Chemical Database Projects Delivered by RSC eScience
Williams, Antony
2013-01-01
This presentation is an overview of some of the projects we are involved with at RSC eScience. The presentation was given at the FDA Meeting regarding the “Development of a Freely Distributable Data System for the Registration of Substances"
Rock suitability classification RSC 2012
Energy Technology Data Exchange (ETDEWEB)
McEwen, T. (ed.) [McEwen Consulting, Leicester (United Kingdom); Kapyaho, A. [Geological Survey of Finland, Espoo (Finland); Hella, P. [Saanio and Riekkola, Helsinki (Finland); Aro, S.; Kosunen, P.; Mattila, J.; Pere, T.
2012-12-15
This report presents Posiva's Rock Suitability Classification (RSC) system, developed for locating suitable rock volumes for repository design and construction. The RSC system comprises both the revised rock suitability criteria and the procedure for the suitability classification during the construction of the repository. The aim of the classification is to avoid such features of the host rock that may be detrimental to the favourable conditions within the repository, either initially or in the long term. This report also discusses the implications of applying the RSC system for the fulfilment of the regulatory requirements concerning the host rock as a natural barrier and the site's overall suitability for hosting a final repository of spent nuclear fuel.
Rock suitability classification RSC 2012
International Nuclear Information System (INIS)
McEwen, T.; Kapyaho, A.; Hella, P.; Aro, S.; Kosunen, P.; Mattila, J.; Pere, T.
2012-12-01
This report presents Posiva's Rock Suitability Classification (RSC) system, developed for locating suitable rock volumes for repository design and construction. The RSC system comprises both the revised rock suitability criteria and the procedure for the suitability classification during the construction of the repository. The aim of the classification is to avoid such features of the host rock that may be detrimental to the favourable conditions within the repository, either initially or in the long term. This report also discusses the implications of applying the RSC system for the fulfilment of the regulatory requirements concerning the host rock as a natural barrier and the site's overall suitability for hosting a final repository of spent nuclear fuel
RSC: Reputación, Sostenibilidad, Compromiso
Directory of Open Access Journals (Sweden)
José Miguel Túñez López
2012-03-01
Full Text Available La responsabilidad social corporativa (RSC como modelo de gestión sobrepasa las declaraciones simbólicas porque requiere de una práctica escenificada públicamente y con rendición de cuentas transparente que combine la mejora de la productividad y la rentabilidad con apuestas decididas por la sostenibilidad social. Este artículo revisa la RSC como compromiso social, a modo de contrato imaginario entre las organizaciones y los ciudadanos, atendiendo a diez parámetros fundamentales: ciudadanía corporativa, ética, gobierno corporativo, inversión socialmente responsable, vinculación con públicos, calidad del clima laboral, cuidado en la cadena de valor, respeto y contribución con el ambiente, memorias anuales y comunicación estratégica responsable. En las últimas tres décadas las actuaciones en RSC todavía son carreras en solitario que no permiten hablar de un despegue completo en Ecuador, a diferencia de países de la Comunidad Andina como Colombia o Perú, o de otros Estados próximos como Argentina o Chile.
Directory of Open Access Journals (Sweden)
Anna L Chambers
Full Text Available The RSC chromatin remodeling complex has been implicated in contributing to DNA double-strand break (DSB repair in a number of studies. Both survival and levels of H2A phosphorylation in response to damage are reduced in the absence of RSC. Importantly, there is evidence for two isoforms of this complex, defined by the presence of either Rsc1 or Rsc2. Here, we investigated whether the two isoforms of RSC provide distinct contributions to DNA damage responses. First, we established that the two isoforms of RSC differ in the presence of Rsc1 or Rsc2 but otherwise have the same subunit composition. We found that both rsc1 and rsc2 mutant strains have intact DNA damage-induced checkpoint activity and transcriptional induction. In addition, both strains show reduced non-homologous end joining activity and have a similar spectrum of DSB repair junctions, suggesting perhaps that the two complexes provide the same functions. However, the hypersensitivity of a rsc1 strain cannot be complemented with an extra copy of RSC2, and likewise, the hypersensitivity of the rsc2 strain remains unchanged when an additional copy of RSC1 is present, indicating that the two proteins are unable to functionally compensate for one another in DNA damage responses. Rsc1, but not Rsc2, is required for nucleosome sliding flanking a DNA DSB. Interestingly, while swapping the domains from Rsc1 into the Rsc2 protein does not compromise hypersensitivity to DNA damage suggesting they are functionally interchangeable, the BAH domain from Rsc1 confers upon Rsc2 the ability to remodel chromatin at a DNA break. These data demonstrate that, despite the similarity between Rsc1 and Rsc2, the two different isoforms of RSC provide distinct functions in DNA damage responses, and that at least part of the functional specificity is dictated by the BAH domains.
