirms and tightens a previously cited Triassic age for this intrusive suite. A fresh mafic dike in Goodnews Bay quadrangle yielded a 40Ar/39Ar whole rock age of 155.0±1.9 Ma; this establishes a Jurassic or older age for the previously unconstrained (Paleozoic? to Mesozoic?) sandstone unit that it intrudes. A thick felsic tuff in the Gemuk Group in Taylor Mountains quadrangle yielded a U-Pb zircon age of 153.0±2.0 Ma, extending the age of magmatism in this part of the Togiak terrane back into the Late Jurassic. We report three new U-Pb zircon ages between 120 and 110 Ma—112.0±0.9 Ma from syenite in the Candle quadrangle, 114.9±0.3 Ma from orthogneiss assigned to the Ruby terrane in Iditarod quadrangle, and 116.6±0.1 Ma from a gabbro of the Dishna River mafic-ultramafic complex in Iditarod quadrangle. The latter result requires a substantial age revision, from Triassic to Cretaceous, for at least some rocks that have been mapped as the Dishna River mafic-ultramafic complex. A tuff in the Upper Cretaceous Kuskokwim Group yielded a U-Pb zircon (sensitive high-resolution ion microprobe, SHRIMP) age of 88.3±1.0 Ma; we speculate that the eruptive source was an arc along the trend of the Pebble

  4. An Ac/Ds-mediated gene trap system for functional genomics in barley

    Directory of Open Access Journals (Sweden)

    Lazarow Katina

    2009-01-01

    Full Text Available Abstract Background Gene trapping is a powerful tool for gene discovery and functional genomics in both animals and plants. Upon insertion of the gene trap construct into an expressed gene, splice donor and acceptor sites facilitate the generation of transcriptional fusions between the flanking sequence and the reporter. Consequently, detection of reporter gene expression allows the identification of genes based on their expression pattern. Up to now rice is the only cereal crop for which gene trap approaches exist. In this study we describe a gene trap system in barley (Hordeum vulgare L. based on the maize transposable elements Ac/Ds. Results We generated gene trap barley lines by crossing Ac transposase expressing plants with multiple independent transformants carrying the Ds based gene trap construct GTDsB. Upstream of the β-Glucuronidase start codon GTDsB carries splice donor and acceptor sites optimized for monocotyledonous plants. DNA blot analysis revealed GTDsB transposition frequencies of 11% and 26% in the F1 and F2 generation of gene trap lines and perpetuation of transposition activity in later generations. Furthermore, analysis of sequences flanking transposed GTDsB elements evidenced preferential insertion into expressed regions of the barley genome. We screened leaves, nodes, immature florets, pollinated florets, immature grains and seedlings of F2 plants and detected GUS expression in 51% (72/141 of the plants. Thus, reporter gene expression was found in 24 of the 28 F1 lines tested and in progeny of all GTDsB parental lines. Conclusion Due to the frequent transposition of GTDsB and the efficient expression of the GUS reporter gene, we conclude that this Ac/Ds-based gene trap system is an applicable approach for gene discovery in barley. The successful introduction of a gene trap construct optimized for monocots in barley contributes a novel functional genomics tool for this cereal crop.

  5. Extreme charge-trapping by pixels in Hubble's ACS/WFC detectors

    Science.gov (United States)

    Ryon, Jenna E.; Grogin, Norman A.; ACS Team

    2017-06-01

    We investigate the properties of sink pixels in the Advanced Camera for Surveys (ACS) Wide Field Channel (WFC) detector. These pixels likely contain extra charge traps and therefore appear anomalously low in images with relatively high backgrounds. We identify sink pixels in the average short (0.5-second) dark image from each monthly anneal cycle, which, since January 2015, have been post-flashed to a background of about 60 e-. Sink pixels can affect the pixels immediately above and below them in the same column, resulting in high downstream pixels and low trails of upstream pixels. We determine typical trail lengths for sink pixels of different depths at various background levels. We create a reference image, one for each anneal cycle since January 2015, that will be used by CALACS to flag sink pixels and the adjacent affected pixels in science images.

  6. Perceptions of breath alcohol concentration (BrAC) levels among a sample of bar patrons with BrAC values of 0.08% or higher.

    Science.gov (United States)

    Martin, Ryan J; Chaney, Beth H; Cremeens-Matthews, Jennifer; Vail-Smith, Karen

    2016-09-01

    Breath alcohol concentration (BrAC) is a commonly used measure of alcohol intoxication. Because of the potential negative consequences of excessive alcohol consumption, it is important to examine how accurately intoxicated individuals can estimate their BrAC values, especially individuals over the legal BrAC driving threshold (i.e., 0.08%). To better understand perceptions of BrAC values among intoxicated individuals, this field study examined actual BrAC values and BrAC range estimates (0.08% and above, 0.02-0.07%, less than 0.02%) among a sample of bar patrons (N = 454) with BrAC levels at 0.08% or higher. Bivariate and multivariate analyses were conducted to examine the relationship between actual BrAC values and perceived BrAC levels. We also examined whether the following demographic and drinking variables were associated with underestimating BrAC in this sample: gender, age, race, college student status, plans to get home, and hazardous drinking. Results indicated that the majority (60.4%) of participants underestimated their BrAC (i.e., less than 0.08%) and lower BrAC values correlated with underestimating BrAC ranges (p < .001, 95% CI[0.2, 0.6]). Further, females (p = .001, 95% CI[1.3, 3.3]) and participants under 21 (p = .039, 95% CI = 1.0, 2.6) were significantly more likely to estimate their BrAC to be less than 0.08%, which is concerning given that young (less than 21) intoxicated females are a group at high risk for sexual assault on college campuses. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

  7. Obtaining continuous BrAC/BAC estimates in the field: A hybrid system integrating transdermal alcohol biosensor, Intellidrink smartphone app, and BrAC Estimator software tools.

    Science.gov (United States)

    Luczak, Susan E; Hawkins, Ashley L; Dai, Zheng; Wichmann, Raphael; Wang, Chunming; Rosen, I Gary

    2017-12-02

    Biosensors have been developed to measure transdermal alcohol concentration (TAC), but converting TAC into interpretable indices of blood/breath alcohol concentration (BAC/BrAC) is difficult because of variations that occur in TAC across individuals, drinking episodes, and devices. We have developed mathematical models and the BrAC Estimator software for calibrating and inverting TAC into quantifiable BrAC estimates (eBrAC). The calibration protocol to determine the individualized parameters for a specific individual wearing a specific device requires a drinking session in which BrAC and TAC measurements are obtained simultaneously. This calibration protocol was originally conducted in the laboratory with breath analyzers used to produce the BrAC data. Here we develop and test an alternative calibration protocol using drinking diary data collected in the field with the smartphone app Intellidrink to produce the BrAC calibration data. We compared BrAC Estimator software results for 11 drinking episodes collected by an expert user when using Intellidrink versus breath analyzer measurements as BrAC calibration data. Inversion phase results indicated the Intellidrink calibration protocol produced similar eBrAC curves and captured peak eBrAC to within 0.0003%, time of peak eBrAC to within 18min, and area under the eBrAC curve to within 0.025% alcohol-hours as the breath analyzer calibration protocol. This study provides evidence that drinking diary data can be used in place of breath analyzer data in the BrAC Estimator software calibration procedure, which can reduce participant and researcher burden and expand the potential software user pool beyond researchers studying participants who can drink in the laboratory. Copyright © 2017. Published by Elsevier Ltd.

  8. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  9. Ammonia treated Mo/AC catalysts for CO hydrogenation with ...

    Indian Academy of Sciences (India)

    A series of ammonia treated Mo/Activated Carbon (AC) catalysts were synthesized by wet impregnation method by nominal incorporation of 5, 10 and 15 wt% of molybdenum. The calcined catalysts (500◦C, 4 h, N₂ flow) were subjected to a stepwise ammonia treatment at temperatures from 25 up to 700◦C. This work ...

  10. Efficient method for AC transmission network expansion planning

    Energy Technology Data Exchange (ETDEWEB)

    Rahmani, M. [Electrical Engineering Department, Shahid Bahonar University of Kerman, Kerman (Iran); Faculdade de Engenharia de Ilha Solteira, UNESP - Univ Estadual Paulista, Departamento de Engenharia Eletrica, Ilha Solteira, SP (Brazil); Rashidinejad, M. [Electrical Engineering Department, Shahid Bahonar University of Kerman, Kerman (Iran); Carreno, E.M. [Centro de Engenharia, Universidade Estadual do Oeste de Parana, UNIOESTE, Foz do Iguacu - PR (Brazil); Romero, R. [Faculdade de Engenharia de Ilha Solteira, UNESP - Univ Estadual Paulista, Departamento de Engenharia Eletrica, Ilha Solteira, SP (Brazil)

    2010-09-15

    A combinatorial mathematical model in tandem with a metaheuristic technique for solving transmission network expansion planning (TNEP) using an AC model associated with reactive power planning (RPP) is presented in this paper. AC-TNEP is handled through a prior DC model while additional lines as well as VAr-plants are used as reinforcements to cope with real network requirements. The solution of the reinforcement stage can be obtained by assuming all reactive demands are supplied locally to achieve a solution for AC-TNEP and by neglecting the local reactive sources, a reactive power planning (RPP) will be managed to find the minimum required reactive power sources. Binary GA as well as a real genetic algorithm (RGA) are employed as metaheuristic optimization techniques for solving this combinatorial TNEP as well as the RPP problem. High quality results related with lower investment costs through case studies on test systems show the usefulness of the proposal when working directly with the AC model in transmission network expansion planning, instead of relaxed models. (author)

  11. Time-reversal symmetry breaking by ac field: Effect of ...

    Indian Academy of Sciences (India)

    in a quantum dot have been theoretically studied. The non-equilibrium noise has been suggested [7] as a cause of both the low temperature dephasing saturation [8] and the anomalously large ensemble averaged persistent current [9]. Here we study the effect of high-frequency ac field on the mesoscopic fluctuations of.

  12. Effect of temperature on the AC impedance of protein and ...

    Indian Academy of Sciences (India)

    guar, a galactomannan obtained from the Indian cluster bean. ∗. Author for correspondence (dppadiyan@msuniv.ac.in). Cyamposis tetragonolobus is a water soluble polysaccharide. It is an excellent stiffener and the absence of toxicity allows its use in the textile, pharmaceutical, biomedical, cosmetic and food industries ...

  13. Rethinking Rectification: AC-DC Power Supply in Package

    DEFF Research Database (Denmark)

    Pejtersen, Jens; Knott, Arnold; Jørgensen, Ivan Harald Holger

    Rectification of AC mains voltage is almost exclusively implemented with passive diode bridge rectifiers for power applications below 100 W. The diode bridge rectifier is reliable, cost effective and easy to use. But it is also lossy, nonlinear and passive. Thus reducing the power conversion...

  14. Electrostatic suppression of the Leidenfrost state using AC electric fields

    Science.gov (United States)

    Ozkan, Onur; Shahriari, Arjang; Bahadur, Vaibhav

    2017-10-01

    The formation of a vapor layer at the solid-liquid interface at high temperatures (Leidenfrost phenomenon) degrades heat transfer substantially. Application of an electric field in this vapor layer can fundamentally eliminate the Leidenfrost state by electrostatically attracting liquid towards the surface. This study analyzes the influence of AC electric fields on electrostatic suppression of the Leidenfrost state; previous studies have only utilized DC electric fields. In particular, the influence of the frequency of the AC waveform on Leidenfrost state suppression is analyzed using high speed visualization of liquid-vapor instabilities and heat transfer measurements of evaporating droplets. It is seen that the extent of suppression is reduced with increasing AC frequency. At sufficiently high frequencies, the influence of an applied voltage is completely negated, and electrostatic suppression of the Leidenfrost state can be completely eliminated. A first-order electromechanical model is used to explain the frequency-dependent reduction in the electrostatic attraction force on the Leidenfrost droplet. Overall, this work highlights the importance of AC frequency as a tool to control the extent of suppression and the boiling heat transfer rate.

  15. THERMOELECTRIC SEMICONDUCTOR ENERGY CONVERTER TO RECTIFY THE AC VOLTAGE

    Directory of Open Access Journals (Sweden)

    T. A. Ismailov

    2014-01-01

    Full Text Available The paper discusses existing means for rectifying alternating electrical signal with inherent advantages and disadvantages. The proposed design of the AC voltage, made on the basis of the thermoelectric Converter using renewable solar energy. Made a rough calculation of this device. 

  16. 78 FR 42567 - ACS Wireless, Inc.; Notice of Application

    Science.gov (United States)

    2013-07-16

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION ACS Wireless, Inc.; Notice of Application June 25, 2013. Correction In notice document 2013-15658 beginning on page 39345 in the issue of Monday, July 1, 2013, make the following correction: On page 39345...

  17. Active Power Regulation based on Droop for AC Microgrid

    DEFF Research Database (Denmark)

    Li, Chendan; Coelho, Ernane A. A.; Firoozabadi, Mehdi Savaghebi

    2015-01-01

    In this paper, two different control strategies are proposed to address the active power regulation issue in AC microgrids. The principle of power regulation in the droop controller is firstly introduced. Frequency scheduling and droop gain scheduling on top of droop control is proposed to succes...

  18. Evaluation of ac conductivity behaviour of graphite filled ...

    Indian Academy of Sciences (India)

    Composites of epoxy resin having different amounts of graphite particles have been prepared by solution casting method. Temperature dependence of dielectric constant, tan and a.c. conductivity was measured in the frequency range, 1–20 kHz, temperature range, 40–180°C for 0.99, 1.96 and 2.91 wt% graphite filled ...

  19. Calculation of AC losses in large HTS stacks and coils

    DEFF Research Database (Denmark)

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad

    2012-01-01

    In this work, we present a homogenization method to model a stack of HTS tapes under AC applied transport current or magnetic field. The idea is to find an anisotropic bulk equivalent for the stack of tapes, where the internal alternating structures of insulating, metallic, superconducting and su...

  20. The Shortest Competition Judgment Ever : AC-Treuhand II

    NARCIS (Netherlands)

    Vedder, Hans; Busscher, Rick Johannes; Herz, Martin

    2015-01-01

    Competition law judgments are notorious for their length. An extreme example is the 5134 paragraph judgment in Cement. In most cases the appeal judgment is significantly shorter, as with the 391 paragraphs in the appeal in Cement. AC-Treuhand is no exception to that rule, but it takes it to the

  1. AC losses of the 5 m BSCCO cables with shield

    Science.gov (United States)

    Ryu, K.; Ma, Y. H.; Li, Z. Y.; Hwang, S. D.; Song, H. J.

    2010-11-01

    In order to research the AC loss characteristics of a multi-layered conductor and a shield in a high temperature superconductor (HTS) cable, we prepared two short cable samples, which are the same as the 22.9 kV/50 MVA HTS-cable installed at Gochang test yard of Korea Electric Power Corporation, and attached voltage-leads to both the conductor and the shield. To investigate the effect of transport period on their AC losses, we also applied current with the same magnitude and opposite direction to the conductor and the shield from a few cycles to several minutes. The tests show that the AC loss measured from the lead attached to the shield (shield-lead) is constant regardless of transport period. But the measured loss from the lead attached to the conductor (conductor-lead) is greatly dependent on transport period. It seems to be caused by difficulty in heat transfer to the surrounding coolant due to thick insulator around the conductor. As transport period becomes longer, the conductor's temperature rises and thus the AC loss measured from the conductor-lead increases. In addition, the measured loss from the conductor-lead is 1.5 times larger than that from the shield-lead, particularly for the transport period of a few cycles.

  2. Investigations on gradient ac conductivity characteristics of bamboo ...

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science; Volume 29; Issue 2. Investigations on gradient a.c. conductivity characteristics of ... presence of moisture in bamboo, which liberated on heating. Sharp peak is observed in case of sample 4, which is inner most strip. Maximum sharp peak is observed at lowest 4 kHz frequency.

  3. [Construction of Bacillus thuringiensis labeled recombinant strain and horizontal transfer of its cry1Ac10 gene].

    Science.gov (United States)

    Zhou, Qin; Sun, Ming; Li, Lin; Yang, Zaiqing; Yu, Ziniu

    2005-01-01

    A recombinant plasmid pBMBZGC10 was obtained by the ligation of gfp-cry1Ac10 fusion gene and vector plasmid pAD4412, which was then introduced by gene pulser into acrystalliferous strain CryB, and a recombinant strain CryB(pBMBZGC10) was obtained. Different fermentative solutions of recombinant strain were used for multi-spraying on Brassica pekinesis, Ipomoea aquatica and Lycopersicon esculentum leaves. The results of fluorescent detection and PCR amplification revealed that cry1Ac10 gene did not transfer into indigenous bacteria, actinomyces and fungi in test soil, and could not be detected in roots, stems and leaves of test plants.

  4. Regulation of P450-mediated permethrin resistance inCulex quinquefasciatusby the GPCR/Gαs/AC/cAMP/PKA signaling cascade.

    Science.gov (United States)

    Li, Ting; Liu, Nannan

    2017-12-01

    This study explores the role of G-protein-coupled receptor-intracellular signaling in the development of P450-mediated insecticide resistance in mosquitoes, Culex quinquefasciatus , focusing on the essential function of the GPCRs and their downstream effectors of Gs alpha subunit protein (Gαs) and adenylyl cyclase (ACs) in P450-mediated insecticide resistance of Culex mosquitoes. Our RNAi-mediated functional study showed that knockdown of Gαs caused the decreased expression of the downstream effectors of ACs and PKAs in the GPCR signaling pathway and resistance P450 genes, whereas knockdown of ACs decreased the expression of PKAs and resistance P450 genes. Knockdown of either Gαs or ACs resulted in an increased susceptibility of mosquitoes to permethrin. These results add significantly to our understanding of the molecular basis of resistance P450 gene regulation through GPCR/Gαs/AC/cAMP-PKA signaling pathways in the insecticide resistance of mosquitoes. The temporal and spatial dynamic analyses of GPCRs, Gαs, ACs, PKAs, and P450s in two insecticide resistant mosquito strains revealed that all the GPCR signaling pathway components tested, namely GPCRs, Gαs, ACs and PKAs, were most highly expressed in the brain for both resistant strains, suggesting the role played by these genes in signaling transduction and regulation. The resistance P450 genes were mainly expressed in the brain, midgut and malpighian tubules (MTs), suggesting their critical function in the central nervous system and importance for detoxification. The temporal dynamics analysis for the gene expression showed a diverse expression profile during mosquito development, indicating their initially functional importance in response to exposure to insecticides during their life stages.

  5. Autographa californica multiple nucleopolyhedrovirus ac75 is required for egress of nucleocapsids from the nucleus and formation of de novo intranuclear membrane microvesicles.

    Directory of Open Access Journals (Sweden)

    Ya-Jun Guo

    Full Text Available In this study, Autographa californica multiple nucleopolyhedrovirus ac75 was functionally characterized. Ac75 has homologs in all sequenced genomes of alphabaculoviruses, betabaculoviruses, and gammabaculoviruses. It was determined to encode a protein that is associated with the nucleocapsid of budded virus and with both envelope and nucleocapsids of occlusion-derived virus. Sf9 cells transfected by an ac75-knockout bacmid resulted in the infection being restricted to single cells. No budded virus were detected although viral DNA replication and late gene expression were unaffected. Electron microscopy revealed that the virogenic stroma, nucleocapsids and occlusion bodies appeared normal in the cells transfected by an ac75-knockout bacmid. However, the nucleocapsids were unenveloped, the occlusion bodies did not contain any virions or nucleocapsids, and no nucleocapsids were found outside the nucleus or spanning the nuclear membrane. In addition, de novo intranuclear membrane microvesicles that are the precursor of occlusion-derived virus envelopes were absent in the nuclei of transfected cells. Confocal microscopy showed that AC75 protein appeared in the cytoplasm as early as 6 hours post infection. It localized to the ring zone at the periphery of the nucleus from 15 to 24 hours post infection and demonstrated light blocky cloud-like distribution in the center of the nucleus. AC75 was found to co-immunoprecipitate with BV and ODV associated envelope protein ODV-E25. The data from this study suggest that ac75 is essential for induction of the intranuclear membrane microvesicles, it appears to be required for the intranuclear envelopment of nucleocapsids, and is also essential for egress of nucleocapsids from the nuclei, in infected cells.

