Fusion of Radar and EO-sensors for Surveillance
Kester, L.J.H.M.; Theil, A.
2001-01-01
Fusion of radar and EO-sensors is investigated for the purpose of surveillance in littoral waters is. All sensors are considered to be co-located with respect to the distance, typically 1 to 10 km, of the area under surveillance. The sensor suite is a coherent polarimetric radar in combination with
Analysis of a Pareto Mixture Distribution for Maritime Surveillance Radar
Directory of Open Access Journals (Sweden)
Graham V. Weinberg
2012-01-01
Full Text Available The Pareto distribution has been shown to be an excellent model for X-band high-resolution maritime surveillance radar clutter returns. Given the success of mixture distributions in radar, it is thus of interest to consider the effect of Pareto mixture models. This paper introduces a formulation of a Pareto intensity mixture distribution and investigates coherent multilook radar detector performance using this new clutter model. Clutter parameter estimates are derived from data sets produced by the Defence Science and Technology Organisation's Ingara maritime surveillance radar.
PENGGUNAAN SECONDARY SURVEILLANCE RADAR UNTUK PENENTUAN POSISI PESAWAT UDARA
Directory of Open Access Journals (Sweden)
Akhmad Hafidz Irfandi
2015-02-01
Full Text Available Republik Indonesia merupakan negara kepulauan terbesar di dunia yang memiliki lebih dari 17.000 pulau dengan pertumbuhan demografi yang sangat pesat, hal ini menjadikan Indonesia sebagai negara berpenduduk terbesar ke-empat di dunia. Pesawat udara merupakan alat transportasi yang paling efektif dalam mendukung mobilitas penduduk.Navigasi atau pandu arah adalah penentuan kedudukan (position dan arah perjalanan baik di medan sebenarnya atau di peta. Navigasi ini dilakukan pada pesawat udara yang dipandu dari darat melalui sinyal yang dipancarkan oleh instrumen terpasang pada menara (ground base maupun sinyal dari satelit (satellite base.Dalam navigasi ada beberapa macam radar yang umum digunakan yaitu Primary Surveillance Radar (PSR dan Secondary Surveillance Radar (SSR.Kedua jenis radar baik PSR maupun SSR mempunyai cara kerja berbeda. Pada PSR sifatnya aktif dan pesawat yang ditargetkan sifatnya pasif.Karena PSR hanya menerima pantulan gelombang radio dari refleksi pesawat tersebut (echo.Sedangkan pesawat itu sendiri tidak ikut aktif dengan pancaran sinyal radar di bawah. Pada SSR, baik radar maupun pesawat kedua-duanya aktif. Hal ini dapat dilakukan karena pesawat terbang telah dilengkapi dengan transponder. Pesawat-pesawat yang tidak dilengkapi transponder tidak akan dapat dilihat pada radar scope seperti identifikasi pesawat, ketinggiannya, dan lain-lain.SSR merupakan peralatan untuk mendeteksi dan mengetahui posisi dan data target yang ada di sekelilingnya secara aktif, dimana pesawat ikut aktif jika menerima pancaran sinyal Radio Frequency (RF radar sekunder. Pancaran radar ini berupa pulsa-pulsa mode, pesawat yang dipasangi transponder, akan menerima pulsa-pulsa tersebut dan akan menjawab berupa pulsa-pulsa code ke sistem penerima radar.
Maritime target and sea clutter measurements with a coherent Doppler polarimetric surveillance radar
Smith, A.J.E.; Gelsema, S.J.; Kester, L.J.H.M.; Melief, H.W.; Premel Cabic, G.; Theil, A.; Woudenberg, E.
2002-01-01
Doppler polarimetry in a surveillance radar for the maritime surface picture is considered. This radar must be able to detect low-RCS targets in littoral environments. Measurements on such targets have been conducted with a coherent polarimetric measurement radar in March 2001 and preliminary
TDMA X-band FMCW MIMO radar for short range surveillance applications
Belfiori, F.; Maas, A.P.M.; Hoogeboom, P.; Rossum, W.L. van
2011-01-01
The work presented in this paper was aimed at the design of a compact radar device to be used for private area surveillance applications. The radar is connected to a pan tilt zoom camera and it provides the camera system with high accuracy position information (bearing and range) of moving targets;
An optimal beam alignment method for large-scale distributed space surveillance radar system
Huang, Jian; Wang, Dongya; Xia, Shuangzhi
2018-06-01
Large-scale distributed space surveillance radar is a very important ground-based equipment to maintain a complete catalogue for Low Earth Orbit (LEO) space debris. However, due to the thousands of kilometers distance between each sites of the distributed radar system, how to optimally implement the Transmitting/Receiving (T/R) beams alignment in a great space using the narrow beam, which proposed a special and considerable technical challenge in the space surveillance area. According to the common coordinate transformation model and the radar beam space model, we presented a two dimensional projection algorithm for T/R beam using the direction angles, which could visually describe and assess the beam alignment performance. Subsequently, the optimal mathematical models for the orientation angle of the antenna array, the site location and the T/R beam coverage are constructed, and also the beam alignment parameters are precisely solved. At last, we conducted the optimal beam alignment experiments base on the site parameters of Air Force Space Surveillance System (AFSSS). The simulation results demonstrate the correctness and effectiveness of our novel method, which can significantly stimulate the construction for the LEO space debris surveillance equipment.
Interval algebra - an effective means of scheduling surveillance radar networks
CSIR Research Space (South Africa)
Focke, RW
2015-05-01
Full Text Available Interval Algebra provides an effective means to schedule surveillance radar networks, as it is a temporal ordering constraint language. Thus it provides a solution to a part of resource management, which is included in the revised Data Fusion...
Interval algebra: an effective means of scheduling surveillance radar networks
CSIR Research Space (South Africa)
Focke, RW
2015-05-01
Full Text Available Interval Algebra provides an effective means to schedule surveillance radar networks, as it is a temporal ordering constraint language. Thus it provides a solution to a part of resource management, which is included in the revised Data Fusion...
Surveillance Unattended Foliage Penetrating Radar for Border Control and Homeland Protection
Directory of Open Access Journals (Sweden)
Felicia Amato
2013-06-01
Full Text Available The increasing request for safety, security and environment protection at local and national level reveal the deficiency of the traditional surveillance and control centers to satisfy the needs and requirements of modern border control systems for homeland protection where land border is expected to be monitored as well as the maritime one. This is, for instance, the case of any land border affected by hidden immigration and/or illegal traffics as well as any small areas such as critical infrastructures or military/ civilian posts in forest or jungle environment characterized by vegetation. In such challenging environment, logistics constraints strongly recommend to have very low power devices able to operate months or years without maintenance. A such scenario should be the perfect place for implementing an Unattended Ground Sensors (UGS network making use FOliage PENetration (FOPEN radar for border control. The paper aims to present the basic characteristics and preliminary results of a Surveillance Unattended FOPEN (SUF radar suitable for detecting moving targets, people or vehicles, in dense forest environment.
Directory of Open Access Journals (Sweden)
R. Murat Demirer
2012-01-01
Full Text Available The feasibility of using Commercial Off-The-Shelf (COTS sensor nodes is studied in a distributed network, aiming at dynamic surveillance and tracking of ground targets. Data acquisition by low-cost ( < $50 US miniature low-power radar through a wireless mote is described. We demonstrate the detection, ranging and velocity estimation, classification and tracking capabilities of the mini-radar, and compare results to simulations and manual measurements. Furthermore, we supplement the radar output with other sensor modalities, such as acoustic and vibration sensors. This method provides innovative solutions for detecting, identifying, and tracking vehicles and dismounts over a wide area in noisy conditions. This study presents a step towards distributed intelligent decision support and demonstrates effectiveness of small cheap sensors, which can complement advanced technologies in certain real-life scenarios.
Zosel, Amy; Bartelson, Becki Bucher; Bailey, Elise; Lowenstein, Steven; Dart, Rick
2013-01-01
Objective: To describe the characteristics and health effects of adolescent (age 13-19 years) prescription drug abuse and misuse using the Researched Abuse Diversion and Addiction-Related Surveillance (RADARS[R])) System. Method: Secondary analysis of data collected from RADARS System participating poison centers was performed. Data for all…
Kozma, Robert; Wang, Lan; Iftekharuddin, Khan; McCracken, Ernest; Khan, Muhammad; Islam, Khandakar; Bhurtel, Sushil R; Demirer, R Murat
2012-01-01
The feasibility of using Commercial Off-The-Shelf (COTS) sensor nodes is studied in a distributed network, aiming at dynamic surveillance and tracking of ground targets. Data acquisition by low-cost (wireless mote is described. We demonstrate the detection, ranging and velocity estimation, classification and tracking capabilities of the mini-radar, and compare results to simulations and manual measurements. Furthermore, we supplement the radar output with other sensor modalities, such as acoustic and vibration sensors. This method provides innovative solutions for detecting, identifying, and tracking vehicles and dismounts over a wide area in noisy conditions. This study presents a step towards distributed intelligent decision support and demonstrates effectiveness of small cheap sensors, which can complement advanced technologies in certain real-life scenarios.
A novel approach of collision assessment for coastal radar surveillance
International Nuclear Information System (INIS)
Ma, Feng; Chen, Yu-wang; Huang, Zi-chao; Yan, Xin-ping; Wang, Jin
2016-01-01
For coastal radar surveillance, this paper proposes a data-driven approach to estimate a blip's collision probability preliminarily based on two factors: the probability of it being a moving vessel and the collision potential of its position. The first factor is determined by a Directed Acyclic Graph (DAG), whose nodes represent the blip's characteristics, including the velocity, direction and size. Additionally, the structure and conditional probability tables of the DAG can be learned from verified samples. Subsequently, obstacles in a waterway can be described as collision potential fields using an Artificial Potential Field model, and the corresponding coefficients can be trained in accordance with the historical vessel distribution. Then, the other factor, the positional collision potential of any position is obtained through overlapping all the collision potential fields. For simplicity, only static obstacles have been considered. Eventually, the two factors are characterised as evidence, and the collision probability of a blip is estimated by combining them with Dempster's rule. Through ranking blips on collision probabilities, those that pose high threat to safety can be picked up in advance to remind radar operators. Particularly, a good agreement between the proposed approach and the manual operation was found in a preliminary test. - Highlights: • Novel estimation approach of collision probability for radar blips. • Novel method to evaluate the positional collision potentials using the APF model. • Novel method to obtain the coefficients of potential fields with historical data.
Performance indicators modern surveillance radar
Nooij, P.N.C.; Theil, A.
2014-01-01
Blake chart computations are widely employed to rank detection coverage capabilities of competitive search radar systems. Developed for comparable 2D radar systems with a mechanically rotating reflector antenna, it was not necessary to regard update rate and plot quality in Blake's chart. To
Radar ornithology and the conservation of migratory birds
Sidney A. Gauthreaux; Carroll G. Belser
2005-01-01
It is possible to study with surveillance radar the movements of migrating birds in the atmosphere at different spatial scales. At a spatial scale within a range of 6 kilometers, high-resolution, 3-centimeter wavelength surveillance radar (e.g. BIRDRAD) can detect the departure of migrants from different types of habitat within a few kilometers of the radar. The radar...
1990-12-01
Overviev . ......................................... 9 2. Programs , Syr!ems, and Services ........................ 11 a. National Weather Service...Equipment Appropriation. ADA, a computer system developed and maintained by the Office of Aviation Policy and rlans, facilitates APS-I processing... Program Plan. The primary benefit of LLWAS, TDWR, and modified airport surveillance radar is reduced risk and expected incidence of wind shear-related
1984-08-01
and FPS-60 -’ vacuum-tube radars. There will be remote control interface units ( RCIU ) for tube-type radars, and an ARSR-3 relocation and RIH package...Facility RCE Remote Control Equipment; Radio Control Equipment RCIU Remote Control Interface Units RCO Remote Communications Outlet RDCC Research
The monocular visual imaging technology model applied in the airport surface surveillance
Qin, Zhe; Wang, Jian; Huang, Chao
2013-08-01
At present, the civil aviation airports use the surface surveillance radar monitoring and positioning systems to monitor the aircrafts, vehicles and the other moving objects. Surface surveillance radars can cover most of the airport scenes, but because of the terminals, covered bridges and other buildings geometry, surface surveillance radar systems inevitably have some small segment blind spots. This paper presents a monocular vision imaging technology model for airport surface surveillance, achieving the perception of scenes of moving objects such as aircrafts, vehicles and personnel location. This new model provides an important complement for airport surface surveillance, which is different from the traditional surface surveillance radar techniques. Such technique not only provides clear objects activities screen for the ATC, but also provides image recognition and positioning of moving targets in this area. Thereby it can improve the work efficiency of the airport operations and avoid the conflict between the aircrafts and vehicles. This paper first introduces the monocular visual imaging technology model applied in the airport surface surveillance and then the monocular vision measurement accuracy analysis of the model. The monocular visual imaging technology model is simple, low cost, and highly efficient. It is an advanced monitoring technique which can make up blind spot area of the surface surveillance radar monitoring and positioning systems.
Radar Polarimetry and Interferometry (La polarimetrie et l'interferometrie radar) (CD-ROM)
National Research Council Canada - National Science Library
Keydel, W; Boerner, W. M; Pottier, E; Lee, J. S; Ferro-Famil, L; Hellmann, M; Cloude, S. R
2005-01-01
...: Scientists and engineers already engaged in the fields of radar surveillance, reconnaissance and scattering measurements, for instance, generally gain their specialist knowledge in both polarimetry...
Ultra-wideband radar sensors and networks
Leach, Jr., Richard R; Nekoogar, Faranak; Haugen, Peter C
2013-08-06
Ultra wideband radar motion sensors strategically placed in an area of interest communicate with a wireless ad hoc network to provide remote area surveillance. Swept range impulse radar and a heart and respiration monitor combined with the motion sensor further improves discrimination.
A Defender-Attacker Optimization of Port Radar Surveillance
2011-01-01
security; optimization; attacker-defender “And thence discover how with most advantage They may vex us with shot, or with assault.” Shakespeare , KingHenryVI...1. INTRODUCTION We introduce a new planning tool for locating shore radars and mobile picket boats with radar to maximize the probabil- ity that one
Low-resolution Airborne Radar Air/ground Moving Target Classification and Recognition
Directory of Open Access Journals (Sweden)
Wang Fu-you
2014-10-01
Full Text Available Radar Target Recognition (RTR is one of the most important needs of modern and future airborne surveillance radars, and it is still one of the key technologies of radar. The majority of present algorithms are based on wide-band radar signal, which not only needs high performance radar system and high target Signal-to-Noise Ratio (SNR, but also is sensitive to angle between radar and target. Low-Resolution Airborne Surveillance Radar (LRASR in downward-looking mode, slow flying aircraft and ground moving truck have similar Doppler velocity and Radar Cross Section (RCS, leading to the problem that LRASR air/ground moving targets can not be distinguished, which also disturbs detection, tracking, and classification of low altitude slow flying aircraft to solve these issues, an algorithm based on narrowband fractal feature and phase modulation feature is presented for LRASR air/ground moving targets classification. Real measured data is applied to verify the algorithm, the classification results validate the proposed method, helicopters and truck can be well classified, the average discrimination rate is more than 89% when SNR ≥ 15 dB.
Radar Target Classification using Recursive Knowledge-Based Methods
DEFF Research Database (Denmark)
Jochumsen, Lars Wurtz
The topic of this thesis is target classification of radar tracks from a 2D mechanically scanning coastal surveillance radar. The measurements provided by the radar are position data and therefore the classification is mainly based on kinematic data, which is deduced from the position. The target...... been terminated. Therefore, an update of the classification results must be made for each measurement of the target. The data for this work are collected throughout the PhD and are both collected from radars and other sensors such as GPS....
A target recognition method for maritime surveillance radars based on hybrid ensemble selection
Fan, Xueman; Hu, Shengliang; He, Jingbo
2017-11-01
In order to improve the generalisation ability of the maritime surveillance radar, a novel ensemble selection technique, termed Optimisation and Dynamic Selection (ODS), is proposed. During the optimisation phase, the non-dominated sorting genetic algorithm II for multi-objective optimisation is used to find the Pareto front, i.e. a set of ensembles of classifiers representing different tradeoffs between the classification error and diversity. During the dynamic selection phase, the meta-learning method is used to predict whether a candidate ensemble is competent enough to classify a query instance based on three different aspects, namely, feature space, decision space and the extent of consensus. The classification performance and time complexity of ODS are compared against nine other ensemble methods using a self-built full polarimetric high resolution range profile data-set. The experimental results clearly show the effectiveness of ODS. In addition, the influence of the selection of diversity measures is studied concurrently.
2014-09-01
3D Antenna Gain 0 dB Azimuth Accuracy 20°/quadrant 52 51. ELT/750 Receiver Figure 51: ELT/750 Receiver/processor...71]) The Itata ELINT system has been developed by Desarrollo de Tecnologia y Sistemas (DTS) Ltd. and is a high-sensitivity electronic... 3D Long Range Surveillance Radar. [Online]. Available: https://www.thalesgroup.com/en/worldwide/defence/smart-l- 3d - long-range-surveillance-radar
Extracting bird migration information from C-band Doppler weather radars
van Gasteren, H.; Holleman, I.; Bouten, W.; van Loon, E.; Shamoun-Baranes, J.
2008-01-01
Although radar has been used in studies of bird migration for 60 years, there is still no network in Europe for comprehensive monitoring of bird migration. Europe has a dense network of military air surveillance radars but most systems are not directly suitable for reliable bird monitoring. Since
The effects of radar on avian behavior: Implications for wildlife management at airports
Sheridan, Eleanor R
2014-01-01
Airports are areas with a high availability of resources for wildlife to forage, breed, and roost. Airports also have different types of radars to assist with air traffic control as well as tracking of wildlife that could become a risk for aircraft. The effect of radar electromagnetic radiation on wildlife behavior is not well understood. The goal of this study was to determine if bird behavior is affected by radar in two contexts: static radar (e.g., surveillance radar) and approaching radar...
A User Guide for Smoothing Air Traffic Radar Data
Bach, Ralph E.; Paielli, Russell A.
2014-01-01
Matlab software was written to provide smoothing of radar tracking data to simulate ADS-B (Automatic Dependent Surveillance-Broadcast) data in order to test a tactical conflict probe. The probe, called TSAFE (Tactical Separation-Assured Flight Environment), is designed to handle air-traffic conflicts left undetected or unresolved when loss-of-separation is predicted to occur within approximately two minutes. The data stream that is down-linked from an aircraft equipped with an ADS-B system would include accurate GPS-derived position and velocity information at sample rates of 1 Hz. Nation-wide ADS-B equipage (mandated by 2020) should improve surveillance accuracy and TSAFE performance. Currently, position data are provided by Center radar (nominal 12-sec samples) and Terminal radar (nominal 4.8-sec samples). Aircraft ground speed and ground track are estimated using real-time filtering, causing lags up to 60 sec, compromising performance of a tactical resolution tool. Offline smoothing of radar data reduces wild-point errors, provides a sample rate as high as 1 Hz, and yields more accurate and lag-free estimates of ground speed, ground track, and climb rate. Until full ADS-B implementation is available, smoothed radar data should provide reasonable track estimates for testing TSAFE in an ADS-B-like environment. An example illustrates the smoothing of radar data and shows a comparison of smoothed-radar and ADS-B tracking. This document is intended to serve as a guide for using the smoothing software.
National Research Council Canada - National Science Library
Grappel, Robert D; Harris, Garrett S; Kozar, Mark J; Wiken, Randall T
2008-01-01
...) and Enhanced Surveillance (ERS) data link applications. The intended audience for this report is an engineering staff assigned the task of implementing a monitoring system used to determine ELS and EHS compliance...
Comments on airborne ISR radar utilization
Doerry, A. W.
2016-05-01
A sensor/payload operator for modern multi-sensor multi-mode Intelligence, Surveillance, and Reconnaissance (ISR) platforms is often confronted with a plethora of options in sensors and sensor modes. This often leads an over-worked operator to down-select to favorite sensors and modes; for example a justifiably favorite Full Motion Video (FMV) sensor at the expense of radar modes, even if radar modes can offer unique and advantageous information. At best, sensors might be used in a serial monogamous fashion with some cross-cueing. The challenge is then to increase the utilization of the radar modes in a manner attractive to the sensor/payload operator. We propose that this is best accomplished by combining sensor modes and displays into `super-modes'.
Innovative SAR/MTI Concepts for Digital Radar
Wit, J.J.M. de
2008-01-01
Contemporary military operations make high demands on the capabilities of sensors. Modern sensors must have the capability to perform different tasks, such as ground surveillance and target tracking, simultaneously. Multifunction digital radar may provide the required capabilities and meet the
Low-Cost Mini Radar: Design Prototyping and Tests
Directory of Open Access Journals (Sweden)
Dario Tarchi
2017-01-01
Full Text Available Radar systems are largely employed for surveillance of wide and remote areas; the recent advent of drones gives the opportunity to exploit radar sensors on board of unmanned aerial platforms. Nevertheless, whereas drone radars are currently available for military applications, their employment in the civilian domain is still limited. The present research focuses on design, prototyping, and testing of an agile, low-cost, mini radar system, to be carried on board of Remotely Piloted Aircraft (RPAs or tethered aerostats. In particular, the paper faces the challenge to integrate the in-house developed radar sensor with a low-cost navigation board, which is used to estimate attitude and positioning data. In fact, a suitable synchronization between radar and navigation data is essential to properly reconstruct the radar picture whenever the platform is moving or the radar is scanning different azimuthal sectors. Preliminary results, relative to tests conducted in preoperational conditions, are provided and exploited to assert the suitable consistency of the obtained radar pictures. From the results, there is a high consistency between the radar images and the picture of the current environment emerges; finally, the comparison of radar images obtained in different scans shows the stability of the platform.
Assessing collision risk for birds and bats : radar survey
Energy Technology Data Exchange (ETDEWEB)
Brunet, R. [Genivar SEC, Sherbrooke, PQ (Canada)
2010-07-01
This PowerPoint presentation described some of the inventories and instrumentation available for monitoring winged fauna in and around wind farms. In addition to visual observations, bird calls and songs can be recorded to determine the amount and different types of birds located at wind farm sites. Radio-telemetry devices are also used to evaluate bird activities, and nest searches are conducted to determine the amount of eggs or young birds that will soon add to the bird population. Between 90 and 100 percent of birds and bats migrate at night. Acoustic radar, Doppler radar, and maritime surveillance radar instruments are used to monitor night-time activities in wind farm locations. Doppler radar is also used to detect bird and bat migration corridors. Screen-shots of various radar interfaces were presented. tabs., figs.
Overview of Experimental Pulse-Doppler Radar Data Collected Oct 1999
National Research Council Canada - National Science Library
Hughes, Steven
2000-01-01
The Defence Research Establishment Ottawa has designed and constructed an experimental air-to-air radar system as the first step in demonstrating an air-to-air surveillance capability for the Canadian...
IFT&E Industry Report Wind Turbine-Radar Interference Test Summary.
Energy Technology Data Exchange (ETDEWEB)
Karlson, Benjamin; LeBlanc, Bruce Philip.; Minster, David G; Estill, Milford; Miller, Bryan Edward; Busse, Franz (MIT LL); Keck, Chris (MIT LL); Sullivan, Jonathan (MIT LL); Brigada, David (MIT LL); Parker, Lorri (MIT LL); Younger, Richard (MIT LL); Biddle, Jason (MIT LL)
2014-10-01
Wind turbines have grown in size and capacity with today's average turbine having a power capacity of around 1.9 MW, reaching to heights of over 495 feet from ground to blade tip, and operating with speeds at the tip of the blade up to 200 knots. When these machines are installed within the line-of-sight of a radar system, they can cause significant clutter and interference, detrimentally impacting the primary surveillance radar (PSR) performance. The Massachusetts Institute of Technology's Lincoln Laboratory (MIT LL) and Sandia National Laboratories (SNL) were co-funded to conduct field tests and evaluations over two years in order to: I. Characterize the impact of wind turbines on existing Program-of-Record (POR) air surveillance radars; II. Assess near-term technologies proposed by industry that have the potential to mitigate the interference from wind turbines on radar systems; and III. Collect data and increase technical understanding of interference issues to advance development of long-term mitigation strategies. MIT LL and SNL managed the tests and evaluated resulting data from three flight campaigns to test eight mitigation technologies on terminal (short) and long-range (60 nmi and 250 nmi) radar systems. Combined across the three flight campaigns, more than 460 of hours of flight time were logged. This paper summarizes the Interagency Field Test & Evaluation (IFT&E) program and publicly- available results from the tests. It will also discuss the current wind turbine-radar interference evaluation process within the government and a proposed process to deploy mitigation technologies.
Localization Capability of Cooperative Anti-Intruder Radar Systems
Directory of Open Access Journals (Sweden)
Mauro Montanari
2008-06-01
Full Text Available System aspects of an anti-intruder multistatic radar based on impulse radio ultrawideband (UWB technology are addressed. The investigated system is composed of one transmitting node and at least three receiving nodes, positioned in the surveillance area with the aim of detecting and locating a human intruder (target that moves inside the area. Such systems, referred to also as UWB radar sensor networks, must satisfy severe power constraints worldwide imposed by, for example, the Federal Communications Commission (FCC and by the European Commission (EC power spectral density masks. A single transmitter-receiver pair (bistatic radar is considered at first. Given the available transmitted power and the capability of the receiving node to resolve the UWB pulses in the time domain, the surveillance area regions where the target is detectable, and those where it is not, are obtained. Moreover, the range estimation error for the transmitter-receiver pair is discussed. By employing this analysis, a multistatic system is then considered, composed of one transmitter and three or four cooperating receivers. For this multistatic system, the impact of the nodes location on area coverage, necessary transmitted power and localization uncertainty is studied, assuming a circular surveillance area. It is highlighted how area coverage and transmitted power, on one side, and localization uncertainty, on the other side, require opposite criteria of nodes placement. Consequently, the need for a system compromising between these factors is shown. Finally, a simple and effective criterion for placing the transmitter and the receivers is drawn.
Distributed radar network for real-time tracking of bullet trajectory
Zhang, Yimin; Li, Xin; Jin, Yuanwei; Amin, Moeness G.; Eydgahi, Ali
2009-05-01
Gunshot detection, sniper localization, and bullet trajectory prediction are of significant importance in military and homeland security applications. While the majority of existing work is based on acoustic and electro-optical sensors, this paper develops a framework of networked radar systems that uses distributed radar sensor networks to achieve the aforementioned objectives. The use of radio frequency radar systems allows the achievement of subtime- of-flight tracking response, enabling to response before the bullet reaches its target and, as such, effectively leading to the reduction of injuries and casualties in military and homeland security operations. The focus of this paper is to examine the MIMO radar concept with concurrent transmission of low-correlation waveforms from multiple radar sets to ensure wide surveillance coverage and maintain a high waveform repetition frequency for long coherent time interval required to achieve return signal concentration.
Reduction of snapshots for MIMO radar detection by block/group orthogonal matching pursuit
Ali, Hussain El Hosiny
2014-10-01
Multiple-input multiple-output (MIMO) radar works on the principle of transmission of independent waveforms at each element of its antenna array and is widely used for surveillance purposes. In this work, we investigate MIMO radar target localization problem with compressive sensing. Specifically, we try to solve the problem of estimation of target location in MIMO radar by group and block sparsity algorithms. It will lead us to a reduced number of snapshots required and also we can achieve better radar resolution. We will use group orthogonal matching pursuit (GOMP) and block orthogonal matching pursuit (BOMP) for our problem. © 2014 IEEE.
Enhancing Arctic Surveillance With Space-Based Radars
2013-06-01
180 degrees (Sellers, 2005). xvii Right Ascension of the Ascending Node: from a geocentric origin perspective, describes how an orbital plane...fascination with remote sensing and intelligence, surveillance, and reconnaissance from space. • Dr. Ray Buettner, my co-advisor, whose positive approach ...48 N; 169 W (northwest maritime corner) • 74 43 N; 156 34 W (uppermost maritime point in the Beaufort Sea approaching the Arctic Ocean) • 72 53 N
A comprehensive review on intelligent surveillance systems
Directory of Open Access Journals (Sweden)
Sutrisno Warsono Ibrahim
2016-05-01
Full Text Available Intelligent surveillance system (ISS has received growing attention due to the increasing demand on security and safety. ISS is able to automatically analyze image, video, audio or other type of surveillance data without or with limited human intervention. The recent developments in sensor devices, computer vision, and machine learning have an important role in enabling such intelligent system. This paper aims to provide general overview of intelligent surveillance system and discuss some possible sensor modalities and their fusion scenarios such as visible camera (CCTV, infrared camera, thermal camera and radar. This paper also discusses main processing steps in ISS: background-foreground segmentation, object detection and classification, tracking, and behavioral analysis.
Improving ISR Radar Utilization (How I quit blaming the user and made the radar easier to use).
Energy Technology Data Exchange (ETDEWEB)
Doerry, Armin Walter
2014-08-01
In modern multi - sensor multi - mode Intelligence, Surveillance, and Reconnaissance ( ISR ) platforms, the plethora of options available to a sensor/payload operator are quite large, leading to an over - worked operator often down - selecting to favorite sensors an d modes. For example, Full Motion Video (FMV) is justifiably a favorite sensor at the expense of radar modes, even if radar modes can offer unique and advantageous information. The challenge is then to increase the utilization of the radar modes in a man ner attractive to the sensor/payload operator. We propose that this is best accomplished by combining sensor modes and displays into 'super - modes'. - 4 - Acknowledgements This report is the result of a n unfunded research and development activity . Sandia Natio nal Laboratories is a multi - program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of Energy's National Nuclear Security Administration under contract DE - AC04 - 94AL850 00.
Ground Penetrating Radar for SMART CITIES
Soldovieri, Francesco; Catapano, Ilaria; Gennarelli, Gianluca
2016-04-01
The use of monitoring and surveillance technologies is now recognized as a reliable option of the overall smart cities management cycle, for the advantages that they offer in terms of: economically sustainable planning of the ordinary and extraordinary maintenance interventions; situational awareness of possible risks factors in view of a reliable early warning; improvement of the security of the communities especially in public environments. In this frame, the abstract will deal with the recent advances in the development and deployment of radar systems for the urban surveillance, exploitation of the subsurface resources and civil engineering structures. In particular, we will present the recent scientific developments and several examples of use of these systems in operational conditions.
Progress with enhancing veterinary surveillance in the United Kingdom.
Lysons, R E; Gibbens, J C; Smith, L H
2007-01-27
The UK has experienced various animal health events that have had national impact in recent years. In response, a ;Veterinary Surveillance Strategy' (VSS) was published in 2003, with the objective of enhancing and coordinating national veterinary surveillance practice in a way that would enable important animal health events to be detected and assessed more rapidly and reliably. The VSS adopts an integrated UK-wide approach, which includes widespread engagement with interested parties both within government and beyond. It proposes enhancing surveillance through improved collaboration; transparent and defensible prioritisation of government resources to surveillance; deriving better value from existing resources, and assuring quality of the surveillance reports and source data. This article describes progress with implementing the VSS, in particular the methodology for developing a functional network and creating an effective, quality-assured, information management system, RADAR.
Directory of Open Access Journals (Sweden)
Jiang Tie-zhen
2015-01-01
Full Text Available Space target surveillance generally uses active radars. To take full advantage of passive radars, the idea of using spaceborne illuminators of opportunity for space target detection is presented in this paper. Analysis of the detectable time and direct wave suppression shows that passive radar using spaceborne illuminators of opportunity can effectively detect a Low-Earth-Orbit (LEO target. Meanwhile, Ku and L band bi-static radar cross section of passive radars that use spaceborne illuminators of opportunity are presented by simulation, providing the basis of choosing space target forward scatter. Finally the key parameters, mainly system gain, accumulation time and radiation source selection are studied. Results show that system size using satellite TV signals as illuminators of opportunity is relatively small. These encouraging results should stimulate the development of passive radar detection of space targets using spaceborne illuminators of opportunity.
UK surveillance: provision of quality assured information from combined datasets.
Paiba, G A; Roberts, S R; Houston, C W; Williams, E C; Smith, L H; Gibbens, J C; Holdship, S; Lysons, R
2007-09-14
Surveillance information is most useful when provided within a risk framework, which is achieved by presenting results against an appropriate denominator. Often the datasets are captured separately and for different purposes, and will have inherent errors and biases that can be further confounded by the act of merging. The United Kingdom Rapid Analysis and Detection of Animal-related Risks (RADAR) system contains data from several sources and provides both data extracts for research purposes and reports for wider stakeholders. Considerable efforts are made to optimise the data in RADAR during the Extraction, Transformation and Loading (ETL) process. Despite efforts to ensure data quality, the final dataset inevitably contains some data errors and biases, most of which cannot be rectified during subsequent analysis. So, in order for users to establish the 'fitness for purpose' of data merged from more than one data source, Quality Statements are produced as defined within the overarching surveillance Quality Framework. These documents detail identified data errors and biases following ETL and report construction as well as relevant aspects of the datasets from which the data originated. This paper illustrates these issues using RADAR datasets, and describes how they can be minimised.
Radar-to-Radar Interference Suppression for Distributed Radar Sensor Networks
Directory of Open Access Journals (Sweden)
Wen-Qin Wang
2014-01-01
Full Text Available Radar sensor networks, including bi- and multi-static radars, provide several operational advantages, like reduced vulnerability, good system flexibility and an increased radar cross-section. However, radar-to-radar interference suppression is a major problem in distributed radar sensor networks. In this paper, we present a cross-matched filtering-based radar-to-radar interference suppression algorithm. This algorithm first uses an iterative filtering algorithm to suppress the radar-to-radar interferences and, then, separately matched filtering for each radar. Besides the detailed algorithm derivation, extensive numerical simulation examples are performed with the down-chirp and up-chirp waveforms, partially overlapped or inverse chirp rate linearly frequency modulation (LFM waveforms and orthogonal frequency division multiplexing (ODFM chirp diverse waveforms. The effectiveness of the algorithm is verified by the simulation results.
Multistatic Wireless Fidelity Network Based Radar – Results of the Chrcynno Experiment
Directory of Open Access Journals (Sweden)
S. Rzewuski
2014-04-01
Full Text Available This paper presents the theory and experimental result of passive radar using WIFI transmitters as illuminators of opportunity. As a result of experiments conducted on 17th August 2013 at airfield Chrcynno a Cessna C208 airplane was detected and tracked using multistatic passive radar system based on low power signal from WIFI network nodes, which were acting as non cooperative illuminators of opportunity. In the experiment 3 wireless access points were communicating with each other and illuminating the radar scene (airfield. The direct reference and reflected (surveillance signals have been acquired and processed using specially developed algorithm presented in the paper. After signal processing using Passive Coherent Location methods target has been detected. This paper describes in details the algorithms and the results of the experiment for the multistatic passive radar based on the WIFI signal.
Jan, Shau-Shiun; Kao, Yu-Chun
2013-05-17
The current trend of the civil aviation technology is to modernize the legacy air traffic control (ATC) system that is mainly supported by many ground based navigation aids to be the new air traffic management (ATM) system that is enabled by global positioning system (GPS) technology. Due to the low receiving power of GPS signal, it is a major concern to aviation authorities that the operation of the ATM system might experience service interruption when the GPS signal is jammed by either intentional or unintentional radio-frequency interference. To maintain the normal operation of the ATM system during the period of GPS outage, the use of the current radar system is proposed in this paper. However, the tracking performance of the current radar system could not meet the required performance of the ATM system, and an enhanced tracking algorithm, the interacting multiple model and probabilistic data association filter (IMMPDAF), is therefore developed to support the navigation and surveillance services of the ATM system. The conventional radar tracking algorithm, the nearest neighbor Kalman filter (NNKF), is used as the baseline to evaluate the proposed radar tracking algorithm, and the real flight data is used to validate the IMMPDAF algorithm. As shown in the results, the proposed IMMPDAF algorithm could enhance the tracking performance of the current aviation radar system and meets the required performance of the new ATM system. Thus, the current radar system with the IMMPDAF algorithm could be used as an alternative system to continue aviation navigation and surveillance services of the ATM system during GPS outage periods.
Directory of Open Access Journals (Sweden)
Shau-Shiun Jan
2013-05-01
Full Text Available The current trend of the civil aviation technology is to modernize the legacy air traffic control (ATC system that is mainly supported by many ground based navigation aids to be the new air traffic management (ATM system that is enabled by global positioning system (GPS technology. Due to the low receiving power of GPS signal, it is a major concern to aviation authorities that the operation of the ATM system might experience service interruption when the GPS signal is jammed by either intentional or unintentional radio-frequency interference. To maintain the normal operation of the ATM system during the period of GPS outage, the use of the current radar system is proposed in this paper. However, the tracking performance of the current radar system could not meet the required performance of the ATM system, and an enhanced tracking algorithm, the interacting multiple model and probabilistic data association filter (IMMPDAF, is therefore developed to support the navigation and surveillance services of the ATM system. The conventional radar tracking algorithm, the nearest neighbor Kalman filter (NNKF, is used as the baseline to evaluate the proposed radar tracking algorithm, and the real flight data is used to validate the IMMPDAF algorithm. As shown in the results, the proposed IMMPDAF algorithm could enhance the tracking performance of the current aviation radar system and meets the required performance of the new ATM system. Thus, the current radar system with the IMMPDAF algorithm could be used as an alternative system to continue aviation navigation and surveillance services of the ATM system during GPS outage periods.
Monostatic radar cross section of flying wing delta planforms
Directory of Open Access Journals (Sweden)
Sevoor Meenakshisundaram Vaitheeswaran
2017-04-01
Full Text Available The design of the flying wing and its variants shapes continues to have a profound influence in the design of the current and future use of military aircraft. There is very little in the open literature available to the understanding and by way of comparison of the radar cross section of the different wing planforms, for obvious reasons of security and sensitivity. This paper aims to provide an insight about the radar cross section of the various flying wing planforms that would aid the need and amount of radar cross section suppression to escape detection from surveillance radars. Towards this, the shooting and bouncing ray method is used for analysis. In this, the geometric optics theory is first used for launching and tracing the electromagnetic rays to calculate the electromagnetic field values as the waves bounce around the target. The physical optics theory is next used to calculate the final scattered electric field using the far field integration along the observation direction. For the purpose of comparison, all the planform shapes are assumed to be having the same area, and only the aspect ratio and taper ratio are varied to feature representative airplanes.
High resolution radar satellite imagery analysis for safeguards applications
Energy Technology Data Exchange (ETDEWEB)
Minet, Christian; Eineder, Michael [German Aerospace Center, Remote Sensing Technology Institute, Department of SAR Signal Processing, Wessling, (Germany); Rezniczek, Arnold [UBA GmbH, Herzogenrath, (Germany); Niemeyer, Irmgard [Forschungszentrum Juelich, Institue of Energy and Climate Research, IEK-6: Nuclear Waste Management and Reactor Safety, Juelich, (Germany)
2011-12-15
For monitoring nuclear sites, the use of Synthetic Aperture Radar (SAR) imagery shows essential promises. Unlike optical remote sensing instruments, radar sensors operate under almost all weather conditions and independently of the sunlight, i.e. time of the day. Such technical specifications are required both for continuous and for ad-hoc, timed surveillance tasks. With Cosmo-Skymed, TerraSARX and Radarsat-2, high-resolution SAR imagery with a spatial resolution up to 1m has recently become available. Our work therefore aims to investigate the potential of high-resolution TerraSAR data for nuclear monitoring. This paper focuses on exploiting amplitude of a single acquisition, assessing amplitude changes and phase differences between two acquisitions, and PS-InSAR processing of an image stack.
Ranger© - An Affordable, Advanced, Next-Generation, Dual-Pol, X-Band Weather Radar
Stedronsky, Richard
2014-05-01
The Enterprise Electronics Corporation (EEC) Ranger© system is a new generation, X-band (3 cm), Adaptive Polarization Doppler Weather Surveillance Radar that fills the gap between high-cost, high-power traditional radar systems and the passive ground station weather sensors. Developed in partnership with the University of Oklahoma Advanced Radar Research Center (ARRC), the system uses relatively low power solid-state transmitters and pulse compression technology to attain nearly the same performance capabilities of much more expensive traditional radar systems. The Ranger© also employs Adaptive Dual Polarization (ADP) techniques to allow Alternating or Simultaneous Dual Polarization capability with total control over the transmission polarization state using dual independent coherent transmitters. Ranger© has been designed using the very latest technology available in the industry and the technical and manufacturing experience gained through over four decades of successful radar system design and production at EEC. The entire Ranger© design concept emphasizes precision, stability, reliability, and value using proven solid state technology combined with the most advanced motion control system ever conceived for weather radar. Key applications include meteorology, hydrology, aviation, offshore oil/gas drilling, wind energy, and outdoor event situational awareness.
A Machine Learning-based Rainfall System for GPM Dual-frequency Radar
Tan, H.; Chandrasekar, V.; Chen, H.
2017-12-01
Precipitation measurement produced by the Global Precipitation Measurement (GPM) Dual-frequency Precipitation Radar (DPR) plays an important role in researching the water circle and forecasting extreme weather event. Compare with its predecessor - Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar (PR), GRM DPR measures precipitation in two different frequencies (i.e., Ku and Ka band), which can provide detailed information on the microphysical properties of precipitation particles, quantify particle size distribution and quantitatively measure light rain and falling snow. This paper presents a novel Machine Learning system for ground-based and space borne radar rainfall estimation. The system first trains ground radar data for rainfall estimation using rainfall measurements from gauges and subsequently uses the ground radar based rainfall estimates to train GPM DPR data in order to get space based rainfall product. Therein, data alignment between space DPR and ground radar is conducted using the methodology proposed by Bolen and Chandrasekar (2013), which can minimize the effects of potential geometric distortion of GPM DPR observations. For demonstration purposes, rainfall measurements from three rain gauge networks near Melbourne, Florida, are used for training and validation purposes. These three gauge networks, which are located in Kennedy Space Center (KSC), South Florida Water Management District (SFL), and St. Johns Water Management District (STJ), include 33, 46, and 99 rain gauge stations, respectively. Collocated ground radar observations from the National Weather Service (NWS) Weather Surveillance Radar - 1988 Doppler (WSR-88D) in Melbourne (i.e., KMLB radar) are trained with the gauge measurements. The trained model is then used to derive KMLB radar based rainfall product, which is used to train GPM DPR data collected from coincident overpasses events. The machine learning based rainfall product is compared against the GPM standard products
Ionospheric Impacts on UHF Space Surveillance
Jones, J. C.
2017-12-01
Earth's atmosphere contains regions of ionized plasma caused by the interaction of highly energetic solar radiation. This region of ionization is called the ionosphere and varies significantly with altitude, latitude, local solar time, season, and solar cycle. Significant ionization begins at about 100 km (E layer) with a peak in the ionization at about 300 km (F2 layer). Above the F2 layer, the atmosphere is mostly ionized but the ion and electron densities are low due to the unavailability of neutral molecules for ionization so the density decreases exponentially with height to well over 1000 km. The gradients of these variations in the ionosphere play a significant role in radio wave propagation. These gradients induce variations in the index of refraction and cause some radio waves to refract. The amount of refraction depends on the magnitude and direction of the electron density gradient and the frequency of the radio wave. The refraction is significant at HF frequencies (3-30 MHz) with decreasing effects toward the UHF (300-3000 MHz) range. UHF is commonly used for tracking of space objects in low Earth orbit (LEO). While ionospheric refraction is small for UHF frequencies, it can cause errors in range, azimuth angle, and elevation angle estimation by ground-based radars tracking space objects. These errors can cause significant errors in precise orbit determinations. For radio waves transiting the ionosphere, it is important to understand and account for these effects. Using a sophisticated radio wave propagation tool suite and an empirical ionospheric model, we calculate the errors induced by the ionosphere in a simulation of a notional space surveillance radar tracking objects in LEO. These errors are analyzed to determine daily, monthly, annual, and solar cycle trends. Corrections to surveillance radar measurements can be adapted from our simulation capability.
Radar equations for modern radar
Barton, David K
2012-01-01
Based on the classic Radar Range-Performance Analysis from 1980, this practical volume extends that work to ensure applicability of radar equations to the design and analysis of modern radars. This unique book helps you identify what information on the radar and its environment is needed to predict detection range. Moreover, it provides equations and data to improve the accuracy of range calculations. You find detailed information on propagation effects, methods of range calculation in environments that include clutter, jamming and thermal noise, as well as loss factors that reduce radar perfo
National Research Council Canada - National Science Library
Elkin, G
2001-01-01
.... The increased processing speed and memory size of the 9PAC hardware made it possible for new surveillance algorithms to be developed in software in order to provide improved primary radar and beacon...
AN/FPS-108 COBRA DANE Space Surveillance Mission Evolution
Chorman, P.; Boggs, J.
2013-09-01
It has been ten years since the COBRA DANE radar was restored to continuous full power operations in a more dedicated role of space debris tracking. Over this time, the satellite catalog population has grown and the overall average RCS value of cataloged objects has decreased dramatically, due to a combination of breakups and collisions together with the increased sensitivity offered by COBRA DANE's support to the network. This shift in catalog composition places new challenges on COBRA DANE and other debris tracking radars (PARCS and Eglin/FPS-85) to consistently track the ever-increasing number of small objects. Space Surveillance Network radars now operate at the limits of their detection performance, tracking several thousand new objects in a size category that only the most powerful and sensitive radars can observe (i.e., COBRA DANE's inherent Spacetrack mission software functionality remained better tuned for its original support role against the larger (known) orbital objects than for its more modern role in acquiring and reporting small debris in an appreciable number -- that is, until now. Several newly-identified software changes offer promise of significantly increased data yield that will make COBRA DANE an even more important asset for this evolving mission. In the course of assisting JSpOC, AFSPC, and USSTRATCOM with the ongoing challenges of lost satellite management, it was discovered that the radar's performance is being artificially restricted by mission software, rather than by the system's overall architectural design (power-aperture envelope and radar resources). This paper captures specific opportunities to improve COBRA DANE's Spacetrack mission performance, several of which are currently implemented and slated to become operational with the next two software releases. With one of the more prominent enhancements, COBRA DANE will be capable of autonomously 'fence tasking' all newly acquired small objects. Under the current operating paradigm
Zosel, Amy; Bartelson, Becki Bucher; Bailey, Elise; Lowenstein, Steven; Dart, Rick
2013-02-01
To describe the characteristics and health effects of adolescent (age 13-19 years) prescription drug abuse and misuse using the Researched Abuse Diversion and Addiction-Related Surveillance (RADARS(®)) System. Secondary analysis of data collected from RADARS System participating poison centers was performed. Data for all intentional exposures from 2007 through 2009 were used to describe adolescent prescription opioid (oxycodone, fentanyl, hydrocodone, hydromorphone, morphine, methadone, buprenorphine, and tramadol) and stimulant (methylphenidate and amphetamines) exposures. A total of 16,209 intentional adolescent exposures to prescription drugs were identified, 68% to opioids and 32% to stimulants. The mean age was 16.6 years (SD ± 1.7 years). Slightly more than half (52.4%) of drug mentions involved females. The five most frequently misused or abused drugs were hydrocodone (32%), amphetamines (18%), oxycodone (15%), methylphenidate (14%), and tramadol (11%). Of all exposures, 38% were classified as suspected suicidal. Of adolescents who intentionally exposed themselves to prescription drugs, 30% were treated in a health care facility, 2,792 of whom were admitted to the hospital, including 1,293 to the intensive care unit. A total of 17.2% of intentional exposures were associated with no effect, 38.9% minor effects, 23.3% moderate effects, 3.6% major effects, and 0.1% were associated with death. Oxycodone and methadone were associated with the most deaths. No deaths were associated with exposures to stimulants. Prescription drug misuse and abuse poses an important health problem and results in thousands of hospitalizations of adolescents per year. Further work is needed to develop focused interventions and educational programs to prevent prescription drug abuse and misuse by adolescents. Copyright © 2013 American Academy of Child and Adolescent Psychiatry. Published by Elsevier Inc. All rights reserved.
Phased-array radar design application of radar fundamentals
Jeffrey, Thomas
2009-01-01
Phased-Array Radar Design is a text-reference designed for electrical engineering graduate students in colleges and universities as well as for corporate in-house training programs for radar design engineers, especially systems engineers and analysts who would like to gain hands-on, practical knowledge and skills in radar design fundamentals, advanced radar concepts, trade-offs for radar design and radar performance analysis.
MATSurv: multisensor air traffic surveillance system
Yeddanapudi, Murali; Bar-Shalom, Yaakov; Pattipati, Krishna R.; Gassner, Richard R.
1995-09-01
This paper deals with the design and implementation of MATSurv 1--an experimental Multisensor Air Traffic Surveillance system. The proposed system consists of a Kalman filter based state estimator used in conjunction with a 2D sliding window assignment algorithm. Real data from two FAA radars is used to evaluate the performance of this algorithm. The results indicate that the proposed algorithm provides a superior classification of the measurements into tracks (i.e., the most likely aircraft trajectories) when compared to the aircraft trajectories obtained using the measurement IDs (squawk or IFF code).
Mass Processing of Sentinel-1 Images for Maritime Surveillance
Directory of Open Access Journals (Sweden)
Carlos Santamaria
2017-07-01
Full Text Available The free, full and open data policy of the EU’s Copernicus programme has vastly increased the amount of remotely sensed data available to both operational and research activities. However, this huge amount of data calls for new ways of accessing and processing such “big data”. This paper focuses on the use of Copernicus’s Sentinel-1 radar satellite for maritime surveillance. It presents a study in which ship positions have been automatically extracted from more than 11,500 Sentinel-1A images collected over the Mediterranean Sea, and compared with ship position reports from the Automatic Identification System (AIS. These images account for almost all the Sentinel-1A acquisitions taken over the area during the two-year period from the start of the operational phase in October 2014 until September 2016. A number of tools and platforms developed at the European Commission’s Joint Research Centre (JRC that have been used in the study are described in the paper. They are: (1 Search for Unidentified Maritime Objects (SUMO, a tool for ship detection in Synthetic Aperture Radar (SAR images; (2 the JRC Earth Observation Data and Processing Platform (JEODPP, a platform for efficient storage and processing of large amounts of satellite images; and (3 Blue Hub, a maritime surveillance GIS and data fusion platform. The paper presents the methodology and results of the study, giving insights into the new maritime surveillance knowledge that can be gained by analysing such a large dataset, and the lessons learnt in terms of handling and processing the big dataset.
Fractionally Spaced Constant Modulus Equalizer with Recognition Capability for Digital Array Radar
Directory of Open Access Journals (Sweden)
Feng Wang
2017-01-01
Full Text Available Fractionally spaced blind equalizer (BE based on constant modulus criteria is exploited to compensate for the channel-to-channel mismatch in a digital array radar. We apply the technique of recognition to improve the stability and reliability of the BE. The surveillance of the calibration signal and the convergence property of BE are both implemented with recognition description words. BE with cognitive capability is appropriate for the equalization of a digital array radar with thousands of channels and hundreds of working frequencies, where reliability becomes the most concerned indicator. The improvement of performance in the accidental scenarios is tested via numerical simulations with the cost of increased computational complexity.
Fpga based L-band pulse doppler radar design and implementation
Savci, Kubilay
As its name implies RADAR (Radio Detection and Ranging) is an electromagnetic sensor used for detection and locating targets from their return signals. Radar systems propagate electromagnetic energy, from the antenna which is in part intercepted by an object. Objects reradiate a portion of energy which is captured by the radar receiver. The received signal is then processed for information extraction. Radar systems are widely used for surveillance, air security, navigation, weather hazard detection, as well as remote sensing applications. In this work, an FPGA based L-band Pulse Doppler radar prototype, which is used for target detection, localization and velocity calculation has been built and a general-purpose Pulse Doppler radar processor has been developed. This radar is a ground based stationary monopulse radar, which transmits a short pulse with a certain pulse repetition frequency (PRF). Return signals from the target are processed and information about their location and velocity is extracted. Discrete components are used for the transmitter and receiver chain. The hardware solution is based on Xilinx Virtex-6 ML605 FPGA board, responsible for the control of the radar system and the digital signal processing of the received signal, which involves Constant False Alarm Rate (CFAR) detection and Pulse Doppler processing. The algorithm is implemented in MATLAB/SIMULINK using the Xilinx System Generator for DSP tool. The field programmable gate arrays (FPGA) implementation of the radar system provides the flexibility of changing parameters such as the PRF and pulse length therefore it can be used with different radar configurations as well. A VHDL design has been developed for 1Gbit Ethernet connection to transfer digitized return signal and detection results to PC. An A-Scope software has been developed with C# programming language to display time domain radar signals and detection results on PC. Data are processed both in FPGA chip and on PC. FPGA uses fixed
Aulenbacher, Uwe; Rech, Klaus; Sedlmeier, Johannes; Pratisto, Hans; Wellig, Peter
2014-10-01
Ground based millimeter wave radar sensors offer the potential for a weather-independent automatic ground surveillance at day and night, e.g. for camp protection applications. The basic principle and the experimental verification of a radar system concept is described, which by means of an extreme off-axis positioning of the antenna(s) combines azimuthal mechanical beam steering with the formation of a circular-arc shaped synthetic aperture (SA). In automatic ground surveillance the function of search and detection of moving ground targets is performed by means of the conventional mechanical scan mode. The rotated antenna structure designed as a small array with two or more RX antenna elements with simultaneous receiver chains allows to instantaneous track multiple moving targets (monopulse principle). The simultaneously operated SAR mode yields areal images of the distribution of stationary scatterers. For ground surveillance application this SAR mode is best suited for identifying possible threats by means of change detection. The feasibility of this concept was tested by means of an experimental radar system comprising of a 94 GHz (W band) FM-CW module with 1 GHz bandwidth and two RX antennas with parallel receiver channels, placed off-axis at a rotating platform. SAR mode and search/track mode were tested during an outdoor measurement campaign. The scenery of two persons walking along a road and partially through forest served as test for the capability to track multiple moving targets. For SAR mode verification an image of the area composed of roads, grassland, woodland and several man-made objects was reconstructed from the measured data.
Design and Implementation of a FPGA and DSP Based MIMO Radar Imaging System
Directory of Open Access Journals (Sweden)
Wei Wang
2015-06-01
Full Text Available The work presented in this paper is aimed at the implementation of a real-time multiple-input multiple-output (MIMO imaging radar used for area surveillance. In this radar, the equivalent virtual array method and time-division technique are applied to make 16 virtual elements synthesized from the MIMO antenna array. The chirp signal generater is based on a combination of direct digital synthesizer (DDS and phase locked loop (PLL. A signal conditioning circuit is used to deal with the coupling effect within the array. The signal processing platform is based on an efficient field programmable gates array (FPGA and digital signal processor (DSP pipeline where a robust beamforming imaging algorithm is running on. The radar system was evaluated through a real field experiment. Imaging capability and real-time performance shown in the results demonstrate the practical feasibility of the implementation.