Pro-neurogenic effects of andrographolide on RSC96 Schwann cells in vitro
Xu, Fuben; Wu, Huayu; Zhang, Kun; Lv, Peizhen; Zheng, Li; Zhao, Jinmin
2016-01-01
Nerve regeneration remains a challenge to the treatment of peripheral nerve injury. Andrographolide (Andro) is the main active constituent of Andrographis paniculata, which has been applied in the treatment of several diseases, including inflammation, in ancient China. Andro has been reported to facilitate the reduction of edema and to exert analgesic effects in the treatment of various diseases. These findings suggest that Andro may be considered a promising anti-inflammatory agent that may suppress destruction and accelerate proliferation of Schwann cells following peripheral nerve injury. In the present study, the effects of Andro on RSC96 cells were investigated in vitro. The RSC96 cell line is a spontaneously immortalized rat Schwann cell line, which was originally derived from a long-term culture of rat primary Schwann cells. RSC96 cells were treated with a range of 0 to 50 µM Andro prior to the MTT assay. Cell proliferation, morphology, synthesis and nerve-specific gene expression were performed to detect the effect of Andro on RSC96 cells. The results of the present study demonstrated that the recommended doses of Andro ranged between 0.78 and 12.5 µM, among which the most obvious response was observed when used at 3.125 µM (P<0.05). DNA content was improved in Andro groups compared with the control group (P<0.05). In addition, Andro was able to promote the gene expression of glial cell line-derived neurotrophic factor, brain-derived neurotrophic factor, ciliary neurotrophic factor, and the specific Schwann cell marker S100β (P<0.05). The results of a viability assay, hematoxylin-eosin staining, and immunohistochemistry were also improved in Andro groups. These results indicated that Andro may accelerate proliferation of RSC96 cells in vitro, whilst maintaining the Schwann cell phenotype; therefore, the present study may provide valuable evidence for the further exploration of the effects of Andro on peripheral nerves. PMID:27599453
Khan, Abdur Rahim; Ullah, Ihsan; Khan, Abdul Latif; Park, Gun-Seok; Waqas, Muhammad; Hong, Sung-Jun; Jung, Byung Kwon; Kwak, Yunyoung; Lee, In-Jung; Shin, Jae-Ho
2015-09-01
The growth of hyperaccumulator plants is often compromised by increased toxicity of metals like cadmium (Cd). However, extraction of such metals from the soil can be enhanced by endophytic microbial association. Present study was aimed to elucidate the potential of microbe-assisted Cd phytoextraction in hyperaccumulator Solanum nigrum plants and their interactions under varied Cd concentrations. An endophytic bacteria Serratia sp. RSC-14 was isolated from the roots of S. nigrum. In addition to Cd tolerance up to 4 mM, the RSC-14 exhibited phosphate solubilization and secreted plant growth-promoting phytohormones such as indole-3-acetic acid (54 μg/mL). S. nigrum plants were inoculated with RSC-14 and were grown in different concentrations of Cd (0, 10, and 30 mg Cd kg(-1) sand). Results revealed that Cd treatment caused significant cessation in plant growth, biomass, and chlorophyll content, whereas significantly higher malondialdehyde (MDA) and electrolyte production in leaves were observed in a dose-dependent manner. Conversely, RSC-14 inoculation relived the toxic effects of Cd-induced stress by significantly increasing root/shoot growth, biomass production, and chlorophyll content and decreasing MDA and electrolytes contents. Ameliorative effects on host growth were also observed by the regulation of metal-induced oxidative stress enzymes such as catalase, peroxidase, and polyphenol peroxidase. Activities of these enzymes were significantly reduced in RSC-14 inoculated plants as compared to control plants under Cd treatments. The lower activities of stress responsive enzymes suggest modulation of Cd stress by RSC-14. The current findings support the beneficial uses of Serratia sp. RSC-14 in improving the phytoextraction abilities of S. nigrum plants in Cd contamination.