  6. Aragonite coating solutions (ACS) based on artificial seawater

    Energy Technology Data Exchange (ETDEWEB)

    Tas, A. Cuneyt, E-mail: c_tas@hotmail.com

    2015-03-01

    Graphical abstract: - Highlights: • Developed completely inorganic solutions for the deposition of monolayers of aragonite spherules (or ooids). • Solutions mimicked the artificial seawater. • Biomimetic crystallization was performed at the tropical sea surface temperature of 30 °C. - Abstract: Aragonite (CaCO{sub 3}, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  7. Flame spread over inclined electrical wires with AC electric fields

    KAUST Repository

    Lim, Seung J.

    2017-07-21

    Flame spread over polyethylene-insulated electrical wires was studied experimentally with applied alternating current (AC) by varying the inclination angle (θ), applied voltage (VAC), and frequency (fAC). For the baseline case with no electric field applied, the flame spread rate and the flame width of downwardly spreading flames (DSFs) decreased from the horizontal case for −20° ≤ θ < 0° and maintained near constant values for −90° ≤ θ < −20°, while the flame spread rate increased appreciably as the inclination angle of upwardly spreading flames (USFs) increased. When an AC electric field was applied, the behavior of flame spread rate in DSFs (USFs) could be classified into two (three) sub-regimes characterized by various functional dependences on VAC, fAC, and θ. In nearly all cases of DSFs, a globular molten polyethylene formed ahead of the spreading flame edge, occasionally dripping onto the ground. In these cases, an effective flame spread rate was defined to represent the burning rate by measuring the mass loss due to dripping. This effective spread rate was independent of AC frequency, while it decreased linearly with voltage and was independent of the inclination angle. In DSFs, when excessively high voltage and frequency were applied, the dripping led to flame extinction during propagation and the extinction frequency correlated well with applied voltage. In USFs, when high voltage and frequency were applied, multiple globular molten PEs formed at several locations, leading to ejections of multiple small flame segments from the main flame, thereby reducing the flame spread rate, which could be attributed to the electrospray phenomenon.

  8. Achievement report for fiscal 1999 on New Sunshine Program. Frontier research and development of basic superconductive AC power generation equipment; 1999 nendo koryu chodendo denryoku kiki kiban sendo kenkyu kaihatsu

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2000-03-01

    As part of the New Sunshine Program of the Agency of Industrial Science and Technology, a 2-year survey and research is conducted beginning in 1998 on the effect of the introduction of superconductive power equipment for the facilitation of the progress of research and development of basic power equipment which utilizes AC (alternating current) superconductivity. Frontier research and development has been started of basic AC superconductive power equipment for clarifying the tasks to solve in the development effort and for preparing an efficient research and development plan. This fiscal year's endeavor covers the survey of the effect of the introduction of superconductive power equipment in addition to the preparation of a basic plan for the research and development of basic AC superconductive power equipment for fiscal 2000 and afterward, continued survey of research and development trends in and outside Japan for the review of the result achieved in the preceding fiscal year, development of AC equipment element technologies utilizing conduit type semiconductors as a basic study for the embodiment of AC superconductive equipment, and a study for elucidating the mechanism of resistance generated in a superconductive current limiter. Furthermore, papers on the superconduction technology released so far are investigated, and technology development trends and efficient research techniques are put together into a technological information database. (NEDO)

  9. Sky Surveys

    Science.gov (United States)

    Djorgovski, S. George; Mahabal, Ashish; Drake, Andrew; Graham, Matthew; Donalek, Ciro

    Sky surveys represent a fundamental data basis for astronomy. We usethem to map in a systematic way the universe and its constituents andto discover new types of objects or phenomena. We review the subject,with an emphasis on the wide-field, imaging surveys, placing them ina broader scientific and historical context. Surveys are now the largestdata generators in astronomy, propelled by the advances in informationand computation technology, and have transformed the ways in whichastronomy is done. This trend is bound to continue, especially with thenew generation of synoptic sky surveys that cover wide areas of the skyrepeatedly and open a new time domain of discovery. We describe thevariety and the general properties of surveys, illustrated by a number ofexamples, the ways in which they may be quantified and compared, andoffer some figures of merit that can be used to compare their scientificdiscovery potential. Surveys enable a very wide range of science, and that isperhaps their key unifying characteristic. As new domains of the observableparameter space open up thanks to the advances in technology, surveys areoften the initial step in their exploration. Some science can be done withthe survey data alone (or a combination of data from different surveys),and some require a targeted follow-up of potentially interesting sourcesselected from surveys. Surveys can be used to generate large, statisticalsamples of objects that can be studied as populations or as tracers of largerstructures to which they belong. They can be also used to discover orgenerate samples of rare or unusual objects and may lead to discoveriesof some previously unknown types. We discuss a general framework ofparameter spaces that can be used for an assessment and comparison ofdifferent surveys and the strategies for their scientific exploration. As we aremoving into the Petascale regime and beyond, an effective processing andscientific exploitation of such large data sets and data streams pose

  10. Young Adult Migration: 2007-2009 to 2010-2012. American Community Survey Reports. ACS-31

    Science.gov (United States)

    Benetsky, Megan J.; Burd, Charlynn A.; Rapino, Melanie A.

    2015-01-01

    Young adults in the United States have the highest rate of migration compared with other age groups. The most common reasons for moving among all ages are job, housing, or family related. Many of these moves are made between the ages of 18 to 34, an age group marked by various life course transitions associated with moving. These include getting a…

  11. The ACS Nearby Galaxies Survey Treasury: Recovering Spatially Resolved Recent Star Formation Histories

    Science.gov (United States)

    Skillman, Evan D.; ANGST Team

    2006-12-01

    Because the supergiant phase of stellar evolution is short relative to the main sequence phase, it is possible to use them as chronometers to reconstruct the spatially resolved recent star formation histories of galaxies (cf., Dohm-Palmer et al. 1997, AJ, 114, 2514). Under the aegis of a cycle 14 HST program to observe a sample of M81 group dwarf galaxies (GO-HST-10605), we have used the star formation history codes of Dolphin (2002, MNRAS, 332, 91) to re-engineer the programs used in Dohm-Palmer et al. and produced automated codes with a wide range of applicability. The ANGST database will allow us our first opportunity to make the transition from analyzing prototypes to analyzing a statistically meaningful sample of galaxies. This promises real progress in quantifying the role of feedback in the evolution of galaxies. This work is supported by NASA grants HST-GO-10605.01-A and HST-GO-10915.06-A

  12. Bias-voltage-controlled ac and dc magnetotransport phenomena in hybrid structures

    Energy Technology Data Exchange (ETDEWEB)

    Volkov, N.V., E-mail: volk@iph.krasn.ru [Kirensky Institute of Physics, Russian Academy of Sciences, Siberian Branch, Krasnoyarsk 660036 (Russian Federation); Siberian Federal University, Krasnoyarsk 660041 (Russian Federation); Tarasov, A.S. [Kirensky Institute of Physics, Russian Academy of Sciences, Siberian Branch, Krasnoyarsk 660036 (Russian Federation); Siberian Federal University, Krasnoyarsk 660041 (Russian Federation); Smolyakov, D.A. [Kirensky Institute of Physics, Russian Academy of Sciences, Siberian Branch, Krasnoyarsk 660036 (Russian Federation); Varnakov, S.N. [Kirensky Institute of Physics, Russian Academy of Sciences, Siberian Branch, Krasnoyarsk 660036 (Russian Federation); Siberian State Aerospace University, Krasnoyarsk 660014 (Russian Federation); Ovchinnikov, S.G. [Kirensky Institute of Physics, Russian Academy of Sciences, Siberian Branch, Krasnoyarsk 660036 (Russian Federation); Siberian Federal University, Krasnoyarsk 660041 (Russian Federation)

    2015-06-01

    We report some ac and dc magnetotransport phenomena in silicon-based hybrid structures. The giant impedance change under an applied magnetic field has been experimentally found in the metal/insulator/semiconductor (MIS) diode with the Schottky barrier based on the Fe/SiO{sub 2}/p-Si and Fe/SiO{sub 2}/n-Si structures. The maximum effect is found to observe at temperatures of 10–30 K in the frequency range 10 Hz–1 MHz. Below 1 kHz the magnetoresistance can be controlled in a wide range by applying a bias to the device. A photoinduced dc magnetoresistance of over 10{sup 4}% has been found in the Fe/SiO{sub 2}/p-Si back-to-back Schottky diode. The observed magnetic-field-dependent effects are caused by the interface states localized in the insula-tor/semiconductor interface. - Highlights: • We report ac and dc magnetotransport phenomena in silicon-based hybrid structures. • The giant magnetoimpedance was experimentally found in the Fe/SiO{sub 2}/n-Si structure. • The dc bias voltage influence of the magnetoimpedance was revealed. • A photoinduced dc magnetoresistance was found in the Fe/SiO{sub 2}/p-Si structure. • The observed magnetic-field-dependent effects are caused by the interface states.

  13. Hot electrons injection in carbon nanotubes under the influence of quasi-static ac-field

    Science.gov (United States)

    Amekpewu, M.; Mensah, S. Y.; Musah, R.; Mensah, N. G.; Abukari, S. S.; Dompreh, K. A.

    2016-07-01

    The theory of hot electrons injection in carbon nanotubes (CNTs) where both dc electric field (Ez), and a quasi-static ac field exist simultaneously (i.e. when the frequency ω of ac field is much less than the scattering frequency v (ω ⪡ v or ωτ ⪡ 1, v =τ-1) where τ is relaxation time) is studied. The investigation is done theoretically by solving semi-classical Boltzmann transport equation with and without the presence of the hot electrons source to derive the current densities. Plots of the normalized current density versus dc field (Ez) applied along the axis of the CNTs in the presence and absence of hot electrons reveal ohmic conductivity initially and finally negative differential conductivity (NDC) provided ωτ ⪡ 1 (i.e. quasi- static case). With strong enough axial injection of the hot electrons, there is a switch from NDC to positive differential conductivity (PDC) about Ez ≥ 75 kV / cm and Ez ≥ 140 kV / cm for a zigzag CNT and an armchair CNT respectively. Thus, the most important tough problem for NDC region which is the space charge instabilities can be suppressed due to the switch from the NDC behaviour to the PDC behaviour predicting a potential generation of terahertz radiations whose applications are relevance in current-day technology, industry, and research.

  14. Microwave a.c. conductivity of domain walls in ferroelectric thin films

    Science.gov (United States)

    Tselev, Alexander; Yu, Pu; Cao, Ye; Dedon, Liv R.; Martin, Lane W.; Kalinin, Sergei V.; Maksymovych, Petro

    2016-01-01

    Ferroelectric domain walls are of great interest as elementary building blocks for future electronic devices due to their intrinsic few-nanometre width, multifunctional properties and field-controlled topology. To realize the electronic functions, domain walls are required to be electrically conducting and addressable non-destructively. However, these properties have been elusive because conducting walls have to be electrically charged, which makes them unstable and uncommon in ferroelectric materials. Here we reveal that spontaneous and recorded domain walls in thin films of lead zirconate and bismuth ferrite exhibit large conductance at microwave frequencies despite being insulating at d.c. We explain this effect by morphological roughening of the walls and local charges induced by disorder with the overall charge neutrality. a.c. conduction is immune to large contact resistance enabling completely non-destructive walls read-out. This demonstrates a technological potential for harnessing a.c. conduction for oxide electronics and other materials with poor d.c. conduction, particularly at the nanoscale. PMID:27240997

  15. A new hobo, Ac, Tam3 transposable element, hopper, from Bactrocera dorsalis is distantly related to hobo and Ac

    Science.gov (United States)

    A new transposable element from the hobo, Ac, TamJ transposon family was isolated as a genomic clone from the oriental fruit fly, BactrOCi!ro dorsalis. It is approximately 3.1 kb in length with 19-bp inverted terminal repeat sequences having a single mismatch.Though sharing several amino acid sequen...

  16. A Case Study of Wind-PV-Thermal-Bundled AC/DC Power Transmission from a Weak AC Network

    Science.gov (United States)

    Xiao, H. W.; Du, W. J.; Wang, H. F.; Song, Y. T.; Wang, Q.; Ding, J.; Chen, D. Z.; Wei, W.

    2017-05-01

    Wind power generation and photovoltaic (PV) power generation bundled with the support by conventional thermal generation enables the generation controllable and more suitable for being sent over to remote load centre which are beneficial for the stability of weak sending end systems. Meanwhile, HVDC for long-distance power transmission is of many significant technique advantages. Hence the effects of wind-PV-thermal-bundled power transmission by AC/DC on power system have become an actively pursued research subject recently. Firstly, this paper introduces the technical merits and difficulties of wind-photovoltaic-thermal bundled power transmission by AC/DC systems in terms of meeting the requirement of large-scale renewable power transmission. Secondly, a system model which contains a weak wind-PV-thermal-bundled sending end system and a receiving end system in together with a parallel AC/DC interconnection transmission system is established. Finally, the significant impacts of several factors which includes the power transmission ratio between the DC and AC line, the distance between the sending end system and receiving end system, the penetration rate of wind power and the sending end system structure on system stability are studied.

  17. Out-of-Equilibrium Fluctuation-Dissipation Relations Verified by the Electrical and Thermoelectrical AC-Conductances in a Quantum Dot

    Science.gov (United States)

    Crépieux, Adeline

    2017-09-01

    The electrical and heat currents flowing through a quantum dot are calculated in the presence of a time-modulated gate voltage with the help of the out-of-equilibrium Green function technique. From the first harmonics of the currents, we extract the electrical and thermoelectrical trans-admittances and ac-conductances. Next, by a careful comparison of the ac-conductances with the finite-frequency electrical and mixed electrical-heat noises, we establish the fluctuation-dissipation relations linking these quantities, which are thus generalized out-of-equilibrium for a quantum system. It is shown that the electrical ac-conductance associated to the displacement current is directly linked to the electrical noise summed over reservoirs, whereas the relation between the thermoelectrical ac-conductance and the mixed noise contains an additional term proportional to the energy step that the electrons must overcome when traveling through the junction. A numerical study reveals however that a fluctuation-dissipation relation involving a single reservoir applies for both electrical and thermoelectrical ac-conductances when the frequency dominates over the other characteristic energies.

  18. Large amplitude Fourier transformed ac voltammetry at a rotating disc electrode: a versatile technique for covering Levich and flow rate insensitive regimes in a single experiment.

    Science.gov (United States)

    Bano, Kiran; Kennedy, Gareth F; Zhang, Jie; Bond, Alan M

    2012-04-14

    The theory for large amplitude Fourier transformed ac voltammetry at a rotating disc electrode is described. Resolution of time domain data into dc and ac harmonic components reveals that the mass transport for the dc component is controlled by convective-diffusion, while the background free higher order harmonic components are flow rate insensitive and mainly governed by linear diffusion. Thus, remarkable versatility is available; Levich behaviour of the dc component limiting current provides diffusion coefficient values and access to higher harmonics allows fast electrode kinetics to be probed. Two series of experiments (dc and ac voltammetry) have been required to extract these parameters; here large amplitude ac voltammetry with RDE methodology is used to demonstrate that kinetics and diffusion coefficient information can be extracted from a single experiment. To demonstrate the power of this approach, theoretical and experimental comparisons of data obtained for the reversible [Ru(NH(3))(6)](3+/2+) and quasi-reversible [Fe(CN)(6)](3-/4-) electron transfer processes are presented over a wide range of electrode rotation rates and with different concentrations and electrode materials. Excellent agreement of experimental and simulated data is achieved, which allows parameters such as electron transfer rate, diffusion coefficient, uncompensated resistance and others to be determined using a strategically applied approach that takes into account the different levels of sensitivity of each parameter to the dc or the ac harmonic.

  19. Comparative Analysis of Voltage Control in Battery Power Converters for Inverter-Based AC Microgrids

    National Research Council Canada - National Science Library

    Chae, Woo-Kyu; Won, Jong-Nam; Lee, Hak-Ju; Kim, Jae-Eon; Kim, Jaehong

    2016-01-01

    .... The energy storage system power converters generally form the local AC bus voltage. This grid-forming operation requires fast and robust voltage control to properly maintain a stable energy flow and high power quality in the local AC bus...

  20. UARS PEM Level 2 VMAG AC V001 (UARPE2VMAGAC) at GES DISC

    Data.gov (United States)

    National Aeronautics and Space Administration — The Particle Environment Monitor (PEM) level 2 Vector Magnetometer (VMAG) AC daily product contains the Vector Magnetic Field AC component. PEM was flown on the UARS...

  1. Recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices.

    Science.gov (United States)

    Sasaki, Naoki

    2012-01-01

    AC electrokinetics is a generic term that refers to an induced motion of particles and fluids under nonuniform AC electric fields. The AC electric fields are formed by application of AC voltages to microelectrodes, which can be easily integrated into microfluidic devices by standard microfabrication techniques. Moreover, the magnitude of the motion is large enough to control the mass transfer on the devices. These advantages are attractive for biomolecular analysis on the microfluidic devices, in which the characteristics of small space and microfluidics have been mainly employed. In this review, I describe recent applications of AC electrokinetics in biomolecular analysis on microfluidic devices. The applications include fluid pumping and mixing by AC electrokinetic flow, and manipulation of biomolecules such as DNA and proteins by various AC electrokinetic techniques. Future prospects for highly functional biomolecular analysis on microfluidic devices with the aid of AC electrokinetics are also discussed.

  2. Data of evolutionary structure change: 1AC6A-1TVDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AC6A-1TVDA 1AC6 1TVD A A DSVTQTEGQVALSEEDFLTIHCNYSASG-YPALFWYVQYPGEGPQFLFRASRDKEK...N--KLTFGAGTKLTIKP DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPD-----YSFQF---VFYGDDSRSEGADFT...RFSVKHILTQKAFHLVISPVRTEDSATYYCAFTLPPPTDKLIFGKGTRVTVEP EEE EEEEEE EEEEEEEEEE - EEEEEEE EEE... 1TVD A 1TVDA

  3. Data of evolutionary structure change: 1AC6B-1TVDA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AC6B-1TVDA 1AC6 1TVD B A DSVTQTEGQVALSEEDFLTIHCNYSASG-YPALFWYVQYPGEGPQFLFRASRDKEK...N--KLTFGAGTKLTIKP DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPD-----YSFQF---VFYGDDSRSEGADFT...RFSVKHILTQKAFHLVISPVRTEDSATYYCAFTLPPPTDKLIFGKGTRVTVEP EEE EEE EEEEEEEE - EEEEEEE EEE EEEEE-----------... 1TVD A 1TVDA

  4. Pengembangan Sistem Otomatisasi AC dan Lampu Menggunakan Fuzzy dan Raspberry Pi

    Directory of Open Access Journals (Sweden)

    Rudy Ariyanto

    2017-11-01

    Full Text Available Otomatisasi AC dan lampu dilakukan untuk menghemat energi yang digunakan pada kehidupan sehari-hari. Dalam pengembangan otomatisasi AC dan lampu perlu menerapkan sebuah perangkat yang memiliki fungsi maksimal dengan harga yang minimal. Raspberry Pi merupakan perangkat atau modul dengan harga rendah yang mampu melakukan komunikasi wireless tanpa bantuan modul lain. Dalam pengembangan otomatisasi AC dan lampu juga diperlukan sebuah metode yang mampu melakukan kontrol terhadap nyala AC dan lampu. Penerapan metode fuzzy dapat dilakukan untuk menghimpun informasi keadaan ruang yang didapat dari sensor untuk menentukan nyala AC dan lampu secara otomatis. Oleh sebab itu pada penelitian ini mengusulkan pengembangan otomatisasi AC dan lampu menggunakan Raspberry Pi dan Fuzzy. Otomatisasi AC dan lampu menggunakan Raspberry Pi yang menerapkan metode Fuzzy dapat menghemat energi hingga 59,87% dalam hal lama waktu nyala AC dan 57,47% untuk lumenasi lampu

  5. A survey of propofol injection practices reveals poor knowledge of ...

    African Journals Online (AJOL)

    204–11. 3. Arduino MJ, Bland LA, McAllister SK, et al. Microbial growth and endotoxin production in the intravenous anesthetic propofol. Infect Control Hosp Epidemiol. 1991;12(9):535–9. https://doi. org/10.2307/30145228. 4. Aydin N, Gultekin ...