Energy Technology Data Exchange (ETDEWEB)
Raynal, Ann Marie [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Hensley, Jr., William H. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Burns, Bryan L. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Doerry, Armin Walter [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)
2014-11-01
The linear ground distance per unit time and ground area covered per unit time of producing synthetic aperture radar (SAR) imagery, termed rate of advance (ROA) and area coverage rate (ACR), are important metrics for platform and radar performance in surveillance applications. These metrics depend on many parameters of a SAR system such as wavelength, aircraft velocity, resolution, antenna beamwidth, imaging mode, and geometry. Often the effects of these parameters on rate of advance and area coverage rate are non-linear. This report addresses the impact of different parameter spaces as they relate to rate of advance and area coverage rate performance.
Improved Detection of Human Respiration Using Data Fusion Basedon a Multistatic UWB Radar
Directory of Open Access Journals (Sweden)
Hao Lv
2016-09-01
Full Text Available This paper investigated the feasibility for improved detection of human respiration using data fusion based on a multistatic ultra-wideband (UWB radar. UWB-radar-based respiration detection is an emerging technology that has great promise in practice. It can be applied to remotely sense the presence of a human target for through-wall surveillance, post-earthquake search and rescue, etc. In these applications, a human target’s position and posture are not known a priori. Uncertainty of the two factors results in a body orientation issue of UWB radar, namely the human target’s thorax is not always facing the radar. Thus, the radial component of the thorax motion due to respiration decreases and the respiratory motion response contained in UWB radar echoes is too weak to be detected. To cope with the issue, this paper used multisensory information provided by the multistatic UWB radar, which took the form of impulse radios and comprised one transmitting and four separated receiving antennas. An adaptive Kalman filtering algorithm was then designed to fuse the UWB echo data from all the receiving channels to detect the respiratory-motion response contained in those data. In the experiment, a volunteer’s respiration was correctly detected when he curled upon a camp bed behind a brick wall. Under the same scenario, the volunteer’s respiration was detected based on the radar’s single transmitting-receiving channels without data fusion using conventional algorithm, such as adaptive line enhancer and single-channel Kalman filtering. Moreover, performance of the data fusion algorithm was experimentally investigated with different channel combinations and antenna deployments. The experimental results show that the body orientation issue for human respiration detection via UWB radar can be dealt well with the multistatic UWB radar and the Kalman-filter-based data fusion, which can be applied to improve performance of UWB radar in real applications.
Lanzagorta, Marco
2011-01-01
This book offers a concise review of quantum radar theory. Our approach is pedagogical, making emphasis on the physics behind the operation of a hypothetical quantum radar. We concentrate our discussion on the two major models proposed to date: interferometric quantum radar and quantum illumination. In addition, this book offers some new results, including an analytical study of quantum interferometry in the X-band radar region with a variety of atmospheric conditions, a derivation of a quantum radar equation, and a discussion of quantum radar jamming.This book assumes the reader is familiar w
Performance test and verification of an off-the-shelf automated avian radar tracking system.
May, Roel; Steinheim, Yngve; Kvaløy, Pål; Vang, Roald; Hanssen, Frank
2017-08-01
Microwave radar is an important tool for observation of birds in flight and represents a tremendous increase in observation capability in terms of amount of surveillance space that can be covered at relatively low cost. Based on off-the-shelf radar hardware, automated radar tracking systems have been developed for monitoring avian movements. However, radar used as an observation instrument in biological research has its limitations that are important to be aware of when analyzing recorded radar data. This article describes a method for exploring the detection capabilities of a dedicated short-range avian radar system used inside the operational Smøla wind-power plant. The purpose of the testing described was to find the maximum detection range for various sized birds, while controlling for the effects of flight tortuosity, flight orientation relative to the radar and ground clutter. The method was to use a dedicated test target in form of a remotely controlled unmanned aerial vehicle (UAV) with calibrated radar cross section (RCS), which enabled the design of virtually any test flight pattern within the area of interest. The UAV had a detection probability of 0.5 within a range of 2,340 m from the radar. The detection performance obtained by the RCS-calibrated test target (-11 dBm 2 , 0.08 m 2 RCS) was then extrapolated to find the corresponding performance of differently sized birds. Detection range depends on system sensitivity, the environment within which the radar is placed and the spatial distribution of birds. The avian radar under study enables continuous monitoring of bird activity within a maximum range up to 2 km dependent on the size of the birds in question. While small bird species may be detected up to 0.5-1 km, larger species may be detected up to 1.5-2 km distance from the radar.
Radar-Derived Quantitative Precipitation Estimation Based on Precipitation Classification
Directory of Open Access Journals (Sweden)
Lili Yang
2016-01-01
Full Text Available A method for improving radar-derived quantitative precipitation estimation is proposed. Tropical vertical profiles of reflectivity (VPRs are first determined from multiple VPRs. Upon identifying a tropical VPR, the event can be further classified as either tropical-stratiform or tropical-convective rainfall by a fuzzy logic (FL algorithm. Based on the precipitation-type fields, the reflectivity values are converted into rainfall rate using a Z-R relationship. In order to evaluate the performance of this rainfall classification scheme, three experiments were conducted using three months of data and two study cases. In Experiment I, the Weather Surveillance Radar-1988 Doppler (WSR-88D default Z-R relationship was applied. In Experiment II, the precipitation regime was separated into convective and stratiform rainfall using the FL algorithm, and corresponding Z-R relationships were used. In Experiment III, the precipitation regime was separated into convective, stratiform, and tropical rainfall, and the corresponding Z-R relationships were applied. The results show that the rainfall rates obtained from all three experiments match closely with the gauge observations, although Experiment II could solve the underestimation, when compared to Experiment I. Experiment III significantly reduced this underestimation and generated the most accurate radar estimates of rain rate among the three experiments.
Directory of Open Access Journals (Sweden)
Tang Jun
2015-08-01
Full Text Available In this paper, the definition and the key features of Software Radar, which is a new concept, are proposed and discussed. We consider the development of modern radar system technology to be divided into three stages: Digital Radar, Software radar and Intelligent Radar, and the second stage is just commencing now. A Software Radar system should be a combination of various modern digital modular components conformed to certain software and hardware standards. Moreover, a software radar system with an open system architecture supporting to decouple application software and low level hardware would be easy to adopt "user requirements-oriented" developing methodology instead of traditional "specific function-oriented" developing methodology. Compared with traditional Digital Radar, Software Radar system can be easily reconfigured and scaled up or down to adapt to the changes of requirements and technologies. A demonstration Software Radar signal processing system, RadarLab 2.0, which has been developed by Tsinghua University, is introduced in this paper and the suggestions for the future development of Software Radar in China are also given in the conclusion.
Directory of Open Access Journals (Sweden)
Miljko Erić
2004-05-01
Full Text Available Za sprovođenje savremenih operacija, kako na operativno-strategijskom, tako i na taktič kom nivou, izuzetno je važno da se obezbedi kontinuirani nadzor vazdušnog prostora. Poznato je da su aktivni radarski sistemi, na kojima se kod nas trenutno zasniva nadzor vazdušnog prostora, u ratnim uslovima veoma ranjivi i podložni elektronskim i borbenim dejstvima protivnika, što je u toku rata 1999. godine i praktično potvrđeno. Kao alternativa aktivnim radarskim sistemima nameće se koncept pasivnog nadzora vazdušnog prostora korišćenjem distribuiranih multisenzorskih sistema. Predmet širih istraživanja predstavljaju tehnička rešenja integrisanog multisenzorskog sistema za pasivan nadzor vazdušnog prostora, koji se sastoji od sledećih podsistema za nadzor vazdušnog prostora: na radio-gonimetarskom principu u frekvencijskom opsegu 20-3000 MHz, na zvukometrijskom principu, na principu vizuelnih osmatračkih stanica, na termovizijskom i televizijskom principu. U ovom radu analizirani su opšti principi pasivnog nadzora vazdušnog prostora multisenzorskim sistemima i predložena je tehnička koncepcija radio-goniometarskog i zvukometrijskog podsistema. / It is very important to provide continuous air surveillance in to realize modern operations on the operational-strategic level and tactical, as well. It is well known that active radar systems, on which air surveillance is based in our country, are very vulnerable in war times and susceptible to the electronic counter and combat attacks of the enemy, what is shown practically in 1999 war. Air surveillance by passive multi-sensor systems is a possible alternative to the air surveillance by the active radar systems. Subjects of our wider research are technical solutions of integrated multi-sensor systems for passive air surveillance which consists of the following subsystems: a subsystem for the air communication intelligence within the frequency range 20-3000 MHz based on intercept
National Research Council Canada - National Science Library
Uroden, M
2001-01-01
...) laser radar systems at MSSS. The paper reviews the first generation kilowatt class ladar/lidar HI-CLASS/LBD systems as the foundation for a second-generation ladar system that was developed under the AFRL/DE ALVA program...
Multi-Sensor Methods for Mobile Radar Motion Capture and Compensation
Nakata, Robert
Remote sensing has many applications, including surveying and mapping, geophysics exploration, military surveillance, search and rescue and counter-terrorism operations. Remote sensor systems typically use visible image, infrared or radar sensors. Camera based image sensors can provide high spatial resolution but are limited to line-of-sight capture during daylight. Infrared sensors have lower resolution but can operate during darkness. Radar sensors can provide high resolution motion measurements, even when obscured by weather, clouds and smoke and can penetrate walls and collapsed structures constructed with non-metallic materials up to 1 m to 2 m in depth depending on the wavelength and transmitter power level. However, any platform motion will degrade the target signal of interest. In this dissertation, we investigate alternative methodologies to capture platform motion, including a Body Area Network (BAN) that doesn't require external fixed location sensors, allowing full mobility of the user. We also investigated platform stabilization and motion compensation techniques to reduce and remove the signal distortion introduced by the platform motion. We evaluated secondary ultrasonic and radar sensors to stabilize the platform resulting in an average 5 dB of Signal to Interference Ratio (SIR) improvement. We also implemented a Digital Signal Processing (DSP) motion compensation algorithm that improved the SIR by 18 dB on average. These techniques could be deployed on a quadcopter platform and enable the detection of respiratory motion using an onboard radar sensor.
Radar Fundamentals, Presentation
Jenn, David
2008-01-01
Topics include: introduction, radar functions, antennas basics, radar range equation, system parameters, electromagnetic waves, scattering mechanisms, radar cross section and stealth, and sample radar systems.
Department of Homeland Security — These data represent Next-Generation Radar (NEXRAD) and Terminal Doppler Weather Radar (TDWR) weather radar stations within the US. The NEXRAD radar stations are...
Cifelli, R.; Chen, H.; Chandrasekar, V.
2017-12-01
A recent study by the State of California's Department of Water Resources has emphasized that the San Francisco Bay Area is at risk of catastrophic flooding. Therefore, accurate quantitative precipitation estimation (QPE) and forecast (QPF) are critical for protecting life and property in this region. Compared to rain gauge and meteorological satellite, ground based radar has shown great advantages for high-resolution precipitation observations in both space and time domain. In addition, the polarization diversity shows great potential to characterize precipitation microphysics through identification of different hydrometeor types and their size and shape information. Currently, all the radars comprising the U.S. National Weather Service (NWS) Weather Surveillance Radar-1988 Doppler (WSR-88D) network are operating in dual-polarization mode. Enhancement of QPE is one of the main considerations of the dual-polarization upgrade. The San Francisco Bay Area is covered by two S-band WSR-88D radars, namely, KMUX and KDAX. However, in complex terrain like the Bay Area, it is still challenging to obtain an optimal rainfall algorithm for a given set of dual-polarization measurements. In addition, the accuracy of rain rate estimates is contingent on additional factors such as bright band contamination, vertical profile of reflectivity (VPR) correction, and partial beam blockages. This presentation aims to improve radar QPE for the Bay area using advanced dual-polarization rainfall methodologies. The benefit brought by the dual-polarization upgrade of operational radar network is assessed. In addition, a pilot study of gap fill X-band radar performance is conducted in support of regional QPE system development. This paper also presents a detailed comparison between the dual-polarization radar-derived rainfall products with various operational products including the NSSL's Multi-Radar/Multi-Sensor (MRMS) system. Quantitative evaluation of various rainfall products is achieved
Universal Library for Building Radar Operator Interface
Directory of Open Access Journals (Sweden)
A. A. Karankevich
2014-01-01
Full Text Available The article contains the results of the development of a software library, used for building software interfaces for radars being developed in BMSTU Radioelectronic Technics Scientific and Research Institute. The library is a software application library written in C++ using Qt and OpenGL libraries.The article describes the requirements, that the library is supposed to meet, in particular — cross-platform capabilities and versatility of the solution. The data types, that library uses, are described. The description of theinterface elements developed is shown, and some pictures of their operation are given.The article shows the main interface elements used. They are: «Matrix» that shows twodimensional data, «Waterfall», that is used for time scanning of the parameter specified, and «Plan Position Indicator» that shows circular scan from surveillance radar without geometric distortions.The part «Library implementation» shows the example of radiolocation station interface, that was based on this library, used in the working model of ultrashortpulse radar. Some results of the operation of this interface are also shown. The experiment shows the system working with two people in the field. As people start to move, the system becomes capable of distinguishing moving targets and stationary surface. The article shows the system operation the same way as the system operator can see it through his interface.The conclusion contains brief results of the development, the sphere of application of the software, and the prospects of the further development of the library.
Improving Weather Radar Precipitation Estimates by Combining two Types of Radars
DEFF Research Database (Denmark)
Nielsen, Jesper Ellerbæk; Thorndahl, Søren Liedtke; Rasmussen, Michael R.
2014-01-01
This paper presents a demonstration of how Local Area Weather Radar (LAWR) X-band measurements can be combined with meteorological C–band measurements into a single radar product. For this purpose, a blending method has been developed which combines the strengths of the two radar systems. Combining...... the two radar types achieves a radar product with both long range and high temporal resolution. It is validated that the blended radar product performs better than the individual radars based on ground observations from laser disdrometers. However, the data combination is challenged by lower performance...... of the LAWR. Although both radars benefits from the data combination, it is also found that advection based temporal interpolation is a more favourable method for increasing the temporal resolution of meteorological C–band measurements....
Radar sensing via a Micro-UAV-borne system
Catapano, Ilaria; Ludeno, Giovanni; Gennarelli, Gianluca; Soldovieri, Francesco; Rodi Vetrella, Amedeo; Fasano, Giancarmine
2017-04-01
In recent years, the miniaturization of flight control systems and payloads has contributed to a fast and widespread diffusion of micro-UAV (Unmanned Aircraft Vehicle). While micro-UAV can be a powerful tool in several civil applications such as environmental monitoring and surveillance, unleashing their full potential for societal benefits requires augmenting their sensing capability beyond the realm of active/passive optical sensors [1]. In this frame, radar systems are drawing attention since they allow performing missions in all-weather and day/night conditions and, thanks to the microwave ability to penetrate opaque media, they enable the detection and localization not only of surface objects but also of sub-surface/hidden targets. However, micro-UAV-borne radar imaging represents still a new frontier, since it is much more than a matter of technology miniaturization or payload installation, which can take advantage of the newly developed ultralight systems. Indeed, micro-UAV-borne radar imaging entails scientific challenges in terms of electromagnetic modeling and knowledge of flight dynamics and control. As a consequence, despite Synthetic Aperture Radar (SAR) imaging is a traditional remote sensing tool, its adaptation to micro-UAV is an open issue and so far only few case studies concerning the integration of SAR and UAV technologies have been reported worldwide [2]. In addition, only early results concerning subsurface imaging by means of an UAV-mounted radar are available [3]. As a contribution to radar imaging via autonomous micro-UAV, this communication presents a proof-of-concept experiment. This experiment represents the first step towards the development of a general methodological approach that exploits expertise about (sub-)surface imaging and aerospace systems with the aim to provide high-resolution images of the surveyed scene. In details, at the conference, we will present the results of a flight campaign carried out by using a single radar
Simulation of a weather radar display for over-water airborne radar approaches
Clary, G. R.
1983-01-01
Airborne radar approach (ARA) concepts are being investigated as a part of NASA's Rotorcraft All-Weather Operations Research Program on advanced guidance and navigation methods. This research is being conducted using both piloted simulations and flight test evaluations. For the piloted simulations, a mathematical model of the airborne radar was developed for over-water ARAs to offshore platforms. This simulated flight scenario requires radar simulation of point targets, such as oil rigs and ships, distributed sea clutter, and transponder beacon replies. Radar theory, weather radar characteristics, and empirical data derived from in-flight radar photographs are combined to model a civil weather/mapping radar typical of those used in offshore rotorcraft operations. The resulting radar simulation is realistic and provides the needed simulation capability for ongoing ARA research.
Flood Monitoring using X-band Dual-polarization Radar Network
Chandrasekar, V.; Wang, Y.; Maki, M.; Nakane, K.
2009-09-01
A dense weather radar network is an emerging concept advanced by the Center for Collaborative Adaptive Sensing of the Atmosphere (CASA). Using multiple radars observing over a common will create different data outcomes depending on the characteristics of the radar units employed and the network topology. To define this a general framework is developed to describe the radar network space, and formulations are obtained that can be used for weather radar network characterization. Current weather radar surveillance networks are based upon conventional sensing paradigm of widely-separated, standalone sensing systems using long range radars that operate at wavelengths in 5-10 cm range. Such configuration has limited capability to observe close to the surface of the earth because of the earth's curvature but also has poorer resolution at far ranges. The dense network radar system, observes and measures weather phenomenon such as rainfall and severe weather close to the ground at higher spatial and temporal resolution compared to the current paradigm. In addition the dense network paradigm also is easily adaptable to complex terrain. Flooding is one of the most common natural hazards in the world. Especially, excessive development decreases the response time of urban watersheds and complex terrain to rainfall and increases the chance of localized flooding events over a small spatial domain. Successful monitoring of urban floods requires high spatiotemporal resolution, accurate precipitation estimation because of the rapid flood response as well as the complex hydrologic and hydraulic characteristics in an urban environment. This paper reviews various aspects in radar rainfall mapping in urban coverage using dense X-band dual-polarization radar networks. By reducing the maximum range and operating at X-band, one can ensure good azimuthal resolution with a small-size antenna and keep the radar beam closer to the ground. The networked topology helps to achieve satisfactory
Shi, Chenguang; Wang, Fei; Salous, Sana; Zhou, Jianjiang
2017-11-25
In this paper, we investigate a low probability of intercept (LPI)-based optimal power allocation strategy for a joint bistatic radar and communication system, which is composed of a dedicated transmitter, a radar receiver, and a communication receiver. The joint system is capable of fulfilling the requirements of both radar and communications simultaneously. First, assuming that the signal-to-noise ratio (SNR) corresponding to the target surveillance path is much weaker than that corresponding to the line of sight path at radar receiver, the analytically closed-form expression for the probability of false alarm is calculated, whereas the closed-form expression for the probability of detection is not analytically tractable and is approximated due to the fact that the received signals are not zero-mean Gaussian under target presence hypothesis. Then, an LPI-based optimal power allocation strategy is presented to minimize the total transmission power for information signal and radar waveform, which is constrained by a specified information rate for the communication receiver and the desired probabilities of detection and false alarm for the radar receiver. The well-known bisection search method is employed to solve the resulting constrained optimization problem. Finally, numerical simulations are provided to reveal the effects of several system parameters on the power allocation results. It is also demonstrated that the LPI performance of the joint bistatic radar and communication system can be markedly improved by utilizing the proposed scheme.
Neish, Catherine D.; Carter, Lynn M.
2015-01-01
This chapter describes the principles of planetary radar, and the primary scientific discoveries that have been made using this technique. The chapter starts by describing the different types of radar systems and how they are used to acquire images and accurate topography of planetary surfaces and probe their subsurface structure. It then explains how these products can be used to understand the properties of the target being investigated. Several examples of discoveries made with planetary radar are then summarized, covering solar system objects from Mercury to Saturn. Finally, opportunities for future discoveries in planetary radar are outlined and discussed.
Kingsley, Simon
1999-01-01
What is radar? What systems are currently in use? How do they work? This book provides engineers and scientists with answers to these critical questions, focusing on actual radar systems in use today. It is a perfect resource for those just entering the field, or as a quick refresher for experienced practitioners. The book leads readers through the specialized language and calculations that comprise the complex world of radar engineering as seen in dozens of state-of-the-art radar systems. An easy to read, wide ranging guide to the world of modern radar systems.
Alabaster, Clive
2012-01-01
This book is a practitioner's guide to all aspects of pulse Doppler radar. It concentrates on airborne military radar systems since they are the most used, most complex, and most interesting of the pulse Doppler radars; however, ground-based and non-military systems are also included. It covers the fundamental science, signal processing, hardware issues, systems design and case studies of typical systems. It will be a useful resource for engineers of all types (hardware, software and systems), academics, post-graduate students, scientists in radar and radar electronic warfare sectors and milit
Radar orthogonality and radar length in Finsler and metric spacetime geometry
Pfeifer, Christian
2014-09-01
The radar experiment connects the geometry of spacetime with an observers measurement of spatial length. We investigate the radar experiment on Finsler spacetimes which leads to a general definition of radar orthogonality and radar length. The directions radar orthogonal to an observer form the spatial equal time surface an observer experiences and the radar length is the physical length the observer associates to spatial objects. We demonstrate these concepts on a forth order polynomial Finsler spacetime geometry which may emerge from area metric or premetric linear electrodynamics or in quantum gravity phenomenology. In an explicit generalization of Minkowski spacetime geometry we derive the deviation from the Euclidean spatial length measure in an observers rest frame explicitly.
Surveillance and remote sensing: ITOPF participation
International Nuclear Information System (INIS)
Nichols, J.A.
1992-01-01
Although the Federation does not sponsor or undertake surveillance and remote sensing research and development projects, it is a potential user of remote sensing equipment when responding to oil spills. Indeed, the Federation has already made use of suitably equipped aircraft on a number of occasions in Europe. Several countries in north west Europe, viz. France, Germany, Netherlands, Norway, Sweden and the U.K., operate aircraft fitted with broadly similar systems comprising side-looking airborne radar (SLAR), infra-red line scanners (IRLS) and ultra-violet line scanners (UVLS). These aircraft are used routinely for the detection of operational discharges of oil from ships in violation of the International Convention on the Prevention of Pollution from Ships 73/78 (MARPOL 73/78)
Li, Xiaowen; Janiga, Matthew A.; Wang, Shuguang; Tao, Wei-Kuo; Rowe, Angela; Xu, Weixin; Liu, Chuntao; Matsui, Toshihisa; Zhang, Chidong
2018-04-01
Evolution of precipitation structures are simulated and compared with radar observations for the November Madden-Julian Oscillation (MJO) event during the DYNAmics of the MJO (DYNAMO) field campaign. Three ground-based, ship-borne, and spaceborne precipitation radars and three cloud-resolving models (CRMs) driven by observed large-scale forcing are used to study precipitation structures at different locations over the central equatorial Indian Ocean. Convective strength is represented by 0-dBZ echo-top heights, and convective organization by contiguous 17-dBZ areas. The multi-radar and multi-model framework allows for more stringent model validations. The emphasis is on testing models' ability to simulate subtle differences observed at different radar sites when the MJO event passed through. The results show that CRMs forced by site-specific large-scale forcing can reproduce not only common features in cloud populations but also subtle variations observed by different radars. The comparisons also revealed common deficiencies in CRM simulations where they underestimate radar echo-top heights for the strongest convection within large, organized precipitation features. Cross validations with multiple radars and models also enable quantitative comparisons in CRM sensitivity studies using different large-scale forcing, microphysical schemes and parameters, resolutions, and domain sizes. In terms of radar echo-top height temporal variations, many model sensitivity tests have better correlations than radar/model comparisons, indicating robustness in model performance on this aspect. It is further shown that well-validated model simulations could be used to constrain uncertainties in observed echo-top heights when the low-resolution surveillance scanning strategy is used.
Willis, Nick
2007-01-01
Advances in Bistatic Radar updates and extends bistatic and multistatic radar developments since publication of Willis' Bistatic Radar in 1991. New and recently declassified military applications are documented. Civil applications are detailed including commercial and scientific systems. Leading radar engineers provide expertise to each of these applications. Advances in Bistatic Radar consists of two major sections: Bistatic/Multistatic Radar Systems and Bistatic Clutter and Signal Processing. Starting with a history update, the first section documents the early and now declassified military
Recommendation on Transition from Primary/Secondary Radar to Secondary- Only Radar Capability
1994-10-01
Radar Beacon Performance Monitor RCIU Remote Control Interface Unit RCL Remote Communications Link R E&D Research, Engineering and Development RML Radar...rate. 3.1.2.5 Maintenance The current LRRs have limited remote maintenance monitoring (RMM) capabilities via the Remote Control Interface Unit ( RCIU ...1, -2 and FPS-20 radars required an upgrade of some of the radar subsystems, namely the RCIU to respond as an RMS and the CD to interface with radar
Jorgensen, David P.; Hanshaw, Maiana N.; Schmidt, Kevin M.; Laber, Jayme L; Staley, Dennis M.; Kean, Jason W.; Restrepo, Pedro J.
2011-01-01
A portable truck-mounted C-band Doppler weather radar was deployed to observe rainfall over the Station Fire burn area near Los Angeles, California, during the winter of 2009/10 to assist with debris-flow warning decisions. The deployments were a component of a joint NOAA–U.S. Geological Survey (USGS) research effort to improve definition of the rainfall conditions that trigger debris flows from steep topography within recent wildfire burn areas. A procedure was implemented to blend various dual-polarized estimators of precipitation (for radar observations taken below the freezing level) using threshold values for differential reflectivity and specific differential phase shift that improves the accuracy of the rainfall estimates over a specific burn area sited with terrestrial tipping-bucket rain gauges. The portable radar outperformed local Weather Surveillance Radar-1988 Doppler (WSR-88D) National Weather Service network radars in detecting rainfall capable of initiating post-fire runoff-generated debris flows. The network radars underestimated hourly precipitation totals by about 50%. Consistent with intensity–duration threshold curves determined from past debris-flow events in burned areas in Southern California, the portable radar-derived rainfall rates exceeded the empirical thresholds over a wider range of storm durations with a higher spatial resolution than local National Weather Service operational radars. Moreover, the truck-mounted C-band radar dual-polarimetric-derived estimates of rainfall intensity provided a better guide to the expected severity of debris-flow events, based on criteria derived from previous events using rain gauge data, than traditional radar-derived rainfall approaches using reflectivity–rainfall relationships for either the portable or operational network WSR-88D radars. Part of the reason for the improvement was due to siting the radar closer to the burn zone than the WSR-88Ds, but use of the dual-polarimetric variables
Adaptive radar resource management
Moo, Peter
2015-01-01
Radar Resource Management (RRM) is vital for optimizing the performance of modern phased array radars, which are the primary sensor for aircraft, ships, and land platforms. Adaptive Radar Resource Management gives an introduction to radar resource management (RRM), presenting a clear overview of different approaches and techniques, making it very suitable for radar practitioners and researchers in industry and universities. Coverage includes: RRM's role in optimizing the performance of modern phased array radars The advantages of adaptivity in implementing RRMThe role that modelling and
Bole, A G
2013-01-01
Radar and ARPA Manual focuses on the theoretical and practical aspects of electronic navigation. The manual first discusses basic radar principles, including principles of range and bearing measurements and picture orientation and presentation. The text then looks at the operational principles of radar systems. Function of units; aerial, receiver, and display principles; transmitter principles; and sitting of units on board ships are discussed. The book also describes target detection, Automatic Radar Plotting Aids (ARPA), and operational controls of radar systems, and then discusses radar plo
CSIR Research Space (South Africa)
Naicker, K
2011-04-01
Full Text Available Maritime border safeguarding is a vital component in the protection of a countries resources and interests against illegal activities. With the increasing asymmetric nature of today’s threats, a primary requirement of any coastal surveillance system...
2012-01-01
RTA HFM-201/RSM PAPER 3 - 1 © 2012 The MITRE Corporation. All Rights Reserved. Social Radar Barry Costa and John Boiney MITRE Corporation...defenders require an integrated set of capabilities that we refer to as a “ social radar.” Such a system would support strategic- to operational-level...situation awareness, alerting, course of action analysis, and measures of effectiveness for each action undertaken. Success of a social radar
Design and development of correlation techniques to maintain a space surveillance system catalogue
Olmedo, E.; Sánchez Ortiz, Noelia; Lerate, Mercedes; Belló-Mora, Miguel; Klinkrad, H.
2009-10-01
A growing interest exists in a future, autonomous European Space Surveillance System (ESSS). Currently, most of the knowledge about Earth-orbiting space objects is based on information provided by the USASPACECOM. This paper presents the required initial orbit determination (IOD) and correlation techniques to process optical measurements. Former studies were focused on the handling of radar measurements, which are summarised with the aim of describing a global procedure for processing hybrid measurement types (combination of radar and optic data for catalogue maintenance). The introduction of manoeuvres are presented due to their importance in the space object catalogue maintenance. The detection of uncatalogued objects and the successful correlation of already catalogued objects involve two different tasks for telescopes: survey and tasking. Assumptions for both strategies are developed on the basis of the previous work developed at the University of Berne (see [T. Flohrer, T. Schildknecht, R. Musci, E. Stöveken, Performance estimation for GEO space surveillance, Advances in Space Research 35 (2005). [1]; T. Flohrer, T. Schildknecht, R. Musci, Proposed strategies for optical observations in a future European Space Surveillance Network, presented in the 36th COSPAR Scientific Assembly (2006). [2]; R. Musci, T. Schildknecht, M. Ploner, Orbit improvement for GEO objects using follow-up observations, Advances in Space Research 34 (2004). [3]; R. Musci, T. Schildknecht, M. Ploner, G. Beutler, Orbit improvement for GTO objects using follow-up observations, Advances in Space Research 35 (2005). [4]; R. Musci, T. Schildknecht, T. Flohrer, G. Beutler, Concept for a catalogue of space debris in GEO, Proceedings of the Fourth European Conference on Space Debris, (ESA SP-587, 2005). [5
Novel radar techniques and applications
Klemm, Richard; Lombardo, Pierfrancesco; Nickel, Ulrich
2017-01-01
Novel Radar Techniques and Applications presents the state-of-the-art in advanced radar, with emphasis on ongoing novel research and development and contributions from an international team of leading radar experts. This volume covers: Real aperture array radar; Imaging radar and Passive and multistatic radar.
CSIR Research Space (South Africa)
Anderson, F
2008-11-01
Full Text Available of an S&T capability based on international technology trends in persistent, ubiquitous surveillance. The ultimate aim of this programme is to develop and produce a series of South African innovations that can be used by departments and agencies...
Minimum redundancy MIMO radars
Chen, Chun-Yang; Vaidyanathan, P. P.
2008-01-01
The multiple-input multiple-output (MIMO) radar concept has drawn considerable attention recently. In the traditional single-input multiple-output (SIMO) radar system, the transmitter emits scaled versions of a single waveform. However, in the MIMO radar system, the transmitter transmits independent waveforms. It has been shown that the MIMO radar can be used to improve system performance. Most of the MIMO radar research so far has focused on the uniform array. However, i...
2007-09-01
Analysis and Design. Wiley- Interscience, 111 River Street, Hoboken, NJ, 3 edition, 2005. ISBN 0-471-66782. 2. Carlos A. Coello Coello, David A. Van ... Veldhuizen and Gary B. Lamont. Evolu- tionary Algorithms for solving Multi-Objective Problems. Kluwer Academic Pub- lishers, 233 Spring Street, New York...Building, Suite 1035, 150 South Independence Mall West, Philadelphia, PA 19106, 2000. 27. Van Blaricum, G. F. “Tactical Air Surveillance RADAR Netting
Principles of modern radar systems
Carpentier, Michel H
1988-01-01
Introduction to random functions ; signal and noise : the ideal receiver ; performance of radar systems equipped with ideal receivers ; analysis of the operating principles of some types of radar ; behavior of real targets, fluctuation of targets ; angle measurement using radar ; data processing of radar information, radar coverage ; applications to electronic scanning antennas to radar ; introduction to Hilbert spaces.
Automated intelligent video surveillance system for ships
Wei, Hai; Nguyen, Hieu; Ramu, Prakash; Raju, Chaitanya; Liu, Xiaoqing; Yadegar, Jacob
2009-05-01
To protect naval and commercial ships from attack by terrorists and pirates, it is important to have automatic surveillance systems able to detect, identify, track and alert the crew on small watercrafts that might pursue malicious intentions, while ruling out non-threat entities. Radar systems have limitations on the minimum detectable range and lack high-level classification power. In this paper, we present an innovative Automated Intelligent Video Surveillance System for Ships (AIVS3) as a vision-based solution for ship security. Capitalizing on advanced computer vision algorithms and practical machine learning methodologies, the developed AIVS3 is not only capable of efficiently and robustly detecting, classifying, and tracking various maritime targets, but also able to fuse heterogeneous target information to interpret scene activities, associate targets with levels of threat, and issue the corresponding alerts/recommendations to the man-in- the-loop (MITL). AIVS3 has been tested in various maritime scenarios and shown accurate and effective threat detection performance. By reducing the reliance on human eyes to monitor cluttered scenes, AIVS3 will save the manpower while increasing the accuracy in detection and identification of asymmetric attacks for ship protection.
A millimetre-wave MIMO radar system for threat detection in urban environments
Kirschner, A. J.; Guetlein, J.; Bertl, S.; Detlefsen, J.
2012-10-01
The European Defence Agency (EDA) engages countermeasures against Improvised Explosive Devices (IEDs) by funding several scientific programs on threat awareness, countermeasures IEDs or land-mine detection, in which this work is only one of numerous projects. The program, denoted as Surveillance in an urban environment using mobile sensors (SUM), covers the idea of equipping one or more vehicles of a patrol or a convoy with a set of sensors exploiting different physical principles in order to gain detailed insights of the road situation ahead. In order to give an added value to a conventional visual camera system, measurement data from an infra-red (IR) camera, a radiometer and a millimetre-wave radar are fused with data from an optical image and are displayed on a human-machine-interface (HMI) which shall assist the vehicle's co-driver to identify suspect objects or persons on or next to the road without forcing the vehicle to stop its cruise. This paper shall especially cover the role of the millimetre-wave radar sensor and its different operational modes. Measurement results are discussed. It is possible to alter the antenna mechanically which gives two choices for a field of view and angular resolution trade-off. Furthermore a synthetic aperture radar mode is possible and has been tested successfully. MIMO radar principles like orthogonal signal design were exploited tofrom a virtual array by 4 transmitters and 4 receivers. In joint evaluation, it was possible to detect e.g. grenade shells under cardboard boxes or covered metal barrels which were invisible for optical or infra-red detection.
Sensor-Oriented Path Planning for Multiregion Surveillance with a Single Lightweight UAV SAR
Li, Jincheng; Chen, Jie; Wang, Pengbo; Li, Chunsheng
2018-01-01
In the surveillance of interested regions by unmanned aerial vehicle (UAV), system performance relies greatly on the motion control strategy of the UAV and the operation characteristics of the onboard sensors. This paper investigates the 2D path planning problem for the lightweight UAV synthetic aperture radar (SAR) system in an environment of multiple regions of interest (ROIs), the sizes of which are comparable to the radar swath width. Taking into account the special requirements of the SAR system on the motion of the platform, we model path planning for UAV SAR as a constrained multiobjective optimization problem (MOP). Based on the fact that the UAV route can be designed in the map image, an image-based path planner is proposed in this paper. First, the neighboring ROIs are merged by the morphological operation. Then, the parts of routes for data collection of the ROIs can be located according to the geometric features of the ROIs and the observation geometry of UAV SAR. Lastly, the route segments for ROIs surveillance are connected by a path planning algorithm named the sampling-based sparse A* search (SSAS) algorithm. Simulation experiments in real scenarios demonstrate that the proposed sensor-oriented path planner can improve the reconnaissance performance of lightweight UAV SAR greatly compared with the conventional zigzag path planner. PMID:29439447
Sensor-Oriented Path Planning for Multiregion Surveillance with a Single Lightweight UAV SAR.
Li, Jincheng; Chen, Jie; Wang, Pengbo; Li, Chunsheng
2018-02-11
In the surveillance of interested regions by unmanned aerial vehicle (UAV), system performance relies greatly on the motion control strategy of the UAV and the operation characteristics of the onboard sensors. This paper investigates the 2D path planning problem for the lightweight UAV synthetic aperture radar (SAR) system in an environment of multiple regions of interest (ROIs), the sizes of which are comparable to the radar swath width. Taking into account the special requirements of the SAR system on the motion of the platform, we model path planning for UAV SAR as a constrained multiobjective optimization problem (MOP). Based on the fact that the UAV route can be designed in the map image, an image-based path planner is proposed in this paper. First, the neighboring ROIs are merged by the morphological operation. Then, the parts of routes for data collection of the ROIs can be located according to the geometric features of the ROIs and the observation geometry of UAV SAR. Lastly, the route segments for ROIs surveillance are connected by a path planning algorithm named the sampling-based sparse A* search (SSAS) algorithm. Simulation experiments in real scenarios demonstrate that the proposed sensor-oriented path planner can improve the reconnaissance performance of lightweight UAV SAR greatly compared with the conventional zigzag path planner.
National Oceanic and Atmospheric Administration, Department of Commerce — The Radar Chart collection is an archived product of summarized radar data. The geographic coverage is the 48 contiguous states of the United States. These hourly...
Combined radar and telemetry system
Energy Technology Data Exchange (ETDEWEB)
Rodenbeck, Christopher T.; Young, Derek; Chou, Tina; Hsieh, Lung-Hwa; Conover, Kurt; Heintzleman, Richard
2017-08-01
A combined radar and telemetry system is described. The combined radar and telemetry system includes a processing unit that executes instructions, where the instructions define a radar waveform and a telemetry waveform. The processor outputs a digital baseband signal based upon the instructions, where the digital baseband signal is based upon the radar waveform and the telemetry waveform. A radar and telemetry circuit transmits, simultaneously, a radar signal and telemetry signal based upon the digital baseband signal.
Energy Technology Data Exchange (ETDEWEB)
Chambers, D. [Lawrence Livermore National Lab., CA (United States)
1994-11-15
The ultimate goal of the Current Meter Array (CMA) is to be able to compare the current patterns detected with the array with radar images of the water surface. The internal wave current patterns modulate the waves on the water surface giving a detectable modulation of the radar cross-section (RCS). The function relating the RCS modulations to the current patterns is the Modulation Transfer Function (MTF). By comparing radar images directly with co-located CMA measurements the MTF can be determined. In this talk radar images and CMA measurements from a recent experiment at Loch Linnhe, Scotland, will be used to make the first direct determination of MTF for an X and S band radar at low grazing angles. The technical problems associated with comparing radar images to CMA data will be explained and the solution method discussed. The results suggest the both current and strain rate contribute equally to the radar modulation for X band. For S band, the strain rate contributes more than the current. The magnitude of the MTF and the RCS modulations are consistent with previous estimates when the wind is blowing perpendicular to the radar look direction.
Full polarimetric millimetre wave radar for stand-off security screening
Blackhurst, Eddie; Salmon, Neil; Southgate, Matthew
2017-10-01
The development and measurements are described of a frequency modulated continuous wave (FMCW) mono-static millimetre wave full polarimetric radar, operating at k-band (18 to 26 GHz). The system has been designed to explore the feasibility of using full polarimetry for the detection of concealed weapons, and person borne improvised explosive devices (PBIED). The philosophy of this scheme is a means to extract the maximum information content from a target which is normally in the single spatial pixel (sometimes sub-pixel) configuration in stand-off (tens of metres) and crowd surveillance scenarios. The radar comprises a vector network analyser (VNA), an orthomode transducer and a conical horn antenna. A calibration strategy is discussed and demonstrated using a variety of known calibration targets with known reflective properties, including a flat metal plate, dihedral reflector, metal sphere, helix and dipole. The orthomode transducer is based on a high performance linear polarizer of the turnstile type with isolation better than - 35dB between orthogonal polarisations. The calibration enables the polarimetric Sinclair scattering matrix to be measured at each frequency for coherent polarimetry, and this can be extended using multiple measurements via the Kennaugh matrix to investigate incoherent full polarimetry.
National Oceanic and Atmospheric Administration, Department of Commerce — RADAR PPI Scope Overlays are used to position a RADAR image over a station at the correct resolution. The archive maintains several different RADAR resolution types,...
Jones, Thomas A.; Stensrud, David; Wicker, Louis; Minnis, Patrick; Palikonda, Rabindra
2015-01-01
Assimilating high-resolution radar reflectivity and radial velocity into convection-permitting numerical weather prediction models has proven to be an important tool for improving forecast skill of convection. The use of satellite data for the application is much less well understood, only recently receiving significant attention. Since both radar and satellite data provide independent information, combing these two sources of data in a robust manner potentially represents the future of high-resolution data assimilation. This research combines Geostationary Operational Environmental Satellite 13 (GOES-13) cloud water path (CWP) retrievals with Weather Surveillance Radar-1988 Doppler (WSR-88D) reflectivity and radial velocity to examine the impacts of assimilating each for a severe weather event occurring in Oklahoma on 24 May 2011. Data are assimilated into a 3-km model using an ensemble adjustment Kalman filter approach with 36 members over a 2-h assimilation window between 1800 and 2000 UTC. Forecasts are then generated for 90 min at 5-min intervals starting at 1930 and 2000 UTC. Results show that both satellite and radar data are able to initiate convection, but that assimilating both spins up a storm much faster. Assimilating CWP also performs well at suppressing spurious precipitation and cloud cover in the model as well as capturing the anvil characteristics of developed storms. Radar data are most effective at resolving the 3D characteristics of the core convection. Assimilating both satellite and radar data generally resulted in the best model analysis and most skillful forecast for this event.
Systems and Methods for Radar Data Communication
Bunch, Brian (Inventor); Szeto, Roland (Inventor); Miller, Brad (Inventor)
2013-01-01
A radar information processing system is operable to process high bandwidth radar information received from a radar system into low bandwidth radar information that may be communicated to a low bandwidth connection coupled to an electronic flight bag (EFB). An exemplary embodiment receives radar information from a radar system, the radar information communicated from the radar system at a first bandwidth; processes the received radar information into processed radar information, the processed radar information configured for communication over a connection operable at a second bandwidth, the second bandwidth lower than the first bandwidth; and communicates the radar information from a radar system, the radar information communicated from the radar system at a first bandwidth.
Zaczek, Mariusz P.
2005-01-01
Java Radar Analysis Tool (JRAT) is a computer program for analyzing two-dimensional (2D) scatter plots derived from radar returns showing pieces of the disintegrating Space Shuttle Columbia. JRAT can also be applied to similar plots representing radar returns showing aviation accidents, and to scatter plots in general. The 2D scatter plots include overhead map views and side altitude views. The superposition of points in these views makes searching difficult. JRAT enables three-dimensional (3D) viewing: by use of a mouse and keyboard, the user can rotate to any desired viewing angle. The 3D view can include overlaid trajectories and search footprints to enhance situational awareness in searching for pieces. JRAT also enables playback: time-tagged radar-return data can be displayed in time order and an animated 3D model can be moved through the scene to show the locations of the Columbia (or other vehicle) at the times of the corresponding radar events. The combination of overlays and playback enables the user to correlate a radar return with a position of the vehicle to determine whether the return is valid. JRAT can optionally filter single radar returns, enabling the user to selectively hide or highlight a desired radar return.
Synthetic impulse and aperture radar (SIAR) a novel multi-frequency MIMO radar
Chen, Baixiao
2014-01-01
Analyzes and discusses the operating principle, signal processing method, and experimental results of this advanced radar technology This book systematically discusses the operating principle, signal processing method, target measurement technology, and experimental results of a new kind of radar called synthetic impulse and aperture radar (SIAR). The purpose is to help readers acquire an insight into the concept and principle of the SIAR, to know its operation mode, signal processing method, the difference between the traditional radar and itself, the designing ideals, and the developing me
Probabilities of False Alarm for Vital Sign Detection on the Basis of a Doppler Radar System
Directory of Open Access Journals (Sweden)
Nguyen Thi Phuoc Van
2018-02-01
Full Text Available Vital detection on the basis of Doppler radars has drawn a great deal of attention from researchers because of its high potential for applications in biomedicine, surveillance, and finding people alive under debris during natural hazards. In this research, the signal-to-noise ratio (SNR of the remote vital-sign detection system is investigated. On the basis of different types of noise, such as phase noise, Gaussian noise, leakage noise between the transmitting and receiving antennae, and so on, the SNR of the system has first been examined. Then the research has focused on the investigation of the detection and false alarm probabilities of the system when the transmission link between the human and the radar sensor system took the Nakagami-m channel model. The analytical model for the false alarm and the detection probabilities of the system have been derived. The proposed theoretical models for the SNR and detection probability match with the simulation and measurement results. These theoretical models have the potential to be used as good references for the hardware development of the vital-sign detection radar sensor system.
Array-Based Ultrawideband through-Wall Radar: Prediction and Assessment of Real Radar Abilities
Directory of Open Access Journals (Sweden)
Nadia Maaref
2013-01-01
Full Text Available This paper deals with a new through-the-wall (TTW radar demonstrator for the detection and the localisation of people in a room (in a noncooperative way with the radar situated outside but in the vicinity of the first wall. After modelling the propagation through various walls and quantifying the backscattering by the human body, an analysis of the technical considerations which aims at defining the radar design is presented. Finally, an ultrawideband (UWB frequency modulated continuous wave (FMCW radar is proposed, designed, and implemented. Some representative trials show that this radar is able to localise and track moving people behind a wall in real time.
Novel radar techniques and applications
Klemm, Richard; Koch, Wolfgang
2017-01-01
Novel Radar Techniques and Applications presents the state-of-the-art in advanced radar, with emphasis on ongoing novel research and development and contributions from an international team of leading radar experts. This volume covers: Waveform diversity and cognitive radar and Target tracking and data fusion.
Transport Infrastructure Surveillance and Monitoring by Electromagnetic Sensing: The ISTIMES Project
Directory of Open Access Journals (Sweden)
Marie Bost
2010-11-01
Full Text Available The ISTIMES project, funded by the European Commission in the frame of a joint Call “ICT and Security” of the Seventh Framework Programme, is presented and preliminary research results are discussed. The main objective of the ISTIMES project is to design, assess and promote an Information and Communication Technologies (ICT-based system, exploiting distributed and local sensors, for non-destructive electromagnetic monitoring of critical transport infrastructures. The integration of electromagnetic technologies with new ICT information and telecommunications systems enables remotely controlled monitoring and surveillance and real time data imaging of the critical transport infrastructures. The project exploits different non-invasive imaging technologies based on electromagnetic sensing (optic fiber sensors, Synthetic Aperture Radar satellite platform based, hyperspectral spectroscopy, Infrared thermography, Ground Penetrating Radar-, low-frequency geophysical techniques, Ground based systems for displacement monitoring. In this paper, we show the preliminary results arising from the GPR and infrared thermographic measurements carried out on the Musmeci bridge in Potenza, located in a highly seismic area of the Apennine chain (Southern Italy and representing one of the test beds of the project.
Radar remote sensing in biology
Moore, Richard K.; Simonett, David S.
1967-01-01
The present status of research on discrimination of natural and cultivated vegetation using radar imaging systems is sketched. The value of multiple polarization radar in improved discrimination of vegetation types over monoscopic radars is also documented. Possible future use of multi-frequency, multi-polarization radar systems for all weather agricultural survey is noted.
Two applications of time reversal mirrors: Seismic radio and seismic radar
Hanafy, Sherif M.
2011-07-08
Two seismic applications of time reversal mirrors (TRMs) are introduced and tested with field experiments. The first one is sending, receiving, and decoding coded messages similar to a radio except seismic waves are used. The second one is, similar to radar surveillance, detecting and tracking a moving object(s) in a remote area, including the determination of the objects speed of movement. Both applications require the prior recording of calibrationGreen’s functions in the area of interest. This reference Green’s function will be used as a codebook to decrypt the coded message in the first application and as a moving sensor for the second application. Field tests show that seismicradar can detect the moving coordinates ( x(t), y(t), z(t)) of a person running through a calibration site. This information also allows for a calculation of his velocity as a function of location. Results with the seismic radio are successful in seismically detecting and decoding coded pulses produced by a hammer. Both seismic radio and radar are highly robust to signals in high noise environments due to the super-stacking property of TRMs.
Signal processing in noise waveform radar
Kulpa, Krzysztof
2013-01-01
This book is devoted to the emerging technology of noise waveform radar and its signal processing aspects. It is a new kind of radar, which use noise-like waveform to illuminate the target. The book includes an introduction to basic radar theory, starting from classical pulse radar, signal compression, and wave radar. The book then discusses the properties, difficulties and potential of noise radar systems, primarily for low-power and short-range civil applications. The contribution of modern signal processing techniques to making noise radar practical are emphasized, and application examples
National Oceanic and Atmospheric Administration, Department of Commerce — Radar Weather Observation is a set of archived historical manuscripts stored on microfiche. The primary source of these radar weather observations manuscript records...
Brookner, E.
1981-10-01
Achievements in the area of array radars are illustrated by such activities as the operational deployment of the large high-power, high-range-resolution Cobra Dane; the operational deployment of two all-solid-state high-power, large UHF Pave Paws radars; and the development of the SAM multifunction Patriot radar. This paper reviews the following topics: array radars steered in azimuth and elevation by phase shifting (phase-phase steered arrays); arrays steered + or - 60 deg, limited scan arrays, hemispherical coverage, and omnidirectional coverage arrays; array radars steering electronically in only one dimension, either by frequency or by phase steering; and array radar antennas which use no electronic scanning but instead use array antennas for achieving low antenna sidelobes.
Doppler radar physiological sensing
Lubecke, Victor M; Droitcour, Amy D; Park, Byung-Kwon; Singh, Aditya
2016-01-01
Presents a comprehensive description of the theory and practical implementation of Doppler radar-based physiological monitoring. This book includes an overview of current physiological monitoring techniques and explains the fundamental technology used in remote non-contact monitoring methods. Basic radio wave propagation and radar principles are introduced along with the fundamentals of physiological motion and measurement. Specific design and implementation considerations for physiological monitoring radar systems are then discussed in detail. The authors address current research and commercial development of Doppler radar based physiological monitoring for healthcare and other applications.
Development of Radar Control system for Multi-mode Active Phased Array Radar for atmospheric probing
Yasodha, Polisetti; Jayaraman, Achuthan; Thriveni, A.
2016-07-01
Modern multi-mode active phased array radars require highly efficient radar control system for hassle free real time radar operation. The requirement comes due to the distributed architecture of the active phased array radar, where each antenna element in the array is connected to a dedicated Transmit-Receive (TR) module. Controlling the TR modules, which are generally few hundreds in number, and functioning them in synchronisation, is a huge task during real time radar operation and should be handled with utmost care. Indian MST Radar, located at NARL, Gadanki, which is established during early 90's, as an outcome of the middle atmospheric program, is a remote sensing instrument for probing the atmosphere. This radar has a semi-active array, consisting of 1024 antenna elements, with limited beam steering, possible only along the principle planes. To overcome the limitations and difficulties, the radar is being augmented into fully active phased array, to accomplish beam agility and multi-mode operations. Each antenna element is excited with a dedicated 1 kW TR module, located in the field and enables to position the radar beam within 20° conical volume. A multi-channel receiver makes the radar to operate in various modes like Doppler Beam Swinging (DBS), Spaced Antenna (SA), Frequency Domain Interferometry (FDI) etc. Present work describes the real-time radar control (RC) system for the above described active phased array radar. The radar control system consists of a Spartan 6 FPGA based Timing and Control Signal Generator (TCSG), and a computer containing the software for controlling all the subsystems of the radar during real-time radar operation and also for calibrating the radar. The main function of the TCSG is to generate the control and timing waveforms required for various subsystems of the radar. Important components of the RC system software are (i) TR module configuring software which does programming, controlling and health parameter monitoring of the
Rosen, Paul A.
2012-01-01
This lecture was just a taste of radar remote sensing techniques and applications. Other important areas include Stereo radar grammetry. PolInSAR for volumetric structure mapping. Agricultural monitoring, soil moisture, ice-mapping, etc. The broad range of sensor types, frequencies of observation and availability of sensors have enabled radar sensors to make significant contributions in a wide area of earth and planetary remote sensing sciences. The range of applications, both qualitative and quantitative, continue to expand with each new generation of sensors.
Li, Yanpeng; Li, Xiang; Wang, Hongqiang; Deng, Bin; Qin, Yuliang
2016-01-06
Radar is a very important sensor in surveillance applications. Near-space vehicle-borne radar (NSVBR) is a novel installation of a radar system, which offers many benefits, like being highly suited to the remote sensing of extremely large areas, having a rapidly deployable capability and having low vulnerability to electronic countermeasures. Unfortunately, a target detection challenge arises because of complicated scenarios, such as nuclear blackout, rain attenuation, etc. In these cases, extra care is needed to evaluate the detection performance in blackout situations, since this a classical problem along with the application of an NSVBR. However, the existing evaluation measures are the probability of detection and the receiver operating curve (ROC), which cannot offer detailed information in such a complicated application. This work focuses on such requirements. We first investigate the effect of blackout on an electromagnetic wave. Performance evaluation indexes are then built: three evaluation indexes on the detection capability and two evaluation indexes on the robustness of the detection process. Simulation results show that the proposed measure will offer information on the detailed performance of detection. These measures are therefore very useful in detecting the target of interest in a remote sensing system and are helpful for both the NSVBR designers and users.
Principles of modern radar radar applications
Scheer, James A
2013-01-01
Principles of Modern Radar: Radar Applications is the third of the three-volume seriesof what was originally designed to be accomplished in one volume. As the final volumeof the set, it finishes the original vision of a complete yet bounded reference for radartechnology. This volume describes fifteen different system applications or class ofapplications in more detail than can be found in Volumes I or II.As different as the applications described, there is a difference in how these topicsare treated by the authors. Whereas in Volumes I and II there is strict adherence tochapter format and leve
Survey of Ultra-wideband Radar
Mokole, Eric L.; Hansen, Pete
The development of UWB radar over the last four decades is very briefly summarized. A discussion of the meaning of UWB is followed by a short history of UWB radar developments and discussions of key supporting technologies and current UWB radars. Selected UWB radars and the associated applications are highlighted. Applications include detecting and imaging buried mines, detecting and mapping underground utilities, detecting and imaging objects obscured by foliage, through-wall detection in urban areas, short-range detection of suicide bombs, and the characterization of the impulse responses of various artificial and naturally occurring scattering objects. In particular, the Naval Research Laboratory's experimental, low-power, dual-polarized, short-pulse, ultra-high resolution radar is used to discuss applications and issues of UWB radar. Some crucial issues that are problematic to UWB radar are spectral availability, electromagnetic interference and compatibility, difficulties with waveform control/shaping, hardware limitations in the transmission chain, and the unreliability of high-power sources for sustained use above 2 GHz.
Jacobs, D.M.; Messens, J.; Wechselberger, R.W.|info:eu-repo/dai/nl/304829005; Brosens, E.; Willem, R.; Wyns, L.; Martins, J.C.