La comunicación web de la RSC- El caso de las empresas cárnicas catalanas
Directory of Open Access Journals (Sweden)
Alejandra Aramayo García
2014-10-01
Full Text Available En los últimos años las buenas prácticas de RSC (Responsabilidad Social Corporativa enfocadas a la sostenibilidad empresarial han ido incrementado su relevancia. La comunicación es una parte intrínseca de la RSC, viabiliza el diálogo con los grupos de interés, pero no siempre es eficiente. El objetivo de este estudio es el de medir y evaluar la gestión de la comunicación web de la RSC que realizan las empresas del sector cárnico catalán, mediante el estudio de las variables significativas del análisis web aplicadas a la información de la RSC disponibles en los websites corporativos. CSR Communication in the Web – The Catalan meat companies case Abstract In recent years the good practices of CSR (Corporate Social Responsibility focused on corporate sustainability are becoming increasingly important. Communication is an intrinsic part of CSR, viable dialogue with stakeholders, but not always efficient. The objective of this study is to measure and evaluate the web communication management of CSR (Corporate Social Responsibility performed by catalan meat companies, by analyzing significant web variables of analysis applicable to the RSC information available on the corporate website. Keywords: Corporate communication; Corporate Social Responsibility; Meat Industry; Catalonia; Website; stakeholders.
Efectos de la RSC sobre el consumidor: una aplicación al sector de transporte público terrestre
Directory of Open Access Journals (Sweden)
Natalia Vila
2010-12-01
Full Text Available El presente trabajo pretende contrastar los efectos que provoca el desarrollo de acciones de responsabilidad social corporativa, RSC, por parte de una empresa en el consumidor, en tres dimensiones: i el conocimiento de una empresa y sus productos; ii la actitud que despierta en el consumidor, y iii el comportamiento de compra que suscita. La idea es verificar, a través del contraste, hasta qué punto una empresa que desarrolla acciones de RSC es mejor percibida, preferida sobre las restantes y escogida en el momento de compra. Para ello se planteó realizar un estudio empírico en un sector de gran transcendencia social y que engloba características de la RSC: el transporte público terrestre en áreas urbanas.
Directory of Open Access Journals (Sweden)
William R. Avendaño C.
2011-07-01
Full Text Available The Corporate Social Responsibility is the contribution of the companies to promote the changes generated in the last decades on of sustainable development in relation with the commitment of the states to act responsibly towards the environment. This trend has had its heyday in the late 80´s and early 90 with the declaration of Rio in Brazil. From this perspective, is a review of the implications the 1992 Rio Declaration to Colombia as a state party and the RSC as a component in the agendas of the actual organizations. For that, it make a thorough review of the literature in order to make a conceptual approach to the term RSC, the RSC legislation analyzing the positions of those who agree and those who oppose, the rules relationed to this area in Colombia and the need to regulate going to examples of other states.
Khan, Abdur Rahim; Park, Gun-Seok; Asaf, Sajjad; Hong, Sung-Jun; Jung, Byung Kwon
2017-01-01
Serratia marcescens RSC-14 is a Gram-negative bacterium that was previously isolated from the surface-sterilized roots of the Cd-hyperaccumulator Solanum nigrum. The strain stimulates plant growth and alleviates Cd stress in host plants. To investigate the genetic basis for these traits, the complete genome of RSC-14 was obtained by single-molecule real-time sequencing. The genome of S. marcescens RSC-14 comprised a 5.12-Mbp-long circular chromosome containing 4,593 predicted protein-coding genes, 22 rRNA genes, 88 tRNA genes, and 41 pseudogenes. It contained genes with potential functions in plant growth promotion, including genes involved in indole-3-acetic acid (IAA) biosynthesis, acetoin synthesis, and phosphate solubilization. Moreover, annotation using NCBI and Rapid Annotation using Subsystem Technology identified several genes that encode antioxidant enzymes as well as genes involved in antioxidant production, supporting the observed resistance towards heavy metals, such as Cd. The presence of IAA pathway-related genes and oxidative stress-responsive enzyme genes may explain the plant growth-promoting potential and Cd tolerance, respectively. This is the first report of a complete genome sequence of Cd-tolerant S. marcescens and its plant growth promotion pathway. The whole-genome analysis of this strain clarified the genetic basis underlying its phenotypic and biochemical characteristics, underpinning the beneficial interactions between RSC-14 and plants. PMID:28187139
Russian RSC Energia employees inspect DM in SSPF
1995-01-01
Employees of the Russian aerospace company RSC Energia prepare to conduct final inspections of the Russian-built Docking Module in the Space Station Processing Facility at KSC. The module will fly as a primary payload on the second Space Shuttle/Mir space station docking mission, STS-74, which is now scheduled for liftoff in the fall of 1995. During the mission, the module will first be attached with the orbiter's robot arm to the Orbiter Docking System (ODS) in the payload bay of the orbiter Atlantis and then be docked with the Mir. When Atlantis undocks from the Mir, it will leave the new docking module permanently attached to the space station for use during future Shuttle Mir docking missions. The new module will simplify future Shuttle linkups with Mir by improving orbiter clearances when it serves as a bridge between the two space vehicles.