  6. A survey of propofol injection practices reveals poor knowledge of ...

    African Journals Online (AJOL)

    Background: Propofol lipid emulsion supports bacterial growth and various outbreaks of postoperative infection are attributed to extrinsic contamination. This study's objectives were to ascertain propofol administration practices among South African anaesthesiologists and to determine the influence of the 2014 South ...

  7. Survey Data

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Cleaned and QCd data for the Fishing Effort Survey. Questions on fishing and other out are asked on weather and outdoor activity, including fishing trips. Used for...

  8. Surveying Humaness

    DEFF Research Database (Denmark)

    Markussen, Randi; Gad, Christopher

    and development of a large collection of biological and psychological symptoms and psycho-social problems. However, the surveys say nothing about how the information will be of use to the people who answer the procedure or how this scientific intervention will be put to use more specifically within the public......Christopher Gad. Ph.d. Dept. of Information and Media Studies Randi Markussen. Associate Professor, Dept. of Information and Media Studies. rmark@imv.au.dk   Abstract:   Surveying humanness -politics of care improvement   For various reasons we both were subjected to a specific survey procedure...... carried out in a Danish county in order to improve treatment of people who have suffered from long-term illnesses. The surveys concern not only feed back on how people experience their present and past interaction with the social services and health care system; they also ask people to indicate the state...

  9. Surveying Humaness

    DEFF Research Database (Denmark)

    Markussen, Randi; Gad, Christopher

    carried out in a Danish county in order to improve treatment of people who have suffered from long-term illnesses. The surveys concern not only feed back on how people experience their present and past interaction with the social services and health care system; they also ask people to indicate the state...... and development of a large collection of biological and psychological symptoms and psycho-social problems. However, the surveys say nothing about how the information will be of use to the people who answer the procedure or how this scientific intervention will be put to use more specifically within the public......Christopher Gad. Ph.d. Dept. of Information and Media Studies Randi Markussen. Associate Professor, Dept. of Information and Media Studies. rmark@imv.au.dk   Abstract:   Surveying humanness -politics of care improvement   For various reasons we both were subjected to a specific survey procedure...

  10. 21 CFR 880.5510 - Non-AC-powered patient lift.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Non-AC-powered patient lift. 880.5510 Section 880... Devices § 880.5510 Non-AC-powered patient lift. (a) Identification. A non-AC-powered patient lift is a hydraulic, battery, or mechanically powered device, either fixed or mobile, used to lift and transport a...

  11. Investigation and comparison of AC losses on stabilizer-free and copper stabilizer HTS tapes

    Science.gov (United States)

    Shen, Boyang; Li, Jing; Geng, Jianzhao; Fu, Lin; Zhang, Xiuchang; Li, Chao; Zhang, Heng; Dong, Qihuan; Ma, Jun; Coombs, T. A.

    2017-10-01

    This paper presents the measurement and simulation of Alternating Current (AC) losses on the Stabilizer-free and Copper Stabilizer High Temperature Superconducting (HTS) Tapes: SuperPower SF12100 and SCS12050. The AC loss measurement utilised electrical method to obtain overall losses with AC transport currents. The 2D H-formulation by COMSOL Multiphysics has been used to simulate the real geometry and multi-layer HTS tapes. Ferromagnetic AC losses of substrate have been assumed to be ignored as the substrates of SF12100 and SCS12050 are non-magnetic. Hysteresis AC losses in the superconducting layer, and eddy-current AC losses in copper stabilizer, silver overlayer and substrate were concerned in this investigation. The measured AC losses were compared to the AC losses from simulation, with 3 cases of different AC frequency 10, 100, and 1000 Hz. The eddy-current AC losses of copper stabilizer at frequency 1000 Hz were determined from both experiment and simulation. The estimation of AC losses with frequency at 10,000 Hz was also carried out using simulation method. Finally, the frequency dependence of AC losses from Stabilizer-free Tape and Copper Stabilizer Tape were compared and analysed.

  12. C/NOFS Observations of AC Electric Field Fields Associated with Equatorial Spread-F

    Science.gov (United States)

    Pfaff, R.; Liebrecht, C.

    2009-01-01

    The Vector Electric Field Investigation (VEFI) on the C/NOFS equatorial satellite provides a unique data set in which to acquire detailed knowledge of irregularities associated with the equatorial ionosphere and in particular with spread-F depletions. We present vector AC electric field observations, primarily gathered within the ELF band (1 Hz to 250 Hz) on C/NOFS that address a variety of key questions regarding how plasma irregularities, from meter to kilometer scales, are created and evolve. The data will be used to explore the anisotropy/isotropy of the waves, their wavelength and phase velocity, as well as their spectral distributions. When analyzed in conjunction with the driving DC electric fields and detailed plasma number density measurements, the combined data reveal important information concerning the instability mechanisms themselves. We also present high resolution, vector measurements of intense lower hybrid waves that have been detected on numerous occasions by the VEFI burst memory VLF electric field channels.

  13. Field measurements of AC- and DC-energized silicone elastomer coated outdoor insulators

    Energy Technology Data Exchange (ETDEWEB)

    Soerqvist, T.; Vlastos, A.E. [Chalmers Univ. of Technology, Goeteborg (Sweden). Dept. of High Voltage Engineering

    1995-12-01

    The paper presents a comparison between the leakage currents of bare porcelain insulators and porcelain insulators coated with two types of room temperature vulcanizing (RTV) silicone rubbers. The data presented is based on field measurements of both AC- and DC-energized insulators during salt-storm conditions. A study of the surfaces of the two coatings reveals that one is less hydrophobic than the other. However, there are no large differences in the leakage currents between the insulators coated with the two types of RTV. The leakage current of the RTV-coated insulators remains very low compared to that of the uncoated porcelain insulators under salt-storm conditions. Moreover, the leakage current of the RTV-coated porcelain insulators is comparable to that of the silicone rubber (SIR) insulators which are also studied under the same conditions. 3 refs, 14 figs, 1 tab

  14. Can commercial ferrofluids be exploited in AC magnetic hyperthermia treatment to address diverse biomedical aspects?

    Science.gov (United States)

    Angelakeris, M.; Li, Zi-An; Sakellari, D.; Simeonidis, K.; Spasova, M.; Farle, M.

    2014-07-01

    Multifunctional magnetic nanoparticles are considered as promising candidates for various applications combining diagnosis, imaging and therapy. In the present work, we elaborate on the commercial colloidal solution "FluidMAG" (from Chemicell GmbH) as a possible candidate for magnetic hyperthermia application. The current product is a dispersion of magnetite nanoparticles employed for purification or separation of biotinylated biomolecules from different sources (e.g. blood). Transmission Electron Microscopy showed that the NPs have a spherical shape with mean diameter of 12.3 nm (± 20%), and SQUID magnetometry revealed their superparamagnetic character. Our promising results of the AC hyperthermia efficiency of "FluidMAG" suggest that with the appropriate manipulation it can also be exploited as magnetic hyperthermia agent.

  15. Can commercial ferrofluids be exploited in AC magnetic hyperthermia treatment to address diverse biomedical aspects?

    Directory of Open Access Journals (Sweden)

    Angelakeris M.

    2014-07-01

    Full Text Available Multifunctional magnetic nanoparticles are considered as promising candidates for various applications combining diagnosis, imaging and therapy. In the present work, we elaborate on the commercial colloidal solution “FluidMAG” (from Chemicell GmbH as a possible candidate for magnetic hyperthermia application. The current product is a dispersion of magnetite nanoparticles employed for purification or separation of biotinylated biomolecules from different sources (e.g. blood. Transmission Electron Microscopy showed that the NPs have a spherical shape with mean diameter of 12.3 nm (± 20%, and SQUID magnetometry revealed their superparamagnetic character. Our promising results of the AC hyperthermia efficiency of “FluidMAG” suggest that with the appropriate manipulation it can also be exploited as magnetic hyperthermia agent.

  16. Ac magnetic susceptibility study of in vivo nanoparticle biodistribution

    Energy Technology Data Exchange (ETDEWEB)

    Gutierrez, L; Veintemillas-Verdaguer, S; Serna, C J; Morales, M P [Instituto de Ciencia de Materiales de Madrid, ICMM-CSIC, Sor Juana Ines de la Cruz 3, Cantoblanco 28049, Madrid (Spain); MejIas, R; Barber, D F [Centro Nacional de BiotecnologIa, CNB-CSIC, Darwin 3, Cantoblanco 28049, Madrid (Spain); Lazaro, F J, E-mail: lucia@icmm.csic.es [Departamento de Ciencia y Tecnologia de Materiales y Fluidos, Universidad de Zaragoza, Maria de Luna 3, 50018, Zaragoza (Spain)

    2011-06-29

    We analysed magnetic nanoparticle biodistribution, before and after cytokine conjugation, in a mouse model by ac susceptibility measurements of the corresponding resected tissues. Mice received repeated intravenous injections of nanoparticle suspension for two weeks and they were euthanized 1 h after the last injection. In general, only 10% of the total injected nanoparticles after multiple exposures were found in tissues. The rest of the particles may probably be metabolized or excreted by the organism. Our findings indicate that the adsorption of interferon to DMSA-coated magnetic nanoparticles changes their biodistribution, reducing the presence of nanoparticles in lungs and therefore their possible toxicity. The specific targeting of the particles to tumour tissues by the use of an external magnetic field has also been studied. Magnetic nanoparticles were observed by transmission electron microscopy in the targeted tissue and quantified by ac magnetic susceptibility.

  17. TINGKAT KEPUASAN PENGGUNA WEBSITE www.unud.ac.id

    Directory of Open Access Journals (Sweden)

    Rr.Sanita Eling Cipta Nesa

    2015-10-01

    Full Text Available Popularitas link suatu situs website dapat ditingkatkan semaksimal mungkin dengan menganalisis dan mengevaluasi tingkat kepuasan penggunanya. Penelitian ini bertujuan untuk menganalisis perkembangan situs website Universitas Udayana (UNUD sejauh mana tingkat kepuasan pengguna website www.unud.ac.id. Analisis tingkat kepuasan pengguna menggunakan kuesioner dengan metode variabel pernyataan End-User Computing Satisfaction (EUCS dan diukur dengan metode Kano. Customer Satisfaction Index (CSI digunakan untuk mengukuran skala tingkat kepuasan pengguna website. Analisis tingkat kepuasan pengguna website UNUD dengan metode Kano menyatakan bahwa sebagian besar atribut website berada pada kategori indifferent, namun atribut Homepages dan Accuracy pada kategori Must-be, dan Atribut Hits pada kategori Reverse. Pengolahan data CSI didapatkan nilai sebesar 69,23% sehingga konsumen dapat dikatakan “PUAS” dengan fasilitas dan kelengkapan isi yang disediakan website www.unud.ac.id.

  18. Measured losses in superconductor magnets for 60-Hertz ac operation.

    Science.gov (United States)

    Hamlet, I. L.; Kilgore, R. A.

    1971-01-01

    Results of an experimental study of electrical losses in superconductor magnets. Preliminary 60-Hz ac loss data are presented for coils constructed of Nb3Sn ribbon, Nb-Ti cable, and multifilament Nb-Ti. Losses have been measured for different size coils up to approximately 20 cm in diameter. Of the conductor types tested, Nb3Sn ribbon has the lowest losses for ac operation. In Nb3Sn-ribbon coils of different sizes, the loss per unit length of conductor is shown to decrease with a decrease in the rate of change of current and to increase, in general, with increase in coil size. An important aspect of the study is the high degree of repeatability of the data.

  19. Variable speed ac motor - A continuous pole printing technology

    Science.gov (United States)

    Morash, R. T.; Barber, R. J.; Roesel, J. F., Jr.

    A description is given of a simply constructed, brushless, commutatorless ac motor that offers significant improvements over conventional induction or synchronous motors. The design makes it possible for the speed to be precisely and readily varied and for the motor to operate with ac currents of any reasonable frequency over a wide range of voltages. In essence, it is a synchronous motor that can operate at speeds well above and below 'normal speed' synchronous conditions. When operated as a constant speed machine, its efficiency is such that it holds promise for reducing electrical energy consumption in the U.S. by 3 to 4 percent. Underlying the design is a magnetizable layer on the surface of the rotor that can be continuously remagnetized while the machine is in operation. A 25-hp motor developed for use with high inertia loads is discussed.

  20. Photovoltaic Inverter Controllers Seeking AC Optimal Power Flow Solutions

    Energy Technology Data Exchange (ETDEWEB)

    Dall' Anese, Emiliano; Dhople, Sairaj V.; Giannakis, Georgios B.

    2016-07-01

    This paper considers future distribution networks featuring inverter-interfaced photovoltaic (PV) systems, and addresses the synthesis of feedback controllers that seek real- and reactive-power inverter setpoints corresponding to AC optimal power flow (OPF) solutions. The objective is to bridge the temporal gap between long-term system optimization and real-time inverter control, and enable seamless PV-owner participation without compromising system efficiency and stability. The design of the controllers is grounded on a dual ..epsilon..-subgradient method, while semidefinite programming relaxations are advocated to bypass the non-convexity of AC OPF formulations. Global convergence of inverter output powers is analytically established for diminishing stepsize rules for cases where: i) computational limits dictate asynchronous updates of the controller signals, and ii) inverter reference inputs may be updated at a faster rate than the power-output settling time.

  1. On-Chip AC self-test controller

    Science.gov (United States)

    Flanagan, John D [Rhinebeck, NY; Herring, Jay R [Poughkeepsie, NY; Lo, Tin-Chee [Fishkill, NY

    2009-09-29

    A system for performing AC self-test on an integrated circuit that includes a system clock for normal operation is provided. The system includes the system clock, self-test circuitry, a first and second test register to capture and launch test data in response to a sequence of data pulses, and a logic circuit to be tested. The self-test circuitry includes an AC self-test controller and a clock splitter. The clock splitter generates the sequence of data pulses including a long data capture pulse followed by an at speed data launch pulse and an at speed data capture pulse followed by a long data launch pulse. The at speed data launch pulse and the at speed data capture pulse are generated for a common cycle of the system clock.

  2. SNL software manual for the ACS Data Analytics Project.

    Energy Technology Data Exchange (ETDEWEB)

    Stearley, Jon R.; McLendon, William Clarence, III; Rodrigues, Arun F.; Williams, Aaron S.; Hooper, Russell Warren; Robinson, David Gerald; Stickland, Michael G.

    2011-10-01

    In the ACS Data Analytics Project (also known as 'YumYum'), a supercomputer is modeled as a graph of components and dependencies, jobs and faults are simulated, and component fault rates are estimated using the graph structure and job pass/fail outcomes. This report documents the successful completion of all SNL deliverables and tasks, describes the software written by SNL for the project, and presents the data it generates. Readers should understand what the software tools are, how they fit together, and how to use them to reproduce the presented data and additional experiments as desired. The SNL YumYum tools provide the novel simulation and inference capabilities desired by ACS. SNL also developed and implemented a new algorithm, which provides faster estimates, at finer component granularity, on arbitrary directed acyclic graphs.

  3. Offshore windfarm connection with low frequency AC transmission technology

    DEFF Research Database (Denmark)

    Qin, Nan; Xu, Zhao; You, Shi

    2009-01-01

    developed, which consists of three parts, the fixed-speed wind turbine representing a wind farm, the transmission line and the frequency converter. Although the transmission capability is greatly improved by the LFAC system, simulation shows it gives negative influences on the wind turbine operation due......This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared...... to the conventional AC solution at the nominal frequency, e.g. 50 Hz or 60 Hz. and reduces the investment cost compared to the HVDC solution. It is estimated that the LFAC system is competitive in the transmission distance of about 30-150 km. The simulation model of the wind integration using the LFAC system has been...

  4. Unbalanced Voltage Compensation in Low Voltage Residential AC Grids

    DEFF Research Database (Denmark)

    Trintis, Ionut; Douglass, Philip; Munk-Nielsen, Stig

    2016-01-01

    This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling. The vol......This paper describes the design and test of a control algorithm for active front-end rectifiers that draw power from a residential AC grid to feed heat pump loads. The control algorithm is able to control the phase to neutral or phase to phase RMS voltages at the point of common coupling....... The voltage control was evaluated with either active or reactive independent phase load current control. The control performance in field operation in a residential grid situated in Bornholm, Denmark was investigated for different use cases....

  5. DIAGNOSTIC FEATURES RESEARCH OF AC ELECTRIC POINT MOTORS

    Directory of Open Access Journals (Sweden)

    S. YU. Buryak

    2014-05-01

    Full Text Available Purpose.Considerable responsibility for safety of operation rests on signal telephone and telegraph department of railway. One of the most attackable nodes (both automation systems, and railway in whole is track switches. The aim of this investigation is developing such system for monitoring and diagnostics of track switches, which would fully meet the requirements of modern conditions of high-speed motion and heavy trains and producing diagnostics, collection and systematization of data in an automated way. Methodology. In order to achieve the desired objectives research of a structure and the operating principle description of the switch electric drive, sequence of triggering its main units were carried out. The operating characteristics and settings, operating conditions, the causes of failures in the work, andrequirements for electric drives technology and their service were considered and analyzed. Basic analysis principles of dependence of nature of the changes the current waveform, which flows in the working circuit of AC electric point motor were determined. Technical implementation of the monitoring and diagnosing system the state of AC electric point motors was carried out. Findings. Signals taken from serviceable and defective electric turnouts were researched. Originality. Identified a strong interconnectionbetween the technical condition of the track switchand curve shape that describes the current in the circuit of AC electric point motor during operation which is based on the research processes that have influence on it during operation. Practical value. Shown the principles of the technical approach to the transition from scheduled preventive maintenance to maintenance of real condition for a more objective assessment and thus more rapid response to emerging or failures when they occur gradually, damages and any other shortcomings in the work track switch AC drives.

  6. Hybrid immersed interface-immersed boundary methods for AC dielectrophoresis

    Energy Technology Data Exchange (ETDEWEB)

    Hossan, Mohammad Robiul [School of Mechanical and Materials Engineering, Washington State University, Pullman, WA 99164-2920 (United States); Department of Engineering and Physics, University of Central Oklahoma, Edmond, OK 73034-5209 (United States); Dillon, Robert [Department of Mathematics, Washington State University, Pullman, WA 99164-3113 (United States); Dutta, Prashanta, E-mail: dutta@mail.wsu.edu [School of Mechanical and Materials Engineering, Washington State University, Pullman, WA 99164-2920 (United States)

    2014-08-01

    Dielectrophoresis, a nonlinear electrokinetic transport mechanism, has become popular in many engineering applications including manipulation, characterization and actuation of biomaterials, particles and biological cells. In this paper, we present a hybrid immersed interface–immersed boundary method to study AC dielectrophoresis where an algorithm is developed to solve the complex Poisson equation using a real variable formulation. An immersed interface method is employed to obtain the AC electric field in a fluid media with suspended particles and an immersed boundary method is used for the fluid equations and particle transport. The convergence of the proposed algorithm as well as validation of the hybrid scheme with experimental results is presented. In this paper, the Maxwell stress tensor is used to calculate the dielectrophoretic force acting on particles by considering the physical effect of particles in the computational domain. Thus, this study eliminates the approximations used in point dipole methods for calculating dielectrophoretic force. A comparative study between Maxwell stress tensor and point dipole methods for computing dielectrophoretic forces are presented. The hybrid method is used to investigate the physics of dielectrophoresis in microfluidic devices using an AC electric field. The numerical results show that with proper design and appropriate selection of applied potential and frequency, global electric field minima can be obtained to facilitate multiple particle trapping by exploiting the mechanism of negative dielectrophoresis. Our numerical results also show that electrically neutral particles form a chain parallel to the applied electric field irrespective of their initial orientation when an AC electric field is applied. This proposed hybrid numerical scheme will help to better understand dielectrophoresis and to design and optimize microfluidic devices.