2001-01-01
In S. aureus, resistance to the metal(III)oxyanions arsenite As(III)O− 2 and antimonite Sb(III)O− 2 is mediated by two proteins, ArsB and ArsR, encoded in the ars operon of plasmid pI258 (Silver, 1999). ArsR acts as the transcription repressor, which is de-repressed in the presence of intracellular
German Radar Observation Shuttle Experiment (ROSE)
Sleber, A. J.; Hartl, P.; Haydn, R.; Hildebrandt, G.; Konecny, G.; Muehlfeld, R.
1984-01-01
The success of radar sensors in several different application areas of interest depends on the knowledge of the backscatter of radar waves from the targets of interest, the variance of these interaction mechanisms with respect to changing measurement parameters, and the determination of the influence of he measuring systems on the results. The incidence-angle dependency of the radar cross section of different natural targets is derived. Problems involved by the combination of data gained with different sensors, e.g., MSS-, TM-, SPOTand SAR-images are analyzed. Radar cross-section values gained with ground-based radar spectrometers and spaceborne radar imaging, and non-imaging scatterometers and spaceborne radar images from the same areal target are correlated. The penetration of L-band radar waves into vegetated and nonvegetated surfaces is analyzed.
Meteor detection on ST (MST) radars
International Nuclear Information System (INIS)
Avery, S.K.
1987-01-01
The ability to detect radar echoes from backscatter due to turbulent irregularities of the radio refractive index in the clear atmosphere has lead to an increasing number of established mesosphere - stratosphere - troposphere (MST or ST) radars. Humidity and temperature variations are responsible for the echo in the troposphere and stratosphere and turbulence acting on electron density gradients provides the echo in the mesosphere. The MST radar and its smaller version, the ST radar, are pulsed Doppler radars operating in the VHF - UHF frequency range. These echoes can be used to determine upper atmosphere winds at little extra cost to the ST radar configuration. In addition, the meteor echoes can supplement mesospheric data from an MST radar. The detection techniques required on the ST radar for delineating meteor echo returns are described
National Aeronautics and Space Administration — The TOGA radar dataset consists of browse and radar data collected from the TOGA radar during the CAMEX-4 experiment. TOGA is a C-band linear polarized doppler radar...
Radar Plan Position Indicator Scope
National Oceanic and Atmospheric Administration, Department of Commerce — Radar Plan Position Indicator Scope is the collection of weather radar imagery for the period prior to the beginning of the Next Generation Radar (NEXRAD) system...
Airborne Radar Observations of Severe Hailstorms: Implications for Future Spaceborne Radar
Heymsfield, Gerald M.; Tian, Lin; Li, Lihua; McLinden, Matthew; Cervantes, Jaime I.
2013-01-01
A new dual-frequency (Ku and Ka band) nadir-pointing Doppler radar on the high-altitude NASA ER-2 aircraft, called the High-Altitude Imaging Wind and Rain Airborne Profiler (HIWRAP), has collected data over severe thunderstorms in Oklahoma and Kansas during the Midlatitude Continental Convective Clouds Experiment (MC3E). The overarching motivation for this study is to understand the behavior of the dualwavelength airborne radar measurements in a global variety of thunderstorms and how these may relate to future spaceborne-radar measurements. HIWRAP is operated at frequencies that are similar to those of the precipitation radar on the Tropical Rainfall Measuring Mission (Ku band) and the upcoming Global Precipitation Measurement mission satellite's dual-frequency (Ku and Ka bands) precipitation radar. The aircraft measurements of strong hailstorms have been combined with ground-based polarimetric measurements to obtain a better understanding of the response of the Ku- and Ka-band radar to the vertical distribution of the hydrometeors, including hail. Data from two flight lines on 24 May 2011 are presented. Doppler velocities were approx. 39m/s2at 10.7-km altitude from the first flight line early on 24 May, and the lower value of approx. 25m/s on a second flight line later in the day. Vertical motions estimated using a fall speed estimate for large graupel and hail suggested that the first storm had an updraft that possibly exceeded 60m/s for the more intense part of the storm. This large updraft speed along with reports of 5-cm hail at the surface, reflectivities reaching 70 dBZ at S band in the storm cores, and hail signals from polarimetric data provide a highly challenging situation for spaceborne-radar measurements in intense convective systems. The Ku- and Ka-band reflectivities rarely exceed approx. 47 and approx. 37 dBZ, respectively, in these storms.
The use of radar for bathymetry assessment
Aardoom, J.H.; Greidanus, H.S.F.
1998-01-01
The bottom topography in shallow seas can be observed by air- and spaceborne imaging radar. Bathymetric information derived from radar data is limited in accuracy, but radar has a good spatial coverage. The accuracy can be increased by assimilating the radar imagery into existing or insitu gathered bathymetric data. The paper reviews the concepts of bathymetry assessment by radar, the radar imaging mechanism, and the possibilities and limitations of the use of radar data in rapid assessment.
Fusion of imaging and nonimaging data for surveillance aircraft
Shahbazian, Elisa; Gagnon, Langis; Duquet, Jean Remi; Macieszczak, Maciej; Valin, Pierre
1997-06-01
This paper describes a phased incremental integration approach for application of image analysis and data fusion technologies to provide automated intelligent target tracking and identification for airborne surveillance on board an Aurora Maritime Patrol Aircraft. The sensor suite of the Aurora consists of a radar, an identification friend or foe (IFF) system, an electronic support measures (ESM) system, a spotlight synthetic aperture radar (SSAR), a forward looking infra-red (FLIR) sensor and a link-11 tactical datalink system. Lockheed Martin Canada (LMCan) is developing a testbed, which will be used to analyze and evaluate approaches for combining the data provided by the existing sensors, which were initially not designed to feed a fusion system. Three concurrent research proof-of-concept activities provide techniques, algorithms and methodology into three sequential phases of integration of this testbed. These activities are: (1) analysis of the fusion architecture (track/contact/hybrid) most appropriate for the type of data available, (2) extraction and fusion of simple features from the imaging data into the fusion system performing automatic target identification, and (3) development of a unique software architecture which will permit integration and independent evolution, enhancement and optimization of various decision aid capabilities, such as multi-sensor data fusion (MSDF), situation and threat assessment (STA) and resource management (RM).
The SUMO Ship Detector Algorithm for Satellite Radar Images
Directory of Open Access Journals (Sweden)
Harm Greidanus
2017-03-01
Full Text Available Search for Unidentified Maritime Objects (SUMO is an algorithm for ship detection in satellite Synthetic Aperture Radar (SAR images. It has been developed over the course of more than 15 years, using a large amount of SAR images from almost all available SAR satellites operating in L-, C- and X-band. As validated by benchmark tests, it performs very well on a wide range of SAR image modes (from Spotlight to ScanSAR and resolutions (from 1–100 m and for all types and sizes of ships, within the physical limits imposed by the radar imaging. This paper describes, in detail, the algorithmic approach in all of the steps of the ship detection: land masking, clutter estimation, detection thresholding, target clustering, ship attribute estimation and false alarm suppression. SUMO is a pixel-based CFAR (Constant False Alarm Rate detector for multi-look radar images. It assumes a K distribution for the sea clutter, corrected however for deviations of the actual sea clutter from this distribution, implementing a fast and robust method for the clutter background estimation. The clustering of detected pixels into targets (ships uses several thresholds to deal with the typically irregular distribution of the radar backscatter over a ship. In a multi-polarization image, the different channels are fused. Azimuth ambiguities, a common source of false alarms in ship detection, are removed. A reliability indicator is computed for each target. In post-processing, using the results of a series of images, additional false alarms from recurrent (fixed targets including range ambiguities are also removed. SUMO can run in semi-automatic mode, where an operator can verify each detected target. It can also run in fully automatic mode, where batches of over 10,000 images have successfully been processed in less than two hours. The number of satellite SAR systems keeps increasing, as does their application to maritime surveillance. The open data policy of the EU
Interception of LPI radar signals
Lee, Jim P.
1991-11-01
Most current radars are designed to transmit short duration pulses with relatively high peak power. These radars can be detected easily by the use of relatively modest EW intercept receivers. Three radar functions (search, anti-ship missile (ASM) seeker, and navigation) are examined to evaluate the effectiveness of potential low probability of intercept (LPI) techniques, such as waveform coding, antenna profile control, and power management that a radar may employ against current Electronic Warfare (EW) receivers. The general conclusion is that it is possible to design a LPI radar which is effective against current intercept EW receivers. LPI operation is most easily achieved at close ranges and against a target with a large radar cross section. The general system sensitivity requirement for the detection of current and projected LPI radars is found to be on the order of -100 dBmi which cannot be met by current EW receivers. Finally, three potential LPI receiver architectures, using channelized, superhet, and acousto-optic receivers with narrow RF and video bandwidths are discussed. They have shown some potential in terms of providing the sensitivity and capability in an environment where both conventional and LPI signals are present.
Air and spaceborne radar systems an introduction
Lacomme, Philippe; Hardange, Jean-Philippe; Normant, Eric
2001-01-01
A practical tool on radar systems that will be of major help to technicians, student engineers and engineers working in industry and in radar research and development. The many users of radar as well as systems engineers and designers will also find it highly useful. Also of interest to pilots and flight engineers and military command personnel and military contractors. """"This introduction to the field of radar is intended for actual users of radar. It focuses on the history, main principles, functions, modes, properties and specific nature of modern airborne radar. The book examines radar's
Human walking estimation with radar
Dorp, Ph. van; Groen, F.C.A.
2003-01-01
Radar can be used to observe humans that are obscured by objects such as walls. These humans cannot be visually observed. The radar measurements are used to animate an obscured human in virtual reality. This requires detailed information about the motion. The radar measurements give detailed
FMWC Radar for Breath Detection
DEFF Research Database (Denmark)
Suhr, Lau Frejstrup; Tafur Monroy, Idelfonso; Vegas Olmos, Juan José
We report on the experimental demonstration of an FMCW radar operating in the 25.7 - 26.6 GHz range with a repetition rate of 500 sweeps per second. The radar is able to track the breathing rate of an adult human from a distance of 1 meter. The experiments have utilized a 50 second recording window...... to accurately track the breathing rate. The radar utilizes a saw tooth modulation format and a low latency receiver. A breath tracking radar is useful both in medical scenarios, diagnosing disorders such as sleep apnea, and for home use where the user can monitor its health. Breathing is a central part of every...... radar chip which, through the use of a simple modulation scheme, is able to measure the breathing rate of an adult human from a distance. A high frequency output makes sure that the radar cannot penetrate solid obstacles which is a wanted feature in private homes where people therefore cannot measure...
Radar meteor rates and solar activity
International Nuclear Information System (INIS)
Prikryl, P.
1983-01-01
The short-term variation of diurnal radar meteor rates with solar activity represented by solar microwave flux Fsub(10.7), and sunspots relative number Rsub(z), is investigated. Applying the superposed-epoch analysis to the observational material of radar meteor rates from Christchurch (1960-61 and 1963-65), a decrease in the recorded radar rates is found during days of enhanced solar activity. No effect of geomagnetic activity similar to the one reported for the Swedish and Canadian radar meteor data was found by the author in the Christchurch data. A possible explanation of the absence of the geomagnetic effect on radar meteor rates from New Zealand due to a lower echo ceiling height of the Christchurch radar is suggested. The variation of the atmospheric parameters as a possible cause of the observed variation in radar meteor rates is also discussed. (author)
Knott, Gene; Tuley, Michael
2004-01-01
This is the second edition of the first and foremost book on this subject for self-study, training, and course work. Radar cross section (RCS) is a comparison of two radar signal strengths. One is the strength of the radar beam sweeping over a target, the other is the strength of the reflected echo sensed by the receiver. This book shows how the RCS ?gauge? can be predicted for theoretical objects and how it can be measured for real targets. Predicting RCS is not easy, even for simple objects like spheres or cylinders, but this book explains the two ?exact? forms of theory so well that even a
Classification and correction of the radar bright band with polarimetric radar
Hall, Will; Rico-Ramirez, Miguel; Kramer, Stefan
2015-04-01
The annular region of enhanced radar reflectivity, known as the Bright Band (BB), occurs when the radar beam intersects a layer of melting hydrometeors. Radar reflectivity is related to rainfall through a power law equation and so this enhanced region can lead to overestimations of rainfall by a factor of up to 5, so it is important to correct for this. The BB region can be identified by using several techniques including hydrometeor classification and freezing level forecasts from mesoscale meteorological models. Advances in dual-polarisation radar measurements and continued research in the field has led to increased accuracy in the ability to identify the melting snow region. A method proposed by Kitchen et al (1994), a form of which is currently used operationally in the UK, utilises idealised Vertical Profiles of Reflectivity (VPR) to correct for the BB enhancement. A simpler and more computationally efficient method involves the formation of an average VPR from multiple elevations for correction that can still cause a significant decrease in error (Vignal 2000). The purpose of this research is to evaluate a method that relies only on analysis of measurements from an operational C-band polarimetric radar without the need for computationally expensive models. Initial results show that LDR is a strong classifier of melting snow with a high Critical Success Index of 97% when compared to the other variables. An algorithm based on idealised VPRs resulted in the largest decrease in error when BB corrected scans are compared to rain gauges and to lower level scans with a reduction in RMSE of 61% for rain-rate measurements. References Kitchen, M., R. Brown, and A. G. Davies, 1994: Real-time correction of weather radar data for the effects of bright band, range and orographic growth in widespread precipitation. Q.J.R. Meteorol. Soc., 120, 1231-1254. Vignal, B. et al, 2000: Three methods to determine profiles of reflectivity from volumetric radar data to correct
2010-10-01
... within one mile of land must be fitted with a FCC Type Accepted general marine radar system for surface... Federal Communications Commission (FCC) type accepted general marine radar system for surface navigation... 46 Shipping 7 2010-10-01 2010-10-01 false Radars. 184.404 Section 184.404 Shipping COAST GUARD...
DEFF Research Database (Denmark)
Albrechtslund, Anders; Coeckelbergh, Mark; Matzner, Tobias
Studying surveillance involves raising questions about the very nature of concepts such as information, technology, identity, space and power. Besides the maybe all too obvious ethical issues often discussed with regard to surveillance, there are several other angles and approaches that we should...... like to encourage. Therefore, our panel will focus on the philosophical, yet non-ethical issues of surveillance in order to stimulate an intense debate with the audience on the ethical implications of our enquiries. We also hope to provide a broader and deeper understanding of surveillance....
Radar network communication through sensing of frequency hopping
Dowla, Farid; Nekoogar, Faranak
2013-05-28
In one embodiment, a radar communication system includes a plurality of radars having a communication range and being capable of operating at a sensing frequency and a reporting frequency, wherein the reporting frequency is different than the sensing frequency, each radar is adapted for operating at the sensing frequency until an event is detected, each radar in the plurality of radars has an identification/location frequency for reporting information different from the sensing frequency, a first radar of the radars which senses the event sends a reporting frequency corresponding to its identification/location frequency when the event is detected, and all other radars in the plurality of radars switch their reporting frequencies to match the reporting frequency of the first radar upon detecting the reporting frequency switch of a radar within the communication range. In another embodiment, a method is presented for communicating information in a radar system.
Sensor management in RADAR/IRST track fusion
Hu, Shi-qiang; Jing, Zhong-liang
2004-07-01
In this paper, a novel radar management strategy technique suitable for RADAR/IRST track fusion, which is based on Fisher Information Matrix (FIM) and fuzzy stochastic decision approach, is put forward. Firstly, optimal radar measurements' scheduling is obtained by the method of maximizing determinant of the Fisher information matrix of radar and IRST measurements, which is managed by the expert system. Then, suggested a "pseudo sensor" to predict the possible target position using the polynomial method based on the radar and IRST measurements, using "pseudo sensor" model to estimate the target position even if the radar is turned off. At last, based on the tracking performance and the state of target maneuver, fuzzy stochastic decision is used to adjust the optimal radar scheduling and retrieve the module parameter of "pseudo sensor". The experiment result indicates that the algorithm can not only limit Radar activity effectively but also keep the tracking accuracy of active/passive system well. And this algorithm eliminates the drawback of traditional Radar management methods that the Radar activity is fixed and not easy to control and protect.
National Research Council Canada - National Science Library
Stryjewski, John
1998-01-01
The BMDO Innovative Science and Technology Experimentation Facility (BMDO/ISTEF) laser radar program is engaged in an ongoing program to develop and demonstrate advanced laser radar concepts for Ballistic Missile Defense (BMD...
Radar and electronic navigation
Sonnenberg, G J
2013-01-01
Radar and Electronic Navigation, Sixth Edition discusses radar in marine navigation, underwater navigational aids, direction finding, the Decca navigator system, and the Omega system. The book also describes the Loran system for position fixing, the navy navigation satellite system, and the global positioning system (GPS). It reviews the principles, operation, presentations, specifications, and uses of radar. It also describes GPS, a real time position-fixing system in three dimensions (longitude, latitude, altitude), plus velocity information with Universal Time Coordinated (UTC). It is accur
National Oceanic and Atmospheric Administration, Department of Commerce — These data represent an inventory of the national impacts of wind turbine interference with NEXRAD radar stations. This inventory was developed by the NOAA Radar...
Pocket radar guide key facts, equations, and data
Curry, G Richard
2010-01-01
ThePocket Radar Guideis a concise collection of key radar facts and important radar data that provides you with necessary radar information when you are away from your office or references. It includes statements and comments on radar design, operation, and performance; equations describing the characteristics and performance of radar systems and their components; and tables with data on radar characteristics and key performance issues.It is intended to supplement other radar information sources by providing a pocket companion to refresh memory and provide details whenever you need them such a
Synthetic aperture radar capabilities in development
Energy Technology Data Exchange (ETDEWEB)
Miller, M. [Lawrence Livermore National Lab., CA (United States)
1994-11-15
The Imaging and Detection Program (IDP) within the Laser Program is currently developing an X-band Synthetic Aperture Radar (SAR) to support the Joint US/UK Radar Ocean Imaging Program. The radar system will be mounted in the program`s Airborne Experimental Test-Bed (AETB), where the initial mission is to image ocean surfaces and better understand the physics of low grazing angle backscatter. The Synthetic Aperture Radar presentation will discuss its overall functionality and a brief discussion on the AETB`s capabilities. Vital subsystems including radar, computer, navigation, antenna stabilization, and SAR focusing algorithms will be examined in more detail.
Extended Target Recognition in Cognitive Radar Networks
Directory of Open Access Journals (Sweden)
Xiqin Wang
2010-11-01
Full Text Available We address the problem of adaptive waveform design for extended target recognition in cognitive radar networks. A closed-loop active target recognition radar system is extended to the case of a centralized cognitive radar network, in which a generalized likelihood ratio (GLR based sequential hypothesis testing (SHT framework is employed. Using Doppler velocities measured by multiple radars, the target aspect angle for each radar is calculated. The joint probability of each target hypothesis is then updated using observations from different radar line of sights (LOS. Based on these probabilities, a minimum correlation algorithm is proposed to adaptively design the transmit waveform for each radar in an amplitude fluctuation situation. Simulation results demonstrate performance improvements due to the cognitive radar network and adaptive waveform design. Our minimum correlation algorithm outperforms the eigen-waveform solution and other non-cognitive waveform design approaches.
Detection of Weather Radar Clutter
DEFF Research Database (Denmark)
Bøvith, Thomas
2008-01-01
classification and use a range of different techniques and input data. The first method uses external information from multispectral satellite images to detect clutter. The information in the visual, near-infrared, and infrared parts of the spectrum can be used to distinguish between cloud and cloud-free areas......Weather radars provide valuable information on precipitation in the atmosphere but due to the way radars work, not only precipitation is observed by the weather radar. Weather radar clutter, echoes from non-precipitating targets, occur frequently in the data, resulting in lowered data quality....... Especially in the application of weather radar data in quantitative precipitation estimation and forecasting a high data quality is important. Clutter detection is one of the key components in achieving this goal. This thesis presents three methods for detection of clutter. The methods use supervised...
Penn State Radar Systems: Implementation and Observations
Urbina, J. V.; Seal, R.; Sorbello, R.; Kuyeng, K.; Dyrud, L. P.
2014-12-01
Software Defined Radio/Radar (SDR) platforms have become increasingly popular as researchers, hobbyists, and military seek more efficient and cost-effective means for radar construction and operation. SDR platforms, by definition, utilize a software-based interface for configuration in contrast to traditional, hard-wired platforms. In an effort to provide new and improved radar sensing capabilities, Penn State has been developing advanced instruments and technologies for future radars, with primary objectives of making such instruments more capable, portable, and more cost effective. This paper will describe the design and implementation of two low-cost radar systems and their deployment in ionospheric research at both low and mid-latitudes. One radar has been installed near Penn State campus, University Park, Pennsylvania (77.97°W, 40.70°N), to make continuous meteor observations and mid-latitude plasma irregularities. The second radar is being installed in Huancayo (12.05°S, -75.33°E), Peru, which is capable of detecting E and F region plasma irregularities as well as meteor reflections. In this paper, we examine and compare the diurnal and seasonal variability of specular, non- specular, and head-echoes collected with these two new radar systems and discuss sampling biases of each meteor observation technique. We report our current efforts to validate and calibrate these radar systems with other VHF radars such as Jicamarca and SOUSY. We also present the general characteristics of continuous measurements of E-region and F-region coherent echoes using these modern radar systems and compare them with coherent radar events observed at other geographic mid-latitude radar stations.
SMAP RADAR Calibration and Validation
West, R. D.; Jaruwatanadilok, S.; Chaubel, M. J.; Spencer, M.; Chan, S. F.; Chen, C. W.; Fore, A.
2015-12-01
The Soil Moisture Active Passive (SMAP) mission launched on Jan 31, 2015. The mission employs L-band radar and radiometer measurements to estimate soil moisture with 4% volumetric accuracy at a resolution of 10 km, and freeze-thaw state at a resolution of 1-3 km. Immediately following launch, there was a three month instrument checkout period, followed by six months of level 1 (L1) calibration and validation. In this presentation, we will discuss the calibration and validation activities and results for the L1 radar data. Early SMAP radar data were used to check commanded timing parameters, and to work out issues in the low- and high-resolution radar processors. From April 3-13 the radar collected receive only mode data to conduct a survey of RFI sources. Analysis of the RFI environment led to a preferred operating frequency. The RFI survey data were also used to validate noise subtraction and scaling operations in the radar processors. Normal radar operations resumed on April 13. All radar data were examined closely for image quality and calibration issues which led to improvements in the radar data products for the beta release at the end of July. Radar data were used to determine and correct for small biases in the reported spacecraft attitude. Geo-location was validated against coastline positions and the known positions of corner reflectors. Residual errors at the time of the beta release are about 350 m. Intra-swath biases in the high-resolution backscatter images are reduced to less than 0.3 dB for all polarizations. Radiometric cross-calibration with Aquarius was performed using areas of the Amazon rain forest. Cross-calibration was also examined using ocean data from the low-resolution processor and comparing with the Aquarius wind model function. Using all a-priori calibration constants provided good results with co-polarized measurements matching to better than 1 dB, and cross-polarized measurements matching to about 1 dB in the beta release. During the
Thiebaud, P.; Cross, D. C.
1980-07-01
A new solid-state radar switchboard equipped with 16 input ports which will output data to 16 displays is presented. Each of the ports will handle a single two-dimensional radar input, or three ports will accommodate a three-dimensional radar input. A video switch card of the switchboard is used to switch all signals, with the exception of the IFF-mode-control lines. Each card accepts inputs from up to 16 sources and can pass a signal with bandwidth greater than 20 MHz to the display assigned to that card. The synchro amplifier of current systems has been eliminated and in the new design each PPI receives radar data via a single coaxial cable. This significant reduction in cabling is achieved by adding a serial-to-parallel interface and a digital-to-synchro converter located at the PPI.
Chandra*, Chandrasekar V.; the full DFW Team
2015-04-01
Currently, the National Weather Service (NWS) Next Generation Weather Radar (NEXRAD) provides observations updated every five-six minutes across the United States. However, at the maximum NEXRAD operating range of 230 km, the 0.5 degree radar beam (lowest tilt) height is about 5.4 km above ground level (AGL) because of the effect of Earth curvature. Consequently, much of the lower atmosphere (1-3 km AGL) cannot be observed by the NEXRAD. To overcome the fundamental coverage limitations of today's weather surveillance radars, and improve the spatial and temporal resolution issues, at urban scale, the National Science Foundation Engineering Research Center (NSF-ERC) for Collaborative Adaptive Sensing of the Atmosphere (CASA) has embarked the development of Dallas-Fort worth (DFW) urban remote sensing network to conduct high-resolution sensing in the lower atmosphere for a metropolitan environment, communicate high resolution observations and nowcasting of severe weather including flash floods, hail storms and high wind events. Being one of the largest inland metropolitan areas in the U.S., the DFW Metroplex is home to over 6.5 million people by 2012 according to the North Central Texas Council of Governments (NCTCOG). It experiences a wide range of natural weather hazards, including urban flash flood, high wind, tornado, and hail, etc. Successful monitoring of the rapid changing meteorological conditions in such a region is necessary for emergency management and decision making. Therefore, it is an ideal location to investigate the impacts of hazardous weather phenomena, to enhance resilience in an urban setting and demonstrate the CASA concept in a densely populated urban environment. The DFW radar network consists of 8 dual-polarization X-band weather radars and standard NEXRAD S-band radar, covering the greater DFW metropolitan region. This paper will present high resolution observation of tornado, urban flood, hail storm and damaging wind event all within the
Introduction to surveillance studies
Petersen, JK
2012-01-01
Introduction & OverviewIntroduction Brief History of Surveillance Technologies & TechniquesOptical SurveillanceAerial Surveillance Audio Surveillance Radio-Wave SurveillanceGlobal Positioning Systems Sensors Computers & the Internet Data Cards Biochemical Surveillance Animal Surveillance Biometrics Genetics Practical ConsiderationsPrevalence of Surveillance Effectiveness of Surveillance Freedom & Privacy IssuesConstitutional Freedoms Privacy Safeguards & Intrusions ResourcesReferences Glossary Index
The use of radar for bathymetry assessment
Aardoom, J.H.; Greidanus, H.S.F.
1998-01-01
The bottom topography in shallow seas can be observed by air- and spaceborne imaging radar. Bathymetric information derived from radar data is limited in accuracy, but radar has a good spatial coverage. The accuracy can be increased by assimilating the radar imagery into existing or insitu gathered
Willis, Nick
2004-01-01
Annotation his book is a major extension of a chapter on bistatic radar written by the author for the Radar Handbook, 2nd edition, edited by Merrill Skolnik. It provides a history of bistatic systems that points out to potential designers the applications that have worked and the dead-ends not worth pursuing. The text reviews the basic concepts and definitions, and explains the mathematical development of relationships, such as geometry, Ovals of Cassini, dynamic range, isorange and isodoppler contours, target doppler, and clutter doppler spread.Key Features * All development and analysis are
Institute of Scientific and Technical Information of China (English)
周君
2015-01-01
[Abstract]Kalman filter for radar surveillance technology in air traffic control systems were analyzed. Discuss the corresponding Kalman filtering techniques: Related adaptive Kalman filtering, multi-model adaptive Kalman filter, adaptive Kalman filter information based on neural network adaptive Kalman filtering, fuzzy logic adaptive Kalman filtering, and their main advantages and disadvantages of the problem.%对卡尔曼雷达滤波技术在空管监视系统中的应用进行了分析,讨论了相应的卡尔曼滤波技术:相关自适应卡尔曼滤波、多模型自适应卡尔曼滤波、基于信息的自适应卡尔曼滤波、神经网络自适应卡尔曼滤波、模糊逻辑自适应卡尔曼滤波,并对它们主要解决的问题及优缺点进行了分析。
Radar spectrum opportunities for cognitive communications transmission
Wang, L; McGeehan, JP; Williams, C; Doufexi, A
2008-01-01
In relation to opportunistic access to radar spectrum, the impact of the radar on a communication system is investigated in this paper. This paper illustrates that by exploring the spatial and temporal opportunities in the radar spectrum and therefore improving the tolerance level to radar interference, a substantial increase on the throughput of a communication system is possible. Results are presented regarding the impact of swept radars on a WiMAX system. The results show the impact of SIR...
Typhoon 9707 observations with the MU radar and L-band boundary layer radar
Directory of Open Access Journals (Sweden)
M. Teshiba
2001-08-01
Full Text Available Typhoon 9707 (Opal was observed with the VHF-band Middle and Upper atmosphere (MU radar, an L-band boundary layer radar (BLR, and a vertical-pointing C-band meteorological radar at the Shigaraki MU Observatory in Shiga prefecture, Japan on 20 June 1997. The typhoon center passed about 80 km southeast from the radar site. Mesoscale precipitating clouds developed due to warm-moist airmass transport from the typhoon, and passed over the MU radar site with easterly or southeasterly winds. We primarily present the wind behaviour including the vertical component which a conventional meteorological Doppler radar cannot directly observe, and discuss the relationship between the wind behaviour of the typhoon and the precipitating system. To investigate the dynamic structure of the typhoon, the observed wind was divided into radial and tangential wind components under the assumption that the typhoon had an axi-symmetric structure. Altitude range of outflow ascended from 1–3 km to 2–10 km with increasing distance (within 80–260 km range from the typhoon center, and in-flow was observed above and below the outflow. Outflow and inflow were associated with updraft and downdraft, respectively. In the tangential wind, the maximum speed of counterclockwise winds was confirmed at 1–2 km altitudes. Based on the vertical velocity and the reflectivity obtained with the MU radar and the C-band meteorological radar, respectively, precipitating clouds, accompanied by the wind behaviour of the typhoon, were classified into stratiform and convective precipitating clouds. In the stratiform precipitating clouds, a vertical shear of radial wind and the maximum speed of counterclockwise wind were observed. There was a strong reflectivity layer called a ‘bright band’ around the 4.2 km altitude. We confirmed strong updrafts and down-drafts below and above it, respectively, and the existence of a relatively dry layer around the bright band level from radiosonde
Typhoon 9707 observations with the MU radar and L-band boundary layer radar
Directory of Open Access Journals (Sweden)
M. Teshiba
Full Text Available Typhoon 9707 (Opal was observed with the VHF-band Middle and Upper atmosphere (MU radar, an L-band boundary layer radar (BLR, and a vertical-pointing C-band meteorological radar at the Shigaraki MU Observatory in Shiga prefecture, Japan on 20 June 1997. The typhoon center passed about 80 km southeast from the radar site. Mesoscale precipitating clouds developed due to warm-moist airmass transport from the typhoon, and passed over the MU radar site with easterly or southeasterly winds. We primarily present the wind behaviour including the vertical component which a conventional meteorological Doppler radar cannot directly observe, and discuss the relationship between the wind behaviour of the typhoon and the precipitating system. To investigate the dynamic structure of the typhoon, the observed wind was divided into radial and tangential wind components under the assumption that the typhoon had an axi-symmetric structure. Altitude range of outflow ascended from 1–3 km to 2–10 km with increasing distance (within 80–260 km range from the typhoon center, and in-flow was observed above and below the outflow. Outflow and inflow were associated with updraft and downdraft, respectively. In the tangential wind, the maximum speed of counterclockwise winds was confirmed at 1–2 km altitudes. Based on the vertical velocity and the reflectivity obtained with the MU radar and the C-band meteorological radar, respectively, precipitating clouds, accompanied by the wind behaviour of the typhoon, were classified into stratiform and convective precipitating clouds. In the stratiform precipitating clouds, a vertical shear of radial wind and the maximum speed of counterclockwise wind were observed. There was a strong reflectivity layer called a ‘bright band’ around the 4.2 km altitude. We confirmed strong updrafts and down-drafts below and above it, respectively, and the existence of a relatively dry layer around the bright band level from radiosonde
International Nuclear Information System (INIS)
Harmon, J.K.; Campbell, D.B.
1988-01-01
Some of the radar altimetry profiles of Mercury obtained on the basis of data from the Arecibo Observatory are presented. In these measurements, the delay-Doppler method was used to measure altitudes along the Doppler equator, rather than to map radar reflectivity. The profiles, derived from observations made over a 6-yr period, provide extensive coverage over a restricted equatorial band and permit the identification of radar signatures for features as small as 50-km diameter craters and 1-km-high arcuate scarps. The data allowed identification of large-scale topographic features such as smooth plains subsidence zones and major highland regions
Energy Technology Data Exchange (ETDEWEB)
Suzuki, K.; Ito, M. [Kawasaki Geological Engineering, Co. Ltd., Tokyo (Japan); Tanabe, K. [Central Research Institute of Electric Power Industry, Tokyo (Japan)
1997-05-27
The underground radar exploration is adopted to surveys of cavity under the road and buried pipes since the result of high resolution is obtained. However, the explorative depth of the radar is shallow, 2-3m in soil basement, and its applicable field has been limited. The continuous wave radar (FM-CW radar) was devised to get deeper explorative depth, but has been used for the geological structure survey such as the fault survey since it is lower in resolution as compared with the pulse radar. Therefore, to make use of characteristics of the continuous wave radar and enhance resolution in the shallow part, an experiment on buried pipes was conducted for the purpose of assessing and improving the FM-CW radar. In this processing, the wave form treatment used in the reflection method seismic survey was adopted for the radar survey. There are some problems, but it is effective to adopt the same algorithm to that used in the seismic survey to the radar exploration. The explorative depth was discussed from the damping rate of electromagnetic waves and dynamic range of facilities of the experimental site, and 7m was obtained. 5 figs., 1 tab.
Radar reflection off extensive air showers
Stasielak, J; Bertaina, M; Blümer, J; Chiavassa, A; Engel, R; Haungs, A; Huege, T; Kampert, K -H; Klages, H; Kleifges, M; Krömer, O; Ludwig, M; Mathys, S; Neunteufel, P; Pekala, J; Rautenberg, J; Riegel, M; Roth, M; Salamida, F; Schieler, H; Šmída, R; Unger, M; Weber, M; Werner, F; Wilczyński, H; Wochele, J
2012-01-01
We investigate the possibility of detecting extensive air showers by the radar technique. Considering a bistatic radar system and different shower geometries, we simulate reflection of radio waves off the static plasma produced by the shower in the air. Using the Thomson cross-section for radio wave reflection, we obtain the time evolution of the signal received by the antennas. The frequency upshift of the radar echo and the power received are studied to verify the feasibility of the radar detection technique.
Etude par imagerie radar des pollutions pétrolières
Directory of Open Access Journals (Sweden)
G. Rees
2004-06-01
Full Text Available En Russie, chaque année, les déversements de pétrole représentent un cinquième de la production totale. Les plus importants se produisent dans le domaine périglaciaire où le milieu naturel est d’une extrême fragilité. Les pipelines sont soumis à de rudes conditions notamment à la corrosion et aux processus cryogéniques. Le risque de rupture augmente en conséquence. La surveillance des déversements d’hydrocarbures, contrainte par l’immensité et la fréquente inaccessibilité du réseau de pipelines, peut être réalisée par le recours à la télédétection. L’objectif de ce travail est de fournir, à travers l’exemple de la catastrophe d’Usinsk (Rép. de Komi survenue en 1994, des outils d’analyse des images radar. Outre leur capacité à s’affranchir du couvert nuageux, les capteurs radar apportent des informations complémentaires à celles fournies par des capteurs optiques. L’exploitation thématique de ces images est rendue difficile par un certain nombre de facteurs perturbateurs tels que les caractéristiques propres du capteur, la direction de visée, la topographie et le phénomène de chatoiement (speckle. Le travail présenté montre le rôle prépondérant joué par ces corrections qui permettent de disposer de données quantitatives comparables d’une date à une autre. La méthode mise au point ici pour le suivi temporel de l’épanchement de pétrole d’Usinsk à partir de trois images radar, est discutée notamment dans ses limites et son aspect opérationnel possible.
Seyfried, Daniel; Schubert, Karsten; Schoebel, Joerg
2014-12-01
Employing a continuous-wave radar system, with the stepped-frequency radar being one type of this class, all reflections from the environment are present continuously and simultaneously at the receiver. Utilizing such a radar system for Ground Penetrating Radar purposes, antenna cross-talk and ground bounce reflection form an overall dominant signal contribution while reflections from objects buried in the ground are of quite weak amplitude due to attenuation in the ground. This requires a large dynamic range of the receiver which in turn requires high sensitivity of the radar system. In this paper we analyze the sensitivity of our vector network analyzer utilized as stepped-frequency radar system for GPR pipe detection. We furthermore investigate the performance of increasing the sensitivity of the radar by means of appropriate averaging and low-noise pre-amplification of the received signal. It turns out that the improvement in sensitivity actually achievable may differ significantly from theoretical expectations. In addition, we give a descriptive explanation why our appropriate experiments demonstrate that the sensitivity of the receiver is independent of the distance between the target object and the source of dominant signal contribution. Finally, our investigations presented in this paper lead to a preferred setting of operation for our vector network analyzer in order to achieve best detection capability for weak reflection amplitudes, hence making the radar system applicable for Ground Penetrating Radar purposes.
Detecting and classifying low probability of intercept radar
Pace, Philip E
2008-01-01
This revised and expanded second edition brings you to the cutting edge with new chapters on LPI radar design, including over-the-horizon radar, random noise radar, and netted LPI radar. You also discover critical LPI detection techniques, parameter extraction signal processing techniques, and anti-radiation missile design strategies to counter LPI radar.
Radar probing of the auroral plasma
International Nuclear Information System (INIS)
Brekke, A.
1977-01-01
The European Incoherent Scatter Radar in the Auroral Zone (EISCAT) is an intereuropean organization planning to install an incoherent scatter radar system in Northern Scandinavia. It is supported by Finland, France, Norway, Great Britain, Sweden and West Germany, and its headquarters is in Kiruna, Sweden. The radar is planned to be operating in 1979. In order to introduce students and young scientists to the incoherent scatter radar technique, a summer school was held in Tromsoe, from 5th to 13th June 1975. In these proceedings an introduction to the basic theory of fluctuations in a plasma is given. Some of the present incoherent scatter radars now in use are presented and special considerations with respect to the planned EISACT facility are discussed. Reviews of some recent results and scientific problems relevant to EISCAT are also presented and finally a presentation of some observational techniques complementary to incoherent scatter radars is included. (Ed.)
Method for radar detection of persons wearing wires
Fox, William P.
2014-01-01
8,730,098 B1 Methods are described for radar detection of persons wearing wires using radar spectra data including the vertical polarization (VV) radar cross section and the horizontal polarization (HH) radar cross section for a person. In one embodiment, the ratio of the vertical polarization (VV) radar cross section to the horizontal polarization (HH) radar cross section for a person is compared to a detection threshold to determine whether the person is wearing wire...
Brookner, E.
1985-02-01
The operating principles, technology, and applications of phased-array radars are reviewed and illustrated with diagrams and photographs. Consideration is given to the antenna elements, circuitry for time delays, phase shifters, pulse coding and compression, and hybrid radars combining phased arrays with lenses to alter the beam characteristics. The capabilities and typical hardware of phased arrays are shown using the US military systems COBRA DANE and PAVE PAWS as examples.
Chang, Hsi-Tien
1987-09-28
A borehole logging tool generates a fast rise-time, short duration, high peak-power radar pulse having broad energy distribution between 30 MHz and 300 MHz through a directional transmitting and receiving antennas having barium titanate in the electromagnetically active region to reduce the wavelength to within an order of magnitude of the diameter of the antenna. Radar returns from geological discontinuities are sampled for transmission uphole. 7 figs.
Radar reflection off extensive air showers
Directory of Open Access Journals (Sweden)
Werner F.
2013-06-01
Full Text Available We investigate the possibility of detecting extensive air showers by the radar technique. Considering a bistatic radar system and different shower geometries, we simulate reflection of radio waves off the static plasma produced by the shower in the air. Using the Thomson cross-section for radio wave reflection, we obtain the time evolution of the signal received by the antennas. The frequency upshift of the radar echo and the power received are studied to verify the feasibility of the radar detection technique.
Millimeter wave radars raise weapon IQ
Lerner, E. J.
1985-02-01
The problems encountered by laser and IR homing devices for guided munitions may be tractable with warhead-mounted mm-wave radars. Operating at about 100 GHz and having several kilometers range, mm-wave radars see through darkness, fog, rain and smoke. The radar must be coupled with an analyzer that discerns moving and stationary targets and higher priority targets. The target lock-on can include shut-off of the transmitter and reception of naturally-generated mm-waves bouncing off the target when in the terminal phase of the flight. Monopulse transmitters have simplified the radar design, although mass production of finline small radar units has yet to be accomplished, particularly in combining GaAs, ferrites and other materials on one monolithic chip.
HF Radar Sea-echo from Shallow Water
Directory of Open Access Journals (Sweden)
Josh Kohut
2008-08-01
Full Text Available HF radar systems are widely and routinely used for the measurement of ocean surface currents and waves. Analysis methods presently in use are based on the assumption of infinite water depth, and may therefore be inadequate close to shore where the radar echo is strongest. In this paper, we treat the situation when the radar echo is returned from ocean waves that interact with the ocean floor. Simulations are described which demonstrate the effect of shallow water on radar sea-echo. These are used to investigate limits on the existing theory and to define water depths at which shallow-water effects become significant. The second-order spectral energy increases relative to the first-order as the water depth decreases, resulting in spectral saturation when the waveheight exceeds a limit defined by the radar transmit frequency. This effect is particularly marked for lower radar transmit frequencies. The saturation limit on waveheight is less for shallow water. Shallow water affects second-order spectra (which gives wave information far more than first-order (which gives information on current velocities, the latter being significantly affected only for the lowest radar transmit frequencies for extremely shallow water. We describe analysis of radar echo from shallow water measured by a Rutgers University HF radar system to give ocean wave spectral estimates. Radar-derived wave height, period and direction are compared with simultaneous shallow-water in-situ measurements.
Marine X-band Weather Radar Data Calibration
DEFF Research Database (Denmark)
Thorndahl, Søren Liedtke; Rasmussen, Michael R.
2012-01-01
estimates. This paper presents some of the challenges in small marine X-band radar calibration by comparing three calibration procedures for assessing the relationship between radar and rain gauge data. Validation shows similar results for precipitation volumes but more diverse results on peak rain......Application of weather radar data in urban hydrology is evolving and radar data is now applied for both modelling, analysis, and real time control purposes. In these contexts, it is allimportant that the radar data is well calibrated and adjusted in order to obtain valid quantitative precipitation...
Raindrop size distribution and radar reflectivity-rain rate relationships for radar hydrology
Uijlenhoet, R.
2001-01-01
The conversion of the radar reflectivity factor Z (mm6m-3) to rain rate R (mm h-1) is a crucial step in the hydrological application of weather radar measurements. It has been common practice for over 50 years now to take for this conversion a simple power law relationship between Z and R. It is the
Wagner, A.; Seltmann, J.; Kunstmann, H.
2015-02-01
A radar-based rainfall statistic demands high quality data that provide realistic precipitation amounts in space and time. Instead of correcting single radar images, we developed a post-correction scheme for long-term composite radar data that corrects corrupted areas, but preserves the original precipitation patterns. The post-correction scheme is based on a 5 year statistical analysis of radar composite data and its constituents. The accumulation of radar images reveals artificial effects that are not visible in the individual radar images. Some of them are already inherent to single radar data such as the effect of increasing beam height, beam blockage or clutter remnants. More artificial effects are introduced in the process of compositing such as sharp gradients at the boundaries of overlapping areas due to different beam heights and resolution. The cause of these disturbances, their behaviour with respect to reflectivity level, season or altitude is analysed based on time-series of two radar products: the single radar reflectivity product PX for each of the 16 radar systems of the German Meteorological Service (DWD) for the time span 2000 to 2006 and the radar composite product RX of DWD from 2005 through to 2009. These statistics result in additional quality information on radar data that is not available elsewhere. The resulting robust characteristics of disturbances, e.g. the dependency of the frequencies of occurrence of radar reflectivities on beam height, are then used as a basis for the post-correction algorithm. The scheme comprises corrections for shading effects and speckles, such as clutter remnants or overfiltering, as well as for systematic differences in frequencies of occurrence of radar reflectivities between the near and the far ranges of individual radar sites. An adjustment to rain gauges is also included. Applying this correction, the Root-Mean-Square-Error for the comparison of radar derived annual rain amounts with rain gauge data
Trilateration-based localization algorithm for ADS-B radar systems
Huang, Ming-Shih
Rapidly increasing growth and demand in various unmanned aerial vehicles (UAV) have pushed governmental regulation development and numerous technology research advances toward integrating unmanned and manned aircraft into the same civil airspace. Safety of other airspace users is the primary concern; thus, with the introduction of UAV into the National Airspace System (NAS), a key issue to overcome is the risk of a collision with manned aircraft. The challenge of UAV integration is global. As automatic dependent surveillance-broadcast (ADS-B) system has gained wide acceptance, additional exploitations of the radioed satellite-based information are topics of current interest. One such opportunity includes the augmentation of the communication ADS-B signal with a random bi-phase modulation for concurrent use as a radar signal for detecting other aircraft in the vicinity. This dissertation provides detailed discussion about the ADS-B radar system, as well as the formulation and analysis of a suitable non-cooperative multi-target tracking method for the ADS-B radar system using radar ranging techniques and particle filter algorithms. In order to deal with specific challenges faced by the ADS-B radar system, several estimation algorithms are studied. Trilateration-based localization algorithms are proposed due to their easy implementation and their ability to work with coherent signal sources. The centroid of three most closely spaced intersections of constant-range loci is conventionally used as trilateration estimate without rigorous justification. In this dissertation, we address the quality of trilateration intersections through range scaling factors. A number of well-known triangle centers, including centroid, incenter, Lemoine point (LP), and Fermat point (FP), are discussed in detail. To the author's best knowledge, LP was never associated with trilateration techniques. According our study, LP is proposed as the best trilateration estimator thanks to the
Radar signal analysis and processing using Matlab
Mahafza, Bassem R
2008-01-01
Offering radar-related software for the analysis and design of radar waveform and signal processing, this book provides comprehensive coverage of radar signals and signal processing techniques and algorithms. It contains numerous graphical plots, common radar-related functions, table format outputs, and end-of-chapter problems. The complete set of MATLAB[registered] functions and routines are available for download online.
Directory of Open Access Journals (Sweden)
N. Swarnalingam
2009-04-01
Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.
International Nuclear Information System (INIS)
Davies, N.G.
1995-01-01
This report examines the possible degradations of radar performance that may be caused by the presence of a wind turbine generator within the radar coverage area. A brief literature survey reviews the previously published work, which is mainly concerned with degradation of broadcast TV reception. Estimates are made of wind turbine generator scattering cross-sections, and of the time and Doppler characteristics of the echo signals from representative wind turbine generator. The general characteristics of radar detection and tracking methods are described, and the behaviour of such systems in the presence of strong returns from a wind turbine generator (or an array of them) is discussed. (author)
Radar techniques using array antennas
Wirth, Wulf-Dieter
2013-01-01
Radar Techniques Using Array Antennas is a thorough introduction to the possibilities of radar technology based on electronic steerable and active array antennas. Topics covered include array signal processing, array calibration, adaptive digital beamforming, adaptive monopulse, superresolution, pulse compression, sequential detection, target detection with long pulse series, space-time adaptive processing (STAP), moving target detection using synthetic aperture radar (SAR), target imaging, energy management and system parameter relations. The discussed methods are confirmed by simulation stud
New look at radar auroral motions
International Nuclear Information System (INIS)
Greenwald, R.A.; Ecklund, W.L.
1975-01-01
During October 1974, three modifications were temporarily added to the NOAA radar auroral backscatter facility located at Anchorage, Alaska. These modifications included (1) a multiple azimuth antenna system. (2) an on-line computer for processing amplitude and mean Doppler profiles of the radar backscatter, and (3) a 13-baud Barker coder. In combination with the radar these modifications provided data relevant to understanding both the microscopic and the macroscopic nature of the radar aurora. Appreciable structure was often found in the Doppler velocity profiles of radar auroral irregularities. Doppler velocities of nearly 2000 m/s were observed. By combining scatter amplitude profiles and mean Doppler profiles from the five azimuths we have produced contour maps of the scatter intensity and the Doppler velocity. The scatter intensity maps often indicate appreciable temporal and spatial structure in the radar auroral irregularities, corroborating the results of Tsunoda et al. (1974). The mean Doppler contour maps indicate that there is also appreciable temporal and spatial structure in the flow velocities of radar auroral irregularities. At those times when there appears to be large-scale uniformity in the irregularity flow, the Doppler velocity varies with azimuth in a manner that is consistent with a cosine-dependent azimuthal variation
Attaching Hollywood to a Surveillant Assemblage: Normalizing Discourses of Video Surveillance
Directory of Open Access Journals (Sweden)
Randy K Lippert
2015-10-01
Full Text Available This article examines video surveillance images in Hollywood film. It moves beyond previous accounts of video surveillance in relation to film by theoretically situating the use of these surveillance images in a broader “surveillant assemblage”. To this end, scenes from a sample of thirty-five (35 films of several genres are examined to discern dominant discourses and how they lend themselves to normalization of video surveillance. Four discourses are discovered and elaborated by providing examples from Hollywood films. While the films provide video surveillance with a positive associative association it is not without nuance and limitations. Thus, it is found that some forms of resistance to video surveillance are shown while its deterrent effect is not. It is ultimately argued that Hollywood film is becoming attached to a video surveillant assemblage discursively through these normalizing discourses as well as structurally to the extent actual video surveillance technology to produce the images is used.
Farnham, Tony; Asphaug, Erik; Barucci, Antonella; Belton, Mike; Bockelee-Morvan, Dominique; Brownlee, Donald; Capria, Maria Teresa; Carter, Lynn; Chesley, Steve; Farnham, Tony; Gaskell, Robert; Gim, Young; Heggy, Essam; Herique, Alain; Klaasen, Ken; Kofman, Wlodek; Kreslavsky, Misha; Lisse, Casey; Orosei, Roberto; Plaut, Jeff; Scheeres, Dan
The Comet Radar Explorer (CORE) is designed to perform a comprehensive and detailed exploration of the interior, surface, and inner coma structures of a scientifically impor-tant Jupiter family comet. These structures will be used to investigate the origins of cometary nuclei, their physical and geological evolution, and the mechanisms driving their spectacular activity. CORE is a high heritage spacecraft, injected by solar electric propulsion into orbit around a comet. It is capable of coherent deep radar imaging at decameter wavelengths, high resolution stereo color imaging, and near-IR imaging spectroscopy. Its primary objective is to obtain a high-resolution map of the interior structure of a comet nucleus at a resolution of ¿100 elements across the diameter. This structure shall be related to the surface geology and morphology, and to the structural details of the coma proximal to the nucleus. This is an ideal complement to the science from recent comet missions, providing insight into how comets work. Knowing the structure of the interior of a comet-what's inside-and how cometary activity works, is required before we can understand the requirements for a cryogenic sample return mission. But more than that, CORE is fundamental to understanding the origin of comets and their evolution in time. The mission is made feasible at low cost by the use of now-standard MARSIS-SHARAD reflec-tion radar imaging hardware and data processing, together with proven flight heritage of solar electric propulsion. Radar flight heritage has been demonstrated by the MARSIS radar on Mars Express (Picardi et al., Science 2005; Plaut et al., Science 2007), the SHARAD radar onboard the Mars Reconnaissance Orbiter (Seu et al., JGR 2007), and the LRS radar onboard Kaguya (Ono et al, EPS 2007). These instruments have discovered detailed subsurface structure to depths of several kilometers in a variety of terrains on Mars and the Moon. A reflection radar deployed in orbit about a comet
Hydrologic applications of weather radar
Seo, Dong-Jun; Habib, Emad; Andrieu, Hervé; Morin, Efrat
2015-12-01
By providing high-resolution quantitative precipitation information (QPI), weather radars have revolutionized hydrology in the last two decades. With the aid of GIS technology, radar-based quantitative precipitation estimates (QPE) have enabled routine high-resolution hydrologic modeling in many parts of the world. Given the ever-increasing need for higher-resolution hydrologic and water resources information for a wide range of applications, one may expect that the use of weather radar will only grow. Despite the tremendous progress, a number of significant scientific, technological and engineering challenges remain to realize its potential. New challenges are also emerging as new areas of applications are discovered, explored and pursued. The purpose of this special issue is to provide the readership with some of the latest advances, lessons learned, experiences gained, and science issues and challenges related to hydrologic applications of weather radar. The special issue features 20 contributions on various topics which reflect the increasing diversity as well as the areas of focus in radar hydrology today. The contributions may be grouped as follows:
Classification of radar echoes using fractal geometry
International Nuclear Information System (INIS)
Azzaz, Nafissa; Haddad, Boualem
2017-01-01
Highlights: • Implementation of two concepts of fractal geometry to classify two types of meteorological radar echoes. • A new approach, called a multi-scale fractal dimension is used for classification between fixed echoes and rain echoes. • An Automatic identification system of meteorological radar echoes was proposed using fractal geometry. - Abstract: This paper deals with the discrimination between the precipitation echoes and the ground echoes in meteorological radar images using fractal geometry. This study aims to improve the measurement of precipitations by weather radars. For this, we considered three radar sites: Bordeaux (France), Dakar (Senegal) and Me lbourne (USA). We showed that the fractal dimension based on contourlet and the fractal lacunarity are pertinent to discriminate between ground and precipitation echoes. We also demonstrated that the ground echoes have a multifractal structure but the precipitations are more homogeneous than ground echoes whatever the prevailing climate. Thereby, we developed an automatic classification system of radar using a graphic interface. This interface, based on the fractal geometry makes possible the identification of radar echoes type in real time. This system can be inserted in weather radar for the improvement of precipitation estimations.
MST radar data-base management
Wickwar, V. B.
1983-01-01
Data management for Mesospheric-Stratospheric-Tropospheric, (MST) radars is addressed. An incoherent-scatter radar data base is discussed in terms of purpose, centralization, scope, and nature of the data base management system.
Stepped-frequency radar sensors theory, analysis and design
Nguyen, Cam
2016-01-01
This book presents the theory, analysis and design of microwave stepped-frequency radar sensors. Stepped-frequency radar sensors are attractive for various sensing applications that require fine resolution. The book consists of five chapters. The first chapter describes the fundamentals of radar sensors including applications followed by a review of ultra-wideband pulsed, frequency-modulated continuous-wave (FMCW), and stepped-frequency radar sensors. The second chapter discusses a general analysis of radar sensors including wave propagation in media and scattering on targets, as well as the radar equation. The third chapter addresses the analysis of stepped-frequency radar sensors including their principles and design parameters. Chapter 4 presents the development of two stepped-frequency radar sensors at microwave and millimeter-wave frequencies based on microwave integrated circuits (MICs), microwave monolithic integrated circuits (MMICs) and printed-circuit antennas, and discusses their signal processing....
Challenges in X-band Weather Radar Data Calibration
DEFF Research Database (Denmark)
Thorndahl, Søren; Rasmussen, Michael R.
2009-01-01
Application of weather radar data in urban hydrology is evolving and radar data is now applied for both modelling, analysis and real time control purposes. In these contexts, it is all-important that the radar data well calibrated and adjusted in order to obtain valid quantitative precipitation e...... estimates. This paper compares two calibration procedures for a small marine X-band radar by comparing radar data with rain gauge data. Validation shows a very good consensus with regards to precipitation volumes, but more diverse results on peak rain intensities.......Application of weather radar data in urban hydrology is evolving and radar data is now applied for both modelling, analysis and real time control purposes. In these contexts, it is all-important that the radar data well calibrated and adjusted in order to obtain valid quantitative precipitation...