Directory of Open Access Journals (Sweden)
Joke J F A van Vugt
Full Text Available BACKGROUND: Chromosome structure, DNA metabolic processes and cell type identity can all be affected by changing the positions of nucleosomes along chromosomal DNA, a reaction that is catalysed by SNF2-type ATP-driven chromatin remodelers. Recently it was suggested that in vivo, more than 50% of the nucleosome positions can be predicted simply by DNA sequence, especially within promoter regions. This seemingly contrasts with remodeler induced nucleosome mobility. The ability of remodeling enzymes to mobilise nucleosomes over short DNA distances is well documented. However, the nucleosome translocation processivity along DNA remains elusive. Furthermore, it is unknown what determines the initial direction of movement and how new nucleosome positions are adopted. METHODOLOGY/PRINCIPAL FINDINGS: We have used AFM imaging and high resolution PAGE of mononucleosomes on 600 and 2500 bp DNA molecules to analyze ATP-dependent nucleosome repositioning by native and recombinant SNF2-type enzymes. We report that the underlying DNA sequence can control the initial direction of translocation, translocation distance, as well as the new positions adopted by nucleosomes upon enzymatic mobilization. Within a strong nucleosomal positioning sequence both recombinant Drosophila Mi-2 (CHD-type and native RSC from yeast (SWI/SNF-type repositioned the nucleosome at 10 bp intervals, which are intrinsic to the positioning sequence. Furthermore, RSC-catalyzed nucleosome translocation was noticeably more efficient when beyond the influence of this sequence. Interestingly, under limiting ATP conditions RSC preferred to position the nucleosome with 20 bp intervals within the positioning sequence, suggesting that native RSC preferentially translocates nucleosomes with 15 to 25 bp DNA steps. CONCLUSIONS/SIGNIFICANCE: Nucleosome repositioning thus appears to be influenced by both remodeler intrinsic and DNA sequence specific properties that interplay to define ATPase
Russian RSC Energia employees attach trunnions to DM
1995-01-01
Employees of the Russian aerospace company RSC Energia attach trunnions to the Russian-built docking module in the Space Station Processing Facility at KSC so that it can be mounted in the payload bay of the Space Shuttle orbiter Atlantis. The module will fly as a primary payload on the second Space Shuttle/Mir space station docking mission, STS-74, which is now scheduled for liftoff in the fall of 1995. During the mission, the module will first be attached with the orbiter's robot arm to the Orbiter Docking System (ODS) in the payload bay of the orbiter Atlantis and then be docked with the Mir. When Atlantis undocks from the Mir, it will leave the new docking module permanently attached to the space station for use during future Shuttle Mir docking missions. The new module will simplify future Shuttle linkups with Mir by improving orbiter clearances when it serves as a bridge between the two space vehicles.
Looking Back at the Audience: The RSC
Directory of Open Access Journals (Sweden)
Mancewicz Aneta
2014-12-01
Full Text Available The controversy around the RSC & The Wooster Group’s Troilus and Cressida (Stratford-upon-Avon 2012 among the spectators and critics in Britain revealed significant differences between the UK and the US patterns of staging, spectating, and reviewing Shakespeare. The production has also exposed the gap between mainstream and avant-garde performance practices in terms of artists’ assumptions and audiences’ expectations. Reviews and blog entries written by scholars, critics, practitioners, and anonymous theatre goers were particularly disapproving of The Wooster Group’s experimentation with language, non-psychological acting, the appropriation of Native American customs, and the overall approach to the play and the very process of stage production. These points of criticism have suggested a clear perception of a successful Shakespeare production in the mainstream British theatre: a staging that approaches the text as an autonomous universe guided by realistic rules, psychological principles, and immediate political concerns. If we assume, however, that Troilus and Cressida as a play relies on the dramaturgy of cultural differences and that it consciously reflects on the notion of spectatorship, the production’s transgression of mainstream patterns of staging and spectating brings it surprisingly close to the Shakespearean source.