  7. Ac Synchronous Servo Based On The Armature Voltage Prediction Model

    Science.gov (United States)

    Hoshino, Akihiro; Kuromaru, Hiroshi; Kobayashi, Shinichi

    1987-10-01

    A new control method of the AC synchro-nous servo-system (Brushless DC servo-system) is discussed. The new system is based on the armature voltage prediction model. Without a resolver-digital-conver-ter nor a tachometer-generator, the resolver provides following three signals to the system immediately, they are the current command, the induced voltage, and the rotor speed. The new method realizes a simple hardware configuration. Experimental results show a good performance of the system.

  8. MD 349: Impedance Localization with AC-dipole

    CERN Document Server

    Biancacci, Nicolo; Metral, Elias; Salvant, Benoit; Papotti, Giulia; Persson, Tobias Hakan Bjorn; Tomas Garcia, Rogelio; CERN. Geneva. ATS Department

    2016-01-01

    The purpose of this MD is to measure the distribution of the transverse impedance of the LHC by observing the phase advance variation with intensity between the machine BPMs. Four injected bunches with different intensities are excited with an AC dipole and the turn by turn data is acquired from the BPM system. Through post-processing analysis the phase variation along the machine is depicted and, from this information, first conclusions of the impedance distribution can be drawn.

  9. Optimal Design of Hybrid AC/DC Microgrids

    OpenAIRE

    Lotfi,Hossein; Khodaei, Amin; Bahramirad, Shay; Bollen, Math

    2017-01-01

    DC loads (such as computers, data centres, electric vehicle chargers, and LED lamps) and dc distributed energy resources (such as fuel cells, solar photovoltaics, and energy storages) are rapidly growing in electric power systems, so dc systems are being introduced as emerging practical investment solutions compared to traditional ac options. DC microgrids offer several advantages such as the elimination of need for synchronizing generators and easier supply of dc loads. Hybrid microgrids can...

  10. Prototipo acústico adaptable. Para espacios multifuncionales

    Directory of Open Access Journals (Sweden)

    Constanza Ipinza Olatte

    2017-04-01

    Full Text Available Este artículo presenta la primera etapa de la investigación “Prototipo Acústico Adaptable –para espacios multifuncionales–”, desarrollado en la Escuela de Arquitectura de la Universidad de Santiago de Chile. El objetivo de ella ha sido diseñar y construir un dispositivo de geometría articulada que permita calibrar la acústica del espacio, en función de las necesidades de recepción de los usuarios. Se revisa la base teórica de la propuesta a partir del concepto de arquitectura líquida, que en su fundamentación pretende incorporar la dimensión dinámica del tiempo en la condición material de los espacios. Asimismo, se examina el término acústica variable, que aborda técnicamente la versatilidad del acontecimiento sonoro en un despliegue de técnicas activas o pasivas. Luego se presenta la metodología a través del diseño, basada en el modelo propuesto por Lucien Blessing, que formula un proceso desde la definición de los criterios, hasta la concreción formal del diseño en la construcción del modelo. Finalmente, se presentan los parámetros de validación del diseño que apuntan a la prosecución de su desarrollo en una segunda etapa. En ella, el objetivo será optimizar el modelo y mejorar las transformaciones del ambiente acústico material, espacial y temporal, como se ha propuesto.

  11. Pancreatectomy risk calculator: an ACS-NSQIP resource

    Science.gov (United States)

    Parikh, Purvi; Shiloach, Mira; Cohen, Mark E; Bilimoria, Karl Y; Ko, Clifford Y; Hall, Bruce L; Pitt, Henry A

    2010-01-01

    Background The morbidity of pancreatoduodenectomy remains high and the mortality may be significantly increased in high-risk patients. However, a method to predict post-operative adverse outcomes based on readily available clinical data has not been available. Therefore, the objective was to create a ‘Pancreatectomy Risk Calculator’ using the American College of Surgeons-National Surgical Quality Improvement Program (ACS-NSQIP) database. Methods The 2005–2008 ACS-NSQIP data on 7571 patients undergoing proximal (n =4621), distal (n =2552) or total pancreatectomy (n =177) as well as enucleation (n =221) were analysed. Pre-operative variables (n =31) were assessed for prediction of post-operative mortality, serious morbidity and overall morbidity using a logistic regression model. Statistically significant variables were ranked and weighted to create a common set of predictors for risk models for all three outcomes. Results Twenty pre-operative variables were statistically significant predictors of post-operative mortality (2.5%), serious morbidity (21%) or overall morbidity (32%). Ten out of 20 significant pre-operative variables were employed to produce the three mortality and morbidity risk models. The risk factors included age, gender, obesity, sepsis, functional status, American Society of Anesthesiologists (ASA) class, coronary heart disease, dyspnoea, bleeding disorder and extent of surgery. Conclusion The ACS-NSQIP ‘Pancreatectomy Risk Calculator’ employs 10 easily assessable clinical parameters to assist patients and surgeons in making an informed decision regarding the risks and benefits of undergoing pancreatic resection. A risk calculator based on this prototype will become available in the future as on online ACS-NSQIP resource. PMID:20815858

  12. AC system stabilization via phase shift transformer with thyristor commutation

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)

    1994-12-31

    This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.

  13. Physical Activity Frequency on the 10-Year Acute Coronary Syndrome (ACS) Prognosis; The Interaction With Cardiovascular Disease History and Diabetes Mellitus: The GREECS Observational Study.

    Science.gov (United States)

    Papataxiarchis, Evangelos; Panagiotakos, Demosthenes B; Notara, Venetia; Kouvari, Matina; Kogias, Yannis; Stravopodis, Petros; Papanagnou, George; Zombolos, Spyros; Mantas, Yannis; Pitsavos, Christos

    2016-10-01

    The association between physical activity, diabetes mellitus (DM), and long-term acute coronary syndrome (ACS) prognosis was evaluated. The GREECS study included 2,172 consecutive ACS patients from six Greek hospitals (2003-2004). In 2013-2014, a 10-year follow up was performed with 1,918 patients. Physical activity was categorized in never, rarely (monthly basis), 1-2 and ≥ 3 times/week. Multi-adjusted analysis revealed that 1-2 and ≥ 3 times/week vs. no physical activity had a protective effect on ACS incidence (OR = 0.63 95% CI 0.38, 1.05) and (OR = 0.63 95% CI 0.40, 0.99) respectively, only in patients without prior baseline CVD event. In a subgroup analysis, with DM as strata in these patients, engagement in physical activity (i.e., 1-2 times/week) had a significant protective effect among patients with diabetes (OR = 0.51, 95% CI 0.27, 0.96, p = .037). These findings revealed the beneficial role of exercise in secondary ACS prevention, even in DM patients. Public health-oriented policies should incorporate regular physical activity as a key protective factor in disease prognosis.

  14. In-silico determination of insecticidal potential of Vip3Aa-Cry1Ac fusion protein against Lepidopteran targets using molecular docking

    Directory of Open Access Journals (Sweden)

    Aftab eAhmad

    2015-12-01

    Full Text Available Study and research of Bt (Bacillus thuringiensis transgenic plants have opened new ways to combat insect pests. Over the decades, however, insect pests, especially the Lepidopteran, have developed tolerance against Bt delta-endotoxins. Such issues can be addressed through the development of novel toxins with greater toxicity and affinity against a broad range of insect receptors. In this computational study, functional domains of Bacillus thuringiensis crystal delta-endotoxin (Cry1Ac insecticidal protein and vegetative insecticidal protein (Vip3Aa have been fused to develop a broad-range Vip3Aa-Cry1Ac fusion protein. Cry1Ac and Vip3Aa are non-homologous insecticidal proteins possessing receptors against different targets within the midgut of insects. The insecticidal proteins were fused to broaden the insecticidal activity. Molecular docking analysis of the fusion protein against aminopeptidase-N (APN and cadherin receptors of five Lepidopteran insects (Agrotis ipsilon, Helicoverpa armigera, Pectinophora gossypiella, Spodoptera exigua and Spodoptera litura revealed that the Ser290, Ser293, Leu337, Thr340 and Arg437 residues of the fusion protein are involved in the interaction with insect receptors. The Helicoverpa armigera cadherin receptor, however, showed no interaction, which might be due to either loss or burial of interactive residues inside the fusion protein. These findings revealed that the Vip3Aa-Cry1Ac fusion protein has a strong affinity against Lepidopteran insect receptors and hence has a potential to be an efficient broad-range insecticidal protein.

  15. Therapeutic efficacy and toxicity of {sup 225}Ac-labelled vs. {sup 213}Bi-labelled tumour-homing peptides in a preclinical mouse model of peritoneal carcinomatosis

    Energy Technology Data Exchange (ETDEWEB)

    Essler, Markus; Gaertner, Florian C.; Blechert, Birgit; Senekowitsch-Schmidtke, Reingard; Seidl, Christof [Technische Universitaet Muenchen, Department of Nuclear Medicine, Munich (Germany); Neff, Frauke [Helmholtz Zentrum Muenchen, Institute of Pathology, Neuherberg (Germany); Bruchertseifer, Frank; Morgenstern, Alfred [Institute for Transuranium Elements, European Commission, Joint Research Centre, Karlsruhe (Germany)

    2012-04-15

    Targeted delivery of alpha-particle-emitting radionuclides is a promising novel option in cancer therapy. We generated stable conjugates of the vascular tumour-homing peptide F3 both with {sup 225}Ac and {sup 213}Bi that specifically bind to nucleolin on the surface of proliferating tumour cells. The aim of our study was to determine the therapeutic efficacy of {sup 225}Ac-DOTA-F3 in comparison with that of {sup 213}Bi-DTPA-F3. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were determined via clonogenic assays. The therapeutic efficacy of both constructs was assayed by repeated treatment of mice bearing intraperitoneal MDA-MB-435 xenograft tumours. Therapy was monitored by bioluminescence imaging. Nephrotoxic effects were analysed by histology. ID{sub 50} values of {sup 213}Bi-DTPA-F3 and {sup 225}Ac-DOTA-F3 were 53 kBq/ml and 67 Bq/ml, respectively. The median survival of control mice treated with phosphate-buffered saline was 60 days after intraperitoneal inoculation of 1 x 10{sup 7} MDA-MB-435 cells. Therapy with 6 x 1.85 kBq of {sup 225}Ac-DOTA-F3 or 6 x 1.85 MBq of {sup 213}Bi-DTPA-F3 prolonged median survival to 95 days and 97 days, respectively. While F3 labelled with short-lived {sup 213}Bi (t{sub 1/2} 46 min) reduced the tumour mass at early time-points up to 30 days after treatment, the antitumour effect of {sup 225}Ac-DOTA-F3 (t{sub 1/2} 10 days) increased at later time-points. The difference in the fraction of necrotic cells after treatment with {sup 225}Ac-DOTA-F3 (43%) and with {sup 213}Bi-DTPA-F3 (36%) was not significant. Though histological analysis of kidney samples revealed acute tubular necrosis and tubular oedema in 10-30% of animals after treatment with {sup 225}Ac-DOTA-F3 or {sup 213}Bi-DTPA-F3, protein casts were negligible (2%), indicating only minor damage to the kidney. Therapy with both {sup 225}Ac-DOTA-F3 and {sup 213}Bi-DTPA-F3 increased survival of mice with peritoneal carcinomatosis. Mild renal toxicity of both

  16. AC electric field induced vortex in laminar coflow diffusion flames

    KAUST Repository

    Xiong, Yuan

    2014-09-22

    Experiments were performed by applying sub-critical high-voltage alternating current (AC) to the nozzle of laminar propane coflow diffusion flames. Light scattering, laser-induced incandescence and laser-induced fluorescence techniques were used to identify the soot zone, and the structures of OH and polycyclic aromatic hydrocarbons (PAHs). Particle image velocimetry was adopted to quantify the velocity field. Under certain AC conditions of applied voltage and frequency, the distribution of PAHs and the flow field near the nozzle exit were drastically altered, leading to the formation of toroidal vortices. Increased residence time and heat recirculation inside the vortex resulted in appreciable formation of PAHs and soot near the nozzle exit. Decreased residence time along the jet axis through flow acceleration by the vortex led to a reduction in the soot volume fraction in the downstream sooting zone. Electromagnetic force generated by AC was proposed as a viable mechanism for the formation of the toroidal vortex. The onset conditions for the vortex formation supported the role of an electromagnetic force acting on charged particles in the flame zone. (C) 2014 The Combustion Institute. Published by Elsevier Inc. All rights reserved.

  17. A Novel Protection Scheme against Fault Resistance for AC Microgrid

    Directory of Open Access Journals (Sweden)

    Xinrui Liu

    2017-01-01

    Full Text Available The faults characteristics of the lines in AC microgrid are weakened due to the fault resistance, which may refuse protection action. To solve the problems caused by different types of the faults through fault resistance (FTFR, the faults where the fault point resistance is greater than zero in AC microgrid, a novel FTFR protection scheme based on the active power of 0-frame component or d-frame component consumed by fault resistance is proposed in this paper as the backup protection of FTFR. This proposed protection scheme utilizes the active power of 0-frame component or d-frame component consumed by fault resistance to identify internal FTFR and external faults. It performs well in grid-connected mode and islanded mode by adopting self-adaptive threshold and is not affected by the factors such as the fault position and the fault resistance value. The theoretical analysis and various simulations show that this protection scheme can identify and isolate different types of internal FTFR in AC microgrid with high reliability and high sensitivity.

  18. New Subarray Readout Patterns for the ACS Wide Field Channel

    Science.gov (United States)

    Golimowski, D.; Anderson, J.; Arslanian, S.; Chiaberge, M.; Grogin, N.; Lim, Pey Lian; Lupie, O.; McMaster, M.; Reinhart, M.; Schiffer, F.; Serrano, B.; Van Marshall, M.; Welty, A.

    2017-04-01

    At the start of Cycle 24, the original CCD-readout timing patterns used to generate ACS Wide Field Channel (WFC) subarray images were replaced with new patterns adapted from the four-quadrant readout pattern used to generate full-frame WFC images. The primary motivation for this replacement was a substantial reduction of observatory and staff resources needed to support WFC subarray bias calibration, which became a new and challenging obligation after the installation of the ACS CCD Electronics Box Replacement during Servicing Mission 4. The new readout patterns also improve the overall efficiency of observing with WFC subarrays and enable the processing of subarray images through stages of the ACS data calibration pipeline (calacs) that were previously restricted to full-frame WFC images. The new readout patterns replace the original 512×512, 1024×1024, and 2048×2046-pixel subarrays with subarrays having 2048 columns and 512, 1024, and 2048 rows, respectively. Whereas the original square subarrays were limited to certain WFC quadrants, the new rectangular subarrays are available in all four quadrants. The underlying bias structure of the new subarrays now conforms with those of the corresponding regions of the full-frame image, which allows raw frames in all image formats to be calibrated using one contemporaneous full-frame "superbias" reference image. The original subarrays remain available for scientific use, but calibration of these image formats is no longer supported by STScI.

  19. The ACS-NUCL Division 50th Anniversary: Introduction

    Energy Technology Data Exchange (ETDEWEB)

    Hobart, David E. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-01-10

    The ACS Division of Nuclear Chemistry and Technology was initiated in 1955 as a subdivision of the Division of Industrial and Engineering Chemistry. Probationary divisional status was lifted in 1965. The Division’s first symposium was held in Denver in 1964 and it is fitting that we kicked-off the 50th Anniversary in Denver in the spring of 2015. Listed as a small ACS Division with only about 1,000 members, NUCL’s impact over the past fifty years has been remarkable. National ACS meetings have had many symposia sponsored or cosponsored by NUCL that included Nobel Laureates, U.S. Senators, other high-ranking officials and many students as speakers. The range of subjects has been exceptional as are the various prestigious awards established by the Division. Of major impact has been the past 30 years of the NUCL Nuclear Chemistry Summer Schools to help fill the void of qualified nuclear scientists and technicians. In celebrating the 50th Anniversary we honor the past, celebrate the present and shape the future of the Division and nuclear science and technology. To celebrate this auspicious occasion a commemorative lapel pin has been designed for distribution to NUCL Division members.

  20. Simulation of the AC corona phenomenon with experimental validation

    Science.gov (United States)

    Villa, Andrea; Barbieri, Luca; Marco, Gondola; Malgesini, Roberto; Leon-Garzon, Andres R.

    2017-11-01

    The corona effect, and in particular the Trichel phenomenon, is an important aspect of plasma physics with many technical applications, such as pollution reduction, surface and medical treatments. This phenomenon is also associated with components used in the power industry where it is, in many cases, the source of electro-magnetic disturbance, noise and production of undesired chemically active species. Despite the power industry to date using mainly alternating current (AC) transmission, most of the studies related to the corona effect have been carried out with direct current (DC) sources. Therefore, there is technical interest in validating numerical codes capable of simulating the AC phenomenon. In this work we describe a set of partial differential equations that are comprehensive enough to reproduce the distinctive features of the corona in an AC regime. The model embeds some selectable chemical databases, comprising tens of chemical species and hundreds of reactions, the thermal dynamics of neutral species and photoionization. A large set of parameters—deduced from experiments and numerical estimations—are compared, to assess the effectiveness of the proposed approach.

  1. Food safety assessment of Cry8Ka5 mutant protein using Cry1Ac as a control Bt protein.

    Science.gov (United States)

    Farias, Davi Felipe; Viana, Martônio Ponte; Oliveira, Gustavo Ramos; Santos, Vanessa Olinto; Pinto, Clidia Eduarda Moreira; Viana, Daniel Araújo; Vasconcelos, Ilka Maria; Grossi-de-Sa, Maria Fátima; Carvalho, Ana Fontenele Urano

    2015-07-01

    Cry8Ka5 is a mutant protein from Bacillus thuringiensis (Bt) that has been proposed for developing transgenic plants due to promising activity against coleopterans, like Anthonomus grandis (the major pest of Brazilian cotton culture). Thus, an early food safety assessment of Cry8Ka5 protein could provide valuable information to support its use as a harmless biotechnological tool. This study aimed to evaluate the food safety of Cry8Ka5 protein following the two-tiered approach, based on weights of evidence, proposed by ILSI. Cry1Ac protein was used as a control Bt protein. The history of safe use revealed no convincing hazard reports for Bt pesticides and three-domain Cry proteins. The bioinformatics analysis with the primary amino acids sequence of Cry8Ka5 showed no similarity to any known toxic, antinutritional or allergenic proteins. The mode of action of Cry proteins is well understood and their fine specificity is restricted to insects. Cry8Ka5 and Cry1Ac proteins were rapidly degraded in simulated gastric fluid, but were resistant to simulated intestinal fluid and heat treatment. The LD50 for Cry8Ka5 and Cry1Ac was >5000 mg/kg body weight when administered by gavage in mice. Thus, no expected relevant risks are associated with the consumption of Cry8Ka5 protein. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Information Privacy Revealed

    Science.gov (United States)

    Lavagnino, Merri Beth

    2013-01-01

    Why is Information Privacy the focus of the January-February 2013 issue of "EDUCAUSE Review" and "EDUCAUSE Review Online"? Results from the 2012 annual survey of the International Association of Privacy Professionals (IAPP) indicate that "meeting regulatory compliance requirements continues to be the top perceived driver…

  3. HST/ACS Narrowband Imaging of the Kepler Supernova Remnant

    Science.gov (United States)

    Sankrit, Ravi; Blair, William P.; Frattare, Lisa M.; Rudnick, Lawrence; DeLaney, Tracey; Harrus, Ilana M.; Ennis, Jessica A.

    2007-01-01

    We present narrowband images of the Kepler supernova remnant obtained with the Advanced Camera for Surveys aboard the Hubble Space Telescope. The images, with an angular resolution of 0.05" reveal the structure of the emitting gas in unprecedented detail. Radiative and nonradiative shocks are found in close proximity, unresolvable in gromd-based spectra, indicating that the pre-shock medium is highly clumped. The ionization structure, traced by differences in the [0 111] to [N 11] flux ratio, varies on subarcsecond scales. The variation is due to 110th differences in shock velocity as well as gradients in the evolutionary stage of the shocks. A prollinent complex of knots protruding beyond the boundary of the rennallt in the northwest is found to consist of bright radiative knots, collected by arcuate nonradiative filaments. Based on the coincidence of the optical emission with a bright isolated knot of X-ray emission, we infer that this feature is due to a Rayleigh-Taylor finger that formed at the contact discontinuity and overtook the primary blast wave.