Radar principles for the nonspecialist, 3rd edition
Toomay, John
2004-01-01
Radar Principles for the Non-specialist, Third Edition continues its popular tradition: to distill the very complex technology of radar into its fundamentals, tying them to the laws of nature on one end and to the most modern and complex systems on the other. It starts with electromagnetic propagation, describes a radar of the utmost simplicity, and derives the radar range equation from that simple radar. Once the range equation is available, the book attacks the meaning of each term in it, moving through antennas, detection and tracking, radar cross-section, waveforms andsignal proces
Principles of modern radar advanced techniques
Melvin, William
2012-01-01
Principles of Modern Radar: Advanced Techniques is a professional reference for practicing engineers that provides a stepping stone to advanced practice with in-depth discussions of the most commonly used advanced techniques for radar design. It will also serve advanced radar academic and training courses with a complete set of problems for students as well as solutions for instructors.
Mutual information-based LPI optimisation for radar network
Shi, Chenguang; Zhou, Jianjiang; Wang, Fei; Chen, Jun
2015-07-01
Radar network can offer significant performance improvement for target detection and information extraction employing spatial diversity. For a fixed number of radars, the achievable mutual information (MI) for estimating the target parameters may extend beyond a predefined threshold with full power transmission. In this paper, an effective low probability of intercept (LPI) optimisation algorithm is presented to improve LPI performance for radar network. Based on radar network system model, we first provide Schleher intercept factor for radar network as an optimisation metric for LPI performance. Then, a novel LPI optimisation algorithm is presented, where for a predefined MI threshold, Schleher intercept factor for radar network is minimised by optimising the transmission power allocation among radars in the network such that the enhanced LPI performance for radar network can be achieved. The genetic algorithm based on nonlinear programming (GA-NP) is employed to solve the resulting nonconvex and nonlinear optimisation problem. Some simulations demonstrate that the proposed algorithm is valuable and effective to improve the LPI performance for radar network.
Radar operation in a hostile electromagnetic environment
Energy Technology Data Exchange (ETDEWEB)
Doerry, Armin Walter
2014-03-01
Radar ISR does not always involve cooperative or even friendly targets. An adversary has numerous techniques available to him to counter the effectiveness of a radar ISR sensor. These generally fall under the banner of jamming, spoofing, or otherwise interfering with the EM signals required by the radar sensor. Consequently mitigation techniques are prudent to retain efficacy of the radar sensor. We discuss in general terms a number of mitigation techniques.
LÜNEBURG, Ernst
2002-01-01
This contribution is a tutorial introduction to the phenomenological theory of radar polarimetry for the coherent scatter case emphasizing monostatic backscattering and forward scattering (transmission). Characteristic similarities and differences between radar polarimetry and optical polarimetry and the role of linear and antilinear operators (time-reversal) are pointed out and typical polarimetric invariants are identified.
Remote sensing with laser spectrum radar
Wang, Tianhe; Zhou, Tao; Jia, Xiaodong
2016-10-01
The unmanned airborne (UAV) laser spectrum radar has played a leading role in remote sensing because the transmitter and the receiver are together at laser spectrum radar. The advantages of the integrated transceiver laser spectrum radar is that it can be used in the oil and gas pipeline leak detection patrol line which needs the non-contact reflective detection. The UAV laser spectrum radar can patrol the line and specially detect the swept the area are now in no man's land because most of the oil and gas pipelines are in no man's land. It can save labor costs compared to the manned aircraft and ensure the safety of the pilots. The UAV laser spectrum radar can be also applied in the post disaster relief which detects the gas composition before the firefighters entering the scene of the rescue.
Complete Systematic Error Model of SSR for Sensor Registration in ATC Surveillance Networks.
Jarama, Ángel J; López-Araquistain, Jaime; Miguel, Gonzalo de; Besada, Juan A
2017-09-21
In this paper, a complete and rigorous mathematical model for secondary surveillance radar systematic errors (biases) is developed. The model takes into account the physical effects systematically affecting the measurement processes. The azimuth biases are calculated from the physical error of the antenna calibration and the errors of the angle determination dispositive. Distance bias is calculated from the delay of the signal produced by the refractivity index of the atmosphere, and from clock errors, while the altitude bias is calculated taking into account the atmosphere conditions (pressure and temperature). It will be shown, using simulated and real data, that adapting a classical bias estimation process to use the complete parametrized model results in improved accuracy in the bias estimation.
Using phase for radar scatterer classification
Moore, Linda J.; Rigling, Brian D.; Penno, Robert P.; Zelnio, Edmund G.
2017-04-01
Traditional synthetic aperture radar (SAR) systems tend to discard phase information of formed complex radar imagery prior to automatic target recognition (ATR). This practice has historically been driven by available hardware storage, processing capabilities, and data link capacity. Recent advances in high performance computing (HPC) have enabled extremely dense storage and processing solutions. Therefore, previous motives for discarding radar phase information in ATR applications have been mitigated. First, we characterize the value of phase in one-dimensional (1-D) radar range profiles with respect to the ability to correctly estimate target features, which are currently employed in ATR algorithms for target discrimination. These features correspond to physical characteristics of targets through radio frequency (RF) scattering phenomenology. Physics-based electromagnetic scattering models developed from the geometrical theory of diffraction are utilized for the information analysis presented here. Information is quantified by the error of target parameter estimates from noisy radar signals when phase is either retained or discarded. Operating conditions (OCs) of signal-tonoise ratio (SNR) and bandwidth are considered. Second, we investigate the value of phase in 1-D radar returns with respect to the ability to correctly classify canonical targets. Classification performance is evaluated via logistic regression for three targets (sphere, plate, tophat). Phase information is demonstrated to improve radar target classification rates, particularly at low SNRs and low bandwidths.
Pedestrian recognition using automotive radar sensors
Bartsch, A.; Fitzek, F.; Rasshofer, R. H.
2012-09-01
The application of modern series production automotive radar sensors to pedestrian recognition is an important topic in research on future driver assistance systems. The aim of this paper is to understand the potential and limits of such sensors in pedestrian recognition. This knowledge could be used to develop next generation radar sensors with improved pedestrian recognition capabilities. A new raw radar data signal processing algorithm is proposed that allows deep insights into the object classification process. The impact of raw radar data properties can be directly observed in every layer of the classification system by avoiding machine learning and tracking. This gives information on the limiting factors of raw radar data in terms of classification decision making. To accomplish the very challenging distinction between pedestrians and static objects, five significant and stable object features from the spatial distribution and Doppler information are found. Experimental results with data from a 77 GHz automotive radar sensor show that over 95% of pedestrians can be classified correctly under optimal conditions, which is compareable to modern machine learning systems. The impact of the pedestrian's direction of movement, occlusion, antenna beam elevation angle, linear vehicle movement, and other factors are investigated and discussed. The results show that under real life conditions, radar only based pedestrian recognition is limited due to insufficient Doppler frequency and spatial resolution as well as antenna side lobe effects.
Next Generation Space Surveillance System-of-Systems
McShane, B.
2014-09-01
International economic and military dependence on space assets is pervasive and ever-growing in an environment that is now congested, contested, and competitive. There are a number of natural and man-made risks that need to be monitored and characterized to protect and preserve the space environment and the assets within it. Unfortunately, today's space surveillance network (SSN) has gaps in coverage, is not resilient, and has a growing number of objects that get lost. Risks can be efficiently and effectively mitigated, gaps closed, resiliency improved, and performance increased within a next generation space surveillance network implemented as a system-of-systems with modern information architectures and analytic techniques. This also includes consideration for the newest SSN sensors (e.g. Space Fence) which are born Net-Centric out-of-the-box and able to seamlessly interface with the JSpOC Mission System, global information grid, and future unanticipated users. Significant opportunity exists to integrate legacy, traditional, and non-traditional sensors into a larger space system-of-systems (including command and control centers) for multiple clients through low cost sustainment, modification, and modernization efforts. Clients include operations centers (e.g. JSpOC, USSTRATCOM, CANSPOC), Intelligence centers (e.g. NASIC), space surveillance sensor sites (e.g. AMOS, GEODSS), international governments (e.g. Germany, UK), space agencies (e.g. NASA), and academic institutions. Each has differing priorities, networks, data needs, timeliness, security, accuracy requirements and formats. Enabling processes and technologies include: Standardized and type accredited methods for secure connections to multiple networks, machine-to-machine interfaces for near real-time data sharing and tip-and-queue activities, common data models for analytical processing across multiple radar and optical sensor types, an efficient way to automatically translate between differing client and
Target scattering characteristics for OAM-based radar
Directory of Open Access Journals (Sweden)
Kang Liu
2018-02-01
Full Text Available The target scattering characteristics are crucial for radar systems. However, there is very little study conducted for the recently developed orbital angular momentum (OAM based radar system. To illustrate the role of OAM-based radar cross section (ORCS, conventional radar equation is modified by taking characteristics of the OAM waves into account. Subsequently, the ORCS is defined in analogy to classical radar cross section (RCS. The unique features of the incident OAM-carrying field are analyzed. The scattered field is derived, and the analytical expressions of ORCSs for metal plate and cylinder targets are obtained. Furthermore, the ORCS and RCS are compared to illustrate the influences of OAM mode number, target size and signal frequency on the ORCS. Analytical studies demonstrate that the mirror-reflection phenomenon disappears and peak values of ORCS are in the non-specular direction. Finally, the ORCS features are summarized to show its advantages in radar target detection. This work can provide theoretical guidance to the design of OAM-based radar as well as the target detection and identification applications.
Target scattering characteristics for OAM-based radar
Liu, Kang; Gao, Yue; Li, Xiang; Cheng, Yongqiang
2018-02-01
The target scattering characteristics are crucial for radar systems. However, there is very little study conducted for the recently developed orbital angular momentum (OAM) based radar system. To illustrate the role of OAM-based radar cross section (ORCS), conventional radar equation is modified by taking characteristics of the OAM waves into account. Subsequently, the ORCS is defined in analogy to classical radar cross section (RCS). The unique features of the incident OAM-carrying field are analyzed. The scattered field is derived, and the analytical expressions of ORCSs for metal plate and cylinder targets are obtained. Furthermore, the ORCS and RCS are compared to illustrate the influences of OAM mode number, target size and signal frequency on the ORCS. Analytical studies demonstrate that the mirror-reflection phenomenon disappears and peak values of ORCS are in the non-specular direction. Finally, the ORCS features are summarized to show its advantages in radar target detection. This work can provide theoretical guidance to the design of OAM-based radar as well as the target detection and identification applications.
Radar application in void and bar detection
International Nuclear Information System (INIS)
Amry Amin Abas; Mohamad Pauzi Ismail; Suhairy Sani
2003-01-01
Radar is one of the new non-destructive testing techniques for concrete and structures inspection. Radar is a non-ionizing electromagnetic wave that can penetrate deep into concrete or soil in about several tenths of meters. Method of inspection using radar enables us to perform high resolution detection, imaging and mapping of subsurface concrete and soil condition. This paper will discuss the use of radar for void and bar detection and sizing. The samples used in this paper are custom made samples and comparison will be made to validate the use of radar in detecting, locating and also size determination of voids and bars. (Author)
Radar micro-doppler signatures processing and applications
Chen, Victor C; Miceli, William J
2014-01-01
Radar Micro-Doppler Signatures: Processing and applications concentrates on the processing and application of radar micro-Doppler signatures in real world situations, providing readers with a good working knowledge on a variety of applications of radar micro-Doppler signatures.
SAR Ambiguity Study for the Cassini Radar
Hensley, Scott; Im, Eastwood; Johnson, William T. K.
1993-01-01
The Cassini Radar's synthetic aperture radar (SAR) ambiguity analysis is unique with respect to other spaceborne SAR ambiguity analyses owing to the non-orbiting spacecraft trajectory, asymmetric antenna pattern, and burst mode of data collection. By properly varying the pointing, burst mode timing, and radar parameters along the trajectory this study shows that the signal-to-ambiguity ratio of better than 15 dB can be achieved for all images obtained by the Cassini Radar.
Argemí, O.; Bech, J.; Pineda, N.; Rigo, T.
2009-09-01
Remote sensing observing systems of the Meteorological Service of Catalonia (SMC) have been upgraded during the last years with newer technologies and enhancements. Recent changes on the weather radar network have been motivated to improve precipitation estimates by radar as well as meteorological surveillance in the area of Catalonia. This region has approximately 32,000 square kilometres and is located in the NE of Spain, limited by the Pyrenees to the North (with mountains exceeding 3000 m) and by the Mediterranean Sea to the East and South. In the case of the total lightning (intra-cloud and cloud-to-ground lightning) detection system, the current upgrades will assure a better lightning detection efficiency and location accuracy. Both upgraded systems help to enhance the tracking and the study of thunderstorm events. Initially, the weather radar network was designed to cover the complex topography of Catalonia and surrounding areas to support the regional administration, which includes civil protection and water authorities. The weather radar network was upgraded in 2008 with the addition of a new C-band Doppler radar system, which is located in the top of La Miranda Mountain (Tivissa) in the southern part of Catalonia enhancing the coverage, particularly to the South and South-West. Technically the new radar is very similar to the last one installed in 2003 (Creu del Vent radar), using a 4 m antenna (i.e., 1 degree beam width), a Vaisala-Sigmet RVP-8 digital receiver and processor and a low power transmitter using a Travelling Wave Tube (TWT) amplifier. This design allows using pulse-compression techniques to enhance radial resolution and sensitivity. Currently, the SMC is upgrading its total lightning detection system, operational since 2003. While a fourth sensor (Amposta) was added last year to enlarge the system coverage, all sensors and central processor will be upgraded this year to the new Vaisala’s total lightning location technology. The new LS8000
Radar Polarimetry: Theory, Analysis, and Applications
Hubbert, John Clark
The fields of radar polarimetry and optical polarimetry are compared. The mathematics of optic polarimetry are formulated such that a local right handed coordinate system is always used to describe the polarization states. This is not done in radar polarimetry. Radar optimum polarization theory is redeveloped within the framework of optical polarimetry. The radar optimum polarizations and optic eigenvalues of common scatterers are compared. In addition a novel definition of an eigenpolarization state is given and the accompanying mathematics is developed. The polarization response calculated using optic, radar and novel definitions is presented for a variety of scatterers. Polarimetric transformation provides a means to characterize scatters in more than one polarization basis. Polarimetric transformation for an ensemble of scatters is obtained via two methods: (1) the covariance method and (2) the instantaneous scattering matrix (ISM) method. The covariance method is used to relate the mean radar parameters of a +/-45^circ linear polarization basis to those of a horizontal and vertical polarization basis. In contrast the ISM method transforms the individual time samples. Algorithms are developed for transforming the time series from fully polarimetric radars that switch between orthogonal states. The transformed time series are then used to calculate the mean radar parameters of interest. It is also shown that propagation effects do not need to be removed from the ISM's before transformation. The techniques are demonstrated using data collected by POLDIRAD, the German Aerospace Research Establishment's fully polarimetric C-band radar. The differential phase observed between two copolar states, Psi_{CO}, is composed of two phases: (1) differential propagation phase, phi_{DP}, and (2) differential backscatter phase, delta. The slope of phi_{DP } with range is an estimate of the specific differential phase, K_{DP}. The process of estimating K_{DP} is complicated when
UAV-based Radar Sounding of Antarctic Ice
Leuschen, Carl; Yan, Jie-Bang; Mahmood, Ali; Rodriguez-Morales, Fernando; Hale, Rick; Camps-Raga, Bruno; Metz, Lynsey; Wang, Zongbo; Paden, John; Bowman, Alec; Keshmiri, Shahriar; Gogineni, Sivaprasad
2014-05-01
We developed a compact radar for use on a small UAV to conduct measurements over the ice sheets in Greenland and Antarctica. It operates at center frequencies of 14 and 35 MHz with bandwidths of 1 MHz and 4 MHz, respectively. The radar weighs about 2 kgs and is housed in a box with dimensions of 20.3 cm x 15.2 cm x 13.2 cm. It transmits a signal power of 100 W at a pulse repletion frequency of 10 kHz and requires average power of about 20 W. The antennas for operating the radar are integrated into the wings and airframe of a small UAV with a wingspan of 5.3 m. We selected the frequencies of 14 and 35 MHz based on previous successful soundings of temperate ice in Alaska with a 12.5 MHz impulse radar [Arcone, 2002] and temperate glaciers in Patagonia with a 30 MHz monocycle radar [Blindow et al., 2012]. We developed the radar-equipped UAV to perform surveys over a 2-D grid, which allows us to synthesize a large two-dimensional aperture and obtain fine resolution in both the along- and cross-track directions. Low-frequency, high-sensitivity radars with 2-D aperture synthesis capability are needed to overcome the surface and volume scatter that masks weak echoes from the ice-bed interface of fast-flowing glaciers. We collected data with the radar-equipped UAV on sub-glacial ice near Lake Whillans at both 14 and 35 MHz. We acquired data to evaluate the concept of 2-D aperture synthesis and successfully demonstrated the first successful sounding of ice with a radar on an UAV. We are planning to build multiple radar-equipped UAVs for collecting fine-resolution data near the grounding lines of fast-flowing glaciers. In this presentation we will provide a brief overview of the radar and UAV, as well as present results obtained at both 14 and 35 MHz. Arcone, S. 2002. Airborne-radar stratigraphy and electrical structure of temperate firn: Bagley Ice Field, Alaska, U.S.A. Journal of Glaciology, 48, 317-334. Blindow, N., C. Salat, and G. Casassa. 2012. Airborne GPR sounding of
Introduction to radar target recognition
Tait, P
2006-01-01
This new text provides an overview of the radar target recognition process and covers the key techniques being developed for operational systems. It is based on the fundamental scientific principles of high resolution radar, and explains how the techniques can be used in real systems, taking into account the characteristics of practical radar system designs and component limitations. It also addresses operational aspects, such as how high resolution modes would fit in with other functions such as detection and tracking. Mathematics is kept to a minimum and the complex techniques and issues are
Reassembling Surveillance Creep
DEFF Research Database (Denmark)
Bøge, Ask Risom; Lauritsen, Peter
2017-01-01
We live in societies in which surveillance technologies are constantly introduced, are transformed, and spread to new practices for new purposes. How and why does this happen? In other words, why does surveillance “creep”? This question has received little attention either in theoretical developm......We live in societies in which surveillance technologies are constantly introduced, are transformed, and spread to new practices for new purposes. How and why does this happen? In other words, why does surveillance “creep”? This question has received little attention either in theoretical...... development or in empirical analyses. Accordingly, this article contributes to this special issue on the usefulness of Actor-Network Theory (ANT) by suggesting that ANT can advance our understanding of ‘surveillance creep’. Based on ANT’s model of translation and a historical study of the Danish DNA database......, we argue that surveillance creep involves reassembling the relations in surveillance networks between heterogeneous actors such as the watchers, the watched, laws, and technologies. Second, surveillance creeps only when these heterogeneous actors are adequately interested and aligned. However...
Wassilak, Steven G F; Williams, Cheryl L; Murrill, Christopher S; Dahl, Benjamin A; Ohuabunwo, Chima; Tangermann, Rudolf H
2017-07-01
Surveillance for acute flaccid paralysis (AFP) is a fundamental cornerstone of the global polio eradication initiative (GPEI). Active surveillance (with visits to health facilities) is a critical strategy of AFP surveillance systems for highly sensitive and timely detection of cases. Because of the extensive resources devoted to AFP surveillance, multiple opportunities exist for additional diseases to be added using GPEI assets, particularly because there is generally 1 district officer responsible for all disease surveillance. For this reason, integrated surveillance has become a standard practice in many countries, ranging from adding surveillance for measles and rubella to integrated disease surveillance for outbreak-prone diseases (integrated disease surveillance and response). This report outlines the current level of disease surveillance integration in 3 countries (Nepal, India, and Nigeria) and proposes that resources continue for long-term maintenance in resource-poor countries of AFP surveillance as a platform for surveillance of vaccine-preventable diseases and other outbreak-prone diseases. © The Author 2017. Published by Oxford University Press for the Infectious Diseases Society of America.
Redefining syndromic surveillance
Directory of Open Access Journals (Sweden)
Rebecca Katz
2011-12-01
Full Text Available With growing concerns about international spread of disease and expanding use of early disease detection surveillance methods, the field of syndromic surveillance has received increased attention over the last decade. The purpose of this article is to clarify the various meanings that have been assigned to the term syndromic surveillance and to propose a refined categorization of the characteristics of these systems. Existing literature and conference proceedings were examined on syndromic surveillance from 1998 to 2010, focusing on low- and middle-income settings. Based on the 36 unique definitions of syndromic surveillance found in the literature, five commonly accepted principles of syndromic surveillance systems were identified, as well as two fundamental categories: specific and non-specific disease detection. Ultimately, the proposed categorization of syndromic surveillance distinguishes between systems that focus on detecting defined syndromes or outcomes of interest and those that aim to uncover non-specific trends that suggest an outbreak may be occurring. By providing an accurate and comprehensive picture of this field’s capabilities, and differentiating among system types, a unified understanding of the syndromic surveillance field can be developed, encouraging the adoption, investment in, and implementation of these systems in settings that need bolstered surveillance capacity, particularly low- and middle-income countries.
Ground and Space Radar Volume Matching and Comparison Software
Morris, Kenneth; Schwaller, Mathew
2010-01-01
This software enables easy comparison of ground- and space-based radar observations. The software was initially designed to compare ground radar reflectivity from operational, ground based Sand C-band meteorological radars with comparable measurements from the Tropical Rainfall Measuring Mission (TRMM) satellite s Precipitation Radar (PR) instrument. The software is also applicable to other ground-based and space-based radars. The ground and space radar volume matching and comparison software was developed in response to requirements defined by the Ground Validation System (GVS) of Goddard s Global Precipitation Mission (GPM) project. This software innovation is specifically concerned with simplifying the comparison of ground- and spacebased radar measurements for the purpose of GPM algorithm and data product validation. This software is unique in that it provides an operational environment to routinely create comparison products, and uses a direct geometric approach to derive common volumes of space- and ground-based radar data. In this approach, spatially coincident volumes are defined by the intersection of individual space-based Precipitation Radar rays with the each of the conical elevation sweeps of the ground radar. Thus, the resampled volume elements of the space and ground radar reflectivity can be directly compared to one another.
Development Of Signal Detection For Radar Navigation System
Theingi Win Hlaing; Hla Myo Tun; Zaw Min Naing; Win Khaing Moe
2017-01-01
This paper aims to evaluate the performance of target detection in the presence of sea clutter. Radar detection of a background of unwanted clutter due to echoes from sea clutter or land is a problem of interest in the radar field. Radar detector has been developed by assuming the radar clutter is Gaussian distributed. However as technology emerges the radar distribution is seen to deviates from the Gaussian assumption. Thus detectors designs based on Gaussian assumption are no longer optimum...
International Nuclear Information System (INIS)
Ostro, S.J.; Cornell University, Ithaca, N.Y.); Campbell, D.B.; Pettengill, G.H.
1980-01-01
Asteroid 4 Vesta was detected on November 6, 1979 with the Arecibo Observatory's S-band (12.6-cm-wavelength) radar. The echo power spectrum, received in the circular polarization opposite to that transmitted, yields a radar cross section of (0.2 + or - 0.1)pi a-squared, for a 272 km. The data are too noisy to permit derivation of Vesta's rotation period
Condor equatorial electrojet campaign: Radar results
International Nuclear Information System (INIS)
Kudeki, E.; Fejer, B.G.; Farley, D.T.; Hanuise, C.
1987-01-01
A review of the experimental and theoretical background to the Condor equatorial electrojet compaign is followed by the presentation and discussion of VHF radar interferometer and HF radar backscatter data taken concurrently with two rocket in situ experiments reported in companion papers (Pfaff et al., this issue (a, b). Both experiments were conducted in strongly driven periods with the on-line radar interferometer displaying signatures of what has been interpreted in earlier radar work (Kudeki et al., 1982) as kilometer scale gradient drift waves. Low-frequency density fluctuations detected by in situ rocket sensors confirm the earlier interpretation. VHF radar/rocket data comparisons also indicate the existence of a turbulent layer in the upper portion of the daytime electrojet at about 108 km altitude driven purely by the two-stream instability. Nonlinear mode coupling of linearly growing two-stream waves to linearly damped 3-m vertical modes could account for the radar echoes scattered from this layer, which showed no indication of large-scale gradient drift waves. Nonlinear mode coupling may therefore compete with the wave-induced anomalous diffusion mechanism proposed recently by Sudan (1983) for the saturation of directly excited two-stream waves. Nighttime radar data show a bifurcated layer with the two parts having comparable echo strength but oppositely directed zonal drift velocities. The lower layer shows narrow backscatter spectra; the upper layer is characterized by kilometer scale waves and vertically propagating type 1 waves
Montebugnoli, S.; Pupillo, G.; Salerno, E.; Pluchino, S.; di Martino, M.
2010-03-01
An accurate measurement of the position and trajectory of the space debris fragments is of primary importance for the characterization of the orbital debris environment. The Medicina Radioastronomical Station is a radio observation facility that is here proposed as receiving part of a ground-based space surveillance system for detecting and tracking space debris at different orbital regions (from Low Earth Orbits up to Geostationary Earth Orbits). The proposed system consists of two bistatic radars formed by the existing Medicina receiving antennas coupled with appropriate transmitters. This paper focuses on the current features and future technical development of the receiving part of the observational setup. Outlines of possible transmitting systems will also be given together with the evaluation of the observation strategies achievable with the proposed facilities.
A 100 GHz Polarimetric Compact Radar Range for Scale-Model Radar Cross Section Measurements
2013-10-01
common radar bands. ACKNOWLEDGEMENTS The authors wish to thank David Jillson (UML STL – Electrical Engineer) for efforts involved in RF and DC wiring...Waldman J., Fetterman H.R., Duffy P.E., Bryant T.G., Tannenwald P.E., “Submillimeter Model Measurements and Their Applications to Millimeter Radar
Lejoly, Cassandra; Howell, Ellen S.; Taylor, Patrick A.; Springmann, Alessondra; Virkki, Anne; Nolan, Michael C.; Rivera-Valentin, Edgard G.; Benner, Lance A. M.; Brozovic, Marina; Giorgini, Jon D.
2017-10-01
The Near-Earth Asteroid (NEA) population ranges in size from a few meters to more than 10 kilometers. NEAs have a wide variety of taxonomic classes, surface features, and shapes, including spheroids, binary objects, contact binaries, elongated, as well as irregular bodies. Using the Arecibo Observatory planetary radar system, we have measured apparent rotation rate, radar reflectivity, apparent diameter, and radar albedos for over 350 NEAs. The radar albedo is defined as the radar cross-section divided by the geometric cross-section. If a shape model is available, the actual cross-section is known at the time of the observation. Otherwise we derive a geometric cross-section from a measured diameter. When radar imaging is available, the diameter was measured from the apparent range depth. However, when radar imaging was not available, we used the continuous wave (CW) bandwidth radar measurements in conjunction with the period of the object. The CW bandwidth provides apparent rotation rate, which, given an independent rotation measurement, such as from lightcurves, constrains the size of the object. We assumed an equatorial view unless we knew the pole orientation, which gives a lower limit on the diameter. The CW also provides the polarization ratio, which is the ratio of the SC and OC cross-sections.We confirm the trend found by Benner et al. (2008) that taxonomic types E and V have very high polarization ratios. We have obtained a larger sample and can analyze additional trends with spin, size, rotation rate, taxonomic class, polarization ratio, and radar albedo to interpret the origin of the NEAs and their dynamical processes. The distribution of radar albedo and polarization ratio at the smallest diameters (≤50 m) differs from the distribution of larger objects (>50 m), although the sample size is limited. Additionally, we find more moderate radar albedos for the smallest NEAs when compared to those with diameters 50-150 m. We will present additional trends we
Doppler Radar and Lightning Network Observations of a Severe Outbreak of Tropical Cyclone Tornadoes
Mccaul, Eugene W., Jr.; Buechler, Dennis E.; Goodman, Steven J.; Cammarata, Michael
2004-01-01
Data from a single Weather Surveillance Radar-1988 Doppler (WSR-88D) and the National Lightning Detection Network are used to examine the characteristics of the convective storms that produced a severe tornado outbreak, including three tornadoes that reached F3 intensity, within Tropical Storm Beryl s remnants on 16 August 1994. Comparison of the radar data with reports of tornadoes suggests that only 13 cells produced the 29 tornadoes that were documented in Georgia and the Carolinas on that date. Six of these cells spawned multiple tornadoes, and the radar data confirm the presence of miniature supercells. One of the cells was identifiable on radar for 11 h. spawning tornadoes over a time period spanning approximately 6.5 h. Several other tornadic cells also exhibited great longevity, with cell lifetimes longer than ever previously documented in a landfalling tropical cyclone (TC) tornado event. This event is easily the most intense TC tornado outbreak yet documented with WSR-88Ds. Time-height analyses of the three strongest tornadic supercells are presented in order to document storm kinematic structure and to show how these storms appear at different ranges from a WSR-88D. In addition, cloud-to-ground (CG) lightning data are examined in Beryl s remnants. Although the tornadic cells were responsible for most of Beryl's CG lightning, their flash rates were only weak to moderate, and in all the tornadic storms the lightning flashes were almost entirely negative in polarity. A few of the single-tornado storms produced no detectable CG lightning at all. There is evidence that CG lightning rates decreased during the tornadoes, compared to 30-min periods before the tornadoes. A number of the storms spawned tornadoes just after producing their final CG lightning flashes. Contrary to the findings for flash rates, both peak currents and positive flash percentages were larger in Beryl's nontornadic storms than in the tornadic ones.
1975-01-01
The investigations for a rendezvous radar system design and an integrated radar/communication system design are presented. Based on these investigations, system block diagrams are given and system parameters are optimized for the noncoherent pulse and coherent pulse Doppler radar modulation types. Both cooperative (transponder) and passive radar operation are examined including the optimization of the corresponding transponder design for the cooperative mode of operation.
Signal compression in radar using FPGA
Escamilla Hemández, Enrique; Kravchenko, Víctor; Ponomaryov, Volodymyr; Duchen Sánchez, Gonzalo; Hernández Sánchez, David
2010-01-01
We present the hardware implementation of radar real time processing procedures using a simple, fast technique based on FPGA (Field Programmable Gate Array) architecture. This processing includes different window procedures during pulse compression in synthetic aperture radar (SAR). The radar signal compression processing is realized using matched filter, and classical and novel window functions, where we focus on better solution for minimum values of sidelobes. The proposed architecture expl...
Pedestrian recognition using automotive radar sensors
A. Bartsch; F. Fitzek; R. H. Rasshofer
2012-01-01
The application of modern series production automotive radar sensors to pedestrian recognition is an important topic in research on future driver assistance systems. The aim of this paper is to understand the potential and limits of such sensors in pedestrian recognition. This knowledge could be used to develop next generation radar sensors with improved pedestrian recognition capabilities. A new raw radar data signal processing algorithm is proposed that allows deep insight...
The plays and arts of surveillance: studying surveillance as entertainment
Albrechtslund, Anders; Dubbeld, L.
2006-01-01
This paper suggests a direction in the development of Surveillance Studies that goes beyond current attention for the caring, productive and enabling aspects of surveillance practices. That is, surveillance could be considered not just as positively protective, but even as a comical, playful,
Radar Scan Methods in Modern Multifunctional Radars
Directory of Open Access Journals (Sweden)
V. N. Skosyrev
2014-01-01
Full Text Available Considered urgent task of organizing the review space in modern multifunctional radar systems shall review the space in a wide range of elevation angles from minus 5 to 60-80 degrees and 360 degrees azimuth. MfRLS this type should provide an overview of the zone for a limited time (2-3 sec, detecting a wide range of subtle high and low-flying targets. The latter circumstance requires the organization to select targets against the background of reflections from the underlying surface and local objects (MP. When providing an overview of the space taken into account the need to increase not only the noise immunity, and survivability.Two variants of the review of space in the elevation plane in the solid-state AESA radar. In the first case the overview space narrow beam by one beam. In the second - the transfer of DNA is formed, covering the whole sector of responsibility in elevation and at the reception beam is formed in spetsvychislitele (CB as a result of the signal processing of digitized after emitters antenna web. The estimations of the parameters specific to the multifunction radar SAM air and missile defense. It is shown that in a number of practically important cases, preference should be given clearly one of the methods described review of space.The functional scheme with AESA radar for both variants of the review. Necessary to analyze their differences. Contains the problem of increasing the cost of MfRLS with digital beamforming DNA with increasing bandwidth probing signal being processed.Noted drawbacks of MfRLS with digital beamforming beam. Including: reduced accuracy of the coordinates at low elevation angles, the complexity of the organization of thermal regime of the solid element base using quasi-continuous signal with a low duty cycle. Shows their fundamentally unavoidable in the steppe and desert areas with uneven terrain (Kazakhstan, China, the Middle East.It is shown that for MfRLS working in strong clutter, more preferably
Liskovich, Diana; Simard, Marc
2011-01-01
Using radar and lidar data, the aim is to improve 3D rendering of terrain, including digital elevation models (DEM) and estimates of vegetation height and biomass in a variety of forest types and terrains. The 3D mapping of vegetation structure and the analysis are useful to determine the role of forest in climate change (carbon cycle), in providing habitat and as a provider of socio-economic services. This in turn will lead to potential for development of more effective land-use management. The first part of the project was to characterize the Shuttle Radar Topography Mission DEM error with respect to ICESat/GLAS point estimates of elevation. We investigated potential trends with latitude, canopy height, signal to noise ratio (SNR), number of LiDAR waveform peaks, and maximum peak width. Scatter plots were produced for each variable and were fitted with 1st and 2nd degree polynomials. Higher order trends were visually inspected through filtering with a mean and median filter. We also assessed trends in the DEM error variance. Finally, a map showing how DEM error was geographically distributed globally was created.
Real-Time Radar-Based Tracking and State Estimation of Multiple Non-Conformant Aircraft
Cook, Brandon; Arnett, Timothy; Macmann, Owen; Kumar, Manish
2017-01-01
In this study, a novel solution for automated tracking of multiple unknown aircraft is proposed. Many current methods use transponders to self-report state information and augment track identification. While conformant aircraft typically report transponder information to alert surrounding aircraft of its state, vehicles may exist in the airspace that are non-compliant and need to be accurately tracked using alternative methods. In this study, a multi-agent tracking solution is presented that solely utilizes primary surveillance radar data to estimate aircraft state information. Main research challenges include state estimation, track management, data association, and establishing persistent track validity. In an effort to realize these challenges, techniques such as Maximum a Posteriori estimation, Kalman filtering, degree of membership data association, and Nearest Neighbor Spanning Tree clustering are implemented for this application.
Efficient Ways to Learn Weather Radar Polarimetry
Cao, Qing; Yeary, M. B.; Zhang, Guifu
2012-01-01
The U.S. weather radar network is currently being upgraded with dual-polarization capability. Weather radar polarimetry is an interdisciplinary area of engineering and meteorology. This paper presents efficient ways to learn weather radar polarimetry through several basic and practical topics. These topics include: 1) hydrometeor scattering model…
Terahertz radar cross section measurements
DEFF Research Database (Denmark)
Iwaszczuk, Krzysztof; Heiselberg, Henning; Jepsen, Peter Uhd
2010-01-01
We perform angle- and frequency-resolved radar cross section (RCS) measurements on objects at terahertz frequencies. Our RCS measurements are performed on a scale model aircraft of size 5-10 cm in polar and azimuthal configurations, and correspond closely to RCS measurements with conventional radar...
Radar cross-section (RCS) analysis of high frequency surface wave radar targets
ÇAKIR, Gonca; SEVGİ, Levent
2010-01-01
Realistic high frequency surface wave radar (HFSWR) targets are investigated numerically in terms of electromagnetic wave -- target interactions. Radar cross sections (RCS) of these targets are simulated via both the finite-difference time-domain (FDTD) method and the Method of Moments (MoM). The virtual RCS prediction tool that was introduced in previous work is used for these investigations. The virtual tool automatically creates the discrete FDTD model of the target under investi...
Sea clutter scattering, the K distribution and radar performance
Ward, Keith; Watts, Simon
2013-01-01
Sea Clutter: Scattering, the K Distribution and Radar Performance, 2nd Edition gives an authoritative account of our current understanding of radar sea clutter. Topics covered include the characteristics of radar sea clutter, modelling radar scattering by the ocean surface, statistical models of sea clutter, the simulation of clutter and other random processes, detection of small targets in sea clutter, imaging ocean surface features, radar detection performance calculations, CFAR detection, and the specification and measurement of radar performance. The calculation of the performance of pract
Daniels, David J
2004-01-01
Ground-penetrating radar has come to public attention in recent criminal investigations, but has actually been a developing and maturing remote sensing field for some time. In the light of recent expansion of the technique to a wide range of applications, the need for an up-to-date reference has become pressing. This fully revised and expanded edition of the best-selling Surface-Penetrating Radar (IEE, 1996) presents, for the non-specialist user or engineer, all the key elements of this technique, which span several disciplines including electromagnetics, geophysics and signal processing. The
DEFF Research Database (Denmark)
Mohr, Johan Jacob; Reeh, Niels; Madsen, Søren Nørvang
2003-01-01
We present a method for analyzing the errors involved in measuring three-dimensional glacier velocities with interferometric radar. We address the surface-parallel flow assumption and an augmented approach with a flux-divergence (FD) term. The errors in an interferometric ERS-1/-2 satellite radar...... dataset with ascending- and descending-orbit data covering Storstrommen glacier, northeast Greenland, are assessed. The FD error assessment is carried out on airborne 60 MHz ice-sounding radar data from the same area. A simple model of an interferometric radar system is developed and analyzed. The error...... sources considered include phase noise, atmospheric distortions, baseline calibration errors, a dry snow layer, and the stationary-flow assumption used in differential interferometry. The additional error sources in the analysis of FD errors are noise, bias and unknown variations of the ice thickness...
Quantification of Reflection Patterns in Ground-Penetrating Radar Data
Moysey, S.; Knight, R. J.; Jol, H. M.; Allen-King, R. M.; Gaylord, D. R.
2005-12-01
Radar facies analysis provides a way of interpreting the large-scale structure of the subsurface from ground-penetrating radar (GPR) data. Radar facies are often distinguished from each other by the presence of patterns, such as flat-lying, dipping, or chaotic reflections, in different regions of a radar image. When these patterns can be associated with radar facies in a repeated and predictable manner we refer to them as `radar textures'. While it is often possible to qualitatively differentiate between radar textures visually, pattern recognition tools, like neural networks, require a quantitative measure to discriminate between them. We investigate whether currently available tools, such as instantaneous attributes or metrics adapted from standard texture analysis techniques, can be used to improve the classification of radar facies. To this end, we use a neural network to perform cross-validation tests that assess the efficacy of different textural measures for classifying radar facies in GPR data collected from the William River delta, Saskatchewan, Canada. We found that the highest classification accuracies (>93%) were obtained for measures of texture that preserve information about the spatial arrangement of reflections in the radar image, e.g., spatial covariance. Lower accuracy (87%) was obtained for classifications based directly on windows of amplitude data extracted from the radar image. Measures that did not account for the spatial arrangement of reflections in the image, e.g., instantaneous attributes and amplitude variance, yielded classification accuracies of less than 65%. Optimal classifications were obtained for textural measures that extracted sufficient information from the radar data to discriminate between radar facies but were insensitive to other facies specific characteristics. For example, the rotationally invariant Fourier-Mellin transform delivered better classification results than the spatial covariance because dip angle of the
Surveillance and Critical Theory
Directory of Open Access Journals (Sweden)
Christian Fuchs
2015-09-01
Full Text Available In this comment, the author reflects on surveillance from a critical theory approach, his involvement in surveillance research and projects, and the status of the study of surveillance. The comment ascertains a lack of critical thinking about surveillance, questions the existence of something called “surveillance studies” as opposed to a critical theory of society, and reflects on issues such as Edward Snowden’s revelations, and Foucault and Marx in the context of surveillance.
Development Of Signal Detection For Radar Navigation System
Directory of Open Access Journals (Sweden)
Theingi Win Hlaing
2017-09-01
Full Text Available This paper aims to evaluate the performance of target detection in the presence of sea clutter. Radar detection of a background of unwanted clutter due to echoes from sea clutter or land is a problem of interest in the radar field. Radar detector has been developed by assuming the radar clutter is Gaussian distributed. However as technology emerges the radar distribution is seen to deviates from the Gaussian assumption. Thus detectors designs based on Gaussian assumption are no longer optimum for detection in non-Gaussian nature. The theory of target detection in Gaussian distributed clutter has been well established and the closed form of the detection performances can be easily obtained. However that is not the case in non-Gaussian clutter distributions. The operation of radar detection is determined by radar detection theory with different types of Swerling target models such as Swerling I II III IV and V. By using MATLAB these signal detection techniques are developed.
Observation of snowfall with a low-power FM-CW K-band radar (Micro Rain Radar)
Kneifel, Stefan; Maahn, Maximilian; Peters, Gerhard; Simmer, Clemens
2011-06-01
Quantifying snowfall intensity especially under arctic conditions is a challenge because wind and snow drift deteriorate estimates obtained from both ground-based gauges and disdrometers. Ground-based remote sensing with active instruments might be a solution because they can measure well above drifting snow and do not suffer from flow distortions by the instrument. Clear disadvantages are, however, the dependency of e.g. radar returns on snow habit which might lead to similar large uncertainties. Moreover, high sensitivity radars are still far too costly to operate in a network and under harsh conditions. In this paper we compare returns from a low-cost, low-power vertically pointing FM-CW radar (Micro Rain Radar, MRR) operating at 24.1 GHz with returns from a 35.5 GHz cloud radar (MIRA36) for dry snowfall during a 6-month observation period at an Alpine station (Environmental Research Station Schneefernerhaus, UFS) at 2,650 m height above sea level. The goal was to quantify the potential and limitations of the MRR in relation to what is achievable by a cloud radar. The operational MRR procedures to derive standard radar variables like effective reflectivity factor ( Z e) or the mean Doppler velocity ( W) had to be modified for snowfall since the MRR was originally designed for rain observations. Since the radar returns from snowfall are weaker than from comparable rainfall, the behavior of the MRR close to its detection threshold has been analyzed and a method is proposed to quantify the noise level of the MRR based on clear sky observations. By converting the resulting MRR- Z e into 35.5 GHz equivalent Z e values, a remaining difference below 1 dBz with slightly higher values close to the noise threshold could be obtained. Due to the much higher sensitivity of MIRA36, the transition of the MRR from the true signal to noise can be observed, which agrees well with the independent clear sky noise estimate. The mean Doppler velocity differences between both radars
Modern Radar Techniques for Geophysical Applications: Two Examples
Arokiasamy, B. J.; Bianchi, C.; Sciacca, U.; Tutone, G.; Zirizzotti, A.; Zuccheretti, E.
2005-01-01
The last decade of the evolution of radar was heavily influenced by the rapid increase in the information processing capabilities. Advances in solid state radio HF devices, digital technology, computing architectures and software offered the designers to develop very efficient radars. In designing modern radars the emphasis goes towards the simplification of the system hardware, reduction of overall power, which is compensated by coding and real time signal processing techniques. Radars are commonly employed in geophysical radio soundings like probing the ionosphere; stratosphere-mesosphere measurement, weather forecast, GPR and radio-glaciology etc. In the laboratorio di Geofisica Ambientale of the Istituto Nazionale di Geofisica e Vulcanologia (INGV), Rome, Italy, we developed two pulse compression radars. The first is a HF radar called AIS-INGV; Advanced Ionospheric Sounder designed both for the purpose of research and for routine service of the HF radio wave propagation forecast. The second is a VHF radar called GLACIORADAR, which will be substituting the high power envelope radar used by the Italian Glaciological group. This will be employed in studying the sub glacial structures of Antarctica, giving information about layering, the bed rock and sub glacial lakes if present. These are low power radars, which heavily rely on advanced hardware and powerful real time signal processing. Additional information is included in the original extended abstract.
UAV-Borne Profiling Radar for Forest Research
Directory of Open Access Journals (Sweden)
Yuwei Chen
2017-01-01
Full Text Available Microwave Radar is an attractive solution for forest mapping and inventories because microwave signals penetrates into the forest canopy and the backscattering signal can provide information regarding the whole forest structure. Satellite-borne and airborne imaging radars have been used in forest resources mapping for many decades. However, their accuracy with respect to the main forest inventory attributes substantially varies depending on the wavelength and techniques used in the estimation. Systems providing canopy backscatter as a function of canopy height are, practically speaking, missing. Therefore, there is a need for a radar system that would enable the scientific community to better understand the radar backscatter response from the forest canopy. Consequently, we undertook a research study to develop an unmanned aerial vehicle (UAV-borne profiling (i.e., waveform radar that could be used to improve the understanding of the radar backscatter response for forestry mapping and inventories. A frequency modulation continuous waveform (FMCW profiling radar, termed FGI-Tomoradar, was introduced, designed and tested. One goal is the total weight of the whole system is less than 7 kg, including the radar system and georeferencing system, with centimetre-level positioning accuracy. Achieving this weight goal would enable the FGI-Tomoradar system to be installed on the Mini-UAV platform. The prototype system had all four linear polarization measuring capabilities, with bistatic configuration in Ku-band. In system performance tests in this study, FGI-Tomoradar was mounted on a manned helicopter together with a Riegl VQ-480-U laser scanner and tested in several flight campaigns performed at the Evo site, Finland. Airborne laser scanning data was simultaneously collected to investigate the differences and similarities of the outputs for the same target area for better understanding the penetration of the microwave signal into the forest canopy
Investigating nearby exoplanets via interstellar radar
Scheffer, Louis K.
2014-01-01
Interstellar radar is a potential intermediate step between passive observation of exoplanets and interstellar exploratory missions. Compared with passive observation, it has the traditional advantages of radar astronomy. It can measure surface characteristics, determine spin rates and axes, provide extremely accurate ranges, construct maps of planets, distinguish liquid from solid surfaces, find rings and moons, and penetrate clouds. It can do this even for planets close to the parent star. Compared with interstellar travel or probes, it also offers significant advantages. The technology required to build such a radar already exists, radar can return results within a human lifetime, and a single facility can investigate thousands of planetary systems. The cost, although too high for current implementation, is within the reach of Earth's economy.
Ideology, Critique and Surveillance
Directory of Open Access Journals (Sweden)
Heidi Herzogenrath-Amelung
2013-11-01
Full Text Available The 2013 revelations concerning global surveillance programmes demonstrate in unprecedented clarity the need for Critical Theory of information and communication technologies (ICTs to address the mechanisms and implications of increasingly global, ubiquitous surveillance. This is all the more urgent because of the dominance of the “surveillance ideology” (the promise of security through surveillance that supports the political economy of surveillance. This paper asks which theoretical arguments and concepts can be useful for philosophically grounding a critique of this surveillance ideology. It begins by examining how the surveillance ideology works through language and introduces the concept of the ‘ideological packaging’ of ICTs to show how rhetoric surrounding the implementation of surveillance technologies reinforces the surveillance ideology. It then raises the problem of how ideology-critique can work if it relies on language itself and argues that Martin Heidegger’s philosophy can make a useful contribution to existing critical approaches to language.
Weather radar rainfall data in urban hydrology
DEFF Research Database (Denmark)
Thorndahl, Søren; Einfalt, Thomas; Willems, Patrick
2017-01-01
Application of weather radar data in urban hydrological applications has evolved significantly during the past decade as an alternative to traditional rainfall observations with rain gauges. Advances in radar hardware, data processing, numerical models, and emerging fields within urban hydrology...... necessitate an updated review of the state of the art in such radar rainfall data and applications. Three key areas with significant advances over the past decade have been identified: (1) temporal and spatial resolution of rainfall data required for different types of hydrological applications, (2) rainfall...... estimation, radar data adjustment and data quality, and (3) nowcasting of radar rainfall and real-time applications. Based on these three fields of research, the paper provides recommendations based on an updated overview of shortcomings, gains, and novel developments in relation to urban hydrological...
Weather radar rainfall data in urban hydrology
DEFF Research Database (Denmark)
Thorndahl, Søren; Einfalt, Thomas; Willems, Patrick
2017-01-01
estimation, radar data adjustment and data quality, and (3) nowcasting of radar rainfall and real-time applications. Based on these three fields of research, the paper provides recommendations based on an updated overview of shortcomings, gains, and novel developments in relation to urban hydrological...... applications. The paper also reviews how the focus in urban hydrology research has shifted over the last decade to fields such as climate change impacts, resilience of urban areas to hydrological extremes, and online prediction/warning systems. It is discussed how radar rainfall data can add value......Application of weather radar data in urban hydrological applications has evolved significantly during the past decade as an alternative to traditional rainfall observations with rain gauges. Advances in radar hardware, data processing, numerical models, and emerging fields within urban hydrology...
Meteor observation by the Kyoto meteor radar
International Nuclear Information System (INIS)
Kato, S.; Tsuda, T.
1987-01-01
The Kyoto Meteor Radar is a monostatic coherent pulsed Doppler radar operating on the frequency of 31.57 MH. The system is computer controlled and uses radio interferometry for echo height determination. The antenna, an improvement, can be directed either to the north or the east. The system has been continuously collecting data on winds at meteor heights by radar observation. The meteor echo rate was also measured, the echo rate distribution with height and the daily variation in height integrated echo rate are discussed. Investigations of atmospheric tides are being pursued by cooperative observations. A novel approach to the study of gravity waves was attempted using the meteor radar which is able to detect the horizontal propagation of the waves by observing the changing phase through the region illuminated by the radar
Complete Systematic Error Model of SSR for Sensor Registration in ATC Surveillance Networks
Directory of Open Access Journals (Sweden)
Ángel J. Jarama
2017-09-01
Full Text Available In this paper, a complete and rigorous mathematical model for secondary surveillance radar systematic errors (biases is developed. The model takes into account the physical effects systematically affecting the measurement processes. The azimuth biases are calculated from the physical error of the antenna calibration and the errors of the angle determination dispositive. Distance bias is calculated from the delay of the signal produced by the refractivity index of the atmosphere, and from clock errors, while the altitude bias is calculated taking into account the atmosphere conditions (pressure and temperature. It will be shown, using simulated and real data, that adapting a classical bias estimation process to use the complete parametrized model results in improved accuracy in the bias estimation.
NOAA NEXt-Generation RADar (NEXRAD) Products
National Oceanic and Atmospheric Administration, Department of Commerce — This dataset consists of Level III weather radar products collected from Next-Generation Radar (NEXRAD) stations located in the contiguous United States, Alaska,...
The use of radar for bathymetry in shallow seas
Greidanus, H.
1997-01-01
The bottom topography in shallow seas can be observed by air- and space borne radar. The paper reviews the radar imaging mechanism, and discusses the possibilities and limitations for practical use of radar in bathymetric applications, including the types of radar instruments available for this
Effects of respiration depth on human body radar cross section Using 2.4GHz continuous wave radar.
Lee, Alexander; Xiaomeng Gao; Jia Xu; Boric-Lubecke, Olga
2017-07-01
In this study, it was tested whether deep and shallow breathing has an effect on the cardiopulmonary radar cross-section (RCS). Continuous wave radar with quadrature architecture at 2.4GHz was used to test 2 human subjects breathing deep and shallow for 30 seconds each while seated 2 meters away from the radar. A retro-reflective marker was placed on the sternum of each subject and measured by infrared motion capture cameras to accurately track displacement of the chest. The quadrature radar outputs were processed to find the radius of the arc on the IQ plot using a circle-fitting algorithm. Results showed that the effective RCS ratio of deep to shallow breathing for subjects 1 and 2 was 6.99 and 2.24 respectively.
Imaging with Synthetic Aperture Radar
Massonnet, Didier
2008-01-01
Describing a field that has been transformed by the recent availability of data from a new generation of space and airborne systems, the authors offer a synthetic geometrical approach to the description of synthetic aperture radar, one that addresses physicists, radar specialists, as well as experts in image processing.
Radar geomorphology of coastal and wetland environments
Lewis, A. J.; Macdonald, H. C.
1973-01-01
Details regarding the collection of radar imagery over the past ten years are considered together with the geomorphic, geologic, and hydrologic data which have been extracted from radar imagery. Recent investigations were conducted of the Louisiana swamp marsh and the Oregon coast. It was found that radar imagery is a useful tool to the scientist involved in wetland research.
Architecture for a 1-GHz Digital RADAR
Mallik, Udayan
2011-01-01
An architecture for a Direct RF-digitization Type Digital Mode RADAR was developed at GSFC in 2008. Two variations of a basic architecture were developed for use on RADAR imaging missions using aircraft and spacecraft. Both systems can operate with a pulse repetition rate up to 10 MHz with 8 received RF samples per pulse repetition interval, or at up to 19 kHz with 4K received RF samples per pulse repetition interval. The first design describes a computer architecture for a Continuous Mode RADAR transceiver with a real-time signal processing and display architecture. The architecture can operate at a high pulse repetition rate without interruption for an infinite amount of time. The second design describes a smaller and less costly burst mode RADAR that can transceive high pulse repetition rate RF signals without interruption for up to 37 seconds. The burst-mode RADAR was designed to operate on an off-line signal processing paradigm. The temporal distribution of RF samples acquired and reported to the RADAR processor remains uniform and free of distortion in both proposed architectures. The majority of the RADAR's electronics is implemented in digital CMOS (complementary metal oxide semiconductor), and analog circuits are restricted to signal amplification operations and analog to digital conversion. An implementation of the proposed systems will create a 1-GHz, Direct RF-digitization Type, L-Band Digital RADAR--the highest band achievable for Nyquist Rate, Direct RF-digitization Systems that do not implement an electronic IF downsample stage (after the receiver signal amplification stage), using commercially available off-the-shelf integrated circuits.
Design of multi-frequency CW radars
Jankiraman, Mohinder
2007-01-01
This book deals with the basic theory for design and analysis of Low Probability of Intercept (LPI) radar systems. The design of one such multi-frequency high resolution LPI radar, PANDORA, is covered.
DEFF Research Database (Denmark)
Mortensen, Mette
2014-01-01
This article concerns the particular form of counter-surveillance termed “sousveillance”, which aims to turn surveillance at the institutions responsible for surveillance. Drawing on the theoretical perspectives “mediatization” and “aerial surveillance,” the article studies WikiLeaks’ publication...