Contactos Sociales y Orientación Estratégica: algunas implicaciones para la RSC
Directory of Open Access Journals (Sweden)
Virginia Fernández Pérez
2011-09-01
Full Text Available Las redes sociales de los directivos suelen tener un claro reflejo en las decisiones estratégicas que guían a la firma a la hora de actuar. Éstas proporcionan alternativas y ayudan a conformar los marcos de referencia que se utilizan en la toma de decisiones. Todo ello influye en el tipo de orientación estratégica de la organización y por tanto, en el nivel de responsabilidad social corporativa (RSC que se desprende de las acciones directivas. Esto es debido a que los grupos de interés que forman parte de las mismas van a tener más probabilidades de ver cumplidas sus expectativas dependiendo del posicionamiento estratégico elegido finalmente por la empresa. Por todo esto, la propia estructura de la red que envuelve al directivo, que en este caso es estudiada desde dos de sus dimensiones, como son: la fortaleza (calidad y la diversidad (cantidad de los nexos que unen y conforman la red; puede condicionar definitivamente la orientación y el comportamiento estratégico y social de la organización. Cuanto mayor es el nivel de relaciones sociales, se suelen adoptar posicionamientos estratégicos más proactivos con mayor grado de desarrollo de ciertos principios de su RSC.
Directory of Open Access Journals (Sweden)
Rohith Srivas
2013-12-01
Full Text Available Efficient repair of UV-induced DNA damage requires the precise coordination of nucleotide excision repair (NER with numerous other biological processes. To map this crosstalk, we generated a differential genetic interaction map centered on quantitative growth measurements of >45,000 double mutants before and after different doses of UV radiation. Integration of genetic data with physical interaction networks identified a global map of 89 UV-induced functional interactions among 62 protein complexes, including a number of links between the RSC complex and several NER factors. We show that RSC is recruited to both silenced and transcribed loci following UV damage where it facilitates efficient repair by promoting nucleosome remodeling. Finally, a comparison of the response to high versus low levels of UV shows that the degree of genetic rewiring correlates with dose of UV and reveals a network of dose-specific interactions. This study makes available a large resource of UV-induced interactions, and it illustrates a methodology for identifying dose-dependent interactions based on quantitative shifts in genetic networks.
PROCEEDINGS OF RIKEN BNL RESEARCH CENTER WORKSHOP, RHIC SPIN COLLABORATION MEETING VI, VOLUME 36
International Nuclear Information System (INIS)
BLAND, L.; SAITO, N.
2001-01-01
The sixth meeting of the RHIC Spin Collaboration (RSC) took place on October 1, 2001 at Brookhaven National Laboratory. RHIC is now in its second year of operation for physics production and the first polarized proton collision run at √s=200 GeV is expected to start in eight weeks. The RSC has developed a plan for this coming run through two previous meetings, RHIC Spin Physics III (August 3, 2000) and IV (October 13-14, 2000). We requested the following: two weeks of polarized proton studies in AGS, three weeks of polarized collider commissioning, and five weeks of polarized proton physics run. As a result, we have obtained all we asked and the above plans are implemented in the current operation schedule. The focus of the present meeting was to bring all involved in the RHIC Spin activities up-to-date on the progress of machine development, theory issues, and experimental issues. This meeting was right after the Program Advisory Committee (PAC) meeting and it started with the comments on the PAC discussion by Gerry Bunce, who was informed about the PAC deliberations by Tom Kirk. The PAC was fully supportive to complete the proposed spin program within the currently available budget for RHIC run 2 operations. Gerry further explained the expected luminosity to be ∫ Ldt = 0.5 pb -1 per week, reflecting the current machine status. The introductory session also had a talk from Werner Vogelsang that reviewed the progress in perturbative QCD theory focused on spin effects
Responsabilidad social corporativa (RSC y comunicación: la agenda de las grandes empresas mexicanas
Directory of Open Access Journals (Sweden)
Mariela Pérez Chavarría
2009-01-01
Full Text Available Este artículo presenta los resultados de una investigación pionera en México acerca de cómo es la comunicación de la responsabilidad social corporativa(rsc en el país y cómo es esa responsabilidad (prácticas más comunes, áreas más atendidas, programas, stakeholders, etc., a partir de lo que dicen al respecto (por internet las 25 empresas más importantes de México, según la revista mexicana Expansión.