  4. Control of hybrid AC/DC microgrid under islanding operational conditions

    DEFF Research Database (Denmark)

    Ding, G.; Gao, F.; Zhang, S.

    2014-01-01

    This paper presents control methods for hybrid AC/DC microgrid under islanding operation condition. The control schemes for AC sub-microgrid and DC sub-microgrid are investigated according to the power sharing requirement and operational reliability. In addition, the key control schemes...... of interlinking converter with DC-link capacitor or energy storage, which will devote to the proper power sharing between AC and DC sub-microgrids to maintain AC and DC side voltage stable, is reviewed. Combining the specific control methods developed for AC and DC sub-microgrids with interlinking converter...

  5. Dicty_cDB: FC-AC21 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AC21 (Link to dictyBase) - - - Contig-U15104-1 FC-AC21E (Li...nk to Original site) - - - - - - FC-AC21E 527 Show FC-AC21 Library FC (Link to library) Clone ID FC-AC21 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15104-1 Original site URL http://dict...ce KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQKDQRCGYCGPILVDQLRDQIKERSLEKEIQVFGTSHVGGHKY... Frames) Frame A: KDSLDVIIFPEMVKLVGLTPNTMEKVLTYFQDNDTIDLSTFPMEIQVEQLSGKYIFICTH KQ

  6. Engineering surveying

    CERN Document Server

    Schofield, W

    2007-01-01

    Engineering surveying involves determining the position of natural and man-made features on or beneath the Earth's surface and utilizing these features in the planning, design and construction of works. It is a critical part of any engineering project. Without an accurate understanding of the size, shape and nature of the site the project risks expensive and time-consuming errors or even catastrophic failure.Engineering Surveying 6th edition covers all the basic principles and practice of this complex subject and the authors bring expertise and clarity. Previous editions of this classic text have given readers a clear understanding of fundamentals such as vertical control, distance, angles and position right through to the most modern technologies, and this fully updated edition continues that tradition.This sixth edition includes:* An introduction to geodesy to facilitate greater understanding of satellite systems* A fully updated chapter on GPS, GLONASS and GALILEO for satellite positioning in surveying* Al...

  7. Computational inference of H3K4me3 and H3K27ac domain length

    Directory of Open Access Journals (Sweden)

    Julian Zubek

    2016-03-01

    Full Text Available Background. Recent epigenomic studies have shown that the length of a DNA region covered by an epigenetic mark is not just a byproduct of the assaying technologies and has functional implications for that locus. For example, expanded regions of DNA sequences that are marked by enhancer-specific histone modifications, such as acetylation of histone H3 lysine 27 (H3K27ac domains coincide with cell-specific enhancers, known as super or stretch enhancers. Similarly, promoters of genes critical for cell-specific functions are marked by expanded H3K4me3 domains in the cognate cell type, and these can span DNA regions from 4–5kb up to 40–50kb in length. These expanded H3K4me3 domains are known as buffer domains or super promoters. Methods. To ask what correlates with—and potentially regulates—the length of loci marked with these two important histone marks, H3K4me3 and H3K27ac, we built Random Forest regression models. With these models, we computationally identified genomic and epigenomic patterns that are predictive for the length of these marks in seven ENCODE cell lines. Results. We found that certain epigenetic marks and transcription factors explain the variability of the length of H3K4me3 and H3K27ac marks across different cell types, which implies that the lengths of these two epigenetic marks are tightly regulated in a given cell type. Our source code for the regression models and data can be found at our GitHub page: https://github.com/zubekj/broad_peaks. Discussion. Our Random Forest based regression models enabled us to estimate the individual contribution of different epigenetic marks and protein binding patterns to the length of H3K4me3 and H3K27ac deposition patterns, therefore potentially revealing genomic signatures at cell specific regulatory elements.

  8. Susceptibility towards enterotoxigenic Escherichia coli F4ac diarrhea is governed by the MUC13 gene in pigs.

    Directory of Open Access Journals (Sweden)

    Jun Ren

    Full Text Available Enterotoxigenic Escherichia coli (ETEC F4ac is a major determinant of diarrhea and mortality in neonatal and young pigs. Susceptibility to ETEC F4ac is governed by the intestinal receptor specific for the bacterium and is inherited as a monogenic dominant trait. To identify the receptor gene (F4acR, we first mapped the locus to a 7.8-cM region on pig chromosome 13 using a genome scan with 194 microsatellite markers. A further scan with high density markers on chromosome 13 refined the locus to a 5.7-cM interval. Recombination breakpoint analysis defined the locus within a 2.3-Mb region. Further genome-wide mapping using 39,720 informative SNPs revealed that the most significant markers were proximal to the MUC13 gene in the 2.3-Mb region. Association studies in a collection of diverse outbred populations strongly supported that MUC13 is the most likely responsible gene. We characterized the porcine MUC13 gene that encodes two transcripts: MUC13A and MUC13B. Both transcripts have the characteristic PTS regions of mucins that are enriched in distinct tandem repeats. MUC13B is predicated to be heavily O-glycosylated, forming the binding site of the bacterium; while MUC13A does not have the O-glycosylation binding site. Concordantly, 127 independent pigs homozygous for MUC13A across diverse breeds are all resistant to ETEC F4ac, and all 718 susceptible animals from the broad breed panel carry at least one MUC13B allele. Altogether, we conclude that susceptibility towards ETEC F4ac is governed by the MUC13 gene in pigs. The finding has an immediate translation into breeding practice, as it allows us to establish an efficient and accurate diagnostic test for selecting against susceptible animals. Moreover, the finding improves our understanding of mucins that play crucial roles in defense against enteric pathogens. It revealed, for the first time, the direct interaction between MUC13 and enteric bacteria, which is poorly understood in mammals.

  9. Surveying Education

    DEFF Research Database (Denmark)

    Enemark, Stig

    2009-01-01

    In relation to surveying education there is one big question to be asked: Is the role of the surveyors changing? In a global perspective the answer will be "Yes". There is a big swing that could be entitled "From Measurement to Management". This does not imply that measurement is no longer....... In surveying education there are a range of other challenges to be faced. These relate to the focus on learning to learn; the need for flexible curriculum to deal with constant change; the move towards introducing virtual academy; the demand for creating a quality culture; and the perspective of lifelong...... on an efficient interaction between education, research, and professional practice....

  10. Differential expression of CD300a/c on human TH1 and TH17 cells

    Directory of Open Access Journals (Sweden)

    Borrego Francisco

    2011-11-01

    Full Text Available Abstract Background Human memory CD4+ T cells can be either CD300a/c+ or CD300a/c- and subsequent analyses showed that CD4+ effector memory T (TEM cells are mostly CD300a/c+, whereas CD4+ central memory T (TCM cells have similar frequencies of CD300a/c+ and CD300a/c- cells. Results Extensive phenotypical and functional characterization showed that in both TCM and TEM cells, the CD300a/c+ subset contained a higher number of TH1 (IFN-γ producing cells. Alternatively, TH17 (IL-17a producing cells tend to be CD300a/c-, especially in the TEM subset. Further characterization of the IL-17a+ cells showed that cells that produce only this cytokine are mostly CD300a/c-, while cells that produce IL-17a in combination with other cytokines, especially IFN-γ, are mostly CD300a/c+, indicating that the expression of this receptor is associated with cells that produce IFN-γ. Co-ligation of the TCR and CD300a/c in CD4+ T cells inhibited Ca2+ mobilization evoked by TCR ligation alone and modulated IFN-γ production on TH1 polarized cells. Conclusion We conclude that the CD300a/c receptors are differentially expressed on human TH1 and TH17 cells and that their ligation is capable of modulating TCR mediated signals.

  11. Relations between ac-dc components and optical path length in photoplethysmography.

    Science.gov (United States)

    Lee, Chungkeun; Sik Shin, Hang; Lee, Myoungho

    2011-07-01

    Photoplethysmography is used in various areas such as vital sign measurement, vascular characteristics analysis, and autonomic nervous system assessment. Photoplethysmographic signals are composed of ac and dc, but it is difficult to find research about the interaction of photoplethysmographic components. This study suggested a model equation combining two Lambert-Beer equations at the onset and peak points of photoplethysmography to evaluate ac characteristics, and verified the model equation through simulation and experiment. In the suggested equation, ac was dependent on dc and optical path length. In the simulation, dc was inversely proportionate to ac sensitivity (slope), and ac and optical path length were proportionate. When dc increased from 10% to 90%, stabilized ac decreased from 1 to 0.89 ± 0.21, and when optical path length increased from 10% to 90%, stabilized ac increased from 1 to 1.53 ± 0.40.

  12. Reassembled Biosynthetic Pathway for a Large-scale Synthesis of CMP-Neu5Ac

    Science.gov (United States)

    Song, Jing; Zhang, Hesheng; Wu, Bingyuan; Zhang, Yingxin; Li, Hanfen; Xiao, Min; Wang, Peng George

    2003-01-01

    CMP-Neu5Ac is an important sugar nucleotide for biosynthesis of sialic acid and its conjugates. In this paper, a large-scale production system of CMP-Neu5Ac by a single strain is reported. The co-expression of Neu5Ac aldolase (EC4.1.3.3) and CMP-Neu5Ac synthetase (EC 2.7.7.43) was achieved by constructing individual genes into one plasmid and having a single culture that has both NeuAc aldolase and CMP-Neu5Ac synthetase activities. Overall this system only employed N-acetylmannosamine, excess of pyruvate and CTP to produce CMP-Neu5Ac. This work has demonstrated that a large-scale synthesis of sialic acid-derived oligosaccharides could be achieved economically and efficiently through a single, biosynthetic pathway engineered microorganism.

  13. Pengaruh Fundamental Safe Work Practice Terhadap Pencegahan Kecelakaan Kerja Bagian Workover di PT. ACS Duri

    Directory of Open Access Journals (Sweden)

    M. Saifullah

    2012-05-01

    Full Text Available PT. Asrindo Citraseni Satria (ACS is a company engaged in oil and gas and is a sub contractor PT.CPI. PT. ACS has implemented FSWP whose objective which is to identify, assess, reduce, control or eliminate the risks associated with the work, but until now there is still a work accident that occurred even in small quantities. The author would like to know about the effect of application of the section Fundamental Safe Work Practice (FSWP can prevent the accident in workover PT. ACS Duri. This research uses quantitative analytical survey, with the design of Cross Sectional conducted from May to June 2012 with a large sample of 122 of the 360 people who work in the workover. Samples were taken by using a system Accidental Sampling, and the data processed using a computer program to analyze the independent variables in the form of application as well as the dependent variable is FSWP occupational accidents and tested using Chi-square. The results showed that, the application of FSWP can prevent accidents which includes Standard Operating Procedure (SOP with the value of P = 0.01 is smaller than the value of α = 0.05 that means there are a significant correlation between the application of SOP with workplace accidents, PTW with a value of P = 0.02 is more smaller than the value of α = 0.05 means that there are significant correlation between the application of Permit To Work (PTW accidents, and tagged with a value of P = 0.01 is smaller than the value of α= 0.05 means there is a significant correlation between the application of Log Out/Tag Out (LOTO by accident. It was concluded that, the application of FSWP can reduce / reduce the number of occupational accidents in the workover, and is expected for the management of HES to improving the knowledge for employee about the aspects of FSWP (SWA, Hazard Analysis, SOP, Access Control, PPE, MSDS, Housekeeping, PTW & Other Safe Work Practices.

  14. THE ADVANCED CAMERA FOR SURVEYS GENERAL CATALOG: STRUCTURAL PARAMETERS FOR APPROXIMATELY HALF A MILLION GALAXIES

    Energy Technology Data Exchange (ETDEWEB)

    Griffith, Roger L.; Kirkpatrick, J. Davy [Infrared Processing and Analysis Center, California Institute of Technology, Pasadena, CA 91125 (United States); Cooper, Michael C. [Center for Galaxy Evolution, Department of Physics and Astronomy, University of California, Irvine, 4129 Frederick Reines Hall, Irvine, CA 92697 (United States); Newman, Jeffrey A. [Pittsburgh Particle Physics, Astrophysics, and Cosmology Center, Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, PA 15260 (United States); Moustakas, Leonidas A.; Stern, Daniel [Jet Propulsion Laboratory, California Institute of Technology, 4800 Oak Grove Dr., Pasadena, CA 91109 (United States); Comerford, Julia M. [Astronomy Department, University of Texas at Austin, Austin, TX 78712 (United States); Davis, Marc [Department of Astronomy, University of California, Berkeley, Hearst Field Annex B, Berkeley, CA 94720 (United States); Lotz, Jennifer M.; Koekemoer, Anton M. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Barden, Marco [Institute of Astro- and Particle Physics, University of Innsbruck, Technikerstr. 25, 6020 Innsbruck (Austria); Conselice, Christopher J. [School of Physics and Astronomy, University of Nottingham, Nottingham (United Kingdom); Capak, Peter L.; Scoville, Nick; Sheth, Kartik; Shopbell, Patrick [Spitzer Science Centre, 314-6 California Institute of Technology, 1200 E. California Blvd., Pasadena, CA 91125 (United States); Faber, S. M.; Koo, David C. [UCO/Lick Observatory, University of California, CA (United States); Noeske, Kai G. [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA (United States); Willmer, Christopher N. A. [Steward Observatory, University of Arizona, 933 North Cherry Avenue, Tucson, AZ 85721 (United States); and others

    2012-05-01

    We present the Advanced Camera for Surveys General Catalog (ACS-GC), a photometric and morphological database using publicly available data obtained with the Advanced Camera for Surveys (ACS) instrument on the Hubble Space Telescope. The goal of the ACS-GC database is to provide a large statistical sample of galaxies with reliable structural and distance measurements to probe the evolution of galaxies over a wide range of look-back times. The ACS-GC includes approximately 470,000 astronomical sources (stars + galaxies) derived from the AEGIS, COSMOS, GEMS, and GOODS surveys. GALAPAGOS was used to construct photometric (SEXTRACTOR) and morphological (GALFIT) catalogs. The analysis assumes a single Sersic model for each object to derive quantitative structural parameters. We include publicly available redshifts from the DEEP2, COMBO-17, TKRS, PEARS, ACES, CFHTLS, and zCOSMOS surveys to supply redshifts (spectroscopic and photometric) for a considerable fraction ({approx}74%) of the imaging sample. The ACS-GC includes color postage stamps, GALFIT residual images, and photometry, structural parameters, and redshifts combined into a single catalog.

  15. Development of Deep-tow Autonomous Cable Seismic (ACS) for Seafloor Massive Sulfides (SMSs) Exploration.

    Science.gov (United States)

    Asakawa, Eiichi; Murakami, Fumitoshi; Tsukahara, Hitoshi; Saito, Shutaro; Lee, Sangkyun; Tara, Kenji; Kato, Masafumi; Jamali Hondori, Ehsan; Sumi, Tomonori; Kadoshima, Kazuyuki; Kose, Masami

    2017-04-01

    respectively. Therefore we can use these sources simultaneously and distinguish the records of each source in the data processing stage. We have developed new marine seismic survey systems with autonomous recording for the exploration of the ocean floor resources. The applications are vertical cable seismic (VCS) and deep-tow seismic (ACS). These enable us the recording close to the seafloor and give the high resolution results with a simple, cost-effective configuration.

  16. Expression Study of LeGAPDH, LeACO1, LeACS1A, and LeACS2 in Tomato Fruit (Solanum lycopersicum

    Directory of Open Access Journals (Sweden)

    Pijar Riza Anugerah

    2015-10-01

    Full Text Available Tomato is a climacteric fruit, which is characterized by ripening-related increase of respiration and elevated ethylene synthesis. Ethylene is the key hormone in ripening process of climacteric fruits. The objective of this research is to study the expression of three ethylene synthesis genes: LeACO1, LeACS1A, LeACS2, and a housekeeping gene LeGAPDH in ripening tomato fruit. Specific primers have been designed to amplify complementary DNA fragment of LeGAPDH (143 bp, LeACO1 (240 bp, LeACS1A (169 bp, and LeACS2 (148 bp using polymerase chain reaction. Nucleotide BLAST results of the complementary DNA fragments show high similarity with LeGAPDH (NM_001247874.1, LeACO1 (NM_001247095.1, LeACS1A (NM_001246993.1, LeACS2 (NM_001247249.1, respectively. Expression study showed that LeACO1, LeACS1A, LeACS2, and LeGAPDH genes were expressed in ripening tomato fruit. Isolation methods, reference sequences, and primers used in this study can be used in future experiments to study expression of genes responsible for ethylene synthesis using quantitative polymerase chain reaction and to design better strategy for controlling fruit ripening in agroindustry.

  17. Pharmacokinetic Modeling of Absorption Behavior of 9-Aminocamptothecin (9-AC) Released from Colon-specific HPMA Copolymer–9-AC Conjugate in Rats

    Science.gov (United States)

    Gao, Song-Qi; Sun, Yongen; Kopečková, Pavla; Peterson, C. Matthew; Kopeček, Jindřich

    2011-01-01

    Purpose To quantitate and predict colon-specific 9-aminocamptothecin (9-AC) release from the N-(2-hydroxypropyl)methacrylamide (HPMA) copolymer–9-AC conjugate and its absorption behavior after oral administration in rats. Methods Drug distribution in the gastrointestinal (GI) tract and the plasma concentration-time profile of 9-AC released from the HPMA copolymer conjugate were predicted using the degradation, transit, and absorption rate constants in cecum. The fate of 9-AC in cecum and liver was measured by in-situ cecum absorption and liver perfusion. Results Following oral administration of the conjugate, 9-AC was released rapidly in cecum. Based on the pharmacokinetic model, up to 60% of the dose was in the cecum at ∼6 h, and 7% of the dose still remained there at 24 h. The predicted plasma concentration curve for released 9-AC after an oral dose of 3 mg/kg of 9-AC equivalent increased gradually and reached a peak of 98 nM at 7 h, then started decreasing slowly to 16 nM at 24 h. The bioavailability value was estimated as 0.31 after the first-pass elimination. Conclusions A pharmacokinetic model delineated the impact of GI transit, drug absorption rate, and first-pass metabolism on drug disposition following oral administration of HPMA copolymer–9-AC conjugate in rats. PMID:17929146

  18. Autonomous Marine Seismic Survey Systems for Seafloor Massive Sulfide (SMS) Exploration

    Science.gov (United States)

    Asakawa, E.; Murakami, F.; Tsukahara, H.; Lee, S.; Saito, S.; Tara, K.; Sumi, T.; Kadoshima, K.; Kose, M.

    2016-12-01

    The Cabinet Office, Government Japan started the Cross-ministerial Strategic Innovation Promotion Program (SIP) in 2014. "Next-generation Ocean Resource Exploration Techniques" is scheduled under SIP from 2014 to 2018. J-MARES participates this program and aims "Multi-stage and integrated approach for Seafloor Massive Sulfide(SMS) exploration" through the development of highly efficient and cost-effective geophysical exploration methods mainly on seismic and EM methods. J-MARES proposed Vertical Cable Seismic (VCS) technique as seismic survey. It is one of reflection seismic methods that uses hydrophone arrays vertically moored from the seafloor. It is useful to delineate detailed structures in a spatially-limited area efficiently. JGI, a member of J-MARES, has developed autonomous VCS systems and carried out several VCS surveys in hydrothermal fields and the detailed subsurface structure is revealed up to 100m. VCS surveys have provides high resolution results but it covers a small survey area with a limited number of vertical cables. To expand the survey area, we operate ROV for re-deployments of the VCS. Another approach is to develop a deep-towed seismic system based on the VCS technology. We re-deployed the vertical cables using ROV. The ROV moved to the location of vertical cable using SSBL navigation and the video information. After arriving the location of vertical cable, the ROV grabbed the anchor and moved it to next target point. We carried out 3 time re-deployment VCS survey with four vertical cables in Iheya North Knoll, Okinawa Trough. The combined seismic sections of the 3 patches are consistent without any gap of each section. Following this, we modified the VCS system to use as a more efficient deep-tow seismic survey system. Although there are other deep-tow seismic systems, signal cables present challenges in deep waters. We use VCS technology in order to avoid these problems. The basic idea is autonomous recording system and we call it ACS

  19. Simulations of deep redshift surveys

    Science.gov (United States)

    Weinberg, David H.; Gunn, James E.