Radar rainfall image repair techniques
Directory of Open Access Journals (Sweden)
Stephen M. Wesson
2004-01-01
Full Text Available There are various quality problems associated with radar rainfall data viewed in images that include ground clutter, beam blocking and anomalous propagation, to name a few. To obtain the best rainfall estimate possible, techniques for removing ground clutter (non-meteorological echoes that influence radar data quality on 2-D radar rainfall image data sets are presented here. These techniques concentrate on repairing the images in both a computationally fast and accurate manner, and are nearest neighbour techniques of two sub-types: Individual Target and Border Tracing. The contaminated data is estimated through Kriging, considered the optimal technique for the spatial interpolation of Gaussian data, where the 'screening effect' that occurs with the Kriging weighting distribution around target points is exploited to ensure computational efficiency. Matrix rank reduction techniques in combination with Singular Value Decomposition (SVD are also suggested for finding an efficient solution to the Kriging Equations which can cope with near singular systems. Rainfall estimation at ground level from radar rainfall volume scan data is of interest and importance in earth bound applications such as hydrology and agriculture. As an extension of the above, Ordinary Kriging is applied to three-dimensional radar rainfall data to estimate rainfall rate at ground level. Keywords: ground clutter, data infilling, Ordinary Kriging, nearest neighbours, Singular Value Decomposition, border tracing, computation time, ground level rainfall estimation
Textural features for radar image analysis
Shanmugan, K. S.; Narayanan, V.; Frost, V. S.; Stiles, J. A.; Holtzman, J. C.
1981-01-01
Texture is seen as an important spatial feature useful for identifying objects or regions of interest in an image. While textural features have been widely used in analyzing a variety of photographic images, they have not been used in processing radar images. A procedure for extracting a set of textural features for characterizing small areas in radar images is presented, and it is shown that these features can be used in classifying segments of radar images corresponding to different geological formations.
Radar detection of ultra high energy cosmic rays
Myers, Isaac J.
TARA (Telescope Array Radar) is a cosmic ray radar detection experiment co-located with Telescope Array, the conventional surface scintillation detector (SD) and fluorescence telescope detector (FD) near Delta, UT. The TARA detector combines a 40 kW transmitter and high gain transmitting antenna which broadcasts the radar carrier over the SD array and in the FD field of view to a 250 MS/s DAQ receiver. Data collection began in August, 2013. TARA stands apart from other cosmic ray radar experiments in that radar data is directly compared with conventional cosmic ray detector events. The transmitter is also directly controlled by TARA researchers. Waveforms from the FD-triggered data stream are time-matched with TA events and searched for signal using a novel signal search technique in which the expected (simulated) radar echo of a particular air shower is used as a matched filter template and compared to radio waveforms. This technique is used to calculate the radar cross-section (RCS) upper-limit on all triggers that correspond to well-reconstructed TA FD monocular events. Our lowest cosmic ray RCS upper-limit is 42 cm2 for an 11 EeV event. An introduction to cosmic rays is presented with the evolution of detection and the necessity of new detection techniques, of which radar detection is a candidate. The software simulation of radar scattering from cosmic rays follows. The TARA detector, including transmitter and receiver systems, are discussed in detail. Our search algorithm and methodology for calculating RCS is presented for the purpose of being repeatable. Search results are explained in context of the usefulness and future of cosmic ray radar detection.
Low Complexity Receiver Design for MIMO-Radar
Ahmed, Sajid
2012-09-08
In this work, an algorithm for the multiple-input multiple-output (MIMO) radar is proposed. It has low computational complexity compared to the available schemes, and relatively low side-lobe-levels in the receive beampattern compared to the phased-array and MIMO-radar. In the proposed algorithm, the received signal vector of MIMO-radar is divided into sub-vectors, and each sub-vector is multiplied with the corresponding weight vector. The number of sub-vectors and weight vectors are optimally found to maximise the received signal power from the target of interest direction. The proposed scheme can be effectively applied in passive radars to minimise the side-lobe levels and place deep nulls for interferers in the receive beampattern. Simulation results show that the proposed scheme has relatively lower side lobe levels and better detection capabilities compared to MIMO-radar and phased-array.
Low Complexity Receiver Design for MIMO-Radar
Ahmed, Sajid; Alouini, Mohamed-Slim
2012-01-01
In this work, an algorithm for the multiple-input multiple-output (MIMO) radar is proposed. It has low computational complexity compared to the available schemes, and relatively low side-lobe-levels in the receive beampattern compared to the phased-array and MIMO-radar. In the proposed algorithm, the received signal vector of MIMO-radar is divided into sub-vectors, and each sub-vector is multiplied with the corresponding weight vector. The number of sub-vectors and weight vectors are optimally found to maximise the received signal power from the target of interest direction. The proposed scheme can be effectively applied in passive radars to minimise the side-lobe levels and place deep nulls for interferers in the receive beampattern. Simulation results show that the proposed scheme has relatively lower side lobe levels and better detection capabilities compared to MIMO-radar and phased-array.
Rijlaarsdam J; Bosman A; Laar MJW van de; CIE
2000-01-01
In May 1999 a working group was started to evaluate the current surveillance systems for sexually transmitted diseases (STD) and to make suggestions for a renewed effective and efficient STD surveillance system in the Netherlands. The surveillance system has to provide insight into the prevalence
Physical working principles of medical radar.
Aardal, Øyvind; Paichard, Yoann; Brovoll, Sverre; Berger, Tor; Lande, Tor Sverre; Hamran, Svein-Erik
2013-04-01
There has been research interest in using radar for contactless measurements of the human heartbeat for several years. While many systems have been demonstrated, not much attention have been given to the actual physical causes of why this work. The consensus seems to be that the radar senses small body movements correlated with heartbeats, but whether only the movements of the body surface or reflections from internal organs are also monitored have not been answered definitely. There has recently been proposed another theory that blood perfusion in the skin could be the main reason radars are able to detect heartbeats. In this paper, an experimental approach is given to determine the physical causes. The measurement results show that it is the body surface reflections that dominate radar measurements of human heartbeats.
Comparison of FPS-16 radar/jimsphere and NASA's 50-MHz radar wind profiler turbulence indicators
Susko, Michael
1993-01-01
Measurements of the wind and turbulent regions from the surface to 16 km by the FPS-11 radar/jimsphere system are reported with particular attention given to the use of these turbulence and wind assessments to validate the NASA 50-MHz radar wind profiler. Wind profile statistics were compared at 150-m wavelengths, a wavelength validated from 20 jimspheres, simultaneously tracked by FPS-16 and FPQ-14 radar, and the resulting analysis of auto spectra, cross-spectra, and coherence squared spectra of the wind profiles. Results demonstrate that the NASA prototype wind profiler is an excellent monitoring device illustrating the measurements of the winds within 1/2 hour of launch zero.
To See the Unseen: A History of Planetary Radar Astronomy
Butrica, Andrew J.
1996-01-01
This book relates the history of planetary radar astronomy from its origins in radar to the present day and secondarily to bring to light that history as a case of 'Big Equipment but not Big Science'. Chapter One sketches the emergence of radar astronomy as an ongoing scientific activity at Jodrell Bank, where radar research revealed that meteors were part of the solar system. The chief Big Science driving early radar astronomy experiments was ionospheric research. Chapter Two links the Cold War and the Space Race to the first radar experiments attempted on planetary targets, while recounting the initial achievements of planetary radar, namely, the refinement of the astronomical unit and the rotational rate and direction of Venus. Chapter Three discusses early attempts to organize radar astronomy and the efforts at MIT's Lincoln Laboratory, in conjunction with Harvard radio astronomers, to acquire antenna time unfettered by military priorities. Here, the chief Big Science influencing the development of planetary radar astronomy was radio astronomy. Chapter Four spotlights the evolution of planetary radar astronomy at the Jet Propulsion Laboratory, a NASA facility, at Cornell University's Arecibo Observatory, and at Jodrell Bank. A congeries of funding from the military, the National Science Foundation, and finally NASA marked that evolution, which culminated in planetary radar astronomy finding a single Big Science patron, NASA. Chapter Five analyzes planetary radar astronomy as a science using the theoretical framework provided by philosopher of science Thomas Kuhn. Chapter Six explores the shift in planetary radar astronomy beginning in the 1970s that resulted from its financial and institutional relationship with NASA Big Science. Chapter Seven addresses the Magellan mission and its relation to the evolution of planetary radar astronomy from a ground-based to a space-based activity. Chapters Eight and Nine discuss the research carried out at ground
TCSP ER-2 DOPPLER RADAR (EDOP) V1
National Aeronautics and Space Administration — The TCSP ER-2 DOPPLER RADAR (EDOP) dataset was collected by the ER-2 Doppler radar (EDOP), which is an X-band (9.6 GHz) Doppler radar mounted in the nose of the ER-2...
National Aeronautics and Space Administration — The CAMEX-4 ER-2 Doppler Radar dataset was collected by the ER-2 Doppler radar (EDOP), which is an X-band (9.6 GHz) Doppler radar mounted in the nose of ER-2. The...
Phased Array Radar Network Experiment for Severe Weather
Ushio, T.; Kikuchi, H.; Mega, T.; Yoshikawa, E.; Mizutani, F.; Takahashi, N.
2017-12-01
Phased Array Weather Radar (PAWR) was firstly developed in 2012 by Osaka University and Toshiba under a grant of NICT using the Digital Beamforming Technique, and showed a impressive thunderstorm behavior with 30 second resolution. After that development, second PAWR was installed in Kobe city about 60 km away from the first PAWR site, and Tokyo Metropolitan University, Osaka Univeristy, Toshiba and the Osaka Local Government started a new project to develop the Osaka Urban Demonstration Network. The main sensor of the Osaka Network is a 2-node Phased Array Radar Network and lightning location system. Data products that are created both in local high performance computer and Toshiba Computer Cloud, include single and multi-radar data, vector wind, quantitative precipitation estimation, VIL, nowcasting, lightning location and analysis. Each radar node is calibarated by the baloon measurement and through the comparison with the GPM (Global Precipitation Measurement)/ DPR (Dual Frequency Space borne Radar) within 1 dB. The attenuated radar reflectivities obtained by the Phased Array Radar Network at X band are corrected based on the bayesian scheme proposed in Shimamura et al. [2016]. The obtained high resolution (every 30 seconds/ 100 elevation angles) 3D reflectivity and rain rate fields are used to nowcast the surface rain rate up to 30 minutes ahead. These new products are transferred to Osaka Local Government in operational mode and evaluated by several section in Osaka Prefecture. Furthermore, a new Phased Array Radar with polarimetric function has been developed in 2017, and will be operated in the fiscal year of 2017. In this presentation, Phased Array Radar, network architecuture, processing algorithm, evalution of the social experiment and first Multi-Prameter Phased Array Radar experiment are presented.
Radar investigations at the Saltsjoetunnel - predictions and validation
International Nuclear Information System (INIS)
Olsson, Olle; Palmqvist, Kai
1989-01-01
Borehole radar investigations have been performed in two boreholes drilled along the extent of the Saltsjoe tunnel in Stockholm, Sweden. The objective of the project was to test investigate the capabilities of the borehole radar technique to predict geological structures prior to tunnel excavation. Singlehole and crosshole radar measurements were made in the two boreholes which outlined and equilateral triangle. The crosshole data was used to produce tomograms showing the distribution of radar attenuation and slowness (inverse of velocity) in the plane between the boreholes. The radar model of the site contained one major feature which was identified as a fracture zone. The intersection of the fracture zone with the tunnel was extrapolated from the radar data and found to be in agreement with observations in the tunnel. At the intersection of the fracture zone with the tunnel grouting had to be applied. It has also been found that the radar identifies a number of smaller features which are of practically no significance with respect to tunnel construction. There is general agreement between the radar model of the site and the geologic-tectonic model of the site. This project has demonstrated the capability of the boreholes radar technique to predict the existence, location, and orientation of geologic features (e.g. fracture zones) which can be of significance to the cost and safety when excavating a tunnel. However, further development is needed to be able to use the technique cost effectively for continuous prediction ahead of the tunnel front. (authors) (17 figs., 1 tab.)
Radar, sonar, and holography an introduction
Kock, Winston E
1974-01-01
Radar, Sonar, and Holography: An Introduction provides an introduction to the technology of radar and sonar. Because the new science of holography is affecting both these fields quite strongly, the book includes an explanation of the fundamental principles underlying this new art (including the subjects of wave coherence, interference, and diffraction) and of the hologram process itself. Finally, numerous examples are discussed which show how holography is providing new horizons to radar and sonar systems. The book thus also provides a simple approach to the new technology of holography. The
Detecting and mitigating wind turbine clutter for airspace radar systems.
Wang, Wen-Qin
2013-01-01
It is well recognized that a wind turbine has a large radar cross-section (RCS) and, due to the movement of the blades, the wind turbine will generate a Doppler frequency shift. This scattering behavior may cause severe interferences on existing radar systems including static ground-based radars and spaceborne or airborne radars. To resolve this problem, efficient techniques or algorithms should be developed to mitigate the effects of wind farms on radars. Herein, one transponder-based mitigation technique is presented. The transponder is not a new concept, which has been proposed for calibrating high-resolution imaging radars. It modulates the radar signal in a manner that the retransmitted signals can be separated from the scene echoes. As wind farms often occupy only a small area, mitigation processing in the whole radar operation will be redundant and cost inefficient. Hence, this paper uses a transponder to determine whether the radar is impacted by the wind farms. If so, the effects of wind farms are then mitigated with subsequent Kalman filtering or plot target extraction algorithms. Taking airborne synthetic aperture radar (SAR) and pulse Doppler radar as the examples, this paper provides the corresponding system configuration and processing algorithms. The effectiveness of the mitigation technique is validated by numerical simulation results.
Detecting and Mitigating Wind Turbine Clutter for Airspace Radar Systems
Directory of Open Access Journals (Sweden)
Wen-Qin Wang
2013-01-01
Full Text Available It is well recognized that a wind turbine has a large radar cross-section (RCS and, due to the movement of the blades, the wind turbine will generate a Doppler frequency shift. This scattering behavior may cause severe interferences on existing radar systems including static ground-based radars and spaceborne or airborne radars. To resolve this problem, efficient techniques or algorithms should be developed to mitigate the effects of wind farms on radars. Herein, one transponder-based mitigation technique is presented. The transponder is not a new concept, which has been proposed for calibrating high-resolution imaging radars. It modulates the radar signal in a manner that the retransmitted signals can be separated from the scene echoes. As wind farms often occupy only a small area, mitigation processing in the whole radar operation will be redundant and cost inefficient. Hence, this paper uses a transponder to determine whether the radar is impacted by the wind farms. If so, the effects of wind farms are then mitigated with subsequent Kalman filtering or plot target extraction algorithms. Taking airborne synthetic aperture radar (SAR and pulse Doppler radar as the examples, this paper provides the corresponding system configuration and processing algorithms. The effectiveness of the mitigation technique is validated by numerical simulation results.
High-precision positioning of radar scatterers
Dheenathayalan, P.; Small, D.; Schubert, A.; Hanssen, R.F.
2016-01-01
Remote sensing radar satellites cover wide areas and provide spatially dense measurements, with millions of scatterers. Knowledge of the precise position of each radar scatterer is essential to identify the corresponding object and interpret the estimated deformation. The absolute position accuracy
Thompson, Douglas; Hallquist, Aaron; Anderson, Hyrum
2017-10-17
The various embodiments presented herein relate to utilizing an operational single-channel radar to collect and process synthetic aperture radar (SAR) and ground moving target indicator (GMTI) imagery from a same set of radar returns. In an embodiment, data is collected by randomly staggering a slow-time pulse repetition interval (PRI) over a SAR aperture such that a number of transmitted pulses in the SAR aperture is preserved with respect to standard SAR, but many of the pulses are spaced very closely enabling movers (e.g., targets) to be resolved, wherein a relative velocity of the movers places them outside of the SAR ground patch. The various embodiments of image reconstruction can be based on compressed sensing inversion from undersampled data, which can be solved efficiently using such techniques as Bregman iteration. The various embodiments enable high-quality SAR reconstruction, and high-quality GMTI reconstruction from the same set of radar returns.
A Dual-Wavelength Radar Technique to Detect Hydrometeor Phases
Liao, Liang; Meneghini, Robert
2016-01-01
This study is aimed at investigating the feasibility of a Ku- and Ka-band space/air-borne dual wavelength radar algorithm to discriminate various phase states of precipitating hydrometeors. A phase-state classification algorithm has been developed from the radar measurements of snow, mixed-phase and rain obtained from stratiform storms. The algorithm, presented in the form of the look-up table that links the Ku-band radar reflectivities and dual-frequency ratio (DFR) to the phase states of hydrometeors, is checked by applying it to the measurements of the Jet Propulsion Laboratory, California Institute of Technology, Airborne Precipitation Radar Second Generation (APR-2). In creating the statistically-based phase look-up table, the attenuation corrected (or true) radar reflectivity factors are employed, leading to better accuracy in determining the hydrometeor phase. In practice, however, the true radar reflectivities are not always available before the phase states of the hydrometeors are determined. Therefore, it is desirable to make use of the measured radar reflectivities in classifying the phase states. To do this, a phase-identification procedure is proposed that uses only measured radar reflectivities. The procedure is then tested using APR-2 airborne radar data. Analysis of the classification results in stratiform rain indicates that the regions of snow, mixed-phase and rain derived from the phase-identification algorithm coincide reasonably well with those determined from the measured radar reflectivities and linear depolarization ratio (LDR).
Energy Technology Data Exchange (ETDEWEB)
Sato, M.; Niitsuma, H. [Tohoku University, Sendai (Japan); Nakauchi, T. [Osaka Gas Co. Ltd., Osaka (Japan)
1997-05-27
If the borehole radar is utilized for detection of buried pipes, the underground radar measurement becomes possible even in the situation where the mesurement on the earth surface is difficult, for example, such a place as under the road where there is much traffic. However, since buried pipes are horizontally installed and the existing borehole radar can send/receive only vertical polarization, the measurement conducted comes to be poor in efficiency from a viewpoint of the polarization utilization. Therefore, by introducing the polarimetric borehole radar to the detection of buried pipes, a basic experiment was conducted for the effective detection of horizontal buried pipes. Proposing the use of a slot antenna which can send/receive horizontal polarization in borehole in addition to a dipole antenna which sends/receives vertical polarization, developed was a step frequency type continuous wave radar of a network analyzer basis. As a result of the experiment, it was confirmed that reflection from buried pipes is largely dependent on polarization. Especially, it was found that in the slot dipole cross polarization mesurement, reflection from buried pipes can be emphasized. 4 refs., 5 figs.
Radar Location Equipment Development Program: Phase I
Energy Technology Data Exchange (ETDEWEB)
Sandness, G.A.; Davis, K.C.
1985-06-01
The work described in this report represents the first phase of a planned three-phase project designed to develop a radar system for monitoring waste canisters stored in a thick layer of bedded salt at the Waste Isolation Pilot Plant near Carlsbad, New Mexico. The canisters will be contained in holes drilled into the floor of the underground waste storage facility. It is hoped that these measurements can be made to accuracies of +-5 cm and +-2/sup 0/, respectively. The initial phase of this project was primarily a feasibility study. Its principal objective was to evaluate the potential effectiveness of the radar method in the planned canister monitoring application. Its scope included an investigation of the characteristics of radar signals backscattered from waste canisters, a test of preliminary data analysis methods, an assessment of the effects of salt and bentonite (a proposed backfill material) on the propagation of the radar signals, and a review of current ground-penetrating radar technology. A laboratory experiment was performed in which radar signals were backscattered from simulated waste canisters. The radar data were recorded by a digital data acquisition system and were subsequently analyzed by three different computer-based methods to extract estimates of canister location and tilt. Each of these methods yielded results that were accurate within a few centimeters in canister location and within 1/sup 0/ in canister tilt. Measurements were also made to determine the signal propagation velocities in salt and bentonite (actually a bentonite/sand mixture) and to estimate the signal attenuation rate in the bentonite. Finally, a product survey and a literature search were made to identify available ground-penetrating radar systems and alternative antenna designs that may be particularly suitable for this unique application. 10 refs., 21 figs., 4 tabs.
Radar Location Equipment Development Program: Phase I
International Nuclear Information System (INIS)
Sandness, G.A.; Davis, K.C.
1985-06-01
The work described in this report represents the first phase of a planned three-phase project designed to develop a radar system for monitoring waste canisters stored in a thick layer of bedded salt at the Waste Isolation Pilot Plant near Carlsbad, New Mexico. The canisters will be contained in holes drilled into the floor of the underground waste storage facility. It is hoped that these measurements can be made to accuracies of +-5 cm and +-2 0 , respectively. The initial phase of this project was primarily a feasibility study. Its principal objective was to evaluate the potential effectiveness of the radar method in the planned canister monitoring application. Its scope included an investigation of the characteristics of radar signals backscattered from waste canisters, a test of preliminary data analysis methods, an assessment of the effects of salt and bentonite (a proposed backfill material) on the propagation of the radar signals, and a review of current ground-penetrating radar technology. A laboratory experiment was performed in which radar signals were backscattered from simulated waste canisters. The radar data were recorded by a digital data acquisition system and were subsequently analyzed by three different computer-based methods to extract estimates of canister location and tilt. Each of these methods yielded results that were accurate within a few centimeters in canister location and within 1 0 in canister tilt. Measurements were also made to determine the signal propagation velocities in salt and bentonite (actually a bentonite/sand mixture) and to estimate the signal attenuation rate in the bentonite. Finally, a product survey and a literature search were made to identify available ground-penetrating radar systems and alternative antenna designs that may be particularly suitable for this unique application. 10 refs., 21 figs., 4 tabs
Directory of Open Access Journals (Sweden)
Milagros Diez Rodríguez
2011-02-01
Full Text Available La red de radares meteorológicos de Cuba está compuesta por siete radares antiguos (cuatro rusos y tresjaponeses, los cuales son mantenidos y operados por el Instituto de Meteorología de Cuba. En 1997 elInstituto de Meteorología decidió modernizar todos sus radares, tarea que tomó diez años para su ejecución.Los sistemas de accionamiento eléctrico de las antenas también fueron sometidos a la modernización,pero junto a los requerimientos impuestos por el nuevo sistema de adquisición, los sistemas deaccionamiento dibieron cumplir con las exigencias energéticas para ser alimentados de baterías. Esteartículo describe las soluciones técnicas implementadas en el nuevo sistema de accionamiento eléctricode las antenas. Weather radar network in Cuba is composed by seven old-fashioned radars (four Russian and three Japaneseand they are maintained and operated by Cuban Meteorological Institute. In 1997 Cuban MeteorologicalInstitute decided to modernize all those radars, and this task was accomplished along ten years.Antenna motor drives were also a matter of modernization, but along with restrictions imposed by dataacquisition, drives needed to complain energy restrictions in order to be used with a battery supply. Thispaper describes technical solutions implemented in newly designed antenna motor drives.
Delrieu, Guy; Cazenave, Frédéric; Yu, Nan; Boudevillain, Brice; Faure, Dominique; Gaussiat, Nicolas
2017-04-01
Operating weather radars in high-mountain regions faces the following well-known dilemma: (1) installing radar on top of mountains allows for the detection of severe summer convective events over 360° but may give poor QPE performance during a very significant part of the year when the 0°C isotherm is located below or close to the radar altitude; (2) installing radar at lower altitudes may lead to better QPE over sensitive areas such as cities located in valleys, but at the cost of reduced visibility and detection capability in other geographical sectors. We have the opportunity to study this question in detail in the region of Grenoble (an Alpine city of 500 000 inhabitants with an average altitude of 210 m asl) with a pair of X-band polarimetric weather radars operated respectively by Meteo-France on top of Mount Moucherotte (1920 m asl) and by IGE on the Grenoble Campus (213 m asl). The XPORT radar (IGE) performs a combination of PPIs at elevations of 3.5, 7.5, 15 and 25° complemented by two RHIs in the vertical plane passing by the two radar sites, in order to document the 4D precipitation variability within the Grenoble intermountain valley. In the proposed communication, preliminary results of this experiment (started in September 2016) will be presented with highlights on (1) the calibration of the two radar systems, (2) the characterization of the melting layer during significant precipitation events (>5mm/day) occurring in autumn, winter and spring; (3) the simulation of the relative effects of attenuation and non-uniform beam filling at X-band and (4) the possibility to use the mountain returns for quantifying the attenuation by the rain and the melting layer.
Energy Technology Data Exchange (ETDEWEB)
Baumann, R.; Flender, F.; Hagen, M.; Hoeller, H.; Keil, C.; Meischner, P.
1998-07-01
Across Europe more than 110 weather radars are in operation. More than 60 of them are Doppler radars and this number is increasing steadily. Doppler systems are becoming an operational standard. Most systems operate in C-band, with the exception of the Spanish radar network which is composed of S-band Doppler radars. Radar product composites are available for Scandinavia and Central Europe. National networks exist for the UK, France and Spain. Europe further is fortunate to have 8 polarimetric Doppler radars used mainly for research. In Italy some of those systems are used also for operational nowcasting applications for dedicated customers. The Chilbolton multiparameter Doppler radar operates at S-band. (orig.)
Directory of Open Access Journals (Sweden)
Dawei Han
2012-02-01
Full Text Available The application of ANNs (Artifi cial Neural Networks has been studied by many researchers in modelling rainfall runoff processes. However, the work so far has been focused on the rainfall data from traditional raingauges. Weather radar is a modern technology which could provide high resolution rainfall in time and space. In this study, a comparison in rainfall runoff modelling between the raingauge and weather radar has been carried out. The data were collected from Brue catchment in Southwest of England, with 49 raingauges covering 136 km2 and two C-band weather radars. This raingauge network is extremely dense (for research purposes and does not represent the usual raingauge density in operational flood forecasting systems. The ANN models were set up with both lumped and spatial rainfall input. The results showed that raingauge data outperformed radar data in all the events tested, regardless of the lumped and spatial input. La aplicación de Redes Neuronales Artificiales (RNA en el modelado de lluvia-flujo ha sido estudiada ampliamente. Sin embargo, hasta ahora se han utilizado datos provenientes de pluviómetros tradicionales. Los radares meteorológicos son una tecnología moderna que puede proveer datos de lluvia de alta resolución en tiempo y espacio. Este es un trabajo de comparación en el modelado lluvia-flujo entre pluviómetros y radares meteorológicos. Los datos provienen de la cuenca del río Brue en el suroeste de Inglaterra, con 49 pluviómetros cubriendo 136 km2 y dos radares meteorológicos en la banda C. Esta red de pluviómetros es extremadamente densa (para investigación y no representa la densidad usual en sistemas de predicción de inundaciones. Los modelos de RNA fueron implementados con datos de entrada de lluvia tanto espaciados como no distribuidos. Los resultados muestran que los datos de los pluviómetros fueron mejores que los datos de los radares en todos los eventos probados.
Wind farms impact on radar aviation interests - final report
Energy Technology Data Exchange (ETDEWEB)
Poupart, G.J.
2003-09-01
The main objectives of the study were: to determine the effects of siting wind turbines adjacent to primary air traffic control radar; to gather the information required for the generation of guidelines by civil, military and wind farm developer stakeholders; to determine the extent to which the design of wind turbines influences their effects on radar systems and to determine the extent to which design of the radar processing influences the effects of wind turbines on radar systems. A computer model was developed to predict the Radar Cross Section (RCS) of wind turbines and understand the interaction of radar energy and turbines. The model was designed to predict and simulate the impact of wind farms on the primary radar display. Validation of the model was carried out in a full-scale trial and modelling process, with data collected from a number of sources. The model was validated against a single turbine scenario and showed an accurate prediction capability. Further validation of the model could be gained through a multiple turbine trial. The knowledge gained from the development and validation of the predictive computer model has been used to conduct a sensitivity analysis (of the sub-elements of the radar and wind farm interaction) and to compile a list of the key factors influencing the radar signature of wind turbines. The result is a more detailed quantification of the complex interactions between wind turbines and radar systems than was previously available. The key findings of how the design, size and construction materials of wind turbines affect RCS are summarised.
Detecting and classifying low probability of intercept radar
Pace, Phillip E
2003-01-01
The drive is on to devise LPI radar systems that evade hostile detection as well as develop non-cooperative intercept devices that outsmart enemy LPI radar. Based on the author's own design experience, this comprehensive, hands-on book gives you the latest design and development techniques to innovate new LPI radar systems and discover new ways to intercept enemy LPI radar. and help you visually identify waveform parameters. Filled with more than 500 equations that provide rigorous mathematical detail, this book can be used by both entry-level and seasoned engineers. Besides thoroughly treatin
The NASA radar entomology program at Wallops Flight Center
Vaughn, C. R.
1979-01-01
NASA contribution to radar entomology is presented. Wallops Flight Center is described in terms of its radar systems. Radar tracking of birds and insects was recorded from helicopters for airspeed and vertical speed.
Image Registration Methode in Radar Interferometry
Directory of Open Access Journals (Sweden)
S. Chelbi
2015-08-01
Full Text Available This article presents a methodology for the determination of the registration of an Interferometric Synthetic radar (InSAR pair images with half pixel precision. Using the two superposed radar images Single Look complexes (SLC [1-4], we developed an iterative process to superpose these two images according to their correlation coefficient with a high coherence area. This work concerns the exploitation of ERS Tandem pair of radar images SLC of the Algiers area acquired on 03 January and 04 January 1994. The former is taken as a master image and the latter as a slave image.
Signal compression in radar using FPGA
Enrique Escamilla Hemández; Víctor Kravchenko; Volodymyr Ponomaryov; Gonzalo Duchen Sánchez; David Hernández Sánchez
2010-01-01
El presente artículo muestra la puesta en práctica de hardware para realizar el procesamiento en tiempo real de la señal de radar usando una técnica simple, rápida basada en arquitectura de FPGA (Field Programmable Gate Array). El proceso incluye diversos procedimientos de enventanado durante la compresión del pulso del radar de apertura sintética (SAR). El proceso de compresión de la señal de radar se hace con un filtro acoplado. que aplica funciones clásicas y nuevas de enventanado, donde n...
Significant wave height retrieval from synthetic radar images
Wijaya, Andreas Parama; van Groesen, Embrecht W.C.
2014-01-01
In many offshore activities radar imagery is used to observe and predict ocean waves. An important issue in analyzing the radar images is to resolve the significant wave height. Different from 3DFFT methods that use an estimate related to the square root of the signal-to-noise ratio of radar images,
Target Detection Based on EBPSK Satellite Passive Radar
Directory of Open Access Journals (Sweden)
Lu Zeyuan
2015-05-01
Full Text Available Passive radar is a topic anti stealth technology with simple structure, and low cost. Radiation source model, signal transmission model, and target detection are the key points of passive radar technology research. The paper analyzes the characteristics of EBPSK signal modulation and target detection method aspect of spaceborne radiant source. By comparison with other satellite navigation and positioning system, the characteristics of EBPSK satellite passive radar system are analyzed. It is proved that the maximum detection range of EBPSK satellite signal can satisfy the needs of the proposed model. In the passive radar model, sparse representation is used to achieve high resolution DOA detection. The comparison with the real target track by simulation demonstrates that effective detection of airborne target using EBPSK satellite passive radar system based on sparse representation is efficient.
Scoring sensor observations to facilitate the exchange of space surveillance data
Weigel, M.; Fiedler, H.; Schildknecht, T.
2017-08-01
In this paper, a scoring metric for space surveillance sensor observations is introduced. A scoring metric allows for direct comparison of data quantity and data quality, and makes transparent the effort made by different sensor operators. The concept might be applied to various sensor types like tracking and surveillance radar, active optical laser tracking, or passive optical telescopes as well as combinations of different measurement types. For each measurement type, a polynomial least squares fit is performed on the measurement values contained in the track. The track score is the average sum over the polynomial coefficients uncertainties and scaled by reference measurement accuracy. Based on the newly developed scoring metric, an accounting model and a rating model are introduced. Both models facilitate the exchange of observation data within a network of space surveillance sensors operators. In this paper, optical observations are taken as an example for analysis purposes, but both models can also be utilized for any other type of observations. The rating model has the capability to distinguish between network participants with major and minor data contribution to the network. The level of sanction on data reception is defined by the participants themselves enabling a high flexibility. The more elaborated accounting model translates the track score to credit points earned for data provision and spend for data reception. In this model, data reception is automatically limited for participants with low contribution to the network. The introduced method for observation scoring is first applied for transparent data exchange within the Small Aperture Robotic Telescope Network (SMARTnet). Therefore a detailed mathematical description is presented for line of sight measurements from optical telescopes, as well as numerical simulations for different network setups.
Radar Observations of Main-Belt M-class Asteroids
Shepard, Michael K.; Clark, B. E.; Ockert-Bell, M.; Nolan, M. C.; Howell, E. S.; Magri, C.; Giorgini, J. D.; Benner, L. A. M.; Ostro, S. J.; Harris, A. W.; Warner, B. D.; Stephens, R. D.; Mueller, M.
2009-01-01
Using the S-band radar at Arecibo Observatory, we have observed 19 Tholen M-class asteroids. The mean radar albedo for all our targets is 0.28 ± 0.13, considerably higher than the mean radar albedo of every other class (Magri et al. 2007, Icarus 186, 126-151). We find approximately one-third (six)
International Nuclear Information System (INIS)
Thompson, T.W.; Moore, H.J.
1990-01-01
Researchers developed a radar-echo model for Mars based on 12.6 cm continuous wave radio transmissions backscattered from the planet. The model broadly matches the variations in depolarized and polarized total radar cross sections with longitude observed by Goldstone in 1986 along 7 degrees S. and yields echo spectra that are generally similiar to the observed spectra. Radar map units in the model include an extensive cratered uplands unit with weak depolarized echo cross sections, average thermal inertias, moderate normal refelectivities, and moderate rms slopes; the volcanic units of Tharsis, Elysium, and Amazonis regions with strong depolarized echo cross sections, low thermal inertia, low normal reflectivities, and large rms slopes; and the northern planes units with moderate to strong depolarized echo cross sections, moderate to very high thermal inertias, moderate to large normal reflectivities, and moderate rms slopes. The relevance of the model to the interpretation of radar echoes from Mars is discussed
Through-the-wall surveillance for homeland security and law enforcement
Borek, Stanley E.; Clarke, Bernard J.; Costianes, Peter J.
2005-05-01
The Air Force Research Laboratory Information Directorate (AFRL/IF), under sponsorship of the Department of Justice's (DOJ), National Institute of Justice (NIJ) Office of Science and Technology (OS&T), is currently developing and evaluating advanced Through the Wall Surveillance (TWS) technologies. These technologies are partitioned into two categories: inexpensive, handheld systems for locating an individual(s) behind a wall or door; and portable, personal computer (PC) based standoff systems to enable the determination of events during critical incident situations. The technologies utilized are primarily focused on active radars operating in the UHF, L, S (ultra wideband (UWB)), X, and Ku Bands. The data displayed by these systems is indicative of range (1 Dimension), or range and azimuth (2 Dimensions) to the moving individual(s). This paper will highlight the technologies employed in five (5) prototype TWS systems delivered to NIJ and AFRL/IF for test and evaluation. It will discuss the systems backgrounds, applications, current states of evolution, and future plans for enhanced assessment.
Space Radar Image of Wenatchee, Washington
1994-01-01
This spaceborne radar image shows a segment of the Columbia River as it passes through the area of Wenatchee, Washington, about 220 kilometers (136 miles) east of Seattle. The Wenatchee Mountains, part of the Cascade Range, are shown in green at the lower left of the image. The Cascades create a 'rain shadow' for the region, limiting rainfall east of the range to less than 26 centimeters (10 inches) per year. The radar's ability to see different types of vegetation is highlighted in the contrast between the pine forests, that appear in green and the dry valley plain that shows up as dark purple. The cities of Wenatchee and East Wenatchee are the grid-like areas straddling the Columbia River in the left center of the image. With a population of about 60,000, the region produces about half of Washington state's lucrative apple crop. Several orchard areas appear as green rectangular patches to the right of the river in the lower right center. Radar images such as these can be used to monitor land use patterns in areas such as Wenatchee, that have diverse and rapidly changing urban, agricultural and wild land pressures. This image was acquired by Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) onboard the space shuttle Endeavour on October 10, 1994. The image is 38 kilometers by 45 kilometers (24 miles by 30 miles) and is centered at 47.3 degrees North latitude, 120.1 degrees West longitude. North is toward the upper left. The colors are assigned to different radar frequencies and polarizations of the radar as follows: red is L-band, horizontally transmitted and received; green is L-band, horizontally transmitted, vertically received; and blue is C-band, horizontally transmitted, vertically received. SIR-C/X-SAR, a joint mission of the German, Italian, and United States space agencies, is part of NASA's Mission to Planet Earth.
1998-11-01
des techniques tr~s prometteuse pour la detection longue port~e. Les progr~s escompt ~s dans le domaine des techniques radar devraient amener des...cibles fixes, des cibles mobiles ou du fouillis de sol. Sa vocation Le moyen de mesures comprend un radar premiere est d’enrichir les banques de donn6es
DEFF Research Database (Denmark)
2017-01-01
What does it mean to live in a world full of surveillance? In this documentary film, we take a look at everyday life in Denmark and how surveillance technologies and practices influence our norms and social behaviour. Researched and directed by Btihaj Ajana and Anders Albrechtslund....
Basic Radar Altimetry Toolbox: Tools and Tutorial To Use Radar Altimetry For Cryosphere
Benveniste, J. J.; Bronner, E.; Dinardo, S.; Lucas, B. M.; Rosmorduc, V.; Earith, D.
2010-12-01
Radar altimetry is very much a technique expanding its applications. If quite a lot of efforts have been made for oceanography users (including easy-to-use data), the use of those data for cryosphere application, especially with the new ESA CryoSat-2 mission data is still somehow tedious, especially for new Altimetry data products users. ESA and CNES thus had the Basic Radar Altimetry Toolbox developed a few years ago, and are improving and upgrading it to fit new missions and the growing number of altimetry uses. The Basic Radar Altimetry Toolbox is an "all-altimeter" collection of tools, tutorials and documents designed to facilitate the use of radar altimetry data. The software is able: - to read most distributed radar altimetry data, from ERS-1 & 2, Topex/Poseidon, Geosat Follow-on, Jason-1, Envisat, Jason- 2, CryoSat and the future Saral missions, - to perform some processing, data editing and statistic, - and to visualize the results. It can be used at several levels/several ways: - as a data reading tool, with APIs for C, Fortran, Matlab and IDL - as processing/extraction routines, through the on-line command mode - as an educational and a quick-look tool, with the graphical user interface As part of the Toolbox, a Radar Altimetry Tutorial gives general information about altimetry, the technique involved and its applications, as well as an overview of past, present and future missions, including information on how to access data and additional software and documentation. It also presents a series of data use cases, covering all uses of altimetry over ocean, cryosphere and land, showing the basic methods for some of the most frequent manners of using altimetry data. It is an opportunity to teach remote sensing with practical training. It has been available from April 2007, and had been demonstrated during training courses and scientific meetings. About 1200 people downloaded it (Summer 2010), with many "newcomers" to altimetry among them, including teachers
Spectral Properties of Homogeneous and Nonhomogeneous Radar Images
DEFF Research Database (Denmark)
Madsen, Søren Nørvang
1987-01-01
On the basis of a two-dimensional, nonstationary white noisemodel for the complex radar backscatter, the spectral properties ofa one-look synthetic-aperture radar (SAR) system is derived. It isshown that the power spectrum of the complex SAR image is sceneindependent. It is also shown that the sp......On the basis of a two-dimensional, nonstationary white noisemodel for the complex radar backscatter, the spectral properties ofa one-look synthetic-aperture radar (SAR) system is derived. It isshown that the power spectrum of the complex SAR image is sceneindependent. It is also shown...... that the spectrum of the intensityimage is in general related to the radar scene spectrum by a linearintegral equation, a Fredholm's integral equation of the third kind.Under simplifying assumptions, a closed-form equation giving theradar scene spectrum as a function of the SAR image spectrum canbe derived....
New Vacuum Electronic Devices for Radar
Directory of Open Access Journals (Sweden)
Hu Yinfu
2016-08-01
Full Text Available Vacuum Electronic Devices (VEDs which are considered as the heart of a radar system, play an important role in their development. VEDs and radar systems supplement and promote each other. Some new trends in VEDs have been observed with advancements in the simulation tools for designing VEDs, new materials, new fabrication techniques. Recently, the performance of VEDs has greatly improved. In addition, new devices have been invented, which have laid the foundation for the developments of radar detection technology. This study introduces the recent development trends and research results of VEDs from microwave and millimeter wave devices and power modules, integrated VEDs, terahertz VEDs, and high power VEDs.
Radar signal processing and its applications
Hummel, Robert; Stoica, Petre; Zelnio, Edmund
2003-01-01
Radar Signal Processing and Its Applications brings together in one place important contributions and up-to-date research results in this fast-moving area. In twelve selected chapters, it describes the latest advances in architectures, design methods, and applications of radar signal processing. The contributors to this work were selected from the leading researchers and practitioners in the field. This work, originally published as Volume 14, Numbers 1-3 of the journal, Multidimensional Systems and Signal Processing, will be valuable to anyone working or researching in the field of radar signal processing. It serves as an excellent reference, providing insight into some of the most challenging issues being examined today.
A Scanning Microwave Radar and Radiometer
DEFF Research Database (Denmark)
Skou, Niels
1995-01-01
The Scanning Microwave Radar and Radiometer (SMRR) is a line scanner featuring a combined radar and radiometer system operating around 35 and 94 GHz. The layout of the SMRR is shown. The 2 offset antenna parabolas scan in synchronism, the receiver antenna has the highest gain in order to ensure...
Modern approach to relativity theory (radar formulation)
International Nuclear Information System (INIS)
Strel'tsov, V.N.
1991-01-01
The main peculiarities of the radar formulation of the relativity theory are presented. This formulation operates with the retarded (light) distances and relativistic or radar length introduced on their basis. 21 refs.; 1 tab
Signal compression in radar using FPGA
Directory of Open Access Journals (Sweden)
Enrique Escamilla Hemández
2010-01-01
Full Text Available El presente artículo muestra la puesta en práctica de hardware para realizar el procesamiento en tiempo real de la señal de radar usando una técnica simple, rápida basada en arquitectura de FPGA (Field Programmable Gate Array. El proceso incluye diversos procedimientos de enventanado durante la compresión del pulso del radar de apertura sintética (SAR. El proceso de compresión de la señal de radar se hace con un filtro acoplado. que aplica funciones clásicas y nuevas de enventanado, donde nos centramos en obtener una mejor atenuación para los valores de lóbulos laterales. La arquitectura propuesta explota los recursos de computación paralela de los dispositivos FPGA para alcanzar una mejor velocidad de cómputo. Las investigaciones experimentales han demostrado que los mejores resultados para el funcionamiento de la compresión del pulso se han obtenido usando las funciones atómicas, mejorando el funcionamiento del sistema del radar en presencia de ruido, y consiguiendo una pequeña degradación en la resolución de rango. La puesta en práctica del tratamiento de señales en el sistema de radar en tiempo real se discute y se justifica la eficiencia de la arquitectura de hardware propuesta.
Multi-function radar emitter identification based on stochastic syntax-directed translation schema
Liu, Haijun; Yu, Hongqi; Sun, Zhaolin; Diao, Jietao
2014-01-01
To cope with the problem of emitter identification caused by the radar words’ uncertainty of measured multi-function radar emitters, this paper proposes a new identification method based on stochastic syntax-directed translation schema (SSDTS). This method, which is deduced from the syntactic modeling of multi-function radars, considers the probabilities of radar phrases appearance in different radar modes as well as the probabilities of radar word errors occurrence in different radar phrases...
Forward scatter radar for remote intelligence of building interiors
Rossum, W.L. van; Wit, J.J.M. de
2017-01-01
Through-wall radar allows for remote intelligence of building interiors including stand-off detection and tracking of persons inside a building. However, reliable radar tracking of people inside a building is not trivial. Conventional, monostatic through-wall radar measures the backscatter of moving
Digital data acquisition for laser radar for vibration analysis
Montes, Felix G.
1998-01-01
Approved for public release; distribution is unlimited Laser radar for vibration analysis represents a military application to develop a target identification system in the future. The problem addressed is how to analyze the vibrations of a target illuminated by the laser radar to achieve a positive identification. This thesis develops a computer-based data acquisition and analysis system for improving the laser radar capability. Specifically, a review is made of the CO2 laser radar, coher...
Ladd, D.; Reeves, R.; Rumi, E.; Trethewey, M.; Fortescue, M.; Appleby, G.; Wilkinson, M.; Sherwood, R.; Ash, A.; Cooper, C.; Rayfield, P.
The Science and Technology Facilities Council (STFC), Control Loop Concepts Limited (CL2), Natural Environment Research Council (NERC) and Defence Science and Technology Laboratory (DSTL), have recently participated in a campaign of satellite observations, with both radar and optical sensors, in order to demonstrate an initial network concept that enhances the value of coordinated observations. STFC and CL2 have developed a Space Surveillance and Tracking (SST) server/client architecture to slave one sensor to another. The concept was originated to enable the Chilbolton radar (an S-band radar on a 25 m diameter fully-steerable dish antenna called CASTR – Chilbolton Advanced Satellite Tracking Radar) which does not have an auto-track function to follow an object based on position data streamed from another cueing sensor. The original motivation for this was to enable tracking during re-entry of ATV-5, a highly manoeuvrable ISS re-supply vessel. The architecture has been designed to be extensible and allows the interface of both optical and radar sensors which may be geographically separated. Connectivity between the sensors is TCP/IP over the internet. The data transferred between the sensors is translated into an Earth centred frame of reference to accommodate the difference in location, and time-stamping and filtering are applied to cope with latency. The server can accept connections from multiple clients, and the operator can switch between the different clients. This architecture is inherently robust and will enable graceful degradation should parts of the system be unavailable. A demonstration was conducted in 2016 whereby a small telescope connected to an agile mount (an EO tracker known as COATS - Chilbolton Optical Advanced Tracking System) located 50m away from the radar at Chilbolton, autonomously tracked several objects and fed the look angle data into a client. CASTR, slaved to COATS through the server followed and successfully detected the objects
Directory of Open Access Journals (Sweden)
Jonathan J Helmus
2016-07-01
Full Text Available The Python ARM Radar Toolkit is a package for reading, visualizing, correcting and analysing data from weather radars. Development began to meet the needs of the Atmospheric Radiation Measurement Climate Research Facility and has since expanded to provide a general-purpose framework for working with data from weather radars in the Python programming language. The toolkit is built on top of libraries in the Scientific Python ecosystem including NumPy, SciPy, and matplotlib, and makes use of Cython for interfacing with existing radar libraries written in C and to speed up computationally demanding algorithms. The source code for the toolkit is available on GitHub and is distributed under a BSD license.
Power centroid radar and its rise from the universal cybernetics duality
Feria, Erlan H.
2014-05-01
Power centroid radar (PC-Radar) is a fast and powerful adaptive radar scheme that naturally surfaced from the recent discovery of the time-dual for information theory which has been named "latency theory." Latency theory itself was born from the universal cybernetics duality (UC-Duality), first identified in the late 1970s, that has also delivered a time dual for thermodynamics that has been named "lingerdynamics" and anchors an emerging lifespan theory for biological systems. In this paper the rise of PC-Radar from the UC-Duality is described. The development of PC-Radar, US patented, started with Defense Advanced Research Projects Agency (DARPA) funded research on knowledge-aided (KA) adaptive radar of the last decade. The outstanding signal to interference plus noise ratio (SINR) performance of PC-Radar under severely taxing environmental disturbances will be established. More specifically, it will be seen that the SINR performance of PC-Radar, either KA or knowledgeunaided (KU), approximates that of an optimum KA radar scheme. The explanation for this remarkable result is that PC-Radar inherently arises from the UC-Duality, which advances a "first principles" duality guidance theory for the derivation of synergistic storage-space/computational-time compression solutions. Real-world synthetic aperture radar (SAR) images will be used as prior-knowledge to illustrate these results.
Development of Bread Board Model of TRMM precipitation radar
Okamoto, Ken'ichi; Ihara, Toshio; Kumagai, Hiroshi
The active array radar was selected as a reliable candidate for the TRMM (Tropical Rainfall Measuring Mission) precipitation radar after the trade off studies performed by Communications Research Laboratory (CRL) in the US-Japan joint feasibility study of TRMM in 1987-1988. Main system parameters and block diagram for TRMM precipitation radar are shown as the result of feasibility study. CRL developed key devices for the active array precipitation radar such as 8-element slotted waveguide array antenna, the 5 bit PIN diode phase shifters, solid state power amplifiers and low noise amplifiers in 1988-1990. Integration of these key devices was made to compose 8-element Bread Board Model of TRMM precipitation radar.
Single Frequency Network Based Distributed Passive Radar Technology
Directory of Open Access Journals (Sweden)
Wan Xian-rong
2015-01-01
Full Text Available The research and application of passive radar are heading from single transmitter-receiver pair to multiple transmitter-receiver pairs. As an important class of the illuminators of opportunity, most of modern digital broadcasting and television systems work on Single Frequency Network (SFN, which intrinsically determines that the passive radar based on such illuminators must be distributed and networked. In consideration of the remarkable working and processing mode of passive radar under SFN configuration, this paper proposes the concept of SFN-based Distributed Passive Radar (SDPR. The main characteristics and key problems of SDPR are first described. Then several potential solutions are discussed for part of the key technologies. The feasibility of SDPR is demonstrated by preliminary experimental results. Finally, the concept of four network convergence that includes the broadcast based passive radar network is conceived, and its application prospects are discussed.
Experimentelles FMCW-Radar zur hochfrequenten Charakterisierung von Windenergieanlagen
Schubert, Karsten; Werner, Jens; Schwartau, Fabian
2017-09-01
During the increasing dissemination of renewable energy sources the potential and actual interference effects of wind turbine plants became obvious. Turbines reflect the signals of weather radar and other radar systems. In addition to the static radar echoes, in particular the Doppler echoes are to be mentioned as an undesirable impairment Keränen (2014). As a result, building permit is refused for numerous new wind turbines, as the potential interference can not be reliably predicted. As a contribution to the improvement of this predictability, measurements are planned which aim at the high-frequency characterisation of wind energy installations. In this paper, a cost-effective FMCW radar is presented, which is operated in the same frequency band (C-band) as the weather radars of the German weather service. Here, the focus is on the description of the hardware design including the considerations used for its dimensioning.
Foliage penetration radar detection and characterization of objects under trees
Davis, Mark
2011-01-01
This book covers all aspects of foliage penetration (FOPEN) radar, concentrating on both airborne military radar systems as well as earth resource mapping radars. It is the first concise and thorough treatment of FOPEN, covering the results of a decade-long investment by DARPA in characterizing foliage and earth surface with ultrawideband UHF and VHF synthetic aperture radar (SAR).
Vertical Pointing Weather Radar for Built-up Urban Areas
DEFF Research Database (Denmark)
Rasmussen, Michael R.; Thorndahl, Søren; Schaarup-Jensen, Kjeld
2008-01-01
A cost effective vertical pointing X-band weather radar (VPR) has been tested for measurement of precipitation in urban areas. Stationary tests indicate that the VPR performs well compared to horizontal weather radars, such as the local area weather radars (LAWR). The test illustrated...
Runoff Calculation by Neural Networks Using Radar Rainfall Data
岡田, 晋作; 四俵, 正俊
1997-01-01
Neural networks, are used to calculate runoff from weather radar data and ground rain gauge data. Compared to usual runoff models, it is easier to use radar data in neural network runoff calculation. Basically you can use the radar data directly, or without transforming them into rainfall, as the input of the neural network. A situation with the difficulty of ground measurement is supposed. To cover the area lacking ground rain gauge, radar data are used. In case that the distribution of grou...
Directory of Open Access Journals (Sweden)
Zheng Shi-chao
2013-12-01
Full Text Available As an important mode in airborne radar systems, Wide Area Surveillance Ground Moving Target Indication (WAS-GMTI mode has the ability of monitoring a large area in a short time, and then the detected moving targets can be located quickly. However, in real environment, many factors introduce considerable errors into the location of moving targets. In this paper, a fast location method based on the characteristics of the moving targets in WAS-GMTI mode is utilized. And in order to improve the location performance, those factors that introduce location errors are analyzed and moving targets are relocated. Finally, the analysis of those factors is proved to be reasonable by simulation and real data experiments.
Detection performance improvement of FMCW radar using frequency shift
Wu, Y.; Linnartz, J.P.M.G.
2011-01-01
Frequency modulated continuous wave (FMCW) radars have been widely used for measuring target range and speed. In this paper, we present a mathematical model that quantifies the system-level performance of FMCW radar systems. In FMCW radar, the target range is measured through measuring the beat
14 CFR 125.223 - Airborne weather radar equipment requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airborne weather radar equipment... Equipment Requirements § 125.223 Airborne weather radar equipment requirements. (a) No person may operate an airplane governed by this part in passenger-carrying operations unless approved airborne weather radar...
14 CFR 121.357 - Airborne weather radar equipment requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airborne weather radar equipment... § 121.357 Airborne weather radar equipment requirements. (a) No person may operate any transport... December 31, 1964, unless approved airborne weather radar equipment has been installed in the airplane. (b...
Advances on Frequency Diverse Array Radar and Its Applications
Directory of Open Access Journals (Sweden)
Wang Wenqin
2018-04-01
Full Text Available Unlike the conventional phased array that provides only angle-dependent transmit beampattern, Frequency Diverse Array (FDA employs a small frequency increment across its array elements to produce automatic beam scanning without requiring phase shifters or mechanical steering. FDA can produce both rangedependent and time-variant transmit beampatterns, which overcomes the disadvantages of conventional phased arrays that produce only angle-dependent beampattern. Thus, FDA has many promising applications. Based on a previous study conducted by the author, “Frequency Diverse Array Radar: Concept, Principle and Application” (Journal of Electronics & Information Technology, 2016, 38(4: 1000–1011, the current study introduces basic FDA radar concepts, principles, and application characteristics and reviews recent advances on FDA radar and its applications. In addition, several new promising applications of FDA technology are discussed, such as radar electronic warfare and radar-communications, as well as open technical challenges such as beampattern variance, effective receiver design, adaptive signal detection and estimation, and the implementation of practical FDA radar demos.
Geological signatures of drillhole radar reflectors in ONKALO
International Nuclear Information System (INIS)
Doese, C.; Gustafsson, J.
2011-12-01
The geological signatures of radar reflectors in ONKALO have been evaluated as a subactivity within the Joint Work Programme 'Rock Suitability Criteria' strategies and methodology' between Svensk Kaernbraenslehantering AB and Posiva Oy. In addition to the geological signature, the usage of geophysical data to predict large fractures was evaluated. Pilot hole radar loggings were carried out using a RAMAC GPR-250 MHz dipole antenna. The radar data were evaluated and reflectors with known position and intersection angle to the pilot hole were correlated with fractures or foliation in the pilot hole and with Tunnel Crosscutting Fractures in the tunnel. This data served as in-data for the evaluation of the geological signatures of radar reflectors. The result of the evaluation is not univocal. Half of the reflectors could be explained by fractures in the pilot hole, but only about 10 % of the reflectors can be explained by Tunnel Crosscutting Fractures. Of these 10 %, 2/3 can also be explained by foliation, leaving only some 3 % of the total reflectors more unambiguously correlated with Tunnel Crosscutting Fractures. The fractures correlated with radar reflectors do not diverge much from other fractures. Fractures having intersection angles of 30 deg- 60 deg are more likely to be detected by radar relative to other. Other properties that seem to be overrepresented in fractures correlated with radar reflectors are quartz and/or graphite content, width ≥0.8 mm and higher alteration (J a ≥3), but the data is not unambiguous. (orig.)