Directory of Open Access Journals (Sweden)
Gracia Navarro Saldaña*
2011-02-01
Full Text Available RESUMENEl presente estudio adapta el modelo de la Responsabilidad Social Corporativa (RSC a la organización universitaria.Busca describir la importancia atribuida a la incorporación de la RSC a la gestión universitaria e identificar la relación entreesta variable y dos características personales relevantes, en directivos y académicos de la Universidad de Concepción(Chile: Jerarquía de valores y orientación social. Se encuestó a 43 directivos y 48 académicos con el cuestionario deImportancia Atribuida a la RSC; el Inventario de Valores de Schwartz y la Encuesta de Orientación Social de Triandis yGelfand. Los resultados muestran alta atribución de importancia a la RSC en la gestión universitaria; alta adhesión a tiposvalóricos de universalismo, benevolencia y autonomía y alta presencia de las orientaciones sociales colectivistas. Existerelación positiva significativa de la atribución de importancia a la RSC con los tipos valóricos de universalismo y benevolenciay negativa con poder y con orientación social individualista vertical.ABSTRACTThis study tries to adapt the model of CSR to the university organization. It describes the importance attributed to theincorporation of CSR to university management and identifies the relationship between this variable and two relevantpersonal characteristics in managers and academics from the University of Concepción (Chile: Hierarchy of values andsocial orientation. We surveyed 43 managers and 48 academics with the Emphasis on the RSC Questionnaire, the SchwartzValues Inventory and the Social Guidance Survey of Triandis and Gelfand. The results show high importance assigned tothe RSC in university management, high adhesion to value types of universalism, benevolence and autonomy and a highpresence of collectivistic social orientations. There is significant positive relationship of attribution of importance to theRSC with the value types of universalism and benevolence and negative
A EVOLUÇÃO DA RSC NO BRASIL ENTRE AS EMPRESAS LISTADAS NA BOVESPA
Directory of Open Access Journals (Sweden)
Vitória Lunardi
2012-03-01
Full Text Available O objetivo deste trabalho é analisar os avanços em responsabilidade social no Brasil, enfatizando o tipo de informação apresentada e o nível dos investimentos realizados durante o período 2003-2007. A análise empírica está baseada no conteúdo dos relatórios de RSC publicados pelas empresas com cotação na Bovespa, entre as quais estão as companhias que compõem a carteira do Índice de Sustentabilidade Empresarial e Responsabilidade Social Corporativa da bolsa de valores de São Paulo (Bovespa. A amostra analisada está composta por 48 companhias com cotação. Na análise empírica foi analisado o conteúdo dos relatórios anuais das empresas da amostra entre os anos de 2003 e 2007. Todos os projetos em RSC desenvolvidos pelas companhias da amostra foram classificados em 11 categorias, bem como em três grandes grupos de investimento: externo, interno e do meio ambiente. Os resultados deixam evidente a necessidade de potencializar a padronização do formato de apresentação dos relatórios de responsabilidade social corporativa devido à ausência de uniformidade. Observa-se também que as empresas investem em projetos que, na maioria dos casos, estão estritamente relacionados com a atividade principal que desenvolvem. Em relação ao crescimento do investimento, o maior avanço durante o período temporal analisado está no investimento externo, embora o investimento durante o período temporal tenha aumentado de forma considerável. O investimento do meio ambiente é que se manteve estável, devido especialmente a uma significativa redução no setor petrolífero.