    1990-04-01

    Magnitude-limited redshift samples drawn from numerical simulations of the biased cold dark matter model are presented, with geometry matched to the recent survey by Geller and Huchra. At an apparent magnitude limit of 15.5, declination slices 20-deg thick have a frothy appearance; the visually dominant features in these slices are walls and filaments, the longest of which covers nearly half of the sky. Gravitational instability of Gaussian density fluctuations with a cold dark matter power spectrum can generate structures comparable in linear extent to the largest existing redshift surveys. Surveys to an apparent magnitude of 16.5 should reveal an even greater wealth of structure.

  20. Six switches solution for single-phase AC/DC/AC converter with capability of second-order power mitigation in DC-link capacitor

    DEFF Research Database (Denmark)

    Liu, Xiong; Wang, Peng; Loh, Poh Chiang

    2011-01-01

    This paper proposes an approach for DC-link second-order harmonic power cancellation in single-phase AC/DC/AC converter with reduced number of switches. The proposed six-switch converter has two bridges with three switches in each of them, where the middle switch in each bridge is shared by the AC...... on their modulation indices of the six-switch converter, and high modulation indices are proved to be feasible for second-order power cancellation in the DC-link based on the phase difference analysis. Both reduced switch numbers and DC electrolytic capacitor size can be achieved using the proposed converter....... Simulation results are provided to validate the effectiveness of the topology and control of the proposed sixswitch AC/DC/AC converter....

  1. Android Emotions Revealed

    DEFF Research Database (Denmark)

    Vlachos, Evgenios; Schärfe, Henrik

    2012-01-01

    in which case an android robot like the Geminoid|DK –a duplicate of an Original person- reveals emotions convincingly; when following an empirical perspective, or when following a theoretical one. The methodology includes the processes of acquiring the empirical data, and gathering feedback on them. Our...

  2. Citizenship Reporting in the American Community Survey

    Directory of Open Access Journals (Sweden)

    Jennifer Van Hook

    2013-07-01

    Full Text Available BACKGROUND Citizenship status among the foreign born is a crucial indicator of social and political incorporation, yet there are good reasons to suspect that citizenship status is inaccurately reported on U.S. surveys. OBJECTIVE This paper updates research carried out in the mid-1990s by Passel and Clark (1997 on the extent to which foreign-born noncitizen respondents in U.S. government-sponsored surveys misreport as naturalized citizens. METHODS We compare demographic estimates of the resident naturalized foreign-born population in 2010, based on administrative data, to estimates from the 2010 American Community Survey (ACS. RESULTS Similar to previous research, we find that misreporting in the ACS is especially high among immigrants from all countries/regions who report fewer than five years in the United States. We also find that among longer-term foreign-born residents, misreporting is concentrated only among those originating in Mexico, especially men of all ages and older women, a finding that diverges from Passel and Clark in that we find no evidence of overreporting among immigrants from Central America and the Caribbean. Finally, the estimated magnitude of misreporting, especially among longer-term Mexican-born men, is sensitive to assumptions about the rate of emigration in our administrative-based demographic estimates, and assumptions about coverage error in the ACS, though altering these assumptions does not change the conclusions drawn from the general patterns of the results. CONCLUSIONS For applications that use citizenship as an indicator of legal status, we recommend that self-reported data on citizenship be accepted at face value for all groups except those with fewer than five years of U.S. residence, Mexican men, and older Mexican women.

  3. EFEK MEDAN LISTRIK AC TERHADAP PERTUMBUHAN BAKTERI Klebsiella Pneumoniae

    Directory of Open Access Journals (Sweden)

    Mokhamad Tirono

    2013-05-01

    Full Text Available Penghambatan pertumbuhan bakteri Klebsiella pneumoniai pada ikan kembung dengan medan listrik alternating current (AC telah dilakukan. Medan Listrik AC yang digunakan divariasi dari 0,38 kV/cm sampai 5 kV/cm dengan frekwensi 50 Hz, sedangkan waktu paparan 10 menit. Pada penelitian ini dilakukan penumbuhan bakteri Klebsiella pneumonia pada media NA selama 24 jam dan berikutnya ditumbuhkan pada medium NB dan ikan yang sudah disterilkan selama 24 jam. Bakteri yang sudah ditumbuhkan pada medium NB dan ikan kemudian dipapar dengan medan listrik AC dengan variasi kuat medan yaitu dari 0,38 kV/cm sampai 5 kV/cm dengan waktu paparan 10 menit. Sehabis dipapar bakteri ditumbuhkan pada medium NB selama 24 jam dan berikutnya diencerkan dengan aquades untuk dihitung jumlah koloninya. Hasil uji menggunkan univariate analysis of variance didapatkan nilai signifisi 0,000 yang menunjukkan ada perbedaan yang signifikan untuk masing-masing kuat medan listrik. Menggunakan statistic post hoc test diperoleh bahwa dengan kuat medan 5 kV/cm mempunyai faktor hambat 0,99, sedangkan  dengan  kuat   medan  0,38   kV/cm  mempunyai  faktor   hambat   0,3.   Terhambatnya pertumbuhan bakteri ini disebabkan oleh karena membran seluler bakteri rusak, sehingga menyebabkan keluarnya materi intraseluler. Kerusakan membran seluler disebabkan oleh terjadinya elektroporasi yang dapat meningkatkan potensial membran. Semakin tinggi medan listrik yang dikenakan, maka peningkatan tegangan transmembran semakin tinggi.

  4. VizieR Online Data Catalog: Photometric survey of planetary nebulae in M31 (Veyette+, 2014)

    Science.gov (United States)

    Veyette, M. J.; Williams, B. F.; Dalcanton, J. J.; Balick, B.; Caldwell, N.; Fouesneau, M.; Girardi, L.; Gordon, K. D.; Kalirai, J.; Rosenfield, P.; Seth, A. C.

    2017-04-01

    The Panchromatic Hubble Andromeda Treasury (PHAT) is a Hubble Space Telescope (HST) multi-cycle imaging survey covering roughly one-third of M31's star-forming disk out to 20 kpc (Dalcanton et al. 2012ApJS..200...18D). Observations were made with the HST using the Advanced Camera for Surveys (ACS) and Wide Field Camera 3 (WFC3), with six filters spanning the UV (WFC3/UVIS F275W and F336W), the optical (ACS/WFC F475W and F814W), and the NIR (WFC3/IR F110W and F160W). (3 data files).

  5. Improvement of cotton fiber quality by transforming the acsA and acsB genes into Gossypium hirsutum L. by means of vacuum infiltration.

    Science.gov (United States)

    Li, X; Wang, X D; Zhao, X; Dutt, Y

    2004-04-01

    A novel method for the genetic transformation of cotton pollen by means of vacuum infiltration and Agrobacterium-mediated transformation is reported. The acsA and acsB genes, which are involved in cellulose synthesis in Acetobacter xylinum, were transferred into pollen grains of brown cotton with the aim of improving its fiber quality by incorporating useful prokaryotic features into the colored cotton plants. Transformation was carried out in cotton pollen-germinating medium, and transformation was mediated by vector pCAMBIA1301, which contains a reporter gene beta-glucuronidase (GUS), a selectable marker gene, hpt, for hygromycin resistance and the genes of interest, acsA and acsB. The integration and expression of acsA, acsB and GUS in the genome of transgenic plants were analyzed with Southern blot hybridization, PCR, histochemical GUS assay and Northern blot hybridization. We found that following pollination on the cotton stigma transformed pollen retained its capability of double-fertilization and that normal cotton seeds were produced in the cotton ovary. Of 1,039 seeds from 312 bolls pollinated with transformed pollen grains, 17 were able to germinate and grow into seedlings for more than 3 weeks in a nutrient medium containing 50 mg/l hygromycin; eight of these were transgenic plants integrated with acsA and acsB, yielding a 0.77% transformation rate. Fiber strength and length from the most positive transformants was 15% greater than those of the control (non-transformed), a significant difference, as was cellulose content between the transformed and control plants. Our study suggests that transformation through vacuum infiltration and Agrobacterium mediated transformation can be an efficient way to introduce foreign genes into the cotton pollen grain and that cotton fiber quality can be improved with the incorporation of the prokaryotic genes acsA and acsB.

  6. AC-photoconductivity measurement of C60 epitaxial film

    Energy Technology Data Exchange (ETDEWEB)

    Ohgami, T.; Shimada, Y.; Kubota, H.; Tanaka, H.; Matsuzaki, S.; Nagata, M. [Kumamoto Univ. (Japan). Dept. of Electr. Eng. and Comput. Sci.

    1997-08-01

    Band gap structure of C60 film coated by Au electrode is reported according to the AC-photoconductivity spectra. Applying bias voltage through the Au electrodes has verified Schottky barrier height of about 2 V. The spectra of the phase indicate that band gap has 1.85 eV at 300 K. With decreasing temperature, the magnitude of the gap expands to 1.91 eV at around 250 K corresponding to the structure change of C60 crystal. (orig.). 7 refs.

  7. AC dipole based optics measurement and correction at RHIC

    CERN Document Server

    Shen, X; Bai, M; White, S; Robert-Domolaize, G; Luo, Y; Marusic, A; Tomas, R

    2013-01-01

    Independent component analysis (ICA) was applied to the AC dipole based optics measurement at RHIC to extract beta functions as well as phase advances at each BPM. Existence of excessive beta-beat was observed in both rings of RHIC at polarized proton store energy. A unique global optics correction scheme was then developed and tested successfully during the RHIC polarized proton run in 2013. The feasibility of using horizontal closed orbit bump at sextupole for arc beta-beat correction was also demonstrated.

  8. Scaling laws for AC gas breakdown and implications for universality

    Science.gov (United States)

    Loveless, Amanda M.; Garner, Allen L.

    2017-10-01

    The reduced dependence on secondary electron emission and electrode surface properties makes radiofrequency (RF) and microwave (MW) plasmas advantageous over direct current (DC) plasmas for various applications, such as microthrusters. Theoretical models relating molecular constants to alternating current (AC) breakdown often fail due to incomplete understanding of both the constants and the mechanisms involved. This work derives simple analytic expressions for RF and MW breakdown, demonstrating the transition between these regimes at their high and low frequency limits, respectively. We further show that the limiting expressions for DC, RF, and MW breakdown voltage all have the same universal scaling dependence on pressure and gap distance at high pressure, agreeing with experiment.

  9. Warning: safety risk with some Apple AC Wall Plug Adapters

    CERN Multimedia

    CERN IT department

    2016-01-01

    Dear Mac and iOS Users, Apple has determined that some of its two prong Apple AC wall plug adapters may break and create a risk of electrical shock.   CERN users can now exchange their affected Apple wall plug adapters at the Service Desk. To find out if your adapter is affected and for any further information concerning the procedure to follow to exchange it, please check the following URL: https://cern.service-now.com/service-portal/view-outage.do?n=OTG0028639.

  10. Propiedades acústicas de los paneles de carrizo

    Directory of Open Access Journals (Sweden)

    Díaz, César

    2012-03-01

    Full Text Available Reed is a plant species very similar to common cane which is widespread all over the Earth. It is an ecological and sustainable material which is low-cost, aesthetically attractive, easy to obtain and install, and can be used in different construction systems. This work analyses the acoustic properties of reed panels from the point of view of sound absorption and sound insulation against airborne noise, according to the corresponding EN ISO standards. The experimental results obtained point to the conclusion that reed panels are suitable construction systems for controlling reverberant sound within a space, and that the sound reduction index values for different thicknesses of reed panels, or reed panels used in combination with wood particle boards, demonstrate the possibility of using them in construction as an element on the facades and roofs of buildings and for interior partitions.

    El carrizo es una especie vegetal, parecida a la caña común, que se encuentra ampliamente distribuida en la superficie terrestre. Es un material ecológico y sostenible de bajo coste, estéticamente aceptable, fácil de obtener y colocar, que permite generar diferentes sistemas constructivos. En este trabajo se analizan las propiedades acústicas de los paneles de carrizo en lo referente a la absorción acústica y al aislamiento acústico a ruido aéreo, para ello se han aplicado los procedimientos de las normas EN ISO correspondientes. De los resultados experimentales obtenidos se concluye que los paneles de carrizo son unos sistemas constructivos adecuados para el control del sonido reverberante en un recinto y que los valores del índice de reducción acústica de paneles de diferentes espesores o en combinación con tableros de partículas de madera muestran la posibilidad de utilizarlos en la edificación como elemento de fachada, en cubiertas de edificios y particiones interiores.

  11. Strongly nonlinear dynamics of electrolytes in large ac voltages

    DEFF Research Database (Denmark)

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    We study the response of a model microelectrochemical cell to a large ac voltage of frequency comparable to the inverse cell relaxation time. To bring out the basic physics, we consider the simplest possible model of a symmetric binary electrolyte confined between parallel-plate blocking electrodes...... layers. The latter is associated with transient diffusion limitation, which drives the formation and collapse of space-charge layers, even in the absence of any net Faradaic current through the cell. We also predict that steric effects of finite ion sizes (going beyond dilute-solution theory) act...

  12. Updated Measurements of ACS/SBC Dark Rates

    Science.gov (United States)

    Avila, R. J.

    2017-05-01

    The results of dark rate monitoring programs for the ACS/SBC are presented here. The dark rate has a very low and stable value of 8.11 × 106 cts/pix/s when the instrument is 25°C. In a 1000s exposure, less than 1% of pixels will have 1 count. As the instrument warms up, the overall dark rate increases due to an elevated dark rate in the central region of the detector. Recommendations are made regarding observation planning and data analysis.

  13. Distributed energy resources in grid interactive AC microgrids

    DEFF Research Database (Denmark)

    Wang, Xiongfei; Guerrero, Josep; Chen, Zhe

    2010-01-01

    Increased penetration of distributed energy resources (DER) and large-scale deployment of renewable energy sources are challenging the entire architecture of traditional power system. Microgrid, featuring higher flexibility and reliability, becomes an attractive candidate for the configuration...... of future electrical power system. This paper gives an overview of DER units in the grid interactive ac microgrid. The options in structures and control methods of power electronics interfaced DER units are described. Instantaneous load sharing strategies among DER units in the islanded microgrid operations...

  14. Total synthesis and allelopathic activity of cytosporones A-C

    Energy Technology Data Exchange (ETDEWEB)

    Zamberlam, Charles E.M.; Meza, Alisson; Lima, Denis P. de; Beatriz, Adilson [Centro de Ciencias Exatas e Tecnologia, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil); Leite, Carla Braga; Marques, Maria Rita [Centro de Ciencias Biologicas e da Saude, Universidade Federal de Mato Grosso do Sul, Campo Grande, MS (Brazil)

    2012-07-01

    The search for efficient, environmentally friendly herbicides has been the focus of numerous studies on the organic synthesis of compounds isolated from natural sources. Cytosporones, which are phenolic lipids isolated from fungi, exhibit noteworthy biological properties. This paper reports the preparation of cytosporones A-C from the same starting material through a short synthetic route, with good yields. All compounds were tested for allelopathic activity on lettuce (Lactuca sativa L) seeds. Cytosporone A and its methylated precursor showed remarkable allelopathic activity, inhibiting seed germination and plantule growth. (author)

  15. Impedance Localization Measurements using AC Dipoles in the LHC

    CERN Document Server

    Biancacci, Nicolo; Papotti, Giulia; Persson, Tobias; Salvant, Benoit; Tomás, Rogelio

    2016-01-01

    The knowledge of the LHC impedance is of primary importance to predict the machine performance and allow for the HL-LHC upgrade. The developed impedance model can be benchmarked with beam measurements in order to assess its validity and limit. This is routinely done, for example, moving the LHC collimator jaws and measuring the induced tune shift. In order to localize possible unknown impedance sources, the variation of phase advance with intensity between beam position monitors can be measured. In this work we will present the impedance localization measurements performed at injection in the LHC using AC dipoles as exciter as well as the underlying theory.

  16. Spectroscopic AC susceptibility imaging (sASI) of magnetic nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Ficko, Bradley W., E-mail: Bradley.W.Ficko@Dartmouth.edu; Nadar, Priyanka M.; Diamond, Solomon G.

    2015-02-01

    This study demonstrates a method for alternating current (AC) susceptibility imaging (ASI) of magnetic nanoparticles (mNPs) using low cost instrumentation. The ASI method uses AC magnetic susceptibility measurements to create tomographic images using an array of drive coils, compensation coils and fluxgate magnetometers. Using a spectroscopic approach in conjunction with ASI, a series of tomographic images can be created for each frequency measurement set and is termed sASI. The advantage of sASI is that mNPs can be simultaneously characterized and imaged in a biological medium. System calibration was performed by fitting the in-phase and out-of-phase susceptibility measurements of an mNP sample with a hydrodynamic diameter of 100 nm to a Brownian relaxation model (R{sup 2}=0.96). Samples of mNPs with core diameters of 10 and 40 nm and a sample of 100 nm hydrodynamic diameter were prepared in 0.5 ml tubes. Three mNP samples were arranged in a randomized array and then scanned using sASI with six frequencies between 425 and 925 Hz. The sASI scans showed the location and quantity of the mNP samples (R{sup 2}=0.97). Biological compatibility of the sASI method was demonstrated by scanning mNPs that were injected into a pork sausage. The mNP response in the biological medium was found to correlate with a calibration sample (R{sup 2}=0.97, p<0.001). These results demonstrate the concept of ASI and advantages of sASI. - Highlights: • Development of an AC susceptibility imaging model. • Comparison of AC susceptibility imaging (ASI) and susceptibility magnitude imaging (SMI). • Demonstration of ASI and spectroscopic ASI (sASI) using three different magnetic nanoparticle types. • SASI scan separation of three different magnetic nanoparticles samples using 5 spectroscopic frequencies. • Demonstration of biological feasibility of sASI.

  17. Security analysis of interconnected AC/DC systems

    DEFF Research Database (Denmark)

    Eriksson, Robert

    2015-01-01

    . The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...... any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage....

  18. Arthropods biodiversity index bollgard cotton (Cry1Ac) in Brazil

    OpenAIRE

    Thomazoni, Danielle; Ferreira Soria, Miguel; Degrande,Paulo Eduardo; Faccenda,Odival; Silvie, Pierre

    2013-01-01

    Shannon-Wiener's diversity index (SWI) was used under untreated conditions of a cotton field during the 2006/2007 crop season in the Cerrado region, Brazil. Comparison was carried out between the transgenic NuOpal® (Bollgard®)(Cry1Ac) and the non-transgenic isogenic variety DeltaOpal®. SWI was calculated for target pests, non-target herbivores and predators groups. Two sampling methods were used: whole plant observation and beat sheet. As expected, the mean number of target pests, especially ...

  19. What Are Probability Surveys?

    Science.gov (United States)

    The National Aquatic Resource Surveys (NARS) use probability-survey designs to assess the condition of the nation’s waters. In probability surveys (also known as sample-surveys or statistical surveys), sampling sites are selected randomly.

  20. Biocontrol activity of Paenibacillus polymyxa AC-1 against Pseudomonas syringae and its interaction with Arabidopsis thaliana.