Radar absorbing properties of carbon nanotubes/polymer ...
Indian Academy of Sciences (India)
This research is devoted to the study of radar absorbing properties of the composites, based on the epoxy binder and ... Radar absorbing materials; carbon nanotubes; nanocomposites; reflection loss. 1. ..... So, for example, the papers of [3–5 ...
Evaluation of radar imagery for geological and cartographic applications
Moore, Gerald K.; Sheehan, Cynthia A.
1981-01-01
The House/Senate conference report on H.R. 4930 (96th Congress), the Department of the Interior and Related Agencies Appropriations bill, 1980, stated that the U.S. Geological Survey should "begin the use of side-looking airborne radar imagery for topographic and geological mapping, and geological resource surveys in promising areas, particularly Alaska." In response to this mandate, the Survey acquired radar data and began scientific studies to analyze and interpret these data. About 70 percent of the project funding was used to acquire radar imagery and to evaluate Alaskan applications. Results of these studies indicate that radar images have a unique incremental value for certain geologic and cartographic applications but that the images are best suited for use as supplemental information sources or as primary data sources in areas of persistent cloud cover.The value of radar data is greatest for geologic mapping and resource surveys, particularly for mineral and petroleum exploration, where the objective is to locate any single feature or group of features that may control the occurrences of these resources. Radar images are considered by oil and gas companies to be worth the cost of data acquisition within a limited area of active exploration.Radar images also have incremental value for geologic site studies and hazard mapping. The need in these cases is TO inventory all geologic hazards to human life, property, resources, and the environment. For other geologic applications, radar images have a relatively small incremental value over a combination of Landsat images and aerial photographs.The value of radar images for cartographic applications is minimal, except when they are used as a substitute for aerial photographs and topographic maps in persistently cloud-covered areas. If conventional data sources are not available, radar images provide useful information on terrain relief, landforms, drainage patterns, and land cover. Screen less lithography is a low
Synthetic aperture radar: principles and applications
International Nuclear Information System (INIS)
Khan, N.A.; Yahya, K.M.
2003-01-01
In this paper an introduction to synthetic aperture radar is presented. Synthetic aperture radar is a relatively new remote sensing platform and the technology has matured a lot in the last two decades. This paper introduces the concepts behind SAR principles as well as the major areas where this new technology has shown additional information. (author)
Wind turbine clutter mitigation in coastal UHF radar.
Yang, Jing; Pan, Chao; Wang, Caijun; Jiang, Dapeng; Wen, Biyang
2014-01-01
Coastal UHF radar provides a unique capability to measure the sea surface dynamic parameters and detect small moving targets, by exploiting the low energy loss of electromagnetic waves propagating along the salty and good conducting ocean surface. It could compensate the blind zone of HF surface wave radar at close range and reach further distance than microwave radars. However, its performance is susceptible to wind turbines which are usually installed on the shore. The size of a wind turbine is much larger than the wavelength of radio waves at UHF band, which results in large radar cross section. Furthermore, the rotation of blades adds time-varying Doppler frequency to the clutter and makes the suppression difficult. This paper proposes a mitigation method which is based on the specific periodicity of wind turbine clutter and performed mainly in the time-frequency domain. Field experimental data of a newly developed UHF radar are used to verify this method, and the results prove its effectiveness.
Mapping high-latitude plasma convection with coherent HF radars
International Nuclear Information System (INIS)
Ruohoniemi, J.M.; Greenwald, R.A.; Baker, K.B.; Villain, J.-P.; Hanuise, C.; Kelly, J.
1989-01-01
In this decade, a new technique for the study of ionosphere electrodynamics has been implemented in an evolving generation of high-latitude HF radars. Coherent backscatter from electron density irregularities at F region altitudes is utilized to observe convective plasma motion. The electronic beam forming and scanning capabilities of the radars afford an excellent combination of spatial (∼50 km) and temporal (∼1 min) resolution of the large-scale (∼10 6 km 2 ) convection pattern. In this paper, we outline the methods developed to synthesize the HF radar data into two-dimensional maps of convection velocity. Although any single radar can directly measure only the line-of-sight, or radial, component of the plasma motion, the convection pattern is sometimes so uniform and stable that scanning in azimuth serves to determine the transverse component as well. Under more variable conditions, data from a second radar are necessary to unambiguously resolve velocity vectors. In either case, a limited region of vector solution can be expanded into contiguous areas of single-radar radial velocity data by noting that the convection must everywhere be divergence-free, i.e., ∇·v=0. It is thus often possible to map velocity vectors without extensive second-radar coverage. We present several examples of two-dimensional velocity maps. These show instances of L shell-aligned flow in the dusk sector, the reversal of convection near magnetic midnight, and counterstreaming in the dayside cleft. We include a study of merged coherent and incoherent radar data that illustrates the applicability of these methods to other ionospheric radar systems. copyright American Geophysical Union 1989
A Wing Pod-based Millimeter Wave Cloud Radar on HIAPER
Vivekanandan, Jothiram; Tsai, Peisang; Ellis, Scott; Loew, Eric; Lee, Wen-Chau; Emmett, Joanthan
2014-05-01
One of the attractive features of a millimeter wave radar system is its ability to detect micron-sized particles that constitute clouds with lower than 0.1 g m-3 liquid or ice water content. Scanning or vertically-pointing ground-based millimeter wavelength radars are used to study stratocumulus (Vali et al. 1998; Kollias and Albrecht 2000) and fair-weather cumulus (Kollias et al. 2001). Airborne millimeter wavelength radars have been used for atmospheric remote sensing since the early 1990s (Pazmany et al. 1995). Airborne millimeter wavelength radar systems, such as the University of Wyoming King Air Cloud Radar (WCR) and the NASA ER-2 Cloud Radar System (CRS), have added mobility to observe clouds in remote regions and over oceans. Scientific requirements of millimeter wavelength radar are mainly driven by climate and cloud initiation studies. Survey results from the cloud radar user community indicated a common preference for a narrow beam W-band radar with polarimetric and Doppler capabilities for airborne remote sensing of clouds. For detecting small amounts of liquid and ice, it is desired to have -30 dBZ sensitivity at a 10 km range. Additional desired capabilities included a second wavelength and/or dual-Doppler winds. Modern radar technology offers various options (e.g., dual-polarization and dual-wavelength). Even though a basic fixed beam Doppler radar system with a sensitivity of -30 dBZ at 10 km is capable of satisfying cloud detection requirements, the above-mentioned additional options, namely dual-wavelength, and dual-polarization, significantly extend the measurement capabilities to further reduce any uncertainty in radar-based retrievals of cloud properties. This paper describes a novel, airborne pod-based millimeter wave radar, preliminary radar measurements and corresponding derived scientific products. Since some of the primary engineering requirements of this millimeter wave radar are that it should be deployable on an airborne platform
Weather radar rainfall data in urban hydrology
Thorndahl, Søren; Einfalt, Thomas; Willems, Patrick; Ellerbæk Nielsen, Jesper; ten Veldhuis, J.A.E.; Arnbjerg-Nielsen, Karsten; Rasmussen, Michael R.; Molnar, Peter
2017-01-01
Application of weather radar data in urban hydrological applications has evolved significantly during the past decade as an alternative to traditional rainfall observations with rain gauges. Advances in radar hardware, data processing, numerical models, and emerging fields within urban hydrology
Prospective IS-MST radar. Potential and diagnostic capabilities
Directory of Open Access Journals (Sweden)
Potekhin A.P.
2016-09-01
Full Text Available In the next few years, a new radar is planned to be built near Irkutsk. It should have capabilities of incoherent scatter (IS radars and mesosphere-stratosphere-troposphere (MST radars [Zherebtsov et al., 2011]. The IS-MST radar is a phased array of two separated antenna panels with a multichannel digital receiving system, which allows detailed space-time processing of backscattered signal. This paper describes characteristics, configuration, and capabilities of the antenna and transceiver systems of this radar. We estimate its potential in basic operating modes to study the ionosphere by the IS method at heights above 100 km and the atmosphere with the use of signals scattered from refractive index fluctuations, caused by turbulent mixing at heights below 100 km. The modeling shows that the radar will allow us to regularly measure neutral atmosphere parameters at heights up to 26 km as well as to observe mesosphere summer echoes at heights near 85 km in the presence of charged ice particles (an increase in Schmidt number and mesosphere winter echoes at heights near 65 km with increasing background electron density. Evaluation of radar resources at the IS mode in two height ranges 100–600 and 600–2000 km demonstrates that in the daytime and with the accumulation time of 10 min, the upper boundaries of electron density and ionospheric plasma temperature are ~1500 and ~1300 km respectively, with the standard deviation of no more than 10 %. The upper boundary of plasma drift velocity is ~1100 km with the standard deviation of 45 m/s. The estimation of interferometric capabilities of the MST radar shows that it has a high sensitivity to objects of angular size near 7.5 arc min, and its potential accuracy in determining target angles can reach 40 arc sec.
Helmus, Jonathan J; Collis, Scott M
2016-01-01
The Python ARM Radar Toolkit is a package for reading, visualizing, correcting and analysing data from weather radars. Development began to meet the needs of the Atmospheric Radiation Measurement Climate Research Facility and has since expanded to provide a general-purpose framework for working with data from weather radars in the Python programming language. The toolkit is built on top of libraries in the Scientific Python ecosystem including NumPy, SciPy, and matplotlib, and makes use of Cy...
The NASA Polarimetric Radar (NPOL)
Petersen, Walter A.; Wolff, David B.
2013-01-01
Characteristics of the NASA NPOL S-band dual-polarimetric radar are presented including its operating characteristics, field configuration, scanning capabilities and calibration approaches. Examples of precipitation science data collections conducted using various scan types, and associated products, are presented for different convective system types and previous field campaign deployments. Finally, the NASA NPOL radar location is depicted in its home base configuration within the greater Wallops Flight Facility precipitation research array supporting NASA Global Precipitation Measurement Mission ground validation.
Feasibility of mitigating the effects of windfarms on primary radar
Energy Technology Data Exchange (ETDEWEB)
Butler, M.M.; Johnson, D.A.
2003-07-01
The objectives of the study were to investigate the feasibility of modifying civil and military radars to mitigate the effects from wind turbines, to provide costings for implementing changes to the radar and to produce guidelines for planning wind farms in the vicinity of radars. The effect of wind turbines on radar signals, assessed through computer modelling, is summarised. The key aspects of turbine design that can be modified to minimise these effects are described. A key issue is the fact that no two radar installations are alike, with settings being customised for local requirements. As a consequence, a detailed understanding of the design and features of each individual radar would be required in order to assess the impact of a wind farm proposal. The costs of a programme of modifications to the civil ATC (air traffic control) radar base will depend on many factors. An estimate of costs is provided, based on the assumption that only 30 of the UK radars would need modification and that a range of modifications from very simple to very complex will be required. A number of other approaches, outside of modification of the radar system, may require investigation during a windfarm planning application, such as layout and location of the wind farm or changing air traffic routes in the vicinity of the wind farm.
Radar-cross-section reduction of wind turbines. part 1.
Energy Technology Data Exchange (ETDEWEB)
Brock, Billy C.; Loui, Hung; McDonald, Jacob J.; Paquette, Joshua A.; Calkins, David A.; Miller, William K.; Allen, Steven E.; Clem, Paul Gilbert; Patitz, Ward E.
2012-03-05
In recent years, increasing deployment of large wind-turbine farms has become an issue of growing concern for the radar community. The large radar cross section (RCS) presented by wind turbines interferes with radar operation, and the Doppler shift caused by blade rotation causes problems identifying and tracking moving targets. Each new wind-turbine farm installation must be carefully evaluated for potential disruption of radar operation for air defense, air traffic control, weather sensing, and other applications. Several approaches currently exist to minimize conflict between wind-turbine farms and radar installations, including procedural adjustments, radar upgrades, and proper choice of low-impact wind-farm sites, but each has problems with limited effectiveness or prohibitive cost. An alternative approach, heretofore not technically feasible, is to reduce the RCS of wind turbines to the extent that they can be installed near existing radar installations. This report summarizes efforts to reduce wind-turbine RCS, with a particular emphasis on the blades. The report begins with a survey of the wind-turbine RCS-reduction literature to establish a baseline for comparison. The following topics are then addressed: electromagnetic model development and validation, novel material development, integration into wind-turbine fabrication processes, integrated-absorber design, and wind-turbine RCS modeling. Related topics of interest, including alternative mitigation techniques (procedural, at-the-radar, etc.), an introduction to RCS and electromagnetic scattering, and RCS-reduction modeling techniques, can be found in a previous report.
Space Radar Image of Maui, Hawaii
1994-01-01
This spaceborne radar image shows the 'Valley Island' of Maui, Hawaii. The cloud-penetrating capabilities of radar provide a rare view of many parts of the island, since the higher elevations are frequently shrouded in clouds. The light blue and yellow areas in the lowlands near the center are sugar cane fields. The three major population centers, Lahaina on the left at the western tip of island, Wailuku left of center, and Kihei in the lower center appear as small yellow, white or purple mottled areas. West Maui volcano, in the lower left, is 1800 meters high (5900 feet) and is considered extinct. The entire eastern half of the island consists of East Maui volcano, which rises to an elevation of 3200 meters (10,500 feet) and features a spectacular crater called Haleakala at its summit. Haleakala Crater was produced by erosion during previous ice ages rather than by volcanic activity, although relatively recent small eruptions have produced the numerous volcanic cones and lava flows that can be seen on the floor of the crater. The most recent eruption took place near the coast at the southwestern end of East Maui volcano in the late 1700s. Such a time frame indicates that East Maui should be considered a dormant, rather than an extinct volcano. A new eruption is therefore possible in the next few hundred years. The multi-wavelength capability of the SIR-C radar also permits differences in the vegetation cover on the middle flanks of East Maui to be identified. Rain forests appear in yellow, while grassland is shown in dark green, pink and blue. Radar images such as this one are being used by scientists to understand volcanic processes and to assess potential threats that future activity may pose to local populations. This image was acquired by Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) onboard the space shuttle Endeavour on April 16, 1994. The image is 73.7 kilometers by 48.7 kilometers (45.7 miles by 30.2 miles) and is centered at 20
Limits on surveillance: frictions, fragilities and failures in the operation of camera surveillance.
Dubbeld, L.
2004-01-01
Public video surveillance tends to be discussed in either utopian or dystopian terms: proponents maintain that camera surveillance is the perfect tool in the fight against crime, while critics argue that the use of security cameras is central to the development of a panoptic, Orwellian surveillance
Intercomparison of attenuation correction algorithms for single-polarized X-band radars
Lengfeld, K.; Berenguer, M.; Sempere Torres, D.
2018-03-01
Attenuation due to liquid water is one of the largest uncertainties in radar observations. The effects of attenuation are generally inversely proportional to the wavelength, i.e. observations from X-band radars are more affected by attenuation than those from C- or S-band systems. On the other hand, X-band radars can measure precipitation fields in higher temporal and spatial resolution and are more mobile and easier to install due to smaller antennas. A first algorithm for attenuation correction in single-polarized systems was proposed by Hitschfeld and Bordan (1954) (HB), but it gets unstable in case of small errors (e.g. in the radar calibration) and strong attenuation. Therefore, methods have been developed that restrict attenuation correction to keep the algorithm stable, using e.g. surface echoes (for space-borne radars) and mountain returns (for ground radars) as a final value (FV), or adjustment of the radar constant (C) or the coefficient α. In the absence of mountain returns, measurements from C- or S-band radars can be used to constrain the correction. All these methods are based on the statistical relation between reflectivity and specific attenuation. Another way to correct for attenuation in X-band radar observations is to use additional information from less attenuated radar systems, e.g. the ratio between X-band and C- or S-band radar measurements. Lengfeld et al. (2016) proposed such a method based isotonic regression of the ratio between X- and C-band radar observations along the radar beam. This study presents a comparison of the original HB algorithm and three algorithms based on the statistical relation between reflectivity and specific attenuation as well as two methods implementing additional information of C-band radar measurements. Their performance in two precipitation events (one mainly convective and the other one stratiform) shows that a restriction of the HB is necessary to avoid instabilities. A comparison with vertically pointing
Directory of Open Access Journals (Sweden)
Sadiel Novo
2008-03-01
Full Text Available Una de las principales aplicaciones del radar meteorológico es el pronóstico inmediato (decenas de minutos a unas pocas horas de antelación de los eventos de precipitación convectiva. Esto reviste gran importancia pues es precisamente en este lapso de tiempo donde son menos efectivos los pronósticos numéricos. Se repasan brevemente algunas de las técnicas de pronóstico inmediato reportadas en los últimos años, haciendo énfasis en aquellas que emplean solamente información de un radar convencional. Se distingue entre las que pronostican el movimiento de las tormentas como un todo y aquellas que permiten distinguir su movimiento interno, señalando sus ventajas y desventajas en situaciones meteorológicas concretas. Como ejemplo se presentan, para un caso de estudio escogido, aplicaciones simples de dos de estas técnicas. Por último se discute la utilidad de la técnica del sistema de referencia móvil para obtener las componentes del viento no observadas a partir de un solo radar Doppler o incluso un radar convencional, y sus implicaciones para la obtención de magnitudes termodinámicas.One of the main applications of the meteorological radar is the nowcasting (some tens of minutes to some hours forward of convective precipitation events. It has a great importance since this is the space of time in which the numerical forecasting is less effective. Some of the nowcasting techniques reported in the last years are reviewed shortly, making emphasis in those that use only information from a conventional radar. A distinction is made among those that predict the total movement of the storms and those that allow distinguishing their internal movement, pointing out their advantages and disadvantages in concrete meteorological situations. It is presented, for a chosen case of study, simple applications of two of these techniques. Finally, the utility of the moving frame of reference technique for obtaining the not observed wind components
Informational analysis for compressive sampling in radar imaging.
Zhang, Jingxiong; Yang, Ke
2015-03-24
Compressive sampling or compressed sensing (CS) works on the assumption of the sparsity or compressibility of the underlying signal, relies on the trans-informational capability of the measurement matrix employed and the resultant measurements, operates with optimization-based algorithms for signal reconstruction and is thus able to complete data compression, while acquiring data, leading to sub-Nyquist sampling strategies that promote efficiency in data acquisition, while ensuring certain accuracy criteria. Information theory provides a framework complementary to classic CS theory for analyzing information mechanisms and for determining the necessary number of measurements in a CS environment, such as CS-radar, a radar sensor conceptualized or designed with CS principles and techniques. Despite increasing awareness of information-theoretic perspectives on CS-radar, reported research has been rare. This paper seeks to bridge the gap in the interdisciplinary area of CS, radar and information theory by analyzing information flows in CS-radar from sparse scenes to measurements and determining sub-Nyquist sampling rates necessary for scene reconstruction within certain distortion thresholds, given differing scene sparsity and average per-sample signal-to-noise ratios (SNRs). Simulated studies were performed to complement and validate the information-theoretic analysis. The combined strategy proposed in this paper is valuable for information-theoretic orientated CS-radar system analysis and performance evaluation.
Homeland Security: Unmanned Aerial Vehicles and Border Surveillance
2010-07-08
outfit the Predator B with a synthetic aperture radar (SAR) system17 and a moving target indicator (MTI) radar. Adding SAR and MTI to the Predator B’s...Predator Squadrons,” Inside the Air Force, June 7, 2002. 17 For more information about Synthetic Aperture Radar, see http://www.sandia.gov/radar...contributed to the seizing of more than 22,000 pounds of marijuana and the apprehension of 5,000 illegal immigrants,” others disagree.24 “Unmanned aircraft
Laser radar: historical prospective-from the East to the West
Molebny, Vasyl; McManamon, Paul; Steinvall, Ove; Kobayashi, Takao; Chen, Weibiao
2017-03-01
This article discusses the history of laser radar development in America, Europe, and Asia. Direct detection laser radar is discussed for range finding, designation, and topographic mapping of Earth and of extraterrestrial objects. Coherent laser radar is discussed for environmental applications, such as wind sensing and for synthetic aperture laser radar development. Gated imaging is discussed through scattering layers for military, medical, and security applications. Laser microradars have found applications in intravascular studies and in ophthalmology for vision correction. Ghost laser radar has emerged as a new technology in theoretical and simulation applications. Laser radar is now emerging as an important technology for applications such as self-driving cars and unmanned aerial vehicles. It is also used by police to measure speed, and in gaming, such as the Microsoft Kinect.
Satellite-generated radar images of the earth
International Nuclear Information System (INIS)
Schanda, E.
1980-01-01
The Synthetic Aperture Radar (SAR) on board of SEASAT was the first non-military satellite-borne radar producing high-resolution images of the earth. Several examples of European scenes are discussed to demonstrate the properties of presently available optically processes images. (orig.)
Handbook of surveillance technologies
Petersen, JK
2012-01-01
From officially sanctioned, high-tech operations to budget spy cameras and cell phone video, this updated and expanded edition of a bestselling handbook reflects the rapid and significant growth of the surveillance industry. The Handbook of Surveillance Technologies, Third Edition is the only comprehensive work to chronicle the background and current applications of the full-range of surveillance technologies--offering the latest in surveillance and privacy issues.Cutting-Edge--updates its bestselling predecessor with discussions on social media, GPS circuits in cell phones and PDAs, new GIS s
Transponder-aided joint calibration and synchronization compensation for distributed radar systems.
Wang, Wen-Qin
2015-01-01
High-precision radiometric calibration and synchronization compensation must be provided for distributed radar system due to separate transmitters and receivers. This paper proposes a transponder-aided joint radiometric calibration, motion compensation and synchronization for distributed radar remote sensing. As the transponder signal can be separated from the normal radar returns, it is used to calibrate the distributed radar for radiometry. Meanwhile, the distributed radar motion compensation and synchronization compensation algorithms are presented by utilizing the transponder signals. This method requires no hardware modifications to both the normal radar transmitter and receiver and no change to the operating pulse repetition frequency (PRF). The distributed radar radiometric calibration and synchronization compensation require only one transponder, but the motion compensation requires six transponders because there are six independent variables in the distributed radar geometry. Furthermore, a maximum likelihood method is used to estimate the transponder signal parameters. The proposed methods are verified by simulation results.
Containment and surveillance devices
International Nuclear Information System (INIS)
Campbell, J.W.; Johnson, C.S.; Stieff, L.R.
The growing acceptance of containment and surveillance as a means to increase safeguards effectiveness has provided impetus to the development of improved surveillance and containment devices. Five recently developed devices are described. The devices include one photographic and two television surveillance systems and two high security seals that can be verified while installed
MWR-05XP Mobile Phased Array Weather Radar
2014-01-01
The NPS/CIRPAS Weather Radar Project objective is to develop the technology for adding a parallel weather processor capability to tactical military radars and to develop an advanced scientific instrument for investigation of atmospheric phenomena and other various types of research. The payoff to the military will be the integration of current weather data into the tactical radar picture. The payoff to the science community will be the availability of an advanced instrument for inves...
Feasibility analysis of WDM links for radar applications
Directory of Open Access Journals (Sweden)
D. Meena
2015-03-01
Full Text Available Active phased array antennas enhances the performance of modern radars by using multiple low power transmit/receive modules in place of a high power transmitter in conventional radars. Fully distributed phased array radars demand the distribution of various signals in radio frequency (RF and digital domain for real time operation. This is normally achieved through complex and bulky coaxial distribution networks. In this work, we intend to tap the inherent advantages of fiber links with wavelength division multiplexed (WDM technology and a feasibility study to adapt these links for radar applications is carried out. This is done by analysing various parameters like amplitude, delay, frequency and phase variation response of various radar waveforms over WDM links. This also includes performance evaluation of non-linear frequency modulation (NLFM signals, known for better signal to noise ratio (SNR to specific side lobe levels. NLFM waveforms are further analysed using pulse compression (PC technique. Link evaluation is also carried out using a standard simulation environment and is then experimentally verified with other waveforms like RF continuous wave (CW, pulsed RF and digital signals. Synchronization signals are generated from this variable duty cycle digital signals during real time radar operation. During evaluation of digital signals, variable transient effects for different duty cycles are observed from an amplifier configuration. A suppression method is proposed to eliminate this transient effects. Further, the link delay response is investigated using different lengths of fiber spools. It can be inferred from the experimental results that WDM links are capable of handling various signals significant to radar applications.
National Oceanic and Atmospheric Administration, Department of Commerce — Clutter present in radar return signals as used for wind profiling is substantially removed by carrying out a Daubechies wavelet transformation on a time series of...
Radar transponder operation with compensation for distortion due to amplitude modulation
Ormesher, Richard C [Albuquerque, NM; Tise, Bertice L [Albuquerque, NM; Axline, Jr., Robert M.
2011-01-04
In radar transponder operation, a variably delayed gating signal is used to gate a received radar pulse and thereby produce a corresponding gated radar pulse for transmission back to the source of the received radar pulse. This compensates for signal distortion due to amplitude modulation on the retransmitted pulse.
Liu, Shiwei; Wu, Xiaoling; Lopez, Alan D; Wang, Lijun; Cai, Yue; Page, Andrew; Yin, Peng; Liu, Yunning; Li, Yichong; Liu, Jiangmei; You, Jinling; Zhou, Maigeng
2016-01-01
In China, sample-based mortality surveillance systems, such as the Chinese Center for Disease Control and Prevention's disease surveillance points system and the Ministry of Health's vital registration system, have been used for decades to provide nationally representative data on health status for health-care decision-making and performance evaluation. However, neither system provided representative mortality and cause-of-death data at the provincial level to inform regional health service needs and policy priorities. Moreover, the systems overlapped to a considerable extent, thereby entailing a duplication of effort. In 2013, the Chinese Government combined these two systems into an integrated national mortality surveillance system to provide a provincially representative picture of total and cause-specific mortality and to accelerate the development of a comprehensive vital registration and mortality surveillance system for the whole country. This new system increased the surveillance population from 6 to 24% of the Chinese population. The number of surveillance points, each of which covered a district or county, increased from 161 to 605. To ensure representativeness at the provincial level, the 605 surveillance points were selected to cover China's 31 provinces using an iterative method involving multistage stratification that took into account the sociodemographic characteristics of the population. This paper describes the development and operation of the new national mortality surveillance system, which is expected to yield representative provincial estimates of mortality in China for the first time.
Block diagrams of the radar interface and control unit
Collier, J. W.
1989-01-01
The Interface and Control Unit is the heart of the radar module, which occupies one complex channel of the High-Speed Data Acquisition System of the Goldstone Solar System Radar. Block diagrams of the interface unit are presented as an aid to understanding its operation and interconnections to the rest of the radar module.
Wind energy applications of synthetic aperture radar
DEFF Research Database (Denmark)
Badger, Merete
Synthetic aperture radars (SAR), mounted on satellites or aircraft, have proven useful for ocean wind mapping. Wind speeds at the height 10 m may be retrieved from measurements of radar backscatter using empirical model functions. The resulting windfields are valuable in offshore wind energy plan...
Cheng, Calvin K Y; Ip, Dennis K M; Cowling, Benjamin J; Ho, Lai Ming; Leung, Gabriel M; Lau, Eric H Y
2011-10-14
Great strides have been made exploring and exploiting new and different sources of disease surveillance data and developing robust statistical methods for analyzing the collected data. However, there has been less research in the area of dissemination. Proper dissemination of surveillance data can facilitate the end user's taking of appropriate actions, thus maximizing the utility of effort taken from upstream of the surveillance-to-action loop. The aims of the study were to develop a generic framework for a digital dashboard incorporating features of efficient dashboard design and to demonstrate this framework by specific application to influenza surveillance in Hong Kong. Based on the merits of the national websites and principles of efficient dashboard design, we designed an automated influenza surveillance digital dashboard as a demonstration of efficient dissemination of surveillance data. We developed the system to synthesize and display multiple sources of influenza surveillance data streams in the dashboard. Different algorithms can be implemented in the dashboard for incorporating all surveillance data streams to describe the overall influenza activity. We designed and implemented an influenza surveillance dashboard that utilized self-explanatory figures to display multiple surveillance data streams in panels. Indicators for individual data streams as well as for overall influenza activity were summarized in the main page, which can be read at a glance. Data retrieval function was also incorporated to allow data sharing in standard format. The influenza surveillance dashboard serves as a template to illustrate the efficient synthesization and dissemination of multiple-source surveillance data, which may also be applied to other diseases. Surveillance data from multiple sources can be disseminated efficiently using a dashboard design that facilitates the translation of surveillance information to public health actions.
Distributed Subarray Antennas for Multifunction Phased-Array Radar
National Research Council Canada - National Science Library
Lin, Chih-heng
2003-01-01
As the target radar cross section (RCS) continuously decreases, the need for high-resolution high-gain radar increases, One approach to high resolution is to use distributed subarray antennas (DSAs...
Utilizing the Vertical Variability of Precipitation to Improve Radar QPE
Gatlin, Patrick N.; Petersen, Walter A.
2016-01-01
Characteristics of the melting layer and raindrop size distribution can be exploited to further improve radar quantitative precipitation estimation (QPE). Using dual-polarimetric radar and disdrometers, we found that the characteristic size of raindrops reaching the ground in stratiform precipitation often varies linearly with the depth of the melting layer. As a result, a radar rainfall estimator was formulated using D(sub m) that can be employed by polarimetric as well as dual-frequency radars (e.g., space-based radars such as the GPM DPR), to lower the bias and uncertainty of conventional single radar parameter rainfall estimates by as much as 20%. Polarimetric radar also suffers from issues associated with sampling the vertical distribution of precipitation. Hence, we characterized the vertical profile of polarimetric parameters (VP3)-a radar manifestation of the evolving size and shape of hydrometeors as they fall to the ground-on dual-polarimetric rainfall estimation. The VP3 revealed that the profile of ZDR in stratiform rainfall can bias dual-polarimetric rainfall estimators by as much as 50%, even after correction for the vertical profile of reflectivity (VPR). The VP3 correction technique that we developed can improve operational dual-polarimetric rainfall estimates by 13% beyond that offered by a VPR correction alone.
AMSNEXRAD-Automated detection of meteorite strewnfields in doppler weather radar
Hankey, Michael; Fries, Marc; Matson, Rob; Fries, Jeff
2017-09-01
For several years meteorite recovery in the United States has been greatly enhanced by using Doppler weather radar images to determine possible fall zones for meteorites produced by witnessed fireballs. While most fireball events leave no record on the Doppler radar, some large fireballs do. Based on the successful recovery of 10 meteorite falls 'under the radar', and the discovery of radar on more than 10 historic falls, it is believed that meteoritic dust and or actual meteorites falling to the ground have been recorded on Doppler weather radar (Fries et al., 2014). Up until this point, the process of detecting the radar signatures associated with meteorite falls has been a manual one and dependent on prior accurate knowledge of the fall time and estimated ground track. This manual detection process is labor intensive and can take several hours per event. Recent technological developments by NOAA now help enable the automation of these tasks. This in combination with advancements by the American Meteor Society (Hankey et al., 2014) in the tracking and plotting of witnessed fireballs has opened the possibility for automatic detection of meteorites in NEXRAD Radar Archives. Here in the processes for fireball triangulation, search area determination, radar interfacing, data extraction, storage, search, detection and plotting are explained.
Orbital radar studies of paleodrainages in the central Namib Desert
Lancaster, N.; Schaber, G.G.; Teller, J.T.
2000-01-01
Orbital radar images of the central Namib Desert show clearly the extent of relict fluvial deposits associated with former courses of the Tsondab and Kuiseb rivers. South of the Kuiseb River, radar data show the existence of a drainage network developed in calcrete-cemented late Tertiary fluvial deposits. The sand-filled paleovalleys are imaged as radar-dark tones in contrast to the radar-bright interfluves where the calcreted gravels occur. The drainage network developed as a result of local runoff from indurated gravels and channeled surface and subsurface flow to the sites of the many interdune lacustrine deposits found in the area. (C) Elsevier Science Inc., 2000.Orbital radar images of the central Namib Desert show clearly the extent of relict fluvial deposits associated with former courses of the Tsondab and Kuiseb rivers. South of the Kuiseb River, radar data show the existence of a drainage network developed in calcrete-cemented late Tertiary fluvial deposits. The sand-filled paleovalleys are imaged as radar-dark tones in contrast to the radar-bright interfluves where the calcreted gravels occur. The drainage network developed as a result of local runoff from indurated gravels and channeled surface and subsurface flow to the sites of the many interdune lacustrine deposits found in the area.
Directory of Open Access Journals (Sweden)
Karolina Bednarska
2016-04-01
Full Text Available Influenza surveillance was established in 1947. From this moment WHO (World Health Organization has been coordinating international cooperation, with a goal of monitoring influenza virus activity, effective diagnostic of the circulating viruses and informing society about epidemics or pandemics, as well as about emergence of new subtypes of influenza virus type A. Influenza surveillance is an important task, because it enables people to prepare themselves for battle with the virus that is constantly mutating, what leads to circulation of new and often more virulent strains of influenza in human population. As vaccination is the most effective method of fighting the virus, one of the major tasks of GISRS is developing an optimal antigenic composition of the vaccine for the current epidemic season. European Influenza Surveillance Network (EISN has also developed over the years. EISN is running integrated epidemiological and virological influenza surveillance, to provide appropriate data to public health experts in member countries, to enable them undertaking relevant activities based on the current information about influenza activity. In close cooperation with GISRS and EISN are National Influenza Centres - national institutions designated by the Ministry of Health in each country.
Advancements on Radar Polarization Information Acquisition and Processing
Directory of Open Access Journals (Sweden)
Dai Dahai
2016-04-01
Full Text Available The study on radar polarization information acquisition and processing has currently been one important part of radar techniques. The development of the polarization theory is simply reviewed firstly. Subsequently, some key techniques which include polarization measurement, polarization anti-jamming, polarization recognition, imaging and parameters inversion using radar polarimetry are emphatically analyzed in this paper. The basic theories, the present states and the development trends of these key techniques are presented and some meaningful conclusions are derived.
Carey, Lawrence D.; Schultz, Chrstopher J.; Schultz, Elise V.; Petersen, Walter A.; Gatlin, Patrick N.; Knupp, Kevin R.; Molthan, Andrew L.; Jedlovec, Gary J.; Darden, Christopher B.
2012-01-01
An historic tornado and severe weather outbreak devastated much of the southeastern United States between 25 and 28 April 2011. On 27 April 2011, northern Alabama was particularly hard hit by a large number of tornadoes, including several that reached EF-4 and EF-5 on the Enhanced Fujita damage scale. In northern Alabama alone, there were approximately 100 fatalities and hundreds of more people who were injured or lost their homes during the havoc caused by these violent tornadic storms. Two long-track and violent (EF-4 and EF-5) tornadoes occurred within range of the University of Alabama in Huntsville (UAHuntsville) Advanced Radar for Meteorological and Operational Research (ARMOR, C-band dual-polarimetric). A unique capability of dual-polarimetric radar is the near-real time identification of lofted debris associated with ongoing tornadoes on the ground. The focus of this paper is to analyze the dual-polarimetric radar-inferred tornado debris signatures and identify the associated debris paths of the long-track EF-4 and EF-5 tornadoes near ARMOR. The relative locations of the debris and damage paths for each tornado will be ascertained by careful comparison of the ARMOR analysis with NASA MODIS (Moderate Resolution Imaging Spectroradiometer) and ASTER (Advanced Spaceborne Thermal Emission and Reflection Radiometer) satellite imagery of the tornado damage scenes and the National Weather Service tornado damage surveys. With the ongoing upgrade of the WSR-88D (Weather Surveillance Radar 1988 Doppler) operational network to dual-polarimetry and a similar process having already taken place or ongoing for many private sector radars, dual-polarimetric radar signatures of tornado debris promise the potential to assist in the situational awareness of government and private sector forecasters and emergency managers during tornadic events. As such, a companion abstract (Schultz et al.) also submitted to this conference explores The use of dual-polarimetric tornadic debris
Advanced Architectures for Modern Weather/Multifunction Radars
2017-03-01
Radar (PAIR) system, a mobile , C-band, active phased array with multiple digital beams for imaging (under development). The digital transceiver... backend from Horus is also being used to drive row-based analog subarrays of the future Polarimetric Atmospheric Imaging Radar (PAIR, Fig. 6), which is
Classification of Agricultural Crops in Radar Images
Hoogeboom, P.
1983-01-01
For the past few years an accurate X-band SLAR system with digital recording has been available in The Netherlands. The images of this system are corrected to indicate radar backscatter coefficients (gamma) instead of arbitrary greytones. In 1980 a radar measurement campaign was organized in the
Radar Image Simulation: Validation of the Point Scattering Method. Volume 2
1977-09-01
the Engineer Topographic Labor - atory (ETL), Fort Belvoir, Virginia. This Radar Simulation Study was performed to validate the point tcattering radar...e.n For radar, the number of Independent samples in a given re.-olution cell is given by 5 ,: N L 2w (16) L Acoso where: 0 Radar incidence angle; w
Simulation Model of Logistic Support to Isolated Airspace Smveillance Radar Stations
Directory of Open Access Journals (Sweden)
Tomislav Crnković
2008-03-01
Full Text Available A simulation model of the radar network operation of fivemilitary radar stations has been developed. Simulation waspeiformed in GPSS language and contains the time of operationof five radars through a period of one year, time of plannedpreventive maintenance, irregularities, time of corrective maintenanceand maintenance team(s. The simulation shows theinfluence of the number of maintenance teams on the availabilityof each radar and presents a good orienteering point fordefining the optimal model of preventive and corrective maintenanceof the radar network.
Annual non-compliance report drops charge on Soviet radars
International Nuclear Information System (INIS)
Lockwood, D.
1993-01-01
Last year's non-compliance report said a data link between Soviet early warming radars and the Moscow ABM system may be a significant violation of fundamental provisions of the ABM Treaty. This year's report, however, reverses last years position by saying: In light of the ambiguity of the Treaty language, and based on further review of the issue and on the probable Soviet practice - the US now judges that the support of ABM systems by early warning radars providing precise handover data will not constitute use of the radars as ABM radars in violation of the ABM Treaty
Small battery operated unattended radar sensor for security systems
Plummer, Thomas J.; Brady, Stephen; Raines, Robert
2013-06-01
McQ has developed, tested, and is supplying to Unattended Ground Sensor (UGS) customers a new radar sensor. This radar sensor is designed for short range target detection and classification. The design emphasis was to have low power consumption, totally automated operation, a very high probability of detection coupled with a very low false alarm rate, be able to locate and track targets, and have a price compatible with the UGS market. The radar sensor complements traditional UGS sensors by providing solutions for scenarios that are difficult for UGS. The design of this radar sensor and the testing are presented in this paper.
Monitoring internal organ motion with continuous wave radar in CT
International Nuclear Information System (INIS)
Pfanner, Florian; Maier, Joscha; Allmendinger, Thomas; Flohr, Thomas; Kachelrieß, Marc
2013-01-01
Purpose: To avoid motion artifacts in medical imaging or to minimize the exposure of healthy tissues in radiation therapy, medical devices are often synchronized with the patient's respiratory motion. Today's respiratory motion monitors require additional effort to prepare the patients, e.g., mounting a motion belt or placing an optical reflector on the patient's breast. Furthermore, they are not able to measure internal organ motion without implanting markers. An interesting alternative to assess the patient's organ motion is continuous wave radar. The aim of this work is to design, implement, and evaluate such a radar system focusing on application in CT.Methods: The authors designed a radar system operating in the 860 MHz band to monitor the patient motion. In the intended application of the radar system, the antennas are located close to the patient's body inside the table of a CT system. One receive and four transmitting antennas are used to avoid the requirement of exact patient positioning. The radar waves propagate into the patient's body and are reflected at tissue boundaries, for example at the borderline between muscle and adipose tissue, or at the boundaries of organs. At present, the authors focus on the detection of respiratory motion. The radar system consists of the hardware mentioned above as well as of dedicated signal processing software to extract the desired information from the radar signal. The system was evaluated using simulations and measurements. To simulate the radar system, a simulation model based on radar and wave field equations was designed and 4D respiratory-gated CT data sets were used as input. The simulated radar signals and the measured data were processed in the same way. The radar system hardware and the signal processing algorithms were tested with data from ten volunteers. As a reference, the respiratory motion signal was recorded using a breast belt simultaneously with the radar measurements.Results: Concerning the
Miniaturized Ka-Band Dual-Channel Radar
Hoffman, James P.; Moussessian, Alina; Jenabi, Masud; Custodero, Brian
2011-01-01
Smaller (volume, mass, power) electronics for a Ka-band (36 GHz) radar interferometer were required. To reduce size and achieve better control over RFphase versus temperature, fully hybrid electronics were developed for the RF portion of the radar s two-channel receiver and single-channel transmitter. In this context, fully hybrid means that every active RF device was an open die, and all passives were directly attached to the subcarrier. Attachments were made using wire and ribbon bonding. In this way, every component, even small passives, was selected for the fabrication of the two radar receivers, and the devices were mounted relative to each other in order to make complementary components isothermal and to isolate other components from potential temperature gradients. This is critical for developing receivers that can track each other s phase over temperature, which is a key mission driver for obtaining ocean surface height. Fully hybrid, Ka-band (36 GHz) radar transmitter and dual-channel receiver were developed for spaceborne radar interferometry. The fully hybrid fabrication enables control over every aspect of the component selection, placement, and connection. Since the two receiver channels must track each other to better than 100 millidegrees of RF phase over several minutes, the hardware in the two receivers must be "identical," routed the same (same line lengths), and as isothermal as possible. This level of design freedom is not possible with packaged components, which include many internal passive, unknown internal connection lengths/types, and often a single orientation of inputs and outputs.
NOAA Next Generation Radar (NEXRAD) Level 3 Products
National Oceanic and Atmospheric Administration, Department of Commerce — This dataset consists of Level 3 weather radar products collected from Next-Generation Radar (NEXRAD) stations located in the contiguous United States, Alaska,...
Multiple-scattering in radar systems: A review
International Nuclear Information System (INIS)
Battaglia, Alessandro; Tanelli, Simone; Kobayashi, Satoru; Zrnic, Dusan; Hogan, Robin J.; Simmer, Clemens
2010-01-01
Although extensively studied within the lidar community, the multiple scattering phenomenon has always been considered a rare curiosity by radar meteorologists. Up to few years ago its appearance has only been associated with two- or three-body-scattering features (e.g. hail flares and mirror images) involving highly reflective surfaces. Recent atmospheric research aimed at better understanding of the water cycle and the role played by clouds and precipitation in affecting the Earth's climate has driven the deployment of high frequency radars in space. Examples are the TRMM 13.5 GHz, the CloudSat 94 GHz, the upcoming EarthCARE 94 GHz, and the GPM dual 13-35 GHz radars. These systems are able to detect the vertical distribution of hydrometeors and thus provide crucial feedbacks for radiation and climate studies. The shift towards higher frequencies increases the sensitivity to hydrometeors, improves the spatial resolution and reduces the size and weight of the radar systems. On the other hand, higher frequency radars are affected by stronger extinction, especially in the presence of large precipitating particles (e.g. raindrops or hail particles), which may eventually drive the signal below the minimum detection threshold. In such circumstances the interpretation of the radar equation via the single scattering approximation may be problematic. Errors will be large when the radiation emitted from the radar after interacting more than once with the medium still contributes substantially to the received power. This is the case if the transport mean-free-path becomes comparable with the instrument footprint (determined by the antenna beam-width and the platform altitude). This situation resembles to what has already been experienced in lidar observations, but with a predominance of wide- versus small-angle scattering events. At millimeter wavelengths, hydrometeors diffuse radiation rather isotropically compared to the visible or near infrared region where scattering is
Multi-antenna synthetic aperture radar
Wang, Wen-Qin
2013-01-01
Synthetic aperture radar (SAR) is a well-known remote sensing technique, but conventional single-antenna SAR is inherently limited by the minimum antenna area constraint. Although there are still technical issues to overcome, multi-antenna SAR offers many benefits, from improved system gain to increased degrees-of-freedom and system flexibility. Multi-Antenna Synthetic Aperture Radar explores the potential and challenges of using multi-antenna SAR in microwave remote sensing applications. These applications include high-resolution imaging, wide-swath remote sensing, ground moving target indica
Forward scatter radar for detection of moving people inside buildings
Wit, J.J.M. de; Rossum, W.L. van
2017-01-01
Through-wall radar offers capabilities that allow an important contribution to inside-building awareness, such as target detection and tracking. However, reliable radar tracking of people inside a building is not a trivial task. In monostatic operation, radar measures the backscatter from people
Monitoring of rain water storage in forests with satellite radar
de Jong, JJM; Klaassen, W; Kuiper, PJC
2002-01-01
The sensitivity of radar backscatter to the amount of intercepted rain in temperate deciduous forests is analyzed to determine the feasibility of retrieval of this parameter from satellite radar data. A backscatter model is validated with X-band radar measurements of a single tree exposed to rain. A good agreement between simulation and measurements is observed and this demonstrates the ability of radar to measure the amount of intercepted rain. The backscatter model is next applied to simula...
Regional Disease Surveillance Meeting - Final Paper
Energy Technology Data Exchange (ETDEWEB)
Lesperance, Ann M.; Mahy, Heidi A.
2006-08-08
On June 1, 2006, public health officials working in surveillance, epidemiological modeling, and information technology communities from the Seattle/Tacoma area and State of Washington met with members of the Pacific Northwest National Laboratory (PNNL) to discuss the current state of disease surveillance and gaps and needs to improve the current systems. The meeting also included a discussion of PNNL initiatives that might be appropriate to enhance disease surveillance and the current tools being used for disease surveillance. Participants broke out into two groups to identify critical gaps and needs for improving a surveillance system, and discuss the requirements for developing improved surveillance. Each group developed a list of key priorities summarizing the requirements for improved surveillance. The objective of this meeting was to work towards the development of an improved disease surveillance system.
Debris Examination Using Ballistic and Radar Integrated Software
Griffith, Anthony; Schottel, Matthew; Lee, David; Scully, Robert; Hamilton, Joseph; Kent, Brian; Thomas, Christopher; Benson, Jonathan; Branch, Eric; Hardman, Paul;
2012-01-01
The Debris Examination Using Ballistic and Radar Integrated Software (DEBRIS) program was developed to provide rapid and accurate analysis of debris observed by the NASA Debris Radar (NDR). This software provides a greatly improved analysis capacity over earlier manual processes, allowing for up to four times as much data to be analyzed by one-quarter of the personnel required by earlier methods. There are two applications that comprise the DEBRIS system: the Automated Radar Debris Examination Tool (ARDENT) and the primary DEBRIS tool.
A review of zoonotic disease surveillance supported by the Armed Forces Health Surveillance Center.
Burke, R L; Kronmann, K C; Daniels, C C; Meyers, M; Byarugaba, D K; Dueger, E; Klein, T A; Evans, B P; Vest, K G
2012-05-01
The Armed Forces Health Surveillance Center (AFHSC), Division of Global Emerging Infections Surveillance and Response System conducts disease surveillance through a global network of US Department of Defense research laboratories and partnerships with foreign ministries of agriculture, health and livestock development in over 90 countries worldwide. In 2010, AFHSC supported zoonosis survey efforts were organized into four main categories: (i) development of field assays for animal disease surveillance during deployments and in resource limited environments, (ii) determining zoonotic disease prevalence in high-contact species which may serve as important reservoirs of diseases and sources of transmission, (iii) surveillance in high-risk human populations which are more likely to become exposed and subsequently infected with zoonotic pathogens and (iv) surveillance at the human-animal interface examining zoonotic disease prevalence and transmission within and between human and animal populations. These efforts have aided in the detection, identification and quantification of the burden of zoonotic diseases such as anthrax, brucellosis, Crimean Congo haemorrhagic fever, dengue fever, Hantaan virus, influenza, Lassa fever, leptospirosis, melioidosis, Q fever, Rift Valley fever, sandfly fever Sicilian virus, sandfly fever Naples virus, tuberculosis and West Nile virus, which are of military and public health importance. Future zoonotic surveillance efforts will seek to develop local capacity for zoonotic surveillance focusing on high risk populations at the human-animal interface. © 2011 Blackwell Verlag GmbH.
35-GHz radar sensor for automotive collision avoidance
Zhang, Jun
1999-07-01
This paper describes the development of a radar sensor system used for automotive collision avoidance. Because the heavy truck may have great larger radar cross section than a motorcyclist has, the radar receiver may have a large dynamic range. And multi-targets at different speed may confuse the echo spectrum causing the ambiguity between range and speed of target. To get more information about target and background and to adapt to the large dynamic range and multi-targets, a frequency modulated and pseudo- random binary sequences phase modulated continuous wave radar system is described. The analysis of this double- modulation system is given. A high-speed signal processing and data processing component are used to process and combine the data and information from echo at different direction and at every moment.
ASSIMILATION OF DOPPLER RADAR DATA INTO NUMERICAL WEATHER MODELS
Energy Technology Data Exchange (ETDEWEB)
Chiswell, S.; Buckley, R.
2009-01-15
During the year 2008, the United States National Weather Service (NWS) completed an eight fold increase in sampling capability for weather radars to 250 m resolution. This increase is expected to improve warning lead times by detecting small scale features sooner with increased reliability; however, current NWS operational model domains utilize grid spacing an order of magnitude larger than the radar data resolution, and therefore the added resolution of radar data is not fully exploited. The assimilation of radar reflectivity and velocity data into high resolution numerical weather model forecasts where grid spacing is comparable to the radar data resolution was investigated under a Laboratory Directed Research and Development (LDRD) 'quick hit' grant to determine the impact of improved data resolution on model predictions with specific initial proof of concept application to daily Savannah River Site operations and emergency response. Development of software to process NWS radar reflectivity and radial velocity data was undertaken for assimilation of observations into numerical models. Data values within the radar data volume undergo automated quality control (QC) analysis routines developed in support of this project to eliminate empty/missing data points, decrease anomalous propagation values, and determine error thresholds by utilizing the calculated variances among data values. The Weather Research and Forecasting model (WRF) three dimensional variational data assimilation package (WRF-3DVAR) was used to incorporate the QC'ed radar data into input and boundary conditions. The lack of observational data in the vicinity of SRS available to NWS operational models signifies an important data void where radar observations can provide significant input. These observations greatly enhance the knowledge of storm structures and the environmental conditions which influence their development. As the increase in computational power and availability has
Space Radar Image of West Texas - SAR scan
1999-01-01
This radar image of the Midland/Odessa region of West Texas, demonstrates an experimental technique, called ScanSAR, that allows scientists to rapidly image large areas of the Earth's surface. The large image covers an area 245 kilometers by 225 kilometers (152 miles by 139 miles). It was obtained by the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) flying aboard the space shuttle Endeavour on October 5, 1994. The smaller inset image is a standard SIR-C image showing a portion of the same area, 100 kilometers by 57 kilometers (62 miles by 35 miles) and was taken during the first flight of SIR-C on April 14, 1994. The bright spots on the right side of the image are the cities of Odessa (left) and Midland (right), Texas. The Pecos River runs from the top center to the bottom center of the image. Along the left side of the image are, from top to bottom, parts of the Guadalupe, Davis and Santiago Mountains. North is toward the upper right. Unlike conventional radar imaging, in which a radar continuously illuminates a single ground swath as the space shuttle passes over the terrain, a Scansar radar illuminates several adjacent ground swaths almost simultaneously, by 'scanning' the radar beam across a large area in a rapid sequence. The adjacent swaths, typically about 50 km (31 miles) wide, are then merged during ground processing to produce a single large scene. Illumination for this L-band scene is from the top of the image. The beams were scanned from the top of the scene to the bottom, as the shuttle flew from left to right. This scene was acquired in about 30 seconds. A normal SIR-C image is acquired in about 13 seconds. The ScanSAR mode will likely be used on future radar sensors to construct regional and possibly global radar images and topographic maps. The ScanSAR processor is being designed for 1996 implementation at NASA's Alaska SAR Facility, located at the University of Alaska Fairbanks, and will produce digital images from the
P-band radar ice sounding in Antarctica
DEFF Research Database (Denmark)
Dall, Jørgen; Kusk, Anders; Kristensen, Steen Savstrup
2012-01-01
In February 2011, the Polarimetric Airborne Radar Ice Sounder (POLARIS) was flown in Antarctica in order to assess the feasibility of a potential space-based radar ice sounding mission. The campaign has demonstrated that the basal return is detectable in areas with up to 3 km thick cold ice, in a...
Statistical Angular Resolution Limit for Ultrawideband MIMO Noise Radar
Directory of Open Access Journals (Sweden)
Xiaoli Zhou
2015-01-01
Full Text Available The two-dimensional angular resolution limit (ARL of elevation and azimuth for MIMO radar with ultrawideband (UWB noise waveforms is investigated using statistical resolution theory. First, the signal model of monostatic UWB MIMO noise radar is established in a 3D reference frame. Then, the statistical angular resolution limits (SARLs of two closely spaced targets are derived using the detection-theoretic and estimation-theoretic approaches, respectively. The detection-theoretic approach is based on the generalized likelihood ratio test (GLRT with given probabilities of false alarm and detection, while the estimation-theoretic approach is based on Smith’s criterion which involves the Cramér-Rao lower bound (CRLB. Furthermore, the relationship between the two approaches is presented, and the factors affecting the SARL, that is, detection parameters, transmit waveforms, array geometry, signal-to-noise ratio (SNR, and parameters of target (i.e., radar cross section (RCS and direction, are analyzed. Compared with the conventional radar resolution theory defined by the ambiguity function, the SARL reflects the practical resolution ability of radar and can provide an optimization criterion for radar system design.
[Radar as imaging tool in ecology and conservation biology].
Matyjasiak, Piotr
2017-01-01
Migrations and dispersal are among the most important ecological processes that shape ecosystems and influence our economy, health and safety. Movements of birds, bats and insects occur in a large spatial scale - regional, continental, or intercontinental. However, studies of these phenomena using classic methods are usually local. Breakthrough came with the development of radar technology, which enabled researchers to study animal movements in the atmosphere in a large spatial and temporal scale. The aim of this article was to present the radar imaging methods used in the research of aerial movements of birds, bats and insects. The types of radars used in research are described, and examples of the use of radar in basic research and in conservation biology are discussed. Radar visualizations are used in studies on the effect of meteorological conditions on bird migration, on spatial and temporal dynamics of movements of birds, bats and insects, and on the mechanism of orientation of migrating birds and insects. In conservation biology research radars are used in the monitoring of endangered species of birds and bats, to monitor bird activity at airports, as well as in assessing the impact of high constructions on flying birds and bats.