LA EVOLUCIÓN DE LA RSC EN BRASIL ENTRE LAS EMPRES AS COTIZADAS EN BOVESPA
Directory of Open Access Journals (Sweden)
Ana Gisbert
2012-03-01
Full Text Available El objetivo de este trabajo es analizar los avances en responsabilidad social en Brasil, haciendo énfasis en el tipo de información presentada y el nivel de las inversiones realizadas durante el período 2003-2007. El análisis empírico está basado en el contenido de los informes de RSC publicados por las empresas cotizadas en Bovespa, entre las que se encuentran las compañías que componen la cartera del Índice de Sostenibilidad Empresarial y Responsabilidad Social Corporativa de la bolsa de valores de Sao Paulo (Bovespa. La muestra analizada está compuesta por 48 compañías cotizadas. En el análisis empírico se ha analizado el contenido de los informes anuales de las empresas de la muestra entre los años 2003 a 2007. Todos los proyectos en RSC desarrollados por las compañías de la muestra han sido clasificados en 11 categorías, así como em tres grandes grupos de inversión: externa, interna y medioambiental. Los resultados ponen de manifiesto la necesidad de potenciar la estandarización del formato de presentación de los informes de responsabilidade social corporativa debido a la ausencia de uniformidad. Asimismo, se observa que las empresas invierten em proyectos que en la mayor parte de los casos están muy relacionados con la actividad principal que desarrollan. Respecto al crecimiento de la inversión, el mayor avance durante el periodo temporal analizado se encuentra en la inversión externa, si bien la inversión en proyectos internos ha aumentado de forma considerable. La inversión medioambiental es la que se ha mantenido, debido especialmente a una significativa reducción en el sector petrolífero.
La Evolución de la RSC en Brasil entre las empresas cotizadas en Bovespa
Directory of Open Access Journals (Sweden)
Ana Gisbert
2012-01-01
Full Text Available El objetivo de este trabajo es analizar los avances en responsabilidad social en Brasil, haciendo énfasis en el tipo de información presentada y el nivel de las inversiones realizadas durante el período 2003-2007. El análisis empírico está basado en el contenido de los informes de RSC publicados por las empresas cotizadas en Bovespa, entre las que se encuentran las compañías que componen la cartera del Índice de Sostenibilidad Empresarial y Responsabilidad Social Corporativa de la bolsa de valores de Sao Paulo (Bovespa. La mues - tra analizada está compuesta por 48 compañías cotizadas. En el análisis empírico se ha analizado el conte - nido de los informes anuales de las empresas de la muestra entre los años 2003 a 2007. Todos los proyectos en RSC desarrollados por las compañías de la muestra han sido clasificados en 11 categorías, así como en tres grandes grupos de inversión: externa, interna y medioambiental. Los resultados ponen de manifiesto la necesidad de potenciar la estandarización del formato de presentación de los informes de responsabilidad social corporativa debido a la ausencia de uniformidad. Asimismo, se observa que las empresas invierten en proyectos que en la mayor parte de los casos están muy relacionados con la actividad principal que desar - rollan. Respecto al crecimiento de la inversión, el mayor avance durante el periodo temporal analizado se encuentra en la inversión externa, si bien la inversión en proyectos internos ha aumentado de forma consi - derable. La inversión medioambiental es la que se ha mantenido, debido especialmente a una significativa reducción en el sector petrolífero
Recommendations of the Reactor Safety Commission, 1971--1974
International Nuclear Information System (INIS)
The Reactor Safety Commission (RSC) of the German Federal Republic was created in 1958 by the then Federal Minister for Atomic Energy and Hydroeconomy. Its task included the advising of the Federal Minister responsible for protection of the population from possible dangers occurring during peaceful utilization of nuclear energy and in all matters of the safety of nuclear oriented installations. The RSC consists of independent experts from differing specialty areas. The results of their consultations are passed on in recommendations to the appropriate Federal Minister. Since the reappointment and reorganization of the RSC in the year 1971 by the then Federal Minister for Education and Science, the recommendations have been published in the ''Federal Gazette.'' The report presented is divided into two parts with a three part appendix. All recommendations of the RSC made since the reorganization (68th Meeting on 3 November 1971) until expiration of the last appointment, (96th Meeting on 25 July 1974) are compiled in the first section. The second part contains all announcements of the RSC which have appeared in the ''Federal Gazette.'' These concern training, agenda, as well as current members. Appendix A includes the ''Guidelines for Pressurized Water Reactors'' approved in the 93rd Meeting on 24 April 1974. Two key word listings follow in Sections B and C of the Appendix. The report was prepared in behalf of the Federal Minister of the Interior through the Office of the RSC assigned to the Institute for Reactor Safety of the Technical Inspection Association (IRS). The report is continued at regular intervals following each meeting period