    Science.gov (United States)

    Hong, Chi Eun; Kwon, Suk Yoon; Park, Jeong Mee

    2016-04-01

    Paenibacillus polymyxa AC-1 (AC-1) is a plant growth-promoting rhizobacterium (PGPR) that has been used as a soil inoculant for biocontrol of plant pathogenic fungi and to promote plant growth. In this study, we examine the effects of AC-1 on the bacterial phytopathogen Pseudomonas syringae and internal colonization of AC-1 by counting bacterial populations that colonize plants. AC-1 inhibited the growth of both P. syringae pv. tomato DC3000 (Pst) and P. syringae pv. tabaci (Pta) in a concentration-dependent manner in in vitro assays. Upon treatment of AC-1 dropping at root tip of axenically grown Arabidopsis, we found that most of the AC-1 was detected in interior of leaves of Arabidiopsis plants rather than roots after 5 days post infection, indicating systemic spreading of AC-1 occur. We examined further AC-1 colonization patterns in Arabidopsis mutants deficient in phytohormone signaling pathways. These results indicated that abscisic acid (ABA) and jasmonic acid (JA) signaling pathways positively and negatively contributed, respectively, to AC-1 colonization of leaves, whereas epiphytic accumulation of AC-1 around root tissues was not affected. This study shows that AC-1 is an effective biocontrol agent to suppress P. syringae growth, possibly owing to its colonization patterns as a leaf-inhabiting endophyte. The results showed in this work will help to expand our understanding of the mode of action of AC-1 as a biological control agent and consequently, its application in agriculture. Copyright © 2016 Elsevier GmbH. All rights reserved.

  1. GASPS—A Herschel Survey of Gas and Dust in Protoplanetary Disks: Summary and Initial Statistics : Summary and Initial Statistics

    NARCIS (Netherlands)

    Dent, W. R. F.; Thi, W. F.; Kamp, I.; Williams, J. P.; Menard, F.; Andrews, S.; Ardila, D.; Aresu, G.; Augereau, J. -C.; Barrado y Navascues, D.; Brittain, S.; Carmona, A.; Ciardi, D.; Danchi, W.; Donaldson, J.; Duchene, G.; Eiroa, C.; Fedele, D.; Grady, C.; de Gregorio-Molsalvo, I.; Howard, C.; Huelamo, N.; Krivov, A.; Lebreton, J.; Liseau, R.; Martin-Zaidi, C.; Mathews, G.; Meeus, G.; Mendigutia, I.; Montesinos, B.; Morales-Calderon, M.; Mora, A.; Nomura, H.; Pantin, E.; Pascucci, I.; Phillips, N.; Pinte, C.; Podio, L.; Ramsay, S. K.; Riaz, B.; Riviere-Marichalar, P.; Roberge, A.; Sandell, G.; Solano, E.; Tilling, I.; Torrelles, J. M.; Vandenbusche, B.; Vicente, S.; White, G. J.; Woitke, P.

    We describe a large-scale far-infrared line and continuum survey of protoplanetary disk through to young debris disk systems carried out using the ACS instrument on the Herschel Space Observatory. This Open Time Key program, known as GASPS (Gas Survey of Protoplanetary Systems), targeted ~250 young

  2. Novel acsF Gene Primers Revealed a Diverse Phototrophic Bacterial Population, Including Gemmatimonadetes, in Lake Taihu (China)

    Czech Academy of Sciences Publication Activity Database

    Huang, Y.; Zeng, Y.; Lu, H.; Feng, H.; Zeng, Yo.; Koblížek, Michal

    2016-01-01

    Roč. 82, č. 18 (2016), s. 5587-5594 ISSN 0099-2240 R&D Projects: GA ČR GA13-11281S; GA MŠk(CZ) LO1416 Institutional support: RVO:61388971 Keywords : AEROBIC ANOXYGENIC PHOTOTROPHS * MICROBIAL COMMUNITIES * OPERONS Subject RIV: EA - Cell Biology Impact factor: 3.807, year: 2016

  3. Diverse cadherin mutations conferring resistance to Bacillus thuringiensis toxin Cry1Ac in Helicoverpa armigera.

    Science.gov (United States)

    Zhao, Jing; Jin, Lin; Yang, Yihua; Wu, Yidong

    2010-02-01

    Transgenic cotton expressing Bacillus thuringiensis (Bt) toxins has been widely adopted to control some key lepidopteran pests including the bollworm Helicoverpa armigera. Evolution of resistance to Bt cotton by target pests is a major threat to the continued success of Bt cotton. Previous results revealed 3 null alleles (r1-r3) of a cadherin gene (Ha_BtR) conferring Cry1Ac resistance in H. armigera. An F(1) screen of 123 single-pair families was conducted between a Cry1Ac-resistant strain (the SCD-r1 strain, homozygous for the r1 allele of Ha_BtR) and field-derived insects from Jiangpu population (Jiangsu province, China) in 2008. Five new null alleles of Ha_BtR (r4-r8) were identified in six candidate single-pair families. These null alleles were created through either an insertion or a point mutation. Interestingly, intact alleles of Ha_BtR were found in two field-derived insects from another two candidate single-pair families. It suggests that these two field-derived insects may carry novel resistance alleles of Ha_BtR, with missense mutations resulting in a non-functional cadherin protein, or a major dominant mutation at a locus other than cadherin. The resistance allele frequency of Ha_BtR was detected at an appreciable level (0.024) in the Jiangpu population of H. armigera in 2008. Together with previous findings, a total of eight different resistance alleles of Ha_BtR were identified from three Chinese strains of H. armigera. Mutational diversity of Ha_BtR could impair DNA screening for Bt resistance allele frequency in the field, and an F(1) screen should be used routinely for monitoring cadherin-based resistance allele frequencies in H. armigera. 2010 Elsevier Ltd. All rights reserved.

  4. Three-phase AC-AC power converters based on matrix converter topology matrix-reactance frequency converters concept

    CERN Document Server

    Szczesniak, Pawel

    2013-01-01

    AC voltage frequency changes is one of the most important functions of solid state power converters. The most desirable features in frequency converters are the ability to generate load voltages with arbitrary amplitude and frequency, sinusoidal currents and voltages waveforms; the possibility of providing unity power factor for any load; and, finally, a simple and compact power circuit. Over the past decades, a number of different frequency converter topologies have appeared in the literature, but only the converters with either a voltage or current DC link are commonly used in industrial app

  5. Jumping number in the droplet jumping by resonant AC electrowetting

    Science.gov (United States)

    Lee, Sanghyun; Lee, Seung Jun; Kang, Kwang Hyoung

    2010-11-01

    The droplet jumping by resonant AC electrowetting (DJ-RACE) is recently introduced to transport droplets to vertical direction, whereby three-dimensional digital microfluidics are envisioned. In DJ-RACE, the central mechanism of the droplet jumping is the conversion of the surface energy stored by resonant AC electrowetting to the kinetic energy for jumping. Here, we newly introduce the jumping number (Ju=γ/ρgR^2), measuring the energy conversion in the jumping process and, thus, the feasibility of droplet jumping. Ju interprets that droplets having higher Ju can make higher and easier jumping, and smaller and lighter droplets with higher surface tension can have higher Ju. Practically, Ju should be greater than 1.5 for the droplet jumping, and active jumping was observed when Ju is greater than 5. In addition, Ju can predict the effect of diverse physicochemical changes in a system such as enzymatic additives or impurities on jumping, where it can also provide diverse strategies to compensate these changes. The newly introduced Ju could be the fundamental and useful parameter in the three-dimensional digital microfluidic devices based on DJ-RACE.

  6. AC-arbejdskraft i den vestlige del af Region Midtjylland

    DEFF Research Database (Denmark)

    Filges, Trine; Holt, Helle

    Denne rapport belyser muligheder og barrierer for AC-arbejdskraft i den vestlige del af Region Midtjylland. Undersøgelsen viser, at ca. 8 pct. af virksomhederne, der indgår i undersøgelsen, på interviewtidspunktet ønsker at rekruttere AC-arbejdskraft inden for 6 måneder. Undersøgelsen viser desuden......, at mange af virksomhederne forventer, at AC’eren møder på arbejdspladsen hver dag – og gerne, at de flytter til lokalområdet. Virksomhederne vurderer, at det er en barriere, at AC’erne har svært ved at se en videre karriere i lokalområdet, og at de foretrækker at pendle til arbejdspladsen. Dårlig...... infrastruktur nævnes i den forbindelse også som en barriere. Undersøgelsen bygger på en spørgeskemaundersøgelse blandt virksomheder i kommunerne: Lemvig, Holstebro, Herning, Ringkøbing-Skjern og Struer. Undersøgelsen er bestilt af Beskæftigelsesregion Midtjylland og er finansieret af Region Midtjylland og...

  7. Adaptive Sliding Mode Control of MEMS AC Voltage Reference Source

    Directory of Open Access Journals (Sweden)

    Ehsan Ranjbar

    2017-01-01

    Full Text Available The accuracy of physical parameters of a tunable MEMS capacitor, as the major part of MEMS AC voltage reference, is of great importance to achieve an accurate output voltage free of the malfunctioning noise and disturbance. Even though strenuous endeavors are made to fabricate MEMS tunable capacitors with desiderated accurate physical characteristics and ameliorate exactness of physical parameters’ values, parametric uncertainties ineluctably emerge in fabrication process attributable to imperfections in micromachining process. First off, this paper considers applying an adaptive sliding mode controller design in the MEMS AC voltage reference source so that it is capable of giving off a well-regulated output voltage in defiance of jumbling parametric uncertainties in the plant dynamics and also aggravating external disturbance imposed on the system. Secondly, it puts an investigatory comparison with the designed model reference adaptive controller and the pole-placement state feedback one into one’s prospective. Not only does the tuned adaptive sliding mode controller show remarkable robustness against slow parameter variation and external disturbance being compared to the pole-placement state feedback one, but also it immensely gets robust against the external disturbance in comparison with the conventional adaptive controller. The simulation results are promising.

  8. Enhanced apparatus for AC Zeeman experiments with ultracold potassium

    Science.gov (United States)

    Rotunno, Andrew; Du, Shuangli; Fancher, Charles; Pyle, Andrew; Aubin, Seth

    2016-05-01

    Ultracold atomic potassium is an excellent candidate for studies of the AC Zeeman force, due to small hyperfine splittings. These experiments require a sufficient sample of potassium near an atom chip supporting RF currents, and an RF source which can make rapid phase-continuous frequency sweeps for fast manipulation of spin states. We present progress on the construction of laser amplifier system for improved laser cooling and trapping of potassium, development of a frequency-agile RF source, and research on RF-capable atom chips. The laser amplifier system consists of two tapered amplifiers for producing 0.4 W of 767 nm light, with a goal of collecting 107 potassium atoms at 100 μK, which will then be cooled sympathetically with ultracold rubidium. We have constructed a direct digital synthesizer (DDS) to produce 1-400 MHz with Hz-level linewidth and noise level below -60dBc, and the ability to produce fast 100 μs frequency sweeps. We are investigating atom chip designs for supporting large RF currents. Immediate applications include AC Zeeman potentials and traps for atom interferometry, and quantum many-body physics. Work supported by AFOSR, W&M, and in part by AFRL.

  9. SOLAR TO AC POWER SOURCE FOR REMOTE AREAS USING SEIG

    Directory of Open Access Journals (Sweden)

    MEHMET AKBABA

    2012-02-01

    Full Text Available Photovoltaic generators (PVG are increasingly used to provide electricity in remote areas. However, in many applications the DC generated electricity by a PVG need to be converted to AC. Traditionally DC to AC inverters have been widely used for this purpose. In this paper, a different system is proposed in which a self excited induction generator (SEIG driven by a permanent magnet DC motor (DCM and powered from a PVG through a maximum power point tracker (MPPT are used. A step-up chopper is utilized as an MPPT unit. The proposed system is modelled in time domain, and a detailed transient and steady-state analysis are presented. The main reason behind analyzing the system in the time domain is because of the fact that for unknown speeds, the methods developed for steady-state analysis of SEIGs can not be applied. The presented work shows that the full available power of the PVG can be harnessed by selecting suitable values for the duty cycle and the frequency of the step up chopper and the excitation capacitor of the SEIG. It is also shown that with such a combination power utilization efficiency of more than 83% can be achieved.

  10. ACS sampling system: design, implementation, and performance evaluation

    Science.gov (United States)

    Di Marcantonio, Paolo; Cirami, Roberto; Chiozzi, Gianluca

    2004-09-01

    By means of ACS (ALMA Common Software) framework we designed and implemented a sampling system which allows sampling of every Characteristic Component Property with a specific, user-defined, sustained frequency limited only by the hardware. Collected data are sent to various clients (one or more Java plotting widgets, a dedicated GUI or a COTS application) using the ACS/CORBA Notification Channel. The data transport is optimized: samples are cached locally and sent in packets with a lower and user-defined frequency to keep network load under control. Simultaneous sampling of the Properties of different Components is also possible. Together with the design and implementation issues we present the performance of the sampling system evaluated on two different platforms: on a VME based system using VxWorks RTOS (currently adopted by ALMA) and on a PC/104+ embedded platform using Red Hat 9 Linux operating system. The PC/104+ solution offers, as an alternative, a low cost PC compatible hardware environment with free and open operating system.

  11. Dielectric and AC Conductivity Studies in PPy-Ag Nanocomposites

    Directory of Open Access Journals (Sweden)

    K. Praveenkumar

    2015-01-01

    Full Text Available Polypyrrole and silver nanoparticles have been synthesized at 277 K by chemical route. Nanoparticles of polypyrrole-silver (PPy-Ag composites were prepared by mixing polypyrrole and silver nanoparticles in different weight percentages. Dielectric properties as a function of temperature in the range from 300 K to 550 K and frequency in the range from 50 Hz to 1 MHz have been measured. Dielectric constant decreased with increase in frequency and temperature. Dielectric loss decreased with increase in frequency and increased with increase in temperature. Using dielectric data AC conductivity has been determined. Conductivity was found to be in the order of 10−3 (Ω−1 m−1 and it increased with increase in temperature. Temperature variation of conductivity data has been analyzed in the light of Mott’s polaron hopping model. Activation energy for conduction has been determined. Activation energy was determined to be in the order of meV and it has increased with increase in frequency and Ag nanoparticles content. This is the first time that PPy-Ag nanocomposites have been investigated for dielectric properties and AC conductivity and data analyzed thoroughly.

  12. AC-driven Organic Light Emission Devices with Carbon Nanotubes

    Energy Technology Data Exchange (ETDEWEB)

    Jeon, So-Yeon [Sungkyunkwan University, Suwon (Korea, Republic of); Yu, SeGi [Hankuk University of Foreign Studies, Yongin (Korea, Republic of)

    2017-02-15

    We have investigated alternating current (AC)-driven organic light-emitting devices (OLEDs), with carbon nanotubes (CNTs) incorporated within the emission layer. With CNT incorporation, the brightness of the OLEDs was substantially improved, and the turn-on voltage was reduced by at least a factor of five. Furthermore, the current levels of the CNT-incorporated OLEDs were lower than that of the reference device. A roughly 70% decrease in the current level was obtained for a CNT concentration of 0.03 wt%. This was accomplished by keeping the concentration of CNTs low and the length of CNTs short, which helped to suppress the percolation networking of CNTs within the emitting layer. Strong local electric fields near the end-tips of CNTs and micro-capacitors formed by dispersed CNTs might have caused this high brightness and these low currents. CNT incorporation in the emitting layer can improve the characteristics of AC-driven OLEDs, which are considered to be one of the candidates for flat panel displays and lightning devices.

  13. SQUIDs De-fluxing Using a Decaying AC Magnetic Field

    Energy Technology Data Exchange (ETDEWEB)

    Matlashov, Andrei Nikolaevich [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Semenov, Vasili Kirilovich [State Univ. of New York (SUNY), Plattsburgh, NY (United States); Anderson, Bill [Senior Scientific, LLC, Albuquerque, NM (United States)

    2016-06-08

    Flux trapping is the Achilles’ heel of all superconductor electronics. The most direct way to avoid flux trapping is a prevention of superconductor circuits from exposure to magnetic fields. Unfortunately this is not feasible if the circuits must be exposed to a strong DC magnetic field even for a short period of time. For example, such unavoidable exposures take place in superparamagnetic relaxation measurements (SPMR) and ultra-low field magnetic resonance imaging (ULF MRI) using unshielded thin-film SQUID-based gradiometers. Unshielded SQUIDs stop working after being exposed to DC magnetic fields of only a few Gauss in strength. In this paper we present experimental results with de-fluxing of planar thin-film LTS SQUID-based gradiometers using a strong decaying AC magnetic field. We used four commercial G136 gradiometers for SPMR measurements with up to a 10 mT magnetizing field. Strong 12.9 kHz decaying magnetic field pulses reliably return SQUIDs to normal operation 50 ms after zeroing the DC magnetizing field. This new AC de-fluxing method was also successfully tested with seven other different types of LTS SQUID sensors and has been shown to dissipate extremely low energy.

  14. Equivalence of Primary Control Strategies for AC and DC Microgrids

    Directory of Open Access Journals (Sweden)

    Eneko Unamuno

    2017-01-01

    Full Text Available Microgrid frequency and voltage regulation is a challenging task, as classical generators with rotational inertia are usually replaced by converter-interfaced systems that inherently do not provide any inertial response. The aim of this paper is to analyse and compare autonomous primary control techniques for alternating current (AC and direct current (DC microgrids that improve this transient behaviour. In this context, a virtual synchronous machine (VSM technique is investigated for AC microgrids, and its behaviour for different values of emulated inertia and droop slopes is tested. Regarding DC microgrids, a virtual-impedance-based algorithm inspired by the operation concept of VSMs is proposed. The results demonstrate that the proposed strategy can be configured to have an analogous behaviour to VSM techniques by varying the control parameters of the integrated virtual-impedances. This means that the steady-state and transient behaviour of converters employing these strategies can be configured independently. As shown in the simulations, this is an interesting feature that could be, for instance, employed for the integration of different dynamic generation or storage systems, such as batteries or supercapacitors.

  15. AC_ICAP: A Flexible High Speed ICAP Controller

    Directory of Open Access Journals (Sweden)

    Luis Andres Cardona

    2015-01-01

    Full Text Available The Internal Configuration Access Port (ICAP is the core component of any dynamic partial reconfigurable system implemented in Xilinx SRAM-based Field Programmable Gate Arrays (FPGAs. We developed a new high speed ICAP controller, named AC_ICAP, completely implemented in hardware. In addition to similar solutions to accelerate the management of partial bitstreams and frames, AC_ICAP also supports run-time reconfiguration of LUTs without requiring precomputed partial bitstreams. This last characteristic was possible by performing reverse engineering on the bitstream. Besides, we adapted this hardware-based solution to provide IP cores accessible from the MicroBlaze processor. To this end, the controller was extended and three versions were implemented to evaluate its performance when connected to Peripheral Local Bus (PLB, Fast Simplex Link (FSL, and AXI interfaces of the processor. In consequence, the controller can exploit the flexibility that the processor offers but taking advantage of the hardware speed-up. It was implemented in both Virtex-5 and Kintex7 FPGAs. Results of reconfiguration time showed that run-time reconfiguration of single LUTs in Virtex-5 devices was performed in less than 5 μs which implies a speed-up of more than 380x compared to the Xilinx XPS_HWICAP controller.

  16. AC-driven organic light emission devices with carbon nanotubes

    Science.gov (United States)

    Jeon, So-Yeon; Yu, SeGi

    2017-02-01

    We have investigated alternating current (AC)-driven organic light-emitting devices (OLEDs), with carbon nanotubes (CNTs) incorporated within the emission layer. With CNT incorporation, the brightness of the OLEDs was substantially improved, and the turn-on voltage was reduced by at least a factor of five. Furthermore, the current levels of the CNT-incorporated OLEDs were lower than that of the reference device. A roughly 70% decrease in the current level was obtained for a CNT concentration of 0.03 wt%. This was accomplished by keeping the concentration of CNTs low and the length of CNTs short, which helped to suppress the percolation networking of CNTs within the emitting layer. Strong local electric fields near the end-tips of CNTs and micro-capacitors formed by dispersed CNTs might have caused this high brightness and these low currents. CNT incorporation in the emitting layer can improve the characteristics of AC-driven OLEDs, which are considered to be one of the candidates for flat panel displays and lightning devices.

  17. A case of MUC5AC-positive intraductal neoplasm of the pancreas classified as an intraductal tubulopapillary neoplasm?