Neuper, Malte; Ehret, Uwe
2014-05-01
The relation between the measured radar reflectivity factor Z and surface rainfall intensity R - the Z/R relation - is profoundly complex, so that in general one speaks about radar-based quantitative precipitation estimation (QPE) rather than exact measurement. Like in Plato's Allegory of the Cave, what we observe in the end is only the 'shadow' of the true rainfall field through a very small backscatter of an electromagnetic signal emitted by the radar, which we hope has been actually reflected by hydrometeors. The meteorological relevant and valuable Information is gained only indirectly by more or less justified assumptions. One of these assumptions concerns the drop size distribution, through which the rain intensity is finally associated with the measured radar reflectivity factor Z. The real drop size distribution is however subject to large spatial and temporal variability, and consequently so is the true Z/R relation. Better knowledge of the true spatio-temporal Z/R structure therefore has the potential to improve radar-based QPE compared to the common practice of applying a single or a few standard Z/R relations. To this end, we use observations from six laser-optic disdrometers, two vertically pointing micro rain radars, 205 rain gauges, one rawindsonde station and two C-band Doppler radars installed or operated in and near the Attert catchment (Luxembourg). The C-band radars and the rawindsonde station are operated by the Belgian and German Weather Services, the rain gauge data was partly provided by the French, Dutch, Belgian, German Weather Services and the Ministry of Agriculture of Luxembourg and the other equipment was installed as part of the interdisciplinary DFG research project CAOS (Catchment as Organized Systems). With the various data sets correlation analyzes were executed. In order to get a notion on the different appearance of the reflectivity patterns in the radar image, first of all various simple distribution indices (for example the
Compressive sensing for urban radar
Amin, Moeness
2014-01-01
With the emergence of compressive sensing and sparse signal reconstruction, approaches to urban radar have shifted toward relaxed constraints on signal sampling schemes in time and space, and to effectively address logistic difficulties in data acquisition. Traditionally, these challenges have hindered high resolution imaging by restricting both bandwidth and aperture, and by imposing uniformity and bounds on sampling rates.Compressive Sensing for Urban Radar is the first book to focus on a hybrid of two key areas: compressive sensing and urban sensing. It explains how reliable imaging, tracki
Assimilation of radar-based nowcast into HIRLAM NWP model
DEFF Research Database (Denmark)
Jensen, David Getreuer; Petersen, Claus; Rasmussen, Michael R.
2015-01-01
The present study introduces a nowcast scheme that assimilates radar extrapolation data (RED) into a nowcasting version of the high resolution limited area model (HIRLAM) numerical weather prediction (NWP) model covering the area of Denmark. The RED are based on the Co-TREC (tracking radar echoes...... by correlation) methodology and are generated from cleaned radar mosaics from the Danish weather radar network. The assimilation technique is a newly developed method that increases model precipitation by increasing low-level convergence and decreasing convergence aloft in order to increase the vertical velocity....... The level of improved predictability relies on the RED quality, which again relies on the type of event....
Propagation of radar rainfall uncertainty in urban flood simulations
Liguori, Sara; Rico-Ramirez, Miguel
2013-04-01
This work discusses the results of the implementation of a novel probabilistic system designed to improve ensemble sewer flow predictions for the drainage network of a small urban area in the North of England. The probabilistic system has been developed to model the uncertainty associated to radar rainfall estimates and propagate it through radar-based ensemble sewer flow predictions. The assessment of this system aims at outlining the benefits of addressing the uncertainty associated to radar rainfall estimates in a probabilistic framework, to be potentially implemented in the real-time management of the sewer network in the study area. Radar rainfall estimates are affected by uncertainty due to various factors [1-3] and quality control and correction techniques have been developed in order to improve their accuracy. However, the hydrological use of radar rainfall estimates and forecasts remains challenging. A significant effort has been devoted by the international research community to the assessment of the uncertainty propagation through probabilistic hydro-meteorological forecast systems [4-5], and various approaches have been implemented for the purpose of characterizing the uncertainty in radar rainfall estimates and forecasts [6-11]. A radar-based ensemble stochastic approach, similar to the one implemented for use in the Southern-Alps by the REAL system [6], has been developed for the purpose of this work. An ensemble generator has been calibrated on the basis of the spatial-temporal characteristics of the residual error in radar estimates assessed with reference to rainfall records from around 200 rain gauges available for the year 2007, previously post-processed and corrected by the UK Met Office [12-13]. Each ensemble member is determined by summing a perturbation field to the unperturbed radar rainfall field. The perturbations are generated by imposing the radar error spatial and temporal correlation structure to purely stochastic fields. A
Turso, S.; Paolella, S.; Gabella, M.; Perona, G.
2013-01-01
In this paper, MicroRadarNet, a novel micro radar network for continuous, unattended meteorological monitoring is presented. Key aspects and constraints are introduced. Specific design strategies are highlighted, leading to the technological implementations of this wireless, low-cost, low power consumption sensor network. Raw spatial and temporal datasets are processed on-board in real-time, featuring a consistent evaluation of the signals from the sensors and optimizing the data loads to be transmitted. Network servers perform the final post-elaboration steps on the data streams coming from each unit. Final network products are meteorological mappings of weather events, monitored with high spatial and temporal resolution, and lastly served to the end user through any Web browser. This networked approach is shown to imply a sensible reduction of the overall operational costs, including management and maintenance aspects, if compared to the traditional long range monitoring strategy. Adoption of the TITAN storm identification and nowcasting engine is also here evaluated for in-loop integration within the MicroRadarNet data processing chain. A brief description of the engine workflow is provided, to present preliminary feasibility results and performance estimates. The outcomes were not so predictable, taking into account relevant operational differences between a Western Alps micro radar scenario and the long range radar context in the Denver region of Colorado. Finally, positive results from a set of case studies are discussed, motivating further refinements and integration activities.
Surface Environmental Surveillance Procedures Manual
International Nuclear Information System (INIS)
Hanf, Robert W.; Poston, Ted M.
2000-01-01
Shows and explains certain procedures needed for surface environmental surveillance. Hanford Site environmental surveillance is conducted by the Pacific Northwest National Laboratory (PNNL) for the U.S. Department of Energy (DOE) under the Surface Environmental Surveillance Project (SESP). The basic requirements for site surveillance are set fourth in DOE Order 5400.1, General Environmental Protection Program Requirements. Guidance for the SESP is provided in DOE Order 5484.1, Environmental Protection, Safety, and Health Protection Information Reporting Requirements and DOE Order 5400.5, Radiation Protection of the Public and Environment. Guidelines for environmental surveillance activities are provided in DOE/EH-0173T, Environmental Regulatory Guide for Radiological Effluent Monitoring and Environmental Surveillance. An environmental monitoring plan for the Hanford Site is outlined in DOE/RL 91-50 Rev. 2, Environmental Monitoring Plan, United States Department of Energy, Richland Operations Office. Environmental surveillance data are used in assessing the impact of current and past site operations on human health and the environment, demonstrating compliance with applicable local, state, and federal environmental regulations, and verifying the adequacy of containment and effluent controls. SESP sampling schedules are reviewed, revised, and published each calendar year in the Hanford Site Environmental Surveillance Master Sampling Schedule. Environmental samples are collected by SESP staff in accordance with the approved sample collection procedures documented in this manual. Personnel training requirements are documented in SESP-TP-01 Rev.2, Surface Environmental Surveillance Project Training Program.
Study on Effectiveness of the chaos laser radar
成田, 義之; 津田, 紀生; 山田, 諄
2003-01-01
A laser is widely applied for measurements, since it is invented. There are two types of laser distance meter for short and long distance. For long distance, a laser radar using propagation time of laser light is used. Generally, a distance is measured from delay time using either a periodic signal or a single pulse. But the signal becomes to be buried in noise with increasing distance. A new type of chaos laser radar which processes by only an addition is proposed. This radar can quickly pro...
An improved hydrometeor detection method for millimeter-wavelength cloud radar
Directory of Open Access Journals (Sweden)
J. Ge
2017-07-01
Full Text Available A modified method with a new noise reduction scheme that can reduce the noise distribution to a narrow range is proposed to distinguish clouds and other hydrometeors from noise and recognize more features with weak signal in cloud radar observations. A spatial filter with central weighting, which is widely used in cloud radar hydrometeor detection algorithms, is also applied in our method to examine radar return for significant levels of signals. Square clouds were constructed to test our algorithm and the method used for the US Department of Energy Atmospheric Radiation Measurements Program millimeter-wavelength cloud radar. We also applied both the methods to 6 months of cloud radar observations at the Semi-Arid Climate and Environment Observatory of Lanzhou University and compared the results. It was found that our method has significant advantages in reducing the rates of both failed negative and false positive hydrometeor identifications in simulated clouds and recognizing clouds with weak signal from our cloud radar observations.
Middle Atmosphere Program. Handbook for MAP. Volume 30: International School on Atmospheric Radar
Fukao, Shoichiro (Editor)
1989-01-01
Broad, tutorial coverage is given to the technical and scientific aspects of mesosphere stratosphere troposphere (MST) meteorological radar systems. Control issues, signal processing, atmospheric waves, the historical aspects of radar atmospheric dynamics, incoherent scatter radars, radar echoes, radar targets, and gravity waves are among the topics covered.
Leon, Barbara D.; Heller, Paul R.
1987-05-01
A surveillance network is a group of multiplatform sensors cooperating to improve network performance. Network control is distributed as a measure to decrease vulnerability to enemy threat. The network may contain diverse sensor types such as radar, ESM (Electronic Support Measures), IRST (Infrared search and track) and E-0 (Electro-Optical). Each platform may contain a single sensor or suite of sensors. In a surveillance network it is desirable to control sensors to make the overall system more effective. This problem has come to be known as sensor management and control (SM&C). Two major facets of network performance are surveillance and survivability. In a netted environment, surveillance can be enhanced if information from all sensors is combined and sensor operating conditions are controlled to provide a synergistic effect. In contrast, when survivability is the main concern for the network, the best operating status for all sensors would be passive or off. Of course, improving survivability tends to degrade surveillance. Hence, the objective of SM&C is to optimize surveillance and survivability of the network. Too voluminous data of various formats and the quick response time are two characteristics of this problem which make it an ideal application for Artificial Intelligence. A solution to the SM&C problem, presented as a computer simulation, will be presented in this paper. The simulation is a hybrid production written in LISP and FORTRAN. It combines the latest conventional computer programming methods with Artificial Intelligence techniques to produce a flexible state-of-the-art tool to evaluate network performance. The event-driven simulation contains environment models coupled with an expert system. These environment models include sensor (track-while-scan and agile beam) and target models, local tracking, and system tracking. These models are used to generate the environment for the sensor management and control expert system. The expert system
Incidence angle normalization of radar backscatter data
NASA’s Soil Moisture Passive Active (SMAP) satellite (~2014) will include a radar system that will provide L-band multi-polarization backscatter at a constant incidence angle of 40º. During the pre-launch phase of the project there is a need for observations that will support the radar-based soil mo...
Critical Surveillance Studies in the Information Society
Directory of Open Access Journals (Sweden)
Thomas Allmer
2011-11-01
Full Text Available The overall aim of this paper is to clarify how we can theorize and systemize economic surveillance. Surveillance studies scholars like David Lyon stress that economic surveillance such as monitoring consumers or the workplace are central aspects of surveillance societies. The approach that is advanced in this work recognizes the importance of the role of the economy in contemporary surveillance societies. The paper at hand constructs theoretically founded typologies in order to systemize the existing literature of surveillance studies and to analyze examples of surveillance. Therefore, it mainly is a theoretical approach combined with illustrative examples. This contribution contains a systematic discussion of the state of the art of surveillance and clarifies how different notions treat economic aspects of surveillance. In this work it is argued that the existing literature is insufficient for studying economic surveillance. In contrast, a typology of surveillance in the modern economy, which is based on foundations of a political economy approach, allows providing a systematic analysis of economic surveillance on the basis of current developments on the Internet. Finally, some political recommendations are drawn in order to overcome economic surveillance. This contribution can be fruitful for scholars who want to undertake a systematic analysis of surveillance in the modern economy and who want to study the field of surveillance critically.
World Alliance for Risk Factor Surveillance White Paper on Surveillance and Health Promotion
Directory of Open Access Journals (Sweden)
Stefano Campostrini
2015-02-01
Full Text Available This is not a research paper on risk factor surveillance. It is an effort by a key group of researchers and practitioners of risk factor surveillance to define the current state of the art and to identify the key issues involved in the current practice of behavioral risk factor surveillance. Those of us who are the principal authors have worked and carried out research in this area for some three decades. As a result of a series of global meetings beginning in 1999 and continuing every two years since then, a collective working group of the International Union of Health Promotion and Education (IUHPE was formed under the name World Alliance of Risk Factor Surveillance (WARFS. Under this banner the organization sought to write a comprehensive statement on the importance of surveillance to health promotion and public health. This paper, which has been revised and reviewed by established peers in the field, is the result. It provides the reader with a clear summary of the major issues that need to be considered by any and all seeking to carry out behavioral risk factor surveillance.
Quantitative analysis of ground penetrating radar data in the Mu Us Sandland
Fu, Tianyang; Tan, Lihua; Wu, Yongqiu; Wen, Yanglei; Li, Dawei; Duan, Jinlong
2018-06-01
Ground penetrating radar (GPR), which can reveal the sedimentary structure and development process of dunes, is widely used to evaluate aeolian landforms. The interpretations for GPR profiles are mostly based on qualitative descriptions of geometric features of the radar reflections. This research quantitatively analyzed the waveform parameter characteristics of different radar units by extracting the amplitude and time interval parameters of GPR data in the Mu Us Sandland in China, and then identified and interpreted different sedimentary structures. The results showed that different types of radar units had specific waveform parameter characteristics. The main waveform parameter characteristics of sand dune radar facies and sandstone radar facies included low amplitudes and wide ranges of time intervals, ranging from 0 to 0.25 and 4 to 33 ns respectively, and the mean amplitudes changed gradually with time intervals. The amplitude distribution curves of various sand dune radar facies were similar as unimodal distributions. The radar surfaces showed high amplitudes with time intervals concentrated in high-value areas, ranging from 0.08 to 0.61 and 9 to 34 ns respectively, and the mean amplitudes changed drastically with time intervals. The amplitude and time interval values of lacustrine radar facies were between that of sand dune radar facies and radar surfaces, ranging from 0.08 to 0.29 and 11 to 30 ns respectively, and the mean amplitude and time interval curve was approximately trapezoidal. The quantitative extraction and analysis of GPR reflections could help distinguish various radar units and provide evidence for identifying sedimentary structure in aeolian landforms.
Development of Coatings for Radar Absorbing Materials at X-band
Kumar, Abhishek; Singh, Samarjit
2018-03-01
The present review gives a brief account on some of the technical features of radar absorbing materials (RAMs). The paper has been presented with a concentrated approach towards the material aspects for achieving enhanced radar absorption characteristics for its application as a promising candidate in stealth technology and electromagnetic interference (EMI) minimization problems. The effect of metal particles doping/dispersion in the ferrites and dielectrics has been discussed for obtaining tunable radar absorbing characteristics. A short theoretical overview on the development of absorber materials, implementation of genetic algorithm (GA) in multi-layering and frequency selective surfaces (FSSs) based multi-layer has also been presented for the development of radar absorbing coatings for achieving better absorption augmented with broadband features in order to counter the radar detection systems.
EISCAT as a tristatic auroral radar
International Nuclear Information System (INIS)
Schlegel, K.; Moorcroft, D.R.
1989-01-01
The authors have used the European Incoherent Scatter radar (EISCAT) in a mode which allows them to use it as a tristatic auroral radar. Observing at an elevation of less than 10 degree with the Tromsoe beam, they achieved magnetic aspect angles between 4 degree and 6 degree at 105 km altitude and recorded coherent echoes simultaneously from all three sites. The backscattered power for these echoes is up to 3 orders of magnitude higher than typical incoherent scatter echoes. Contrary to most existing auroral radars, they can calibrate the coherent echo strength and thus determine absolute values of the coherent backscatter cross section. Moreover, switching the common volume in short time intervals from E to F region heights, permits the determination of the E x B drift vector almost simultaneously with the E region coherent scattering measurements. This opens unique possibilities to study the E region plasma instabilities and their driving force. The main aim of this paper is to describe the capabilities of EISCAT as an auroral radar and to present and discuss results in terms of coherent backscatter cross sections, coherent spectra shape, irregularity phase velocities, and aspect angle dependence. In forthcoming papers several of these topics will be explored in more detail
ARM Cloud Radar Simulator Package for Global Climate Models Value-Added Product
Energy Technology Data Exchange (ETDEWEB)
Zhang, Yuying [North Carolina State Univ., Raleigh, NC (United States); Xie, Shaocheng [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2017-05-01
It has been challenging to directly compare U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility ground-based cloud radar measurements with climate model output because of limitations or features of the observing processes and the spatial gap between model and the single-point measurements. To facilitate the use of ARM radar data in numerical models, an ARM cloud radar simulator was developed to converts model data into pseudo-ARM cloud radar observations that mimic the instrument view of a narrow atmospheric column (as compared to a large global climate model [GCM] grid-cell), thus allowing meaningful comparison between model output and ARM cloud observations. The ARM cloud radar simulator value-added product (VAP) was developed based on the CloudSat simulator contained in the community satellite simulator package, the Cloud Feedback Model Intercomparison Project (CFMIP) Observation Simulator Package (COSP) (Bodas-Salcedo et al., 2011), which has been widely used in climate model evaluation with satellite data (Klein et al., 2013, Zhang et al., 2010). The essential part of the CloudSat simulator is the QuickBeam radar simulator that is used to produce CloudSat-like radar reflectivity, but is capable of simulating reflectivity for other radars (Marchand et al., 2009; Haynes et al., 2007). Adapting QuickBeam to the ARM cloud radar simulator within COSP required two primary changes: one was to set the frequency to 35 GHz for the ARM Ka-band cloud radar, as opposed to 94 GHz used for the CloudSat W-band radar, and the second was to invert the view from the ground to space so as to attenuate the beam correctly. In addition, the ARM cloud radar simulator uses a finer vertical resolution (100 m compared to 500 m for CloudSat) to resolve the more detailed structure of clouds captured by the ARM radars. The ARM simulator has been developed following the COSP workflow (Figure 1) and using the capabilities available in COSP
2000-01-01
The southeast part of the island of Hokkaido, Japan, is an area dominated by volcanoes and volcanic caldera. The active Usu Volcano is at the lower right edge of the circular Lake Toya-Ko and near the center of the image. The prominent cone above and to the left of the lake is Yotei Volcano with its summit crater. The city of Sapporo lies at the base of the mountains at the top of the image and the town of Yoichi -- the hometown of SRTM astronaut Mamoru Mohri -- is at the upper left edge. The bay of Uchiura-Wan takes up the lower center of the image. In this image, color represents elevation, from blue at the lowest elevations to white at the highest. The radar image has been overlaid to provide more details of the terrain. Due to a processing problem, an island in the center of this crater lake is missing and will be properly placed when further SRTM swaths are processed. The horizontal banding in this image is a processing artifact that will be removed when the navigation information collected by SRTM is fully calibrated. This image was acquired by the Shuttle Radar Topography Mission (SRTM) aboard the Space Shuttle Endeavour, launched on February 11, 2000. SRTM used the same radar instrument that comprised the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) that flew twice on the Space Shuttle Endeavour in 1994. SRTM was designed to collect three-dimensional measurements of the Earth's surface. To collect the 3-D data, engineers added a 60-meter-long (200-foot) mast, installed additional C-band and X-band antennas, and improved tracking and navigation devices. The mission is a cooperative project between the National Aeronautics and Space Administration (NASA), the National Imagery and Mapping Agency (NIMA) of the U.S. Department of Defense (DoD), and the German and Italian space agencies. It is managed by NASA's Jet Propulsion Laboratory, Pasadena, CA, for NASA's Earth Science Enterprise, Washington, DC. Size: 100 by 150 kilometers (62
Radar-acoustic interaction for IFF applications
Saffold, James A.; Williamson, Frank R.; Ahuja, Krishan; Stein, Lawrence R.; Muller, Marjorie
1998-08-01
This paper describes the results of an internal development program (IDP) No. 97-1 conducted from August 1-October 1 1996 at the Georgia Tech Research Institute. The IDP program was implemented to establish theoretical relationships and verify the interaction between X-band radar waves and ultrasonic acoustics. Low cost, off-the-shelf components were used for the verification in order to illustrate the cost savings potential of developing and utilizing these systems. The measured data was used to calibrate the developed models of the phenomenology and to support extrapolation for radar systems which can exploit these interactions. One such exploitation is for soldier identification IFF and radar taggant concepts. The described IDP program provided the phenomenological data which is being used to extrapolate concept system performances based on technological limitations and battlefield conditions for low cost IFF and taggant configurations.
Radar Signature Calculation Facility
Federal Laboratory Consortium — FUNCTION: The calculation, analysis, and visualization of the spatially extended radar signatures of complex objects such as ships in a sea multipath environment and...
Ka-Band ARM Zenith Radar Corrections Value-Added Product
Energy Technology Data Exchange (ETDEWEB)
Johnson, Karen [Brookhaven National Lab. (BNL), Upton, NY (United States); Toto, Tami [Brookhaven National Lab. (BNL), Upton, NY (United States); Giangrande, Scott [Brookhaven National Lab. (BNL), Upton, NY (United States)
2017-10-15
The KAZRCOR Value -added Product (VAP) performs several corrections to the ingested KAZR moments and also creates a significant detection mask for each radar mode. The VAP computes gaseous attenuation as a function of time and radial distance from the radar antenna, based on ambient meteorological observations, and corrects observed reflectivities for that effect. KAZRCOR also dealiases mean Doppler velocities to correct velocities whose magnitudes exceed the radar’s Nyquist velocity. Input KAZR data fields are passed through into the KAZRCOR output files, in their native time and range coordinates. Complementary corrected reflectivity and velocity fields are provided, along with a mask of significant detections and a number of data quality flags. This report covers the KAZRCOR VAP as applied to the original KAZR radars and the upgraded KAZR2 radars. Currently there are two separate code bases for the different radar versions, but once KAZR and KAZR2 data formats are harmonized, only a single code base will be required.
System aspects of the Indian MST radar facility
Viswanathan, G.
1986-01-01
One of the major objectives of the Indian Middle Atmosphere Program is to investigate the motions of the middle atmosphere on temporal and spatial scales and the interaction between the three height regions of the middle atmosphere. Realizing the fact that radar technique has proven to be a very powerful tool for the study of Earth atmosphere, the Indian Middle Atmosphere Program has recommended establishing a mesosphere-stratosphere-troposphere (MST) radar as a national facility for atmospheric research. The major landmarks in this attempt to setup the MST radar as a national facility are described.
Performance Prediction of Constrained Waveform Design for Adaptive Radar
2016-11-01
the famous Woodward quote, having a ubiquitous feeling for all radar waveform design (and performance prediction) researchers , that is found at the end...discuss research that develops performance prediction models to quantify the impact on SINR when an amplitude constraint is placed on a radar waveform...optimize the radar perfor- mance for the particular scenario and tasks. There have also been several survey papers on various topics in waveform design for
Bistatic Forward Scattering Radar Detection and Imaging
Directory of Open Access Journals (Sweden)
Hu Cheng
2016-06-01
Full Text Available Forward Scattering Radar (FSR is a special type of bistatic radar that can implement image detection, imaging, and identification using the forward scattering signals provided by the moving targets that cross the baseline between the transmitter and receiver. Because the forward scattering effect has a vital significance in increasing the targets’ Radar Cross Section (RCS, FSR is quite advantageous for use in counter stealth detection. This paper first introduces the front line technology used in forward scattering RCS, FSR detection, and Shadow Inverse Synthetic Aperture Radar (SISAR imaging and key problems such as the statistical characteristics of forward scattering clutter, accurate parameter estimation, and multitarget discrimination are then analyzed. Subsequently, the current research progress in FSR detection and SISAR imaging are described in detail, including the theories and experiments. In addition, with reference to the BeiDou navigation satellite, the results of forward scattering experiments in civil aircraft detection are shown. Finally, this paper considers future developments in FSR target detection and imaging and presents a new, promising technique for stealth target detection.
A 100,000 Scale Factor Radar Range.
Blanche, Pierre-Alexandre; Neifeld, Mark; Peyghambarian, Nasser
2017-12-19
The radar cross section of an object is an important electromagnetic property that is often measured in anechoic chambers. However, for very large and complex structures such as ships or sea and land clutters, this common approach is not practical. The use of computer simulations is also not viable since it would take many years of computational time to model and predict the radar characteristics of such large objects. We have now devised a new scaling technique to overcome these difficulties, and make accurate measurements of the radar cross section of large items. In this article we demonstrate that by reducing the scale of the model by a factor 100,000, and using near infrared wavelength, the radar cross section can be determined in a tabletop setup. The accuracy of the method is compared to simulations, and an example of measurement is provided on a 1 mm highly detailed model of a ship. The advantages of this scaling approach is its versatility, and the possibility to perform fast, convenient, and inexpensive measurements.
Slope stability radar for monitoring mine walls
Reeves, Bryan; Noon, David A.; Stickley, Glen F.; Longstaff, Dennis
2001-11-01
Determining slope stability in a mining operation is an important task. This is especially true when the mine workings are close to a potentially unstable slope. A common technique to determine slope stability is to monitor the small precursory movements, which occur prior to collapse. The slope stability radar has been developed to remotely scan a rock slope to continuously monitor the spatial deformation of the face. Using differential radar interferometry, the system can detect deformation movements of a rough wall with sub-millimeter accuracy, and with high spatial and temporal resolution. The effects of atmospheric variations and spurious signals can be reduced via signal processing means. The advantage of radar over other monitoring techniques is that it provides full area coverage without the need for mounted reflectors or equipment on the wall. In addition, the radar waves adequately penetrate through rain, dust and smoke to give reliable measurements, twenty-four hours a day. The system has been trialed at three open-cut coal mines in Australia, which demonstrated the potential for real-time monitoring of slope stability during active mining operations.
Armour, Patricia A; Nguyen, Linh M; Lutman, Michelle L; Middaugh, John P
2013-01-01
Infections caused by respiratory viruses are associated with recurrent epidemics and widespread morbidity and mortality. Routine surveillance of these pathogens is necessary to determine virus activity, monitor for changes in circulating strains, and plan for public health preparedness. The Southern Nevada Health District in Las Vegas, Nevada, recruited five pediatric medical practices to serve as sentinel sites for the Pediatric Early Warning Sentinel Surveillance (PEWSS) program. Sentinel staff collected specimens throughout the year from ill children who met the influenza-like illness case definition and submitted specimens to the Southern Nevada Public Health Laboratory for molecular testing for influenza and six non-influenza viruses. Laboratory results were analyzed and reported to the medical and general communities in weekly bulletins year-round. PEWSS data were also used to establish viral respiratory seasonal baselines and in influenza vaccination campaigns. The surveillance program was evaluated using the Centers for Disease Control and Prevention's (CDC's) Updated Guidelines for Evaluating Public Health Surveillance Systems. PEWSS met three of six program usefulness criteria and seven of nine surveillance system attributes, which exceeded the CDC Guidelines evaluation criteria for a useful and complete public health surveillance program. We found that PEWSS is a useful and complete public health surveillance system that is simple, flexible, accessible, and stable.
Development of a Software-Defined Radar
2017-10-01
disrupt desired radar operation. The cognitive radar system discussed herein mitigates the effects of RFI by sensing and adapting the transmitted...present received data, and plot processed data. Top right: Calculates a “ flicker ” rate caused by an unknown issue where blank data are received due to...and plot processed data. Top right: Calculates a “ flicker ” rate caused by an unknown issue where blank data are received due to missed
Surveillance of the environmental radioactivity
International Nuclear Information System (INIS)
Schneider, Th.; Gitzinger, C.; Jaunet, P.; Eberbach, F.; Clavel, B.; Hemidy, P.Y.; Perrier, G.; Kiper, Ch.; Peres, J.M.; Josset, M.; Calvez, M.; Leclerc, M.; Leclerc, E.; Aubert, C.; Levelut, M.N.; Debayle, Ch.; Mayer, St.; Renaud, Ph.; Leprieur, F.; Petitfrere, M.; Catelinois, O.; Monfort, M.; Baron, Y.; Target, A.
2008-01-01
The objective of these days was to present the organisation of the surveillance of the environmental radioactivity and to allow an experience sharing and a dialog on this subject between the different actors of the radiation protection in france. The different presentations were as follow: evolution and stakes of the surveillance of radioactivity in environment; the part of the European commission, regulatory aspects; the implementation of the surveillance: the case of Germany; Strategy and logic of environmental surveillance around the EDF national centers of energy production; environmental surveillance: F.B.F.C. site of Romans on Isere; steps of the implementation 'analysis for release decree at the F.B.F.C./C.E.R.C.A. laboratory of Romans; I.R.S.N. and the environmental surveillance: situation and perspectives; the part of a non institutional actor, the citizenship surveillance done by A.C.R.O.; harmonization of sampling methods: the results of inter operators G.T. sampling; sustainable observatory of environment: data traceability and samples conservation; inter laboratories tests of radioactivity measurements; national network of environmental radioactivity measurement: laboratories agreements; the networks of environmental radioactivity telemetry: modernization positioning; programme of observation and surveillance of surface environment and installations of the H.A.-M.A.V.L. project (high activity and long life medium activity); Evolution of radionuclides concentration in environment and adaptation of measurements techniques to the surveillance needs; the national network of radioactivity measurement in environment; modes of data restoration of surveillance: the results of the Loire environment pilot action; method of sanitary impacts estimation in the area of ionizing radiations; the radiological impact of atmospheric nuclear tests in French Polynesia; validation of models by the measure; network of measurement and alert management of the atmospheric
Inappropriate colonoscopic surveillance of hyperplastic polyps.
LENUS (Irish Health Repository)
Keane, R A
2011-11-15
Colonoscopic surveillance of hyperplastic polyps alone is controversial and may be inappropriate. The colonoscopy surveillance register at a university teaching hospital was audited to determine the extent of such hyperplastic polyp surveillance. The surveillance endoscopy records were reviewed, those patients with hyperplastic polyps were identified, their clinical records were examined and contact was made with each patient. Of the 483 patients undergoing surveillance for colonic polyps 113 (23%) had hyperplastic polyps alone on last colonoscopy. 104 patients remained after exclusion of those under appropriate surveillance. 87 of the 104 patients (84%) were successfully contacted. 37 patients (8%) were under appropriate colonoscopic surveillance for a significant family history of colorectal carcinoma. 50 (10%) patients with hyperplastic polyps alone and no other clinical indication for colonoscopic surveillance were booked for follow up colonoscopy. This represents not only a budgetary but more importantly a clinical opportunity cost the removal of which could liberate valuable colonoscopy time for more appropriate indications.
Overview of radar intra-pulse modulation recognition
Zang, Hanlin; Li, Yanling
2018-05-01
This paper introduces the current radar intra-pulse modulation method, describes the status quo and development direction of the intentional modulation and unintentional modulation in the pulse, and summarizes the existing problems and prospects for the future. Looking forward to the future, and providing a reference direction for the research on radar signal recognition in the next step.
ORF Alignment: NC_003078 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available lator, ArsR family protein [Sinorhizobium meliloti ... 1021] ... Length = 83 ... Query: 8 ... LSALADPTRRAIVARLAAGEATVNELAAPFEM...SLPAVSKHLKVLERAGLISRGRNAQWRP 67 ... LSALADPTRRAIVARLAAGEATVNELAAPFEMSLPAVSKHL...KVLERAGLISRGRNAQWRP Sbjct: 1 ... LSALADPTRRAIVARLAAGEATVNELAAPFEMSLPAVSKHLKVLERAGLISRGRNAQWRP 60 ...
The Role of Cloud and Precipitation Radars in Convoys and Constellations
Tanelli, Simone; Durden, Stephen L.; Im, Eastwood; Sadowy, Gregory A.
2013-01-01
We provide an overview of which benefits a radar, and only a radar, can provide to any constellation of satellites monitoring Earth's atmosphere; which aspects instead are most useful to complement a radar instrument to provide accurate and complete description of the state of the troposphere; and finally which goals can be given a lower priority assuming that other types of sensors will be flying in formation with a radar.
Energy Technology Data Exchange (ETDEWEB)
Koch, Mark William [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Steinbach, Ryan Matthew [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Moya, Mary M [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2015-10-01
Except in the most extreme conditions, Synthetic aperture radar (SAR) is a remote sensing technology that can operate day or night. A SAR can provide surveillance over a long time period by making multiple passes over a wide area. For object-based intelligence it is convenient to segment and classify the SAR images into objects that identify various terrains and man-made structures that we call “static features.” In this paper we introduce a novel SAR image product that captures how different regions decorrelate at different rates. Using superpixels and their first two moments we develop a series of one-class classification algorithms using a goodness-of-fit metric. P-value fusion is used to combine the results from different classes. We also show how to combine multiple one-class classifiers to get a confidence about a classification. This can be used by downstream algorithms such as a conditional random field to enforce spatial constraints.
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-03-01
Described herein are the results of the joint project between Japan and Indonesia to construct a new laser radar network system, which can three-dimensionally measure air pollution conditions in urban areas, in Djakarta. This joint project is implemented to elucidate the mechanisms involved in air pollution in the city, and thereby to contribute to environmental administration of Indonesia. This project is expected to give the basic approach to solution of environmental problems in urban areas, and eventually on a global scale, and hence to contribute to construction of the global network systems for environment-related information, which should be necessary in the near future. The (ODA Laser Radar Development Committee) is the deliberative body for the project, responsible for evaluating the project results. The project will be implemented on a 4-year plan from FY1993 to 1996. The activities in this year, the third year for the project, include on-the-spot survey, selection of the laser radar site, and development/improvement of the laser radar system. These results are described herein. (NEDO)
Space Radar Image of Manaus, Brazil
1999-01-01
These two images were created using data from the Spaceborne Imaging Radar-C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR). On the left is a false-color image of Manaus, Brazil acquired April 12, 1994, onboard space shuttle Endeavour. In the center of this image is the Solimoes River just west of Manaus before it combines with the Rio Negro to form the Amazon River. The scene is around 8 by 8 kilometers (5 by 5 miles) with north toward the top. The radar image was produced in L-band where red areas correspond to high backscatter at HH polarization, while green areas exhibit high backscatter at HV polarization. Blue areas show low backscatter at VV polarization. The image on the right is a classification map showing the extent of flooding beneath the forest canopy. The classification map was developed by SIR-C/X-SAR science team members at the University of California,Santa Barbara. The map uses the L-HH, L-HV, and L-VV images to classify the radar image into six categories: Red flooded forest Green unflooded tropical rain forest Blue open water, Amazon river Yellow unflooded fields, some floating grasses Gray flooded shrubs Black floating and flooded grasses Data like these help scientists evaluate flood damage on a global scale. Floods are highly episodic and much of the area inundated is often tree-covered. Spaceborne Imaging Radar-C and X-Synthetic Aperture Radar (SIR-C/X-SAR) is part of NASA's Mission to Planet Earth. The radars illuminate Earth with microwaves allowing detailed observations at any time, regardless of weather or sunlight conditions. SIR-C/X-SAR uses three microwave wavelengths: L-band (24 cm), C-band (6 cm) and X-band (3 cm). The multi-frequency data will be used by the international scientific community to better understand the global environment and how it is changing. The SIR-C/X-SAR data, complemented by aircraft and ground studies, will give scientists clearer insights into those environmental changes which are caused by nature and those
Directory of Open Access Journals (Sweden)
Yuxiang He
2018-01-01
Full Text Available This paper presents a new and enhanced fusion module for the Multi-Sensor Precipitation Estimator (MPE that would objectively blend real-time satellite quantitative precipitation estimates (SQPE with radar and gauge estimates. This module consists of a preprocessor that mitigates systematic bias in SQPE, and a two-way blending routine that statistically fuses adjusted SQPE with radar estimates. The preprocessor not only corrects systematic bias in SQPE, but also improves the spatial distribution of precipitation based on SQPE and makes it closely resemble that of radar-based observations. It uses a more sophisticated radar-satellite merging technique to blend preprocessed datasets, and provides a better overall QPE product. The performance of the new satellite-radar-gauge blending module is assessed using independent rain gauge data over a five-year period between 2003–2007, and the assessment evaluates the accuracy of newly developed satellite-radar-gauge (SRG blended products versus that of radar-gauge products (which represents MPE algorithm currently used in the NWS (National Weather Service operations over two regions: (I Inside radar effective coverage and (II immediately outside radar coverage. The outcomes of the evaluation indicate (a ingest of SQPE over areas within effective radar coverage improve the quality of QPE by mitigating the errors in radar estimates in region I; and (b blending of radar, gauge, and satellite estimates over region II leads to reduction of errors relative to bias-corrected SQPE. In addition, the new module alleviates the discontinuities along the boundaries of radar effective coverage otherwise seen when SQPE is used directly to fill the areas outside of effective radar coverage.
Recent Advances In Radar Polarimetry And Polarimetric SAR Interferometry
2007-02-01
progressing from “Classical X- Ray -Shadow-graphy” toward “functional Magnetic Resonant Imaging (fMRI)”. Classical Amplitude-Only Radar & SAR, and “Scalar...Chipman, R. A, and J. W. Morris, eds. 1990, Polarimetry: Radar, Infrared, Visible, Ultraviolet, X- Ray , Proc. SPIE-1317 ( also see SPIE Proc. 891... Oldenburg Verlag, Munich 1999, 88 p. [173] Mott, H. and W-M. Boerner, 1992, editors, “Radar Polarimetry, SPIE’s Annual Mtg., Polarimetry Conference
Rainfall estimation for hydrology using volumetric weather radar
Hazenberg, P.
2013-01-01
This thesis focuses specifically on weather radar rainfall measurements in strati form precipitation. In North-Western Europe this type of precipitation is most dominant in winter and leads to the largest hydro logical response of catchments. Unfortunately, the quality of uncorrected radar rainfall
Radar remote sensing to support tropical forest management
Sanden, van der J.J.
1997-01-01
This text describes an investigation into the potential of radar remote sensing for application to tropical forest management. The information content of various radar images is compared and assessed with regard to the information requirements of parties involved in tropical forest
Radar Remote Sensing of Agricultural Canopies : A Review
Steele-Dunne, S.C.; McNairn, Heather; Monsivais-Huertero, Alejandro; Judge, Jasmeet; Liu, Pang Wei; Papathanassiou, Kostas
2017-01-01
Observations from spaceborne radar contain considerable information about vegetation dynamics.The ability to extract this information could lead to improved soil moisture retrievals and the increased capacity to monitor vegetation phenology and water stress using radar data.The purpose of this
International Nuclear Information System (INIS)
Rao, V.; Abel, T.
2009-01-01
Disease surveillance systems are a critical component of an early warning system for public health agencies to prepare and respond to major public health catastrophes. With a growing emphasis for more robust early indicator and warning systems to track emerging and dangerous diseases of suspicious nature, considerable emphasis is now placed on deployment of more expanded electronic disease surveillance systems. The architectural considerations for bio surveillance information system are based on collection, analysis and dissemination of human, veterinary and agricultural related disease surveillance to broader regional areas likely to be affected in the event of an emerging disease, or due to bioterrorism and better coordinate plans, preparations and response by governmental agencies and multilateral forums. The diseases surveillance systems architectures by intent and design could as well support biological threat monitoring and threat reduction initiatives. As an illustrative sample set, this paper will describe the comparative informatics requirements for a disease surveillance systems developed by CSC for the US Centers for Diseases Control and Prevention (CDC) currently operational nationwide, and biological weapons threat assessment developed as part of the Threat Agent Detection and Response (TADR) Network under the US Biological Threat Reduction Program and deployed at Uzbekistan, Kazakhstan, Georgia, and Azerbaijan.(author)
Wind Turbine Radar Cross Section
Directory of Open Access Journals (Sweden)
David Jenn
2012-01-01
Full Text Available The radar cross section (RCS of a wind turbine is a figure of merit for assessing its effect on the performance of electronic systems. In this paper, the fundamental equations for estimating the wind turbine clutter signal in radar and communication systems are presented. Methods of RCS prediction are summarized, citing their advantages and disadvantages. Bistatic and monostatic RCS patterns for two wind turbine configurations, a horizontal axis three-blade design and a vertical axis helical design, are shown. The unique electromagnetic scattering features, the effect of materials, and methods of mitigating wind turbine clutter are also discussed.
Comparison of HF radar measurements with Eulerian and Lagrangian surface currents
Röhrs, Johannes; Sperrevik, Ann Kristin; Christensen, Kai Håkon; Broström, Göran; Breivik, Øyvind
2015-05-01
High-frequency (HF) radar-derived ocean currents are compared with in situ measurements to conclude if the radar observations include effects of surface waves that are of second order in the wave amplitude. Eulerian current measurements from a high-resolution acoustic Doppler current profiler and Lagrangian measurements from surface drifters are used as references. Directional wave spectra are obtained from a combination of pressure sensor data and a wave model. Our analysis shows that the wave-induced Stokes drift is not included in the HF radar-derived currents, that is, HF radars measure the Eulerian current. A disputed nonlinear correction to the phase velocity of surface gravity waves, which may affect HF radar signals, has a magnitude of about half the Stokes drift at the surface. In our case, this contribution by nonlinear dispersion would be smaller than the accuracy of the HF radar currents, hence no conclusion can be made. Finally, the analysis confirms that the HF radar data represent an exponentially weighted vertical average where the decay scale is proportional to the wavelength of the transmitted signal.
Imaging of concrete specimens using inverse synthetic aperture radar
International Nuclear Information System (INIS)
Rhim, Hong C.; Buyukozturk, Oral
2000-01-01
Radar Measurement results of laboratory size concrete specimens are presented in this paper. The purpose of this research work is to study various aspects of the radar method in an effort to develop an improved radar system for nondestructive testing of concrete structures. The radar system used for the study is an Inverse Synthetic Aperture Radar (ISAR), which is capable of transmitting microwaves at three different frequency ranges of 2-3.4, 3.4-5.8, and 8-12 GHz. Radar measurement setup is such that the radar is locates 14.4 m away from a concrete target to satisfy a far-field criterion. The concrete target is rotated for 20 degrees during the measurements for the generation of two-dimensional (cross-range) imagery. Concrete targets used for the measurements have the dimensions of 305 mm (width)x305 mm (height)x92 mm (thickness) with different inside configurations. Comparisons are made for dry and wet specimens, specimens with and without inclusions. Each specimen is made to model various situations that a concrete structure can have in reality. Results show that center frequency, frequency bandwidth, and polarization of the incident wave have different effects on identifying the thickness or inclusions inside concrete specimens. Results also suggest that a certain combination of measurement parameters is suitable for a specific application area. Thus, measurement parameters can be optimized for a specific problem. The findings are presented and discussed in details in the paper. Signal processing schemes implemented for imaging of the specimens are also discussed
Study on the shipboard radar reconnaissance equipment azimuth benchmark method
Liu, Zhenxing; Jiang, Ning; Ma, Qian; Liu, Songtao; Wang, Longtao
2015-10-01
The future naval battle will take place in a complex electromagnetic environment. Therefore, seizing the electromagnetic superiority has become the major actions of the navy. Radar reconnaissance equipment is an important part of the system to obtain and master battlefield electromagnetic radiation source information. Azimuth measurement function is one of the main function radar reconnaissance equipments. Whether the accuracy of direction finding meets the requirements, determines the vessels successful or not active jamming, passive jamming, guided missile attack and other combat missions, having a direct bearing on the vessels combat capabilities . How to test the performance of radar reconnaissance equipment, while affecting the task as little as possible is a problem. This paper, based on radar signal simulator and GPS positioning equipment, researches and experiments on one new method, which povides the azimuth benchmark required by the direction-finding precision test anytime anywhere, for the ships at jetty to test radar reconnaissance equipment performance in direction-finding. It provides a powerful means for the naval radar reconnaissance equipments daily maintenance and repair work[1].
Preliminary radar systems analysis for Venus orbiter missions
Brandenburg, R. K.; Spadoni, D. J.
1971-01-01
A short, preliminary analysis is presented of the problems involved in mapping the surface of Venus with radar from an orbiting spacecraft. Two types of radar, the noncoherent sidelooking and the focused synthetic aperture systems, are sized to fulfill two assumed levels of Venus exploration. The two exploration levels, regional and local, assumed for this study are based on previous Astro Sciences work (Klopp 1969). The regional level is defined as 1 to 3 kilometer spatial and 0.5 to 1 km vertical resolution of 100 percent 0 of the planet's surface. The local level is defined as 100 to 200 meter spatial and 50-10 m vertical resolution of about 100 percent of the surfAce (based on the regional survey). A 10cm operating frequency was chosen for both radar systems in order to minimize the antenna size and maximize the apparent radar cross section of the surface.
Venus radar mapper attitude reference quaternion
Lyons, D. T.
1986-01-01
Polynomial functions of time are used to specify the components of the quaternion which represents the nominal attitude of the Venus Radar mapper spacecraft during mapping. The following constraints must be satisfied in order to obtain acceptable synthetic array radar data: the nominal attitude function must have a large dynamic range, the sensor orientation must be known very accurately, the attitude reference function must use as little memory as possible, and the spacecraft must operate autonomously. Fitting polynomials to the components of the desired quaternion function is a straightforward method for providing a very dynamic nominal attitude using a minimum amount of on-board computer resources. Although the attitude from the polynomials may not be exactly the one requested by the radar designers, the polynomial coefficients are known, so they do not contribute to the attitude uncertainty. Frequent coefficient updates are not required, so the spacecraft can operate autonomously.
Micropower impulse radar technology and applications
Energy Technology Data Exchange (ETDEWEB)
Mast, J., LLNL
1998-04-15
The LLNL-developed Micropower Impulse Radar (MIR) technology has quickly gone from laboratory concept to embedded circuitry in numerous government and commercial systems in the last few years[l]. The main ideas behind MIR, invented by T. McEwan in the Laser Program, are the generation and detection systems for extremely low- power ultra-wideband pulses in the gigaHertz regime using low-cost components. These ideas, coupled with new antenna systems, timing and radio-frequency (RF) circuitry, computer interfaces, and signal processing, have provided the catalyst for a new generation of compact radar systems. Over the past several years we have concentrated on a number of applications of MIR which address a number of remote-sensing applications relevant to emerging programs in defense, transportation, medical, and environmental research. Some of the past commercial successes have been widely publicized [2] and are only now starting to become available for market. Over 30 patents have been filed and over 15 licenses have been signed on various aspects of the MIR technology. In addition, higher performance systems are under development for specific laboratory programs and government reimbursables. The MIR is an ultra- wideband, range-gated radar system that provides the enabling hardware technology used in the research areas mentioned above. It has numerous performance parameters that can be Selected by careful design to fit the requirements. We have improved the baseline, short- range, MIR system to demonstrate its effectiveness. The radar operates over the hand from approximately I to 4 GHz with pulse repetition frequencies up to 10 MHz. It provides a potential range resolution of I cm at ranges of greater than 20 m. We have developed a suite of algorithms for using MIR for image formation. These algorithms currently support Synthetic aperture and multistate array geometries. This baseline MIR radar imaging system has been used for several programmatic applications.
Radar Search and Detection With the CASA 212 S43 Aircraft
National Research Council Canada - National Science Library
Borges, Jose M
2004-01-01
.... The model can use given periscope radar cross section data, or roughly calculate radar cross section given assumptions about exposed periscope height above the sea-surface and sea-state conditions. Submarine evasion due to radar counter-detection is also modeled.
77 FR 3323 - Airborne Radar Altimeter Equipment (For Air Carrier Aircraft)
2012-01-23
... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Airborne Radar Altimeter Equipment... to cancel Technical Standard Order (TSO)-C67, Airborne Radar Altimeter Equipment (For Air Carrier Aircraft). SUMMARY: This notice announces the FAA's intent to cancel TSO-C67, Airborne Radar Altimeter...
Autonomous Non-Linear Classification of LPI Radar Signal Modulations
National Research Council Canada - National Science Library
Gulum, Taylan O
2007-01-01
...) radar modulations is investigated. A software engineering architecture that allows a full investigation of various preprocessing algorithms and classification techniques is applied to a database of important LPI radar waveform...
ORF Alignment: NC_005085 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... transcriptional regulator, ArsR family [Chromobacterium ... violaceum ATCC 12472] ... Length = 88 ... Query: 1 ... MTDAH...LPDISRLASLLADPGRALMLLLMLDGRSYPASELAQHAGLSAQAASNHLAKLLQG 60 ... MTDAH...LPDISRLASLLADPGRALMLLLMLDGRSYPASELAQHAGLSAQAASNHLAKLLQG Sbjct: 1 ... MTDAHLPDISRLASLLADPGRALMLLLMLDGRSYPASELAQHAGLSAQAASNHLAKLLQG 60 ...
Surveillance of antibiotic resistance
Johnson, Alan P.
2015-01-01
Surveillance involves the collection and analysis of data for the detection and monitoring of threats to public health. Surveillance should also inform as to the epidemiology of the threat and its burden in the population. A further key component of surveillance is the timely feedback of data to stakeholders with a view to generating action aimed at reducing or preventing the public health threat being monitored. Surveillance of antibiotic resistance involves the collection of antibiotic susceptibility test results undertaken by microbiology laboratories on bacteria isolated from clinical samples sent for investigation. Correlation of these data with demographic and clinical data for the patient populations from whom the pathogens were isolated gives insight into the underlying epidemiology and facilitates the formulation of rational interventions aimed at reducing the burden of resistance. This article describes a range of surveillance activities that have been undertaken in the UK over a number of years, together with current interventions being implemented. These activities are not only of national importance but form part of the international response to the global threat posed by antibiotic resistance. PMID:25918439
The Next Generation Airborne Polarimetric Doppler Radar
Vivekanandan, J.; Lee, Wen-Chau; Loew, Eric; Salazar, Jorge; Chandrasekar, V.
2013-04-01
NCAR's Electra Doppler radar (ELDORA) with a dual-beam slotted waveguide array using dual-transmitter, dual-beam, rapid scan and step-chirped waveform significantly improved the spatial scale to 300m (Hildebrand et al. 1996). However, ELDORA X-band radar's penetration into precipitation is limited by attenuation and is not designed to collect polarimetric measurements to remotely estimate microphysics. ELDORA has been placed on dormancy because its airborne platform (P3 587) was retired in January 2013. The US research community has strongly voiced the need to continue measurement capability similar to the ELDORA. A critical weather research area is quantitative precipitation estimation/forecasting (QPE/QPF). In recent years, hurricane intensity change involving eye-eyewall interactions has drawn research attention (Montgomery et al., 2006; Bell and Montgomery, 2006). In the case of convective precipitation, two issues, namely, (1) when and where convection will be initiated, and (2) determining the organization and structure of ensuing convection, are key for QPF. Therefore collocated measurements of 3-D winds and precipitation microphysics are required for achieving significant skills in QPF and QPE. Multiple radars in dual-Doppler configuration with polarization capability estimate dynamical and microphysical characteristics of clouds and precipitation are mostly available over land. However, storms over complex terrain, the ocean and in forest regions are not observable by ground-based radars (Bluestein and Wakimoto, 2003). NCAR/EOL is investigating potential configurations for the next generation airborne radar that is capable of retrieving dynamic and microphysical characteristics of clouds and precipitation. ELDORA's slotted waveguide array radar is not compatible for dual-polarization measurements. Therefore, the new design has to address both dual-polarization capability and platform requirements to replace the ELDORA system. NCAR maintains a C-130
Discussion on informatization teaching of certain radar transmitter
Liang, Guanhui; Lv, Guizhou; Meng, Yafeng
2017-04-01
With the development of informatization, the traditional teaching method of certain radar transmitter is more and more difficult to meet the need of cultivating new type of high-quality military talents. This paper first analyzes the problems traditional teaching method of certain radar transmitter, and then puts forward the strategy of informatization teaching, and finally elaborates the concrete steps and contents of informatization teaching. Using the multimedia maintenance training system, information simulation training system and network courses and other informatization means, effectively improves the master degree to radar transmitter by trainees, but also lays a good foundation for repair in the next step.
The Radar locates spills of Petroleum Sea inside
International Nuclear Information System (INIS)
Acantland Sylvie; De Biegert
1996-01-01
The satellite information is helping to the petroleum geologists to determine the potential of new petroleum reserves all over the world. Particularly, radar technology recently available is providing an increased dependability, an improved effectiveness of costs and a quicker access to the information that can be vital to detect and to supervise the petroleum spills that naturally happen. Several projects have been carrying out to evaluate the best use in the technology of the satellite information, specifically radar information for satellite, in sea inside exploration. The authors comment about of the kindness and benefits in the radar use
Radar observation of the equatorial counter-electrojet
International Nuclear Information System (INIS)
Hanuise, C.; Crochet, M.; Gouin, P.; Ogubazghi, Ghebrebrhan
1979-01-01
Electron drift velocity in the equatorial electrojet has been measured for a few years by coherent radar techniques in Africa. For the first time such measurements were performed during a strong reversal of the ionospheric current dubbed 'counter-electrojet'. These observations agree with the theories of the plasma instabilities at the origin of the electron density irregularities giving the radar echoes
Digital Beamforming Synthetic Aperture Radar Developments at NASA Goddard Space Flight Center
Rincon, Rafael; Fatoyinbo, Temilola; Osmanoglu, Batuhan; Lee, Seung Kuk; Du Toit, Cornelis F.; Perrine, Martin; Ranson, K. Jon; Sun, Guoqing; Deshpande, Manohar; Beck, Jaclyn;
2016-01-01
Advanced Digital Beamforming (DBF) Synthetic Aperture Radar (SAR) technology is an area of research and development pursued at the NASA Goddard Space Flight Center (GSFC). Advanced SAR architectures enhances radar performance and opens a new set of capabilities in radar remote sensing. DBSAR-2 and EcoSAR are two state-of-the-art radar systems recently developed and tested. These new instruments employ multiple input-multiple output (MIMO) architectures characterized by multi-mode operation, software defined waveform generation, digital beamforming, and configurable radar parameters. The instruments have been developed to support several disciplines in Earth and Planetary sciences. This paper describes the radars advanced features and report on the latest SAR processing and calibration efforts.
Piñeros, Marion; Znaor, Ariana; Mery, Les; Bray, Freddie
2017-01-01
The growing burden of cancer among several major noncommunicable diseases (NCDs) requires national implementation of tailored public health surveillance. For many emerging economies where emphasis has traditionally been placed on the surveillance of communicable diseases, it is critical to understand the specificities of NCD surveillance and, within it, of cancer surveillance. We propose a general framework for cancer surveillance that permits monitoring the core components of cancer control. We examine communalities in approaches to the surveillance of other major NCDs as well as communicable diseases, illustrating key differences in the function, coverage, and reporting in each system. Although risk factor surveys and vital statistics registration are the foundation of surveillance of NCDs, population-based cancer registries play a unique fundamental role specific to cancer surveillance, providing indicators of population-based incidence and survival. With an onus now placed on governments to collect these data as part of the monitoring of NCD targets, the integration of cancer registries into existing and future NCD surveillance strategies is a vital requirement in all countries worldwide. The Global Initiative for Cancer Registry Development, endorsed by the World Health Organization, provides a means to enhance cancer surveillance capacity in low- and middle-income countries. © The Author 2017. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Aramini Jeff
2006-04-01
Full Text Available Abstract Background An extensive West Nile virus surveillance program of dead birds, mosquitoes, horses, and human infection has been launched as a result of West Nile virus first being reported in Canada in 2001. Some desktop and web GIS have been applied to West Nile virus dead bird surveillance. There have been urgent needs for a comprehensive GIS services and real-time surveillance. Results A pilot system was developed to integrate real-time surveillance, real-time GIS, and Open GIS technology in order to enhance West Nile virus dead bird surveillance in Canada. Driven and linked by the newly developed real-time web GIS technology, this integrated real-time surveillance system includes conventional real-time web-based surveillance components, integrated real-time GIS components, and integrated Open GIS components. The pilot system identified the major GIS functions and capacities that may be important to public health surveillance. The six web GIS clients provide a wide range of GIS tools for public health surveillance. The pilot system has been serving Canadian national West Nile virus dead bird surveillance since 2005 and is adaptable to serve other disease surveillance. Conclusion This pilot system has streamlined, enriched and enhanced national West Nile virus dead bird surveillance in Canada, improved productivity, and reduced operation cost. Its real-time GIS technology, static map technology, WMS integration, and its integration with non-GIS real-time surveillance system made this pilot system unique in surveillance and public health GIS.