Directory of Open Access Journals (Sweden)
Jorge Enrique Maldonado Pinto
2016-02-01
Full Text Available RESUMEN El presente trabajo de investigación, está encaminado al análisis de la gestión ambiental de las pymes del sector industrial de la arcilla, tema que en la actualidad está inserto en discusión de diferentes sectores que conforman las sociedades en torno a la temática sobre el rol que le compete a las organizaciones para su buena gestión en las prácticas sociales. Es a partir de esto, donde surge la necesidad de realizar la siguiente investigación buscando el fomento de una cultura de RSC con base al cumplimiento de alternativas de gestión ambiental. La investigación presenta ante todo un amplio marco teórico al respecto, donde se perfila el concepto de RSC, con sus definiciones, enfoques y términos relacionados, su historia y evolución, normatividad existente e instrumentos de medición, su evaluación y argumentos de tipo social que justifican desde los ángulos ético y económico; el modelo de los stakeholders y las alternativas ecológicas propuestas para articular las pequeñas y medianas empresas (PYMES con el contexto ambiental. La metodología utilizada es un trabajo de campo donde se recoge información descriptiva y documental de los empresarios y expertos sobre el tema de gestión ambiental y su aplicación en las empresas pymes del sector industrial de la transformación de la arcilla del departamento Norte de Santander, Colombia. Sus resultados pueden servir de modelo para mejorar la gestión ambiental y contribuir a fomentar una cultura de RSC en las pymes, objeto de estudio.
Directory of Open Access Journals (Sweden)
Sérgio Henrique da Conceição
2011-01-01
Full Text Available O presente trabalho constitui-se, enquanto uma pesquisa qualitativa e quantitativa, que a partir do levantamento de literatura acerca do processo de disclosure, em responsabilidade social corporativa (RSC em companhias brasileiras. Realizou levantamento dos relatórios disponibilizados pelas companhias listadas na BOVESPA (Bolsa de Valores do Estado de São Paulo para um conjunto de 123 empresas, fundamentado pelo referencial da Teoria da Divulgação Voluntária e da Teoria da Legitimidade, aliado à técnica estatística da análise fatorial, buscou identificar o nível de comunicação das informações relacionadas ao desempenho em RSC e prováveis fatores determinantes ao disclosure em responsabilidade social corporativa (RSC a partir de variáveis independentes do desempenho econômico-financeiro e social (distribuição de riqueza dessas companhias. Os resultados obtidos no estudo sugerem que a política de disclosure em RSC para as empresas que formaram a amostra demonstrou ser bastante incipiente e altamente vinculada a aspectos de externalidade positiva (marketing social, sendo possível estabelecer uma determinação significante entre o desempenho econômico-financeiro e social com o disclosure em RSC, para as empresas que atuam em atividade regulamentada.The current article is a qualitative and quantitative study based on the literature regarding the corporative social responsibility (CSR disclosure in Brazilian companies. This research evaluated reports provided by companies listed in BOVESPA (Stock Exchange of the State of São Paulo, Brazil. Based on the Voluntary Disclosure Theory and Legitimacy Theory, 123 companies were evaluated in combination with factor analysis, a statistical technique, in order to identify the level of communication concerning sharing information related to CSR performance and the probable determinant factors to corporative social responsibility (CSR disclosure using financial economical, and social
Directory of Open Access Journals (Sweden)
Fernández Lombao, Tania
2013-06-01
Full Text Available En español: La Responsabilidad Social Corporativa es un concepto que define el modelo de gobernanza empresarial basado en la gestión responsable, horizontal e interactiva, en oposición a los sistemas de control cerrados y férreos. Las tres primeras corporaciones de radiotelevisión pública de la UE en implantar la RSC son British Broadcasting Corporation (BBC del Reino Unido, Raidió Teilifís Éireann (RTÉ de Irlanda y Zweites Deutsches Fernsehen (ZDF de Alemania. Sus estrategias se desarrollan en los ámbitos de gobernanza, condiciones laborales, derechos humanos, aspectos vinculados al consumidor, buenas prácticas en la actividad, medio ambiente y compromiso con la comunidad.Anualmente las tres corporaciones presentan memorias de resumen y evaluación del de sus acciones de RSC, con el objetivo de informar detalladamente a sus stakeholders, es decir, audiencia, directivos, proveedores, empleados, colaboradores, y comunidades locales e internacionales.El objeto de esta comunicación es analizar cómo las tres corporaciones utilizan la web 2.0. a través de sus páginas