    Science.gov (United States)

    Muraki, Takashi; Uehara, Takeshi; Sano, Kenji; Oota, Hiroyoshi; Yoshizawa, Akihiko; Asaka, Shiho; Tateishi, Ayako; Otsuki, Toshiaki; Shingu, Kunihiko; Matoba, Hisanori; Kobayashi, Shota; Ichimata, Shojiro; Watanabe, Takayuki; Itou, Tetsuya; Tanaka, Eiji

    2015-12-01

    This report describes a unique case of intraductal tubulopapillary neoplasm (ITPN) of the pancreas in order to clarify its oncogenesis and more precisely classify pancreatic intraductal neoplasms. A 74-year-old man visited our institution for follow-up of acute pancreatitis. Imaging examinations revealed a hypovascular intraductal mass in the head of the pancreas with progressive dilation of the pancreatic duct, atrophy of the pancreatic parenchyma, and a non-mucinous appearance. A pancreatoduodenectomy was performed to identify this pancreatic intraductal neoplasm. Macroscopically, the tumor was a solid nodular mass with no visibly secreted mucin obstructing the dilated ducts. Histologically, it had a homogeneous appearance with nodules of back-to-back tubular glands and occasional papillary elements, and there were no apparent transitions to areas with less marked cytoarchitectural atypia. Although the intraductal neoplastic growth corresponded to an ITPN, immunohistochemical staining revealed partial positivity for MUC5AC, for which ITPNs are characteristically negative. Somatic mutations in KRAS, GNAS, BRAF, and PIK3CA were not detected. A loss of MUC5AC expression and mutations in KRAS and GNAS are key elements in the diagnosis of ITPN. Thus, it was difficult to distinguish the present case as a pancreatobiliary-type (PB-type) intraductal papillary mucinous neoplasm (IPMN) or a phenotypic variant of ITPN. As it is possible that some cases of PB-type IPMN and ITPN overlap, the precise classification of these rare lesions may require re-evaluation. Copyright © 2015 Elsevier GmbH. All rights reserved.

  18. Total Survey Error for Longitudinal Surveys

    NARCIS (Netherlands)

    Lynn, Peter; Lugtig, P.J.

    2016-01-01

    This article describes the application of the total survey error paradigm to longitudinal surveys. Several aspects of survey error, and of the interactions between different types of error, are distinct in the longitudinal survey context. Furthermore, error trade-off decisions in survey design and

  19. Repeat surveys of spawning cisco (Coregonus artedi) in western Lake Superior: timing, distribution and composition of spawning stocks

    Science.gov (United States)

    Yule, Daniel L.; Schreiner, Donald R.; Addison, Peter A.; Seider, Michael J.; Evrard, Lori M.; Geving, Steven A.; Quinlan, Henry R.

    2012-01-01

    Acoustic (AC) and midwater trawl (MT) surveys of spawning cisco (Coregonus artedi) in Lake Superior have been combined with commercial yield to estimate exploitation. To time surveys properly, it is important to understand when adults typically arrive at spawning grounds and how numbers change as the spawning season progresses. We conducted repeat autumn surveys during nighttime hours at coastal sites where commercial roe fisheries occur. Spawner densities increased significantly from October to mid-November, but differences measured at sites sampled from mid- to late-November were comparatively small. Spawners occupied the upper 20–30 m of the water column during mid-November before utilizing a wider range of depths by late-November. We compared repeat AC densities to temporal trends of catch-per-unit-effort (CPUE) in suspended commercial gillnets and found good agreement within sites. Because different gillnet mesh sizes were used in each roe fishery. CPUE and AC density were poorly correlated among sites. We recommend that future surveys be conducted between mid- and late-November, and that MT gear be used to measure cisco densities in the uppermost 10 m of the water column where AC estimates may be conservative. Given the short temporal window for assessing spawner density, we believe both AC-MT and gillnet surveys will be needed to ensure that harvest of different stocks is kept at a sustainable level.

  20. Active waveshaping of AC mains current in direct torque-controlled permanent magnet synchronous motor drive

    Energy Technology Data Exchange (ETDEWEB)

    Singh, Bim; Singh, B.P.; Dwivedi, Sanjeet [Indian Inst. of Technology, Dept. of Electrical Engineering, New Delhi (India)

    2006-07-01

    This paper deals with the power quality improvement of AC mains in Direct Torque-Controlled (DTC) permanent magnet synchronous motor (PMSM) drive using active wave shaping techniques. For this purpose, different topologies for active wave shaping of AC mains current in DTC-based PMSM drive such as single- and two-switch boost power factor correction (PFC) AC-DC converter, asymmetrical two-switch boost PFC AC-DC converter and single-phase voltage source AC-DC converter (VSC) are considered. The models are developed and simulated in MATLAB environment along with the Power System Blockset (PSB) and Simulink toolboxes to compute the relevant power quality performance indices. The simulated results demonstrate the effectiveness of different topologies in improving the power quality of the input AC mains in DTC-based PMSM drive. (Author)

  1. The Normal and Inverted Meyer-Neldel Rule in the ac Conductivity

    OpenAIRE

    ABDEL-WAHAB, Fouad

    2004-01-01

    Recently, a new approach has been proposed for the correlated barrier hopping (CBH) model where the ac relaxation time is thought to obey the Meyer-Neldel (MN) rule. This approach gives quantitative agreement with some reliable published experimental data. We report on an experiment involving the characterization of the ac conductivity of Se-Te thin films over a wide range of frequencies and temperatures, carried out in order to confirm applicability of the MN rule to the ac conducti...

  2. AC susceptibility in superconducting Pb-Bi alloys; Pb-Bi chodendotai no koryu taijiritsu

    Energy Technology Data Exchange (ETDEWEB)

    Matsuda, A.; Mawatari, K.; Akune, T.; Sakamoto, N. [Kyushu sangyo Univ., Fukuoka (Japan). Dept. of Electrical Engineering

    1999-11-10

    It is effective to measure the ac magnetic susceptibility by the control of the pin force. The control of pin force of the oxide superconductor measured the ac magnetic susceptibility using Pb-Bi alloy in which the control of the pin force was the easy metal system superconductor, because it is difficult, and then, evaluation and examination were carried out with peaks in the imaginary part of got ac magnetic susceptibility, etc. in respect of the relation with the pinning characteristics. (NEDO)

  3. Interlink Converter with Linear Quadratic Regulator Based Current Control for Hybrid AC/DC Microgrid

    Directory of Open Access Journals (Sweden)

    Dwi Riana Aryani

    2017-11-01

    Full Text Available A hybrid alternate current/direct current (AC/DC microgrid consists of an AC subgrid and a DC subgrid, and the subgrids are connected through the interlink bidirectional AC/DC converter. In the stand-alone operation mode, it is desirable that the interlink bidirectional AC/DC converter manages proportional power sharing between the subgrids by transferring power from the under-loaded subgrid to the over-loaded one. In terms of system security, the interlink bidirectional AC/DC converter takes an important role, so proper control strategies need to be established. In addition, it is assumed that a battery energy storage system is installed in one subgrid, and the coordinated control of interlink bidirectional AC/DC converter and battery energy storage system converter is required so that the power sharing scheme between subgrids becomes more efficient. For the purpose of designing a tracking controller for the power sharing by interlink bidirectional AC/DC converter in a hybrid AC/DC microgrid, a droop control method generates a power reference for interlink bidirectional AC/DC converter based on the deviation of the system frequency and voltages first and then interlink bidirectional AC/DC converter needs to transfer the power reference to the over-loaded subgrid. For efficiency of this power transferring, a linear quadratic regulator with exponential weighting for the current regulation of interlink bidirectional AC/DC converter is designed in such a way that the resulting microgrid can operate robustly against various uncertainties and the power sharing is carried out quickly. Simulation results show that the proposed interlink bidirectional AC/DC converter control strategy provides robust and efficient power sharing scheme between the subgrids without deteriorating the secure system operation.

  4. Instantaneous characteristics simulation and analysis on three-level brushless AC synchronous generators of aeronautic constant speed and frequency AC power system

    Science.gov (United States)

    Ma, Xiaohe; Shen, Songhua

    2006-11-01

    This paper mainly introduces theoretical analysis and experimental results of instantaneous characteristics on a certain three level brushless three-phase AC synchronous generators. The analysis, modeling and simulations with Simplorer software of Ansoft Company are carried out. It establishes three level generator models, gives theoretical relation matrix equation, and simulates some instantaneous characteristics. Design of the system requires reliable simulation tools with comprehensive component libraries capable of dealing with complex system behavior. The simulation results verify that the proposed system model can efficiently simulate the instantaneous characteristics of the real AC generator system. It gives better design experiences and digital methods for aeronautic constant speed and frequency AC power system.

  5. AcEST(EST sequences of Adiantum capillus-veneris and their annotation) - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us AcEST AcEST(EST sequences of Adiantum capillus-veneris and their annotation) Data detail Dat...a name AcEST(EST sequences of Adiantum capillus-veneris and their annotation) DOI 10.18908/lsdba.nbdc00839-0...01 Description of data contents EST sequence of Adiantum capillus-veneris and its annotation (clone ID, libr...le search URL http://togodb.biosciencedbc.jp/togodb/view/archive_acest#en Data acquisition method Capillary ...ainst UniProtKB/Swiss-Prot and UniProtKB/TrEMBL databases) Number of data entries Adiantum capillus-veneris

  6. AC losses in Bi2212 ROSAT wires exposed to an AC magnetic field(2); Bi2212 ROSAT senzai no koryu sonshitsu (2)

    Energy Technology Data Exchange (ETDEWEB)

    Fukuda, Y.; Matsumura, K.; Kajikawa, K.; Iwakuma, M.; Funaki, K. [Kyushu Univ., Fukuoka (Japan); Okada, M. [Hitachi Ltd., Tokyo (Japan)

    1999-11-10

    The wire rod the anisotropy is big for the Bi system superconductor, and it is processed in order to level the orientation of the superconductive crystal, thin tapelike. Therefore, wire rod itself of the rectangular cross section also has the anisotropy for critical current and ac loss characteristics. This time, the base metal was alloyed, and the ac loss was measured on improvement of mechanical strength and Bi2212ROSAT wire rod with the aim of making into low-loss, and it was compared and was examined with the ac loss of theoretical value and pure silver base metal ROSAT wire rod. (NEDO)

  7. Revealing the programming process

    DEFF Research Database (Denmark)

    Bennedsen, Jens; Caspersen, Michael Edelgaard

    2005-01-01

    One of the most important goals of an introductory programming course is that the students learn a systematic approach to the development of computer programs. Revealing the programming process is an important part of this; however, textbooks do not address the issue -- probably because...... the textbook medium is static and therefore ill-suited to expose the process of programming. We have found that process recordings in the form of captured narrated programming sessions are a simple, cheap, and efficient way of providing the revelation.We identify seven different elements of the programming...

  8. TypeScript revealed

    CERN Document Server

    Maharry, Dan

    2013-01-01

    TypeScript Revealed is a quick 100-page guide to Anders Hejlsberg's new take on JavaScript. With this brief, fast-paced introduction to TypeScript, .NET, Web and Windows 8 application developers who are already familiar with JavaScript will easily get up to speed with TypeScript and decide whether or not to start incorporating it into their own development. TypeScript is 'JavaScript for Application-scale development'; a superset of JavaScript that brings to it an additional object-oriented-like syntax familiar to .NET programmers that compiles down into simple, clean JavaScript that any browse

  9. Multiple Surveys of Students and Survey Fatigue

    Science.gov (United States)

    Porter, Stephen R.; Whitcomb, Michael E.; Weitzer, William H.

    2004-01-01

    This chapter reviews the literature on survey fatigue and summarizes a research project that indicates that administering multiple surveys in one academic year can significantly suppress response rates in later surveys. (Contains 4 tables.)

  10. Production of screw dislocations by the external dc and ac forces

    Science.gov (United States)

    Zhang, Xia; Duan, Wen-Shan; Gou, Xue-Qiang

    2017-11-01

    The effects of both the ac and the dc external driving forces on the production of screw dislocations are studied by employing the two-dimensional Frenkel-Kontorova model. The ac force is introduced in the model as a way to describe external periodic disturbances or artificial periodic forces. We find that the appearance of the screw dislocation is influenced by the frequency and amplitude of the ac force. It is shown that the screw dislocation can be easily produced by either the lower frequency or the larger amplitude of the ac force.

  11. Low ac loss geometries in YBCO coated conductors and impact on conductor stability

    Energy Technology Data Exchange (ETDEWEB)

    Duckworth, Robert C [ORNL; List III, Frederick Alyious [ORNL; Paranthaman, Mariappan Parans [ORNL; Rupich, M. W. [American Superconductor Corporation, Westborough, MA; Zhang, W. [American Superconductor Corporation, Westborough, MA; Xie, Y. Y. [SuperPower Incorporated, Schenectady, New York; Selvamanickam, V. [SuperPower Incorporated, Schenectady, New York

    2007-01-01

    Reduction of ac losses in applied ac fields can be accomplished through either the creation of filaments and bridging in YBCO coated conductors or an assembly of narrow width YBCO tapes. The ac losses for each of these geometries were measured at 77 K in perpendicular ac fields up to 100 mT. While ac loss reduction was achieved with YBCO filaments created through laser scribing and inkjet deposition, the assembly of stacked YBCO conductor provides an alternative method of ac loss reduction. When compared to a 4-mm wide YBCO coated conductor with a critical current of 60 A, the ac loss in a stack of 2-mm wide YBCO coated conductors with a similar total critical current was reduced. While the reduction in ac loss in a 2-mm wide stack coincided with the reduction in the engineering current density of the conductor, further reduction of ac loss was obtained through the splicing of the 2-mm wide tapes with low resistance solders. To better determine the practicality of these methods from a stability point of view, a numerical analysis was carried out to determine the influence of bridging and splicing on stability of a YBCO coated conductor for both liquid nitrogen-cooled and conduction cooled geometries.

  12. DC Vs AC - War Of Currents For Future Power Systems A HVDC Technology Overview

    Directory of Open Access Journals (Sweden)

    Anil K. Rai

    2015-08-01

    Full Text Available DC vs AC discussion began in 1880s with development of first commercial power transmission in Wall Street New York. Later when AC technology came into notice by efforts of inventor and researcher Sir Nicola Tesla soon the advantages of AC transmission and AC devices overtook the DC technology. It was hoped that DC technology had lost battle of currents. Today with researches going on FACTS devices and bulk power transmission HVDC has again gained a reputation in power sector. Solution of this centuries old debate is to develop HVDC systems that assists HVAC systems for better performance stability and control

  13. Analytical theory and possible detection of the ac quantum spin Hall effect.

    Science.gov (United States)

    Deng, W Y; Ren, Y J; Lin, Z X; Shen, R; Sheng, L; Sheng, D N; Xing, D Y

    2017-07-11

    We develop an analytical theory of the low-frequency ac quantum spin Hall (QSH) effect based upon the scattering matrix formalism. It is shown that the ac QSH effect can be interpreted as a bulk quantum pumping effect. When the electron spin is conserved, the integer-quantized ac spin Hall conductivity can be linked to the winding numbers of the reflection matrices in the electrodes, which also equal to the bulk spin Chern numbers of the QSH material. Furthermore, a possible experimental scheme by using ferromagnetic metals as electrodes is proposed to detect the topological ac spin current by electrical means.

  14. Update History of This Database - AcEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us AcEST Update History of This Database Date Update contents 2013/01/10 Errors found on AcEST ...s Database Database Description Download License Update History of This Data...base Site Policy | Contact Us Update History of This Database - AcEST | LSDB Archive ... ...Conting data have been correceted. For details, please refer to the following page. Data correction 2010/03/29 AcEST English archi

  15. Investigation of microflow reversal by ac electrokinetics in orthogonal electrodes for micropump design

    Science.gov (United States)

    Yang, Kai; Wu, Jie

    2008-01-01

    Orthogonal electrodes have been reported to produce high velocity microflows when excited by ac signals, showing potential for micropumping applications. This paper investigates the microflow reversal phenomena in such orthogonal electrode micropumps. Three types of microflow fields were observed by changing the applied electric signals. Three ac electrokinetic processes, capacitive electrode polarization, Faradaic polarization, and the ac electrothermal effect, are proposed to explain the different flow patterns, respectively. The hypotheses were corroborated by impedance analysis, numerical simulations, and velocity measurements. The investigation of microflow reversal can improve the understanding of ac electrokinetics and hence effectively manipulate fluids. PMID:19693404

  16. Appeals to AC as a Percentage of Appealable Hearing Level Dispositions

    Data.gov (United States)

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Requests for Review (RR) of hearing level decisions or dismissals filed with the Appeals Council (AC)...

  17. One-channel multi-function AC power monitor; Ichikairogata takino koryu denryoku monitor

    Energy Technology Data Exchange (ETDEWEB)

    Sudo, A.; Irumano, Y. [Fuji Electric Instruments Co. Ltd., Yamanashi (Japan)

    2000-10-10

    This AC power monitor receives inputs of AC voltage and AC current. With these inputs converted into digital data, the monitor calculates wattage, wattage-hour, reactive wattage, reactive wattage-hour, power factor, and frequency, and then saves the calculated data into the memory card periodically. The AC power monitor is designed as a useful tool for energy monitoring and saving. It can be used as an independent unit or a component linked to the high level system through the communication line. Exclusive-use split-type current transformers are prepared to make a current measurement system in combination with the monitor. (author)

  18. Effect of AC electric fields on the stabilization of premixed bunsen flames

    KAUST Repository

    Kim, Minkuk

    2011-01-01

    The stabilization characteristics of laminar premixed bunsen flames have been investigated experimentally for stoichiometric methane-air mixture by applying AC voltage to the nozzle with the single-electrode configuration. The detachment velocity either at blowoff or partial-detachment has been measured by varying the applied voltage and frequency of AC. The result showed that the detachment velocity increased with the applied AC electric fields, such that the flame could be nozzle-attached even over five times of the blowoff velocity without having electric fields. There existed four distinct regimes depending on applied AC voltage and frequency. In the low voltage regime, the threshold condition of AC electric fields was identified, below which the effect of electric fields on the detachment velocity is minimal. In the moderate voltage regime, the flame base oscillated with the frequency synchronized to AC frequency and the detachment velocity increased linearly with the applied AC voltage and nonlinearly with the frequency. In the high voltage regime, two different sub-regimes depending on AC frequency were observed. For relatively low frequency, the flame base oscillated with the applied AC frequency together with the half frequency and the variation of the detachment velocity was insensitive to the applied voltage. For relatively high frequency, the stabilization of the flame was significantly affected by the generation of streamers and the detachment velocity decreased with the applied voltage. © 2010 Published by Elsevier Inc. on behalf of The Combustion Institute. All rights reserved.

  19. An H2A Histone Isotype, H2ac, Associates with Telomere and Maintains Telomere Integrity.

    Directory of Open Access Journals (Sweden)

    Chia-Hsin Su

    Full Text Available Telomeres are capped at the ends of eukaryotic chromosomes and are composed of TTAGGG repeats bound to the shelterin complex. Here we report that a replication-dependent histone H2A isotype, H2ac, was associated with telomeres in human cells and co-immunoprecipitates with telomere repeat factor 2 (TRF2 and protection of telomeres protein 1 (POT1, whereas other histone H2A isotypes and mutations of H2ac did not bind to telomeres or these two proteins. The amino terminal basic domain of TRF2 was necessary for the association with H2ac and for the recruitment of H2ac to telomeres. Depletion of H2ac led to loss of telomeric repeat sequences, the appearance of dysfunctional telomeres, and chromosomal instability, including chromosomal breaks and anaphase bridges, as well as accumulation of telomere-associated DNA damage factors in H2ac depleted cells. Additionally, knockdown of H2ac elicits an ATM-dependent DNA damage response at telomeres and depletion of XPF protects telomeres against H2ac-deficiency-induced G-strand overhangs loss and DNA damage response, and prevents chromosomal instability. These findings suggest that the H2A isotype, H2ac, plays an essential role in maintaining telomere functional integrity.

  20. Togiak National Wildlife Refuge lake surveys, 1984

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Preliminary review of the data reveals that all lakes surveyed can be classified as having low conductibility, ranging from the low 20's for the Goodnews Lakes to...