Use of radars to monitor stream discharge by noncontact methods
Costa, J.E.; Cheng, R.T.; Haeni, F.P.; Melcher, N.; Spicer, K.R.; Hayes, E.; Plant, W.; Hayes, K.; Teague, C.; Barrick, D.
2006-01-01
Conventional measurements of river flows are costly, time‐consuming, and frequently dangerous. This report evaluates the use of a continuous wave microwave radar, a monostatic UHF Doppler radar, a pulsed Doppler microwave radar, and a ground‐penetrating radar to measure river flows continuously over long periods and without touching the water with any instruments. The experiments duplicate the flow records from conventional stream gauging stations on the San Joaquin River in California and the Cowlitz River in Washington. The purpose of the experiments was to directly measure the parameters necessary to compute flow: surface velocity (converted to mean velocity) and cross‐sectional area, thereby avoiding the uncertainty, complexity, and cost of maintaining rating curves. River channel cross sections were measured by ground‐penetrating radar suspended above the river. River surface water velocity was obtained by Bragg scattering of microwave and UHF Doppler radars, and the surface velocity data were converted to mean velocity on the basis of detailed velocity profiles measured by current meters and hydroacoustic instruments. Experiments using these radars to acquire a continuous record of flow were conducted for 4 weeks on the San Joaquin River and for 16 weeks on the Cowlitz River. At the San Joaquin River the radar noncontact measurements produced discharges more than 20% higher than the other independent measurements in the early part of the experiment. After the first 3 days, the noncontact radar discharge measurements were within 5% of the rating values. On the Cowlitz River at Castle Rock, correlation coefficients between the USGS stream gauging station rating curve discharge and discharge computed from three different Doppler radar systems and GPR data over the 16 week experiment were 0.883, 0.969, and 0.992. Noncontact radar results were within a few percent of discharge values obtained by gauging station, current meter, and hydroacoustic methods
Radar cross section measurements using terahertz waves
DEFF Research Database (Denmark)
Iwaszczuk, Krzysztof; Heiselberg, Henning; Jepsen, Peter Uhd
2010-01-01
Radar cross sections at terahertz frequencies are measured on scale models of aircrafts. A time domain broadband THz system generates freely propagating THz pulses measured with sub-picosecond time resolution. The THz radiation is generated using fs laser pulses by optical rectification...... in order to measure realistic radar cross sections. RCS polar and azimuthal angle plots of F-16 and F-35 are presented....... in a lithium niobate crystal with application of the tilted wave front method, resulting in high electric field THz pulses with a broad band spectrum from 100 GHz up to 4 THz. The corresponding wave lengths are two orders of magnitude smaller than normal radars and we therefore use scale models of size 5-10 cm...
Tenth Biennial Coherent Laser Radar Technology and Applications Conference
Kavaya, Michael J. (Compiler)
1999-01-01
The tenth conference on coherent laser radar technology and applications is the latest in a series beginning in 1980 which provides a forum for exchange of information on recent events current status, and future directions of coherent laser radar (or lidar or lader) technology and applications. This conference emphasizes the latest advancement in the coherent laser radar field, including theory, modeling, components, systems, instrumentation, measurements, calibration, data processing techniques, operational uses, and comparisons with other remote sensing technologies.
Apodization of spurs in radar receivers using multi-channel processing
Doerry, Armin W.; Bickel, Douglas L.
2017-11-21
The various technologies presented herein relate to identification and mitigation of spurious energies or signals (aka "spurs") in radar imaging. Spurious energy in received radar data can be a consequence of non-ideal component and circuit behavior. Such behavior can result from I/Q imbalance, nonlinear component behavior, additive interference (e.g. cross-talk, etc.), etc. The manifestation of the spurious energy in a radar image (e.g., a range-Doppler map) can be influenced by appropriate pulse-to-pulse phase modulation. Comparing multiple images which have been processed using the same data but of different signal paths and modulations enables identification of undesired spurs, with subsequent cropping or apodization of the undesired spurs from a radar image. Spurs can be identified by comparison with a threshold energy. Removal of an undesired spur enables enhanced identification of true targets in a radar image.
Ku-Band radar penetration into Snow over Arctic Sea Ice
DEFF Research Database (Denmark)
Hendricks, Stefan; Stenseng, Lars; Helm, Veit
is the snow/air interface, whereas radar waves interact with the variable physical properties of the snow cover on the Arctic sea ice. In addition, radar elevation measurements may vary for different retracker algorithms, which determine the track point of the scattered echo power distribution. Since accurate...... knowledge of the reflection horizon is critical for sea ice thickness retrieval, validation data is necessary to investigate the penetration of radar waves into the snow for the upcoming CryoSat-2 mission. Furthermore, the combination of both optical and RF wavelengths might be used to derive snow thickness......, if radar altimeters are capable of measuring the distance to the snow-ice interface reliably. We present the results of aircraft campaigns in the Arctic with a scanning laser altimeter and the Airborne SAR/Interferometric Radar Altimeter System (ASIRAS) of the European Space Agency. The elevation...
Development and Application of integrated monitoring platform for the Doppler Weather SA-BAND Radar
Zhang, Q.; Sun, J.; Zhao, C. C.; Chen, H. Y.
2017-10-01
The doppler weather SA-band radar is an important part of modern meteorological observation methods, monitoring the running status of radar and the data transmission is important.This paper introduced the composition of radar system and classification of radar data,analysed the characteristics and laws of the radar when is normal or abnormal. Using Macromedia Dreamweaver and PHP, developed the integrated monitoring platform for the doppler weather SA-band radar which could monitor the real-time radar system running status and important performance indicators such as radar power,status parameters and others on Web page,and when the status is abnormal it will trigger the audio alarm.
Laser radar IV; Proceedings of the Meeting, Orlando, FL, Mar. 29, 30, 1989
Becherer, Richard J.
1989-09-01
Various papers on laser radars are presented. Individual topics considered include: frequency chirp of a low-pressure hybrid TE CO2 laser, design of a high-power isotopic CO2 laser amplifier, monolithic beam steering for large aperture laser radar, laser radar receiver using a Digicon detector, all-solid-state CO2 laser driver, noise in an acoustooptic-modulated laser source, laser signature prediction using the Value computer program, laser radar acquisition and tracking, concept of a moving target indicator search ladar, system design philosophy for laser radar wavelength determination, imaging three-frequency CO2 laser radar, backscatter-modulation semiconductor laser radar, three-dimensional imaging using a single laser pulse, design and manufacture of a high-resolution laser radar scanner, calculations of vibrational signatures for coherent ladar, coherent subaperture ultraviolet imagery, and range-Doppler resolution degradation associated with amplitude distortion.
Directory of Open Access Journals (Sweden)
T. Rigo
2010-09-01
Full Text Available Monitoring thunderstorms activity is an essential part of operational weather surveillance given their potential hazards, including lightning, hail, heavy rainfall, strong winds or even tornadoes. This study has two main objectives: firstly, the description of a methodology, based on radar and total lightning data to characterise thunderstorms in real-time; secondly, the application of this methodology to 66 thunderstorms that affected Catalonia (NE Spain in the summer of 2006. An object-oriented tracking procedure is employed, where different observation data types generate four different types of objects (radar 1-km CAPPI reflectivity composites, radar reflectivity volumetric data, cloud-to-ground lightning data and intra-cloud lightning data. In the framework proposed, these objects are the building blocks of a higher level object, the thunderstorm.
The methodology is demonstrated with a dataset of thunderstorms whose main characteristics, along the complete life cycle of the convective structures (development, maturity and dissipation, are described statistically. The development and dissipation stages present similar durations in most cases examined. On the contrary, the duration of the maturity phase is much more variable and related to the thunderstorm intensity, defined here in terms of lightning flash rate. Most of the activity of IC and CG flashes is registered in the maturity stage. In the development stage little CG flashes are observed (2% to 5%, while for the dissipation phase is possible to observe a few more CG flashes (10% to 15%. Additionally, a selection of thunderstorms is used to examine general life cycle patterns, obtained from the analysis of normalized (with respect to thunderstorm total duration and maximum value of variables considered thunderstorm parameters. Among other findings, the study indicates that the normalized duration of the three stages of thunderstorm life cycle is similar in most thunderstorms
Rigo, T.; Pineda, N.; Bech, J.
2010-09-01
Monitoring thunderstorms activity is an essential part of operational weather surveillance given their potential hazards, including lightning, hail, heavy rainfall, strong winds or even tornadoes. This study has two main objectives: firstly, the description of a methodology, based on radar and total lightning data to characterise thunderstorms in real-time; secondly, the application of this methodology to 66 thunderstorms that affected Catalonia (NE Spain) in the summer of 2006. An object-oriented tracking procedure is employed, where different observation data types generate four different types of objects (radar 1-km CAPPI reflectivity composites, radar reflectivity volumetric data, cloud-to-ground lightning data and intra-cloud lightning data). In the framework proposed, these objects are the building blocks of a higher level object, the thunderstorm. The methodology is demonstrated with a dataset of thunderstorms whose main characteristics, along the complete life cycle of the convective structures (development, maturity and dissipation), are described statistically. The development and dissipation stages present similar durations in most cases examined. On the contrary, the duration of the maturity phase is much more variable and related to the thunderstorm intensity, defined here in terms of lightning flash rate. Most of the activity of IC and CG flashes is registered in the maturity stage. In the development stage little CG flashes are observed (2% to 5%), while for the dissipation phase is possible to observe a few more CG flashes (10% to 15%). Additionally, a selection of thunderstorms is used to examine general life cycle patterns, obtained from the analysis of normalized (with respect to thunderstorm total duration and maximum value of variables considered) thunderstorm parameters. Among other findings, the study indicates that the normalized duration of the three stages of thunderstorm life cycle is similar in most thunderstorms, with the longest
77 FR 21834 - Airborne Radar Altimeter Equipment (For Air Carrier Aircraft)
2012-04-11
... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Airborne Radar Altimeter Equipment... Technical Standard Order (TSO)-C67, Airborne Radar Altimeter Equipment (For Air Carrier Aircraft). SUMMARY: This is a confirmation notice of the cancellation of TSO-C67, Airborne Radar Altimeter Equipment (For...
REAL - Ensemble radar precipitation estimation for hydrology in a mountainous region
Germann, Urs; Berenguer Ferrer, Marc; Sempere Torres, Daniel; Zappa, Massimiliano
2009-01-01
An elegant solution to characterise the residual errors in radar precipitation estimates is to generate an ensemble of precipitation fields. The paper proposes a radar ensemble generator designed for usage in the Alps using LU decomposition (REAL), and presents first results from a real-time implementation coupling the radar ensemble with a semi-distributed rainfall–runoff model for flash flood modelling in a steep Alpine catchment. Each member of the radar ensemble is a possible realisati...
The Goldstone solar system radar: A science instrument for planetary research
Dvorsky, J. D.; Renzetti, N. A.; Fulton, D. E.
1992-01-01
The Goldstone Solar System Radar (GSSR) station at NASA's Deep Space Communications Complex in California's Mojave Desert is described. A short chronological account of the GSSR's technical development and scientific discoveries is given. This is followed by a basic discussion of how information is derived from the radar echo and how the raw information can be used to increase understanding of the solar system. A moderately detailed description of the radar system is given, and the engineering performance of the radar is discussed. The operating characteristics of the Arcibo Observatory in Puerto Rico are briefly described and compared with those of the GSSR. Planned and in-process improvements to the existing radar, as well as the performance of a hypothetical 128-m diameter antenna radar station, are described. A comprehensive bibliography of referred scientific and engineering articles presenting results that depended on data gathered by the instrument is provided.
Specification for a surface-search radar-detection-range model
Hattan, Claude P.
1990-09-01
A model that predicts surface-search radar detection range versus a variety of combatants has been developed at the Naval Ocean Systems Center. This model uses a simplified ship radar cross section (RCS) model and the U.S. Navy Oceanographic and Atmospheric Mission Library Standard Electromagnetic Propagation Model. It provides the user with a method of assessing the effects of the environment of the performance of a surface-search radar system. The software implementation of the model is written in ANSI FORTRAN 77, with MIL-STD-1753 extensions. The program provides the user with a table of expected detection ranges when the model is supplied with the proper environmental radar system inputs. The target model includes the variation in RCS as a function of aspect angle and the distribution of reflected radar energy as a function of height above the waterline. The modeled propagation effects include refraction caused by a multisegmented refractivity profile, sea-surface roughness caused by local winds, evaporation ducting, and surface-based ducts caused by atmospheric layering.
Radar and infrared remote sensing of terrain, water resources, arctic sea ice, and agriculture
Biggs, A. W.
1983-01-01
Radar range measurements, basic waveforms of radar systems, and radar displays are initially described. These are followed by backscatter from several types of terrain and vegetation as a function of frequency and grazing angle. Analytical models for this backscatter include the facet models of radar return, with range-angle, velocity-range, velocity-angle, range, velocity, and angular only discriminations. Several side-looking airborne radar geometries are presented. Radar images of Arctic sea ice, fresh water lake ice, cloud-covered terrain, and related areas are presented to identify applications of radar imagery. Volume scatter models are applied to radar imagery from alpine snowfields. Short pulse ice thickness radar for subsurface probes is discussed in fresh-water ice and sea ice detection. Infrared scanners, including multispectral, are described. Diffusion of cold water into a river, Arctic sea ice, power plant discharges, volcanic heat, and related areas are presented in thermal imagery. Multispectral radar and infrared imagery are discussed, with comparisons of photographic, infrared, and radar imagery of the same terrain or subjects.
Broadband Counter-Wound Spiral Antenna for Subsurface Radar Applications
National Research Council Canada - National Science Library
Yong, Lim
2003-01-01
Subsurface radar also known as ground-penetrating radar is increasingly being used for the detection and location of buried objects such as mines and structure that are found within the upper regions...
Multi-Input Multi-Output (MIMO) Radar - Diversity Means Superiority
National Research Council Canada - National Science Library
Li, Jian
2008-01-01
.... It also uses multiple antennas to receive the reflected signals. It has been shown that by exploiting this waveform diversity, MIMO radar can overcome performance degradations caused by radar cross section (RCS...
Regime-dependence of Impacts of Radar Rainfall Data Assimilation
Craig, G. C.; Keil, C.
2009-04-01
Experience from the first operational trials of assimilation of radar data in kilometre scale numerical weather prediction models (operating without cumulus parameterisation) shows that the positive impact of the radar data on convective precipitation forecasts typically decay within a few hours, although certain cases show much longer impacts. Here the impact time of radar data assimilation is related to characteristics of the meteorological environment. This QPF uncertainty is investigated using an ensemble of 10 forecasts at 2.8 km horizontal resolution based on different initial and boundary conditions from a global forecast ensemble. Control forecasts are compared with forecasts where radar reflectivity data is assimilated using latent heat nudging. Examination of different cases of convection in southern Germany suggests that the forecasts can be separated into two regimes using a convective timescale. Short impact times are associated with short convective timescales that are characteristic of equilibrium convection. In this regime the statistical properties of the convection are constrained by the large-scale forcing, and effects of the radar data are lost within a few hours as the convection rapidly returns to equilibrium. When the convective timescale is large (non-equilibrium conditions), the impact of the radar data is longer since convective systems are triggered by the latent heat nudging and are able to persist for many hours in the very unstable conditions present in these cases.
Water stress detection in the Amazon using radar
van Emmerik, Tim; Steele-Dunne, Susan; Paget, Aaron; Oliveira, Rafael S.; Bittencourt, Paulo R. L.; Barros, Fernanda de V.; van de Giesen, Nick
2017-07-01
The Amazon rainforest plays an important role in the global water and carbon cycle, and though it is predicted to continue drying in the future, the effect of drought remains uncertain. Developments in remote sensing missions now facilitate large-scale observations. The RapidScat scatterometer (Ku band) mounted on the International Space Station observes the Earth in a non-Sun-synchronous orbit, which allows for studying changes in the diurnal cycle of radar backscatter over the Amazon. Diurnal cycles in backscatter are significantly affected by the state of the canopy, especially during periods of increased water stress. We use RapidScat backscatter time series and water deficit measurements from dendrometers in 20 trees during a 9 month period to relate variations in backscatter to increased tree water deficit. Morning radar bacskcatter dropped significantly with increased tree water deficit measured with dendrometers. This provides unique observational evidence that demonstrates the sensitivity of radar backscatter to vegetation water stress, highlighting the potential of drought detection and monitoring using radar.
Impact of Shutting Down En Route Primary Radars within CONUS Interior
1993-06-01
Remote Control Interface Unit ( RCIU ) RMS software for the primary radar will be deleted. Any dependency of the secondary radar on the primary radar data...Generators RCIU Remote Control and Interface Unit RMM Remote Monitoring and Maintenance RMMS Remote Maintenance Monitoring System RMS Remote Maintenance
Coherent Doppler Laser Radar: Technology Development and Applications
Kavaya, Michael J.; Arnold, James E. (Technical Monitor)
2000-01-01
NASA's Marshall Space Flight Center has been investigating, developing, and applying coherent Doppler laser radar technology for over 30 years. These efforts have included the first wind measurement in 1967, the first airborne flights in 1972, the first airborne wind field mapping in 1981, and the first measurement of hurricane eyewall winds in 1998. A parallel effort at MSFC since 1982 has been the study, modeling and technology development for a space-based global wind measurement system. These endeavors to date have resulted in compact, robust, eyesafe lidars at 2 micron wavelength based on solid-state laser technology; in a factor of 6 volume reduction in near diffraction limited, space-qualifiable telescopes; in sophisticated airborne scanners with full platform motion subtraction; in local oscillator lasers capable of rapid tuning of 25 GHz for removal of relative laser radar to target velocities over a 25 km/s range; in performance prediction theory and simulations that have been validated experimentally; and in extensive field campaign experience. We have also begun efforts to dramatically improve the fundamental photon efficiency of the laser radar, to demonstrate advanced lower mass laser radar telescopes and scanners; to develop laser and laser radar system alignment maintenance technologies; and to greatly improve the electrical efficiency, cooling technique, and robustness of the pulsed laser. This coherent Doppler laser radar technology is suitable for high resolution, high accuracy wind mapping; for aerosol and cloud measurement; for Differential Absorption Lidar (DIAL) measurements of atmospheric and trace gases; for hard target range and velocity measurement; and for hard target vibration spectra measurement. It is also suitable for a number of aircraft operations applications such as clear air turbulence (CAT) detection; dangerous wind shear (microburst) detection; airspeed, angle of attack, and sideslip measurement; and fuel savings through
NOAA Next Generation Radar (NEXRAD) Level 2 Base Data
National Oceanic and Atmospheric Administration, Department of Commerce — This dataset consists of Level II weather radar data collected from Next-Generation Radar (NEXRAD) stations located in the contiguous United States, Alaska, Hawaii,...
Modified echo peak correction for radial acquisition regime (RADAR).
Takizawa, Masahiro; Ito, Taeko; Itagaki, Hiroyuki; Takahashi, Tetsuhiko; Shimizu, Kanichirou; Harada, Junta
2009-01-01
Because radial sampling imposes many limitations on magnetic resonance (MR) imaging hardware, such as on the accuracy of the gradient magnetic field or the homogeneity of B(0), some correction of the echo signal is usually needed before image reconstruction. In our previous study, we developed an echo-peak-shift correction (EPSC) algorithm not easily affected by hardware performance. However, some artifacts remained in lung imaging, where tissue is almost absent, or in cardiac imaging, which is affected by blood flow. In this study, we modified the EPSC algorithm to improve the image quality of the radial aquisition regime (RADAR) and expand its application sequences. We assumed the artifacts were mainly caused by errors in the phase map for EPSC and used a phantom on a 1.5-tesla (T) MR scanner to investigate whether to modify the EPSC algorithm. To evaluate the effectiveness of EPSC, we compared results from T(1)- and T(2)-weighted images of a volunteer's lung region using the current and modified EPSC. We then applied the modified EPSC to RADAR spin echo (SE) and RADAR balanced steady-state acquisition with rewound gradient echo (BASG) sequence. The modified EPSC reduced phase discontinuity in the reference data used for EPSC and improved visualization of blood vessels in the lungs. Motion and blood flow caused no visible artifacts in the resulting images in either RADAR SE or RADAR BASG sequence. Use of the modified EPSC eliminated artifacts caused by signal loss in the reference data for EPSC. In addition, the modified EPSC was applied to RADAR SE and RADAR BASG sequences.
Modified echo peak correction for radial acquisition regime (RADAR)
International Nuclear Information System (INIS)
Takizawa, Masahiro; Ito, Taeko; Itagaki, Hiroyuki; Takahashi, Tetsuhiko; Shimizu, Kanichirou; Harada, Junta
2009-01-01
Because radial sampling imposes many limitations on magnetic resonance (MR) imaging hardware, such as on the accuracy of the gradient magnetic field or the homogeneity of B 0 , some correction of the echo signal is usually needed before image reconstruction. In our previous study, we developed an echo-peak-shift correction (EPSC) algorithm not easily affected by hardware performance. However, some artifacts remained in lung imaging, where tissue is almost absent, or in cardiac imaging, which is affected by blood flow. In this study, we modified the EPSC algorithm to improve the image quality of the radial acquisition regime (RADAR) and expand its application sequences. We assumed the artifacts were mainly caused by errors in the phase map for EPSC and used a phantom on a 1.5-tesla (T) MR scanner to investigate whether to modify the EPSC algorithm. To evaluate the effectiveness of EPSC, we compared results from T 1 -and T 2 -weighted images of a volunteer's lung region using the current and modified EPSC. We then applied the modified EPSC to RADAR spin echo (SE) and RADAR balanced steady-state acquisition with rewound gradient echo (BASG) sequence. The modified EPSC reduced phase discontinuity in the reference data used for EPSC and improved visualization of blood vessels in the lungs. Motion and blood flow caused no visible artifacts in the resulting images in either RADAR SE or RADAR BASG sequence. Use of the modified EPSC eliminated artifacts caused by signal loss in the reference data for EPSC. In addition, the modified EPSC was applied to RADAR SE and RADAR BASG sequences. (author)
The Comet Radar Explorer Mission
Asphaug, Erik; Belton, Mike; Bockelee-Morvan, Dominique; Chesley, Steve; Delbo, Marco; Farnham, Tony; Gim, Yonggyu; Grimm, Robert; Herique, Alain; Kofman, Wlodek; Oberst, Juergen; Orosei, Roberto; Piqueux, Sylvain; Plaut, Jeff; Robinson, Mark; Sava, Paul; Heggy, Essam; Kurth, William; Scheeres, Dan; Denevi, Brett; Turtle, Elizabeth; Weissman, Paul
2014-11-01
Missions to cometary nuclei have revealed major geological surprises: (1) Global scale layers - do these persist through to the interior? Are they a record of primary accretion? (2) Smooth regions - are they landslides originating on the surface? Are they cryovolcanic? (3) Pits - are they impact craters or sublimation pits, or rooted in the interior? Unambiguous answers to these and other questions can be obtained by high definition 3D radar reflection imaging (RRI) of internal structure. RRI can answer many of the great unknowns in planetary science: How do primitive bodies accrete? Are cometary nuclei mostly ice? What drives their spectacular activity and evolution? The Comet Radar Explorer (CORE) mission will image the detailed internal structure of the nucleus of 10P/Tempel 2. This ~16 x 8 x 7 km Jupiter Family Comet (JFC), or its parent body, originated in the outer planets region possibly millions of years before planet formation. CORE arrives post-perihelion and observes the comet’s waning activity from safe distance. Once the nucleus is largely dormant, the spacecraft enters a ~20-km dedicated Radar Mapping Orbit (RMO). The exacting design of the RRI experiment and the precise navigation of RMO will achieve a highly focused 3D radar reflection image of internal structure, to tens of meters resolution, and tomographic images of velocity and attenuation to hundreds of meters resolution, tied to the gravity model and shape. Visible imagers will produce maps of the surface morphology, albedo, color, texture, and photometric response, and images for navigation and shape determination. The cameras will also monitor the structure and dynamics of the coma, and its dusty jets, allowing their correlation in 3D with deep interior structures and surface features. Repeated global high-resolution thermal images will probe the near-surface layers heated by the Sun. Derived maps of thermal inertia will be correlated with the radar boundary response, and photometry and
Improved Laser Vibration Radar
National Research Council Canada - National Science Library
Hilaire, Pierre
1998-01-01
.... This thesis reconfigured an existing CO2 laboratory laser radar system that is capable of measuring the frequencies of vibration of a simulated target into a more compact and rugged form for field testing...
Runoff Analysis Considering Orographical Features Using Dual Polarization Radar Rainfall
Noh, Hui-seong; Shin, Hyun-seok; Kang, Na-rae; Lee, Choong-Ke; Kim, Hung-soo
2013-04-01
Recently, the necessity for rainfall estimation and forecasting using the radar is being highlighted, due to the frequent occurrence of torrential rainfall resulting from abnormal changes of weather. Radar rainfall data represents temporal and spatial distributions properly and replace the existing rain gauge networks. It is also frequently applied in many hydrologic field researches. However, the radar rainfall data has an accuracy limitation since it estimates rainfall, by monitoring clouds and precipitation particles formed around the surface of the earth(1.5-3km above the surface) or the atmosphere. In a condition like Korea where nearly 70% of the land is covered by mountainous areas, there are lots of restrictions to use rainfall radar, because of the occurrence of beam blocking areas by topography. This study is aiming at analyzing runoff and examining the applicability of (R(Z), R(ZDR) and R(KDP)) provided by the Han River Flood Control Office(HRFCO) based on the basin elevation of Nakdong river watershed. For this purpose, the amount of radar rainfall of each rainfall event was estimated according to three sub-basins of Nakdong river watershed with the average basin elevation above 400m which are Namgang dam, Andong dam and Hapcheon dam and also another three sub-basins with the average basin elevation below 150m which are Waegwan, Changryeong and Goryeong. After runoff analysis using a distribution model, Vflo model, the results were reviewed and compared with the observed runoff. This study estimated the rainfall by using the radar-rainfall transform formulas, (R(Z), R(Z,ZDR) and R(Z,ZDR,KDP) for four stormwater events and compared the results with the point rainfall of the rain gauge. As the result, it was overestimated or underestimated, depending on rainfall events. Also, calculation indicates that the values from R(Z,ZDR) and R(Z,ZDR,KDP) relatively showed the most similar results. Moreover the runoff analysis using the estimated radar rainfall is
Plasma-based radar cross section reduction
Singh, Hema; Jha, Rakesh Mohan
2016-01-01
This book presents a comprehensive review of plasma-based stealth, covering the basics, methods, parametric analysis, and challenges towards the realization of the idea. The concealment of aircraft from radar sources, or stealth, is achieved through shaping, radar absorbing coatings, engineered materials, or plasma, etc. Plasma-based stealth is a radar cross section (RCS) reduction technique associated with the reflection and absorption of incident electromagnetic (EM) waves by the plasma layer surrounding the structure. A plasma cloud covering the aircraft may give rise to other signatures such as thermal, acoustic, infrared, or visual. Thus it is a matter of concern that the RCS reduction by plasma enhances its detectability due to other signatures. This needs a careful approach towards the plasma generation and its EM wave interaction. The book starts with the basics of EM wave interactions with plasma, briefly discuss the methods used to analyze the propagation characteristics of plasma, and its generatio...
Operational Bright-Band Snow Level Detection Using Doppler Radar
National Oceanic and Atmospheric Administration, Department of Commerce — A method to detect the bright-band snow level from radar reflectivity and Doppler vertical velocity data collection with an atmospheric profiling Doppler radar. The...
Issues ignored in laboratory quality surveillance
International Nuclear Information System (INIS)
Zeng Jing; Li Xingyuan; Zhang Tingsheng
2008-01-01
According to the work requirement of the related laboratory quality surveillance in ISO17025, this paper analyzed and discussed the issued ignored in the laboratory quality surveillance. In order to solve the present problem, it is required to understand the work responsibility in the quality surveillance correctly, to establish the effective working routine in the quality surveillance, and to conduct, the quality surveillance work. The object in the quality surveillance shall be 'the operator' who engaged in the examination/calibration directly in the laboratory, especially the personnel in training (who is engaged in the examination/calibration). The quality supervisors shall be fully authorized, so that they can correctly understand the work responsibility in quality surveillance, and are with the rights for 'full supervision'. The laboratory also shall arrange necessary training to the quality supervisor, so that they can obtain sufficient guide in time and are with required qualification or occupation prerequisites. (authors)
Near-Space Microwave Radar Remote Sensing: Potentials and Challenge Analysis
Directory of Open Access Journals (Sweden)
Qicong Peng
2010-03-01
Full Text Available Near-space, defined as the region between 20 km and 100 km, offers many new capabilities that are not accessible to low earth orbit (LEO satellites and airplanes, because it is above storm and not constrained by either the orbital mechanics of satellites or the high fuel consumption of airplanes. By placing radar transmitter/receiver in near-space platforms, many functions that are currently performed with satellites or airplanes could be performed in a cheaper way. Inspired by these advantages, this paper introduces several near-space vehicle-based radar configurations, such as near-space passive bistatic radar and high-resolution wide-swath (HRWS synthetic aperture radar (SAR. Their potential applications, technical challenges and possible solutions are investigated. It is shown that near-space is a satisfactory solution to some specific remote sensing applications. Firstly, near-space passive bistatic radar using opportunistic illuminators offers a solution to persistent regional remote sensing, which is particularly interest for protecting homeland security or monitoring regional environment. Secondly, near-space provides an optimal solution to relative HRWS SAR imaging. Moreover, as motion compensation is a common technical challenge for the described radars, an active transponder-based motion compensation is also described.
Space-borne polarimetric SAR sensors or the golden age of radar polarimetry
Directory of Open Access Journals (Sweden)
Pottier E.
2010-06-01
Full Text Available SAR Polarimetry represents an active area of research in Active Earth Remote Sensing. This interest is clearly supported by the fact that nowadays there exists, or there will exist in a very next future, a non negligible quantity of launched Polarimetric SAR Spaceborne sensors. The ENVISAT satellite, developed by ESA, was launched on March 2002, and was the first Spaceborne sensor offering an innovative dualpolarization Advanced Synthetic Aperture Radar (ASAR system operating at C-band. The second Polarimetric Spaceborne sensor is ALOS, a Japanese Earth-Observation satellite, developed by JAXA and was launched in January 2006. This mission includes an active L-band polarimetric radar sensor (PALSAR whose highresolution data may be used for environmental and hazard monitoring. The third Polarimetric Spaceborne sensor is TerraSAR-X, a new German radar satellite, developed by DLR, EADS-Astrium and Infoterra GmbH, was launched on June 2007. This sensor carries a dual-polarimetric and high frequency X-Band SAR sensor that can be operated in different modes and offers features that were not available from space before. At least, the Polarimetric Spaceborne sensor, developed by CSA and MDA, and named RADARSAT-2 was launched in December 2007 The Radarsat program was born out the need for effective monitoring of Canada’s icy waters, and some Radarsat-2 capabilities that benefit sea- and river ice applications are the multi-polarization options that will improve ice-edge detection, ice-type discrimination and structure information. The many advances in these different Polarimetric Spaceborne platforms were developed to respond to specific needs for radar data in environmental monitoring applications around the world, like : sea- and river-ice monitoring, marine surveillance, disaster management, oil spill detection, snow monitoring, hydrology, mapping, geology, agriculture, soil characterisation, forestry applications (biomass, allometry, height
MAJOR SOURCE OF NEW RADAR DATA FOR EXPLORATION RESEARCH.
Kover, Allan N.; Jones, John Edwin; Southworth, C. Scott
1984-01-01
In 1980, the U. S. Geological Survey (USGS) initiated a program to acquire high-quality, side-looking, airborne-radar (SLAR) imagery of selected areas of the United States. The program goals were to demonstrate the usefulness of SLAR imagery for geologic exploration and geoscience applications and to make radar data readily available to the public for additional research and economic applications. Considerable SLAR imagery has been acquired already since 1980 under a mandate from the U. S. Congress. The U. S. Geological Survey is actively engaged in demonstrating the usefulness of radar imagery, and since 1980 has started more than 50 studies addressing geologic, cartographic, and hydrologic applications. All of the radar-imagery products acquired by the USGS during 1980 and 1982 have been archived and are available for public sale.
Combined radar observations of equatorial electrojet irregularities at Jicamarca
Directory of Open Access Journals (Sweden)
D. L. Hysell
2007-03-01
Full Text Available Daytime equatorial electrojet plasma irregularities were investigated using five distinct radar diagnostics at Jicamarca including range-time-intensity (RTI mapping, Faraday rotation, radar imaging, oblique scattering, and multiple-frequency scattering using the new AMISR prototype UHF radar. Data suggest the existence of plasma density striations separated by 3–5 km and propagating slowly downward. The striations may be caused by neutral atmospheric turbulence, and a possible scenario for their formation is discussed. The Doppler shifts of type 1 echoes observed at VHF and UHF frequencies are compared and interpreted in light of a model of Farley Buneman waves based on kinetic ions and fluid electrons with thermal effects included. Finally, the up-down and east-west asymmetries evident in the radar observations are described and quantified.
Detecting weather radar clutter using satellite-based nowcasting products
DEFF Research Database (Denmark)
Jensen, Thomas B.S.; Gill, Rashpal S.; Overgaard, Søren
2006-01-01
This contribution presents the initial results from experiments with detection of weather radar clutter by information fusion with satellite based nowcasting products. Previous studies using information fusion of weather radar data and first generation Meteosat imagery have shown promising results...... for the detecting and removal of clutter. Naturally, the improved spatio-temporal resolution of the Meteosat Second Generation sensors, coupled with its increased number of spectral bands, is expected to yield even better detection accuracies. Weather radar data from three C-band Doppler weather radars...... Application Facility' of EUMETSAT and is based on multispectral images from the SEVIRI sensor of the Meteosat-8 platform. Of special interest is the 'Precipitating Clouds' product, which uses the spectral information coupled with surface temperatures from Numerical Weather Predictions to assign probabilities...
Broadview Radar Altimetry Toolbox
Garcia-Mondejar, Albert; Escolà, Roger; Moyano, Gorka; Roca, Mònica; Terra-Homem, Miguel; Friaças, Ana; Martinho, Fernando; Schrama, Ernst; Naeije, Marc; Ambrózio, Américo; Restano, Marco; Benveniste, Jérôme
2017-04-01
The universal altimetry toolbox, BRAT (Broadview Radar Altimetry Toolbox) which can read all previous and current altimetry missions' data, incorporates now the capability to read the upcoming Sentinel3 L1 and L2 products. ESA endeavoured to develop and supply this capability to support the users of the future Sentinel3 SAR Altimetry Mission. BRAT is a collection of tools and tutorial documents designed to facilitate the processing of radar altimetry data. This project started in 2005 from the joint efforts of ESA (European Space Agency) and CNES (Centre National d'Etudes Spatiales), and it is freely available at http://earth.esa.int/brat. The tools enable users to interact with the most common altimetry data formats. The BratGUI is the frontend for the powerful command line tools that are part of the BRAT suite. BRAT can also be used in conjunction with MATLAB/IDL (via reading routines) or in C/C++/Fortran via a programming API, allowing the user to obtain desired data, bypassing the dataformatting hassle. BRAT can be used simply to visualise data quickly, or to translate the data into other formats such as NetCDF, ASCII text files, KML (Google Earth) and raster images (JPEG, PNG, etc.). Several kinds of computations can be done within BRAT involving combinations of data fields that the user can save for posterior reuse or using the already embedded formulas that include the standard oceanographic altimetry formulas. The Radar Altimeter Tutorial, that contains a strong introduction to altimetry, shows its applications in different fields such as Oceanography, Cryosphere, Geodesy, Hydrology among others. Included are also "use cases", with step-by-step examples, on how to use the toolbox in the different contexts. The Sentinel3 SAR Altimetry Toolbox shall benefit from the current BRAT version. While developing the toolbox we will revamp of the Graphical User Interface and provide, among other enhancements, support for reading the upcoming S3 datasets and specific
Carolina Angélica da Silva Parada
2012-01-01
Este trabalho descreve a construção de plasmídeos para expressão e ancoragem de proteínas de alta afinidade a íons Hg2+ e As5+. Os genes merR e arsR de C. metallidurans foram inseridos no vetor que contém o sistema para expressão e ancoragem de proteínas heterólogas em bactérias Gram-negativas originando os plasmídeos pCM-Hg e pCM-As. MerR e ArsR foram produzidas sob comando do promotor pan. E. coli recombinantes apresentaram resistência 100% superior a Hg2+ e As5+. C. metallidurans/pCM-As ap...
Space Radar Image of Central Sumatra, Indonesia
1994-01-01
This is a radar image of the central part of the island of Sumatra in Indonesia that shows how the tropical rainforest typical of this country is being impacted by human activity. Native forest appears in green in this image, while prominent pink areas represent places where the native forest has been cleared. The large rectangular areas have been cleared for palm oil plantations. The bright pink zones are areas that have been cleared since 1989, while the dark pink zones are areas that were cleared before 1989. These radar data were processed as part of an effort to assist oil and gas companies working in the area to assess the environmental impact of both their drilling operations and the activities of the local population. Radar images are useful in these areas because heavy cloud cover and the persistent smoke and haze associated with deforestation have prevented usable visible-light imagery from being acquired since 1989. The dark shapes in the upper right (northeast) corner of the image are a chain of lakes in flat coastal marshes. This image was acquired in October 1994 by the Spaceborne Imaging Radar C/X-Band Synthetic Aperture Radar (SIR-C/X-SAR) onboard the space shuttle Endeavour. Environmental changes can be easily documented by comparing this image with visible-light data that were acquired in previous years by the Landsat satellite. The image is centered at 0.9 degrees north latitude and 101.3 degrees east longitude. The area shown is 50 kilometers by 100 kilometers (31 miles by 62 miles). The colors in the image are assigned to different frequencies and polarizations of the radar as follows: red is L-band horizontally transmitted, horizontally received; green is L-band horizontally transmitted, vertically received; blue is L-band vertically transmitted, vertically received. SIR-C/X-SAR, a joint mission of the German, Italian and United States space agencies, is part of NASA's Mission to Planet Earth program.
A simple device for long-term radar cross section recordings.
Eskelinen, Pekka; Ruoskanen, Jukka; Peltonen, Jouni
2009-05-01
A sample and hold circuit with settable delay can be used for recording of radar echo amplitude variations having time scales up to 100 s at the selected range bin in systems utilizing short rf pulses. The design is based on two integrated circuits and gives 1% uncertainty for 70 ns pulses. The key benefit is a real-time display of lengthy amplitude variations because the sample rate is defined by the radar pulse repetition frequency. Additionally we get a reduction in file size at least by the inverse of the radar's duty cycle. Examples of 10 and 100 s recordings with a Ka-band short pulse radar are described.
2011-09-01
CHALLENGES ............................66 1. Radar Processing Gain ........................66 2. High Sensitivity Requirement .................68 B...Relationship Between Network Space and Challenges .....................................127 Figure 42. Maneuverability................................129...virtually any kind of terrain. It has five modes: Normal, Weather, ECCM, LPI, and Very Low Clearance ( VLC ). Pictures of the LANTIRN pod aboard and F-16
Temperature sheets and aspect sensitive radar echoes
Directory of Open Access Journals (Sweden)
H. Luce
Full Text Available here have been years of discussion and controversy about the existence of very thin and stable temperature sheets and their relationship to the VHF radar aspect sensitivity. It is only recently that very high-resolution in situ temperature observations have brought credence to the reality and ubiquity of these structures in the free atmosphere and to their contribution to radar echo enhancements along the vertical. Indeed, measurements with very high-resolution sensors are still extremely rare and rather difficult to obtain outside of the planetary boundary layer. They have only been carried out up to the lower stratosphere by Service d’A´ eronomie (CNRS, France for about 10 years. The controversy also persisted due to the volume resolution of the (Mesosphere-Stratosphere-Troposphere VHF radars which is coarse with respect to sheet thickness, although widely sufficient for meteorological or mesoscale investigations. The contribution within the range gate of many of these structures, which are advected by the wind, and decay and grow at different instants and could be distorted either by internal gravity waves or turbulence fields, could lead to radar echoes with statistical properties similar to those produced by anisotropic turbulence. Some questions thus remain regarding the manner in which temperature sheets contribute to VHF radar echoes. In particular, the zenithal and azimuthal angular dependence of the echo power may not only be produced by diffuse reflection on stable distorted or corrugated sheets, but also by extra contributions from anisotropic turbulence occurring in the stratified atmosphere. Thus, for several years, efforts have been put forth to improve the radar height resolution in order to better describe thin structures. Frequency interferometric techniques are widely used and have been recently further developed with the implementation of high-resolution data processings. We begin by reviewing briefly some characteristics
Temperature sheets and aspect sensitive radar echoes
Directory of Open Access Journals (Sweden)
H. Luce
2001-08-01
Full Text Available here have been years of discussion and controversy about the existence of very thin and stable temperature sheets and their relationship to the VHF radar aspect sensitivity. It is only recently that very high-resolution in situ temperature observations have brought credence to the reality and ubiquity of these structures in the free atmosphere and to their contribution to radar echo enhancements along the vertical. Indeed, measurements with very high-resolution sensors are still extremely rare and rather difficult to obtain outside of the planetary boundary layer. They have only been carried out up to the lower stratosphere by Service d’A´ eronomie (CNRS, France for about 10 years. The controversy also persisted due to the volume resolution of the (Mesosphere-Stratosphere-Troposphere VHF radars which is coarse with respect to sheet thickness, although widely sufficient for meteorological or mesoscale investigations. The contribution within the range gate of many of these structures, which are advected by the wind, and decay and grow at different instants and could be distorted either by internal gravity waves or turbulence fields, could lead to radar echoes with statistical properties similar to those produced by anisotropic turbulence. Some questions thus remain regarding the manner in which temperature sheets contribute to VHF radar echoes. In particular, the zenithal and azimuthal angular dependence of the echo power may not only be produced by diffuse reflection on stable distorted or corrugated sheets, but also by extra contributions from anisotropic turbulence occurring in the stratified atmosphere. Thus, for several years, efforts have been put forth to improve the radar height resolution in order to better describe thin structures. Frequency interferometric techniques are widely used and have been recently further developed with the implementation of high-resolution data processings. We begin by reviewing briefly some characteristics
Identification of corn fields using multidate radar data
International Nuclear Information System (INIS)
Shanmugan, K.S.; Ulaby, F.T.; Narayanan, V.; Dobson, C.
1983-01-01
Airborne C- and L-band radar data acquired over a test site in western Kansas were analyzed to determine corn-field identification accuracies obtainable using single-channel, multichannel, and multidate radar data. An automated pattern-recognition procedure was used to classify 144 fields into three categories: corn, pasture land, and bare soil (including wheat stubble and fallow). Corn fields were identified with accuracies ranging from 85% for single channel, single-date data to 100% for single-channel, multidate data. The effects of radar parameters such as frequency, polarization, and look angle as well as the effects of soil moisture on the classification accuracy are also presented
SKB - PNC. Development of tunnel radar antennas
International Nuclear Information System (INIS)
Falk, L.
1991-07-01
Tunnel antennas for the RAMAC borehole radar system have been developed and tested in the field. The antennas are of the loaded dipole type and the receiver and transmitter electronics have been rebuilt to screen them from the antennas. A series of measurements has demonstrated that the radar pulse is short and well shaped and relatively free from ringing, even compared with the existing borehole antennas. Two antenna sets were tested: one centered at 60 MHz and another above 100 MHz. Both produced excellent radar pictures when tested in tunnels in Stripa mine. The antennas have been designed to be easy to carry, since the signal quality often depends on the way the antenna is held relative to electric conductors in the tunnels. (au) (46 figs., 57 refs.)
Environmental effects on the radar signature of maritime targets and assets
Heemskerk, H.J.M.
1999-01-01
The member nations of task group 5 (TG05) of the NATO AC/323 SET panel have conducted the cooperative research project Livorno'96 to investigate the dependence of the radar signature on radar, geometrical and target parameters, and to investigate the environmental effects on the measured radar
Greene, Saara; Ion, Allyson; Kwaramba, Gladys; Lazarus, Lisa; Loutfy, Mona
2017-12-01
Pregnant women and mothers living with HIV are under surveillance of service providers, family members, and the community at large. Surveillance occurs throughout the medical management of their HIV during pregnancy, preventing HIV transmission to their baby, infant feeding practices, and as part of assessments related to their ability to mother. Enacted and anticipatory HIV-related stigma can exacerbate the negative impact that being under surveillance has on mothers living with HIV as they move through their pregnancy, birthing, and mothering experiences. In response, women living with HIV find ways to manage their experiences of surveillance through engaging in acts of distancing, planning, and resisting at different points in time, and sometimes enacting all three practices at once. Positioning the narratives of pregnant women and mothers living with HIV in relation to their experiences of surveillance illuminates the relationship between the surveillance of mothers living with HIV and HIV-related stigma.
Space Radar Image of Kilauea Volcano, Hawaii
1994-01-01
This is a deformation map of the south flank of Kilauea volcano on the big island of Hawaii, centered at 19.5 degrees north latitude and 155.25 degrees west longitude. The map was created by combining interferometric radar data -- that is data acquired on different passes of the space shuttle which are then overlayed to obtain elevation information -- acquired by the Spaceborne Imaging Radar-C/X-band Synthetic Aperture Radar during its first flight in April 1994 and its second flight in October 1994. The area shown is approximately 40 kilometers by 80 kilometers (25 miles by 50 miles). North is toward the upper left of the image. The colors indicate the displacement of the surface in the direction that the radar instrument was pointed (toward the right of the image) in the six months between images. The analysis of ground movement is preliminary, but appears consistent with the motions detected by the Global Positioning System ground receivers that have been used over the past five years. The south flank of the Kilauea volcano is among the most rapidly deforming terrains on Earth. Several regions show motions over the six-month time period. Most obvious is at the base of Hilina Pali, where 10 centimeters (4 inches) or more of crustal deformation can be seen in a concentrated area near the coastline. On a more localized scale, the currently active Pu'u O'o summit also shows about 10 centimeters (4 inches) of change near the vent area. Finally, there are indications of additional movement along the upper southwest rift zone, just below the Kilauea caldera in the image. Deformation of the south flank is believed to be the result of movements along faults deep beneath the surface of the volcano, as well as injections of magma, or molten rock, into the volcano's 'plumbing' system. Detection of ground motions from space has proven to be a unique capability of imaging radar technology. Scientists hope to use deformation data acquired by SIR-C/X-SAR and future imaging
Regional frequency analysis of extreme rainfall in Belgium based on radar estimates
Directory of Open Access Journals (Sweden)
E. Goudenhoofdt
2017-10-01
Full Text Available In Belgium, only rain gauge time series have been used so far to study extreme rainfall at a given location. In this paper, the potential of a 12-year quantitative precipitation estimation (QPE from a single weather radar is evaluated. For the period 2005–2016, 1 and 24 h rainfall extremes from automatic rain gauges and collocated radar estimates are compared. The peak intensities are fitted to the exponential distribution using regression in Q-Q plots with a threshold rank which minimises the mean squared error. A basic radar product used as reference exhibits unrealistic high extremes and is not suitable for extreme value analysis. For 24 h rainfall extremes, which occur partly in winter, the radar-based QPE needs a bias correction. A few missing events are caused by the wind drift associated with convective cells and strong radar signal attenuation. Differences between radar and gauge rainfall values are caused by spatial and temporal sampling, gauge underestimations and radar errors. Nonetheless the fit to the QPE data is within the confidence interval of the gauge fit, which remains large due to the short study period. A regional frequency analysis for 1 h duration is performed at the locations of four gauges with 1965–2008 records using the spatially independent QPE data in a circle of 20 km. The confidence interval of the radar fit, which is small due to the sample size, contains the gauge fit for the two closest stations from the radar. In Brussels, the radar extremes are significantly higher than the gauge rainfall extremes, but similar to those observed by an automatic gauge during the same period. The extreme statistics exhibit slight variations related to topography. The radar-based extreme value analysis can be extended to other durations.
Reporting and Surveillance for Norovirus Outbreaks
... Vaccine Surveillance Network (NVSN) Foodborne Diseases Active Surveillance Network (FoodNet) National Outbreak Reporting System (NORS) Estimates of Foodborne Illness in the United States CDC's Vessel Sanitation Program CDC Feature: Surveillance for Norovirus Outbreaks Top ...
Green corona, geomagnetic activity and radar meteor rates
International Nuclear Information System (INIS)
Prikryl, P.
1979-01-01
The short-term dependence of radar meteor rates on geomagnetic activity and/or central meridian passage (CMP) of bright or faint green corona regions is studied. A superimposed-epoch analysis was applied to radar meteor observations from the Ottawa patrol radar (Springhill, Ont.) and Ksub(p)-indices of geomagnetic activity for the period 1963 to 1967. During the minimum of solar activity (1963 to 1965) the CMP of bright coronal regions was followed by the maximum in the daily rates of persistent meteor echoes (>=4s), and the minimum in the daily sums of Ksub(p)-indices whereas the minimum or the maximum, respectively, occurs after the CMP of faint coronal regions. The time delay between the CMP of coronal structures and the corresponding maxima or minima is found to be 3 to 4 days. However, for the period immediately after the minimum of solar activity (1966 to 1967) the above correlation with the green corona is void both for the geomagnetic activity and radar meteor rates. An inverse correlation was found between the radar meteor rates and the geomagnetic activity irrespective of the solar activity. The observed effect can be ascribed to the solar-wind-induced ''geomagnetic'' heating of the upper atmosphere and to the subsequent change in the density gradient in the meteor zone. (author)
Reactor Vessel Surveillance Program for Advanced Reactor
Energy Technology Data Exchange (ETDEWEB)
Jeong, Kyeong-Hoon; Kim, Tae-Wan; Lee, Gyu-Mahn; Kim, Jong-Wook; Park, Keun-Bae; Kim, Keung-Koo
2008-10-15
This report provides the design requirements of an integral type reactor vessel surveillance program for an integral type reactor in accordance with the requirements of Korean MEST (Ministry of Education, Science and Technology Development) Notice 2008-18. This report covers the requirements for the design of surveillance capsule assemblies including their test specimens, test block materials, handling tools, and monitors of the surveillance capsule neutron fluence and temperature. In addition, this report provides design requirements for the program for irradiation surveillance of reactor vessel materials, a layout of specimens and monitors in the surveillance capsule, procedures of installation and retrieval of the surveillance capsule assemblies, and the layout of the surveillance capsule assemblies in the reactor.
Indoor radar SLAM A radar application for vision and GPS denied environments
Marck, J.W.; Mohamoud, A.A.; Houwen, E.H. van de; Heijster, R.M.E.M. van
2013-01-01
Indoor navigation especially in unknown areas is a real challenge. Simultaneous Localization and Mapping (SLAM) technology provides a solution. However SLAM as currently based on optical sensors, is unsuitable in vision denied areas, which are for example encountered by first responders. Radar can
Millimeter-wave silicon-based ultra-wideband automotive radar transceivers
Jain, Vipul
Since the invention of the integrated circuit, the semiconductor industry has revolutionized the world in ways no one had ever anticipated. With the advent of silicon technologies, consumer electronics became light-weight and affordable and paved the way for an Information-Communication-Entertainment age. While silicon almost completely replaced compound semiconductors from these markets, it has been unable to compete in areas with more stringent requirements due to technology limitations. One of these areas is automotive radar sensors, which will enable next-generation collision-warning systems in automobiles. A low-cost implementation is absolutely essential for widespread use of these systems, which leads us to the subject of this dissertation---silicon-based solutions for automotive radars. This dissertation presents architectures and design techniques for mm-wave automotive radar transceivers. Several fully-integrated transceivers and receivers operating at 22-29 GHz and 77-81 GHz are demonstrated in both CMOS and SiGe BiCMOS technologies. Excellent performance is achieved indicating the suitability of silicon technologies for automotive radar sensors. The first CMOS 22-29-GHz pulse-radar receiver front-end for ultra-wideband radars is presented. The chip includes a low noise amplifier, I/Q mixers, quadrature voltage-controlled oscillators, pulse formers and variable-gain amplifiers. Fabricated in 0.18-mum CMOS, the receiver achieves a conversion gain of 35-38.1 dB and a noise figure of 5.5-7.4 dB. Integration of multi-mode multi-band transceivers on a single chip will enable next-generation low-cost automotive radar sensors. Two highly-integrated silicon ICs are designed in a 0.18-mum BiCMOS technology. These designs are also the first reported demonstrations of mm-wave circuits with high-speed digital circuits on the same chip. The first mm-wave dual-band frequency synthesizer and transceiver, operating in the 24-GHz and 77-GHz bands, are demonstrated. All
Between visibility and surveillance
DEFF Research Database (Denmark)
Uldam, Julie
As activists move from alternative media platforms to commercial social media platforms they face increasing challenges in protecting their online security and privacy. While government surveillance of activists is well-documented in both scholarly research and the media, corporate surveillance...
Motion measurement for synthetic aperture radar
Energy Technology Data Exchange (ETDEWEB)
Doerry, Armin W. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2015-01-01
Synthetic Aperture Radar (SAR) measures radar soundings from a set of locations typically along the flight path of a radar platform vehicle. Optimal focusing requires precise knowledge of the sounding source locations in 3-D space with respect to the target scene. Even data driven focusing techniques (i.e. autofocus) requires some degree of initial fidelity in the measurements of the motion of the radar. These requirements may be quite stringent especially for fine resolution, long ranges, and low velocities. The principal instrument for measuring motion is typically an Inertial Measurement Unit (IMU), but these instruments have inherent limi ted precision and accuracy. The question is %22How good does an IMU need to be for a SAR across its performance space?%22 This report analytically relates IMU specifications to parametric requirements for SAR. - 4 - Acknowledgements Th e preparation of this report is the result of a n unfunded research and development activity . Although this report is an independent effort, it draws heavily from limited - release documentation generated under a CRADA with General Atomics - Aeronautical System, Inc. (GA - ASI), and under the Joint DoD/DOE Munitions Program Memorandum of Understanding. Sandia National Laboratories is a multi - program laboratory managed and operated by Sandia Corporation, a wholly owned subsidiary of Lockheed Martin Corporation, for the U.S. Department of En ergy's National Nuclear Security Administration under contract AC04-94AL85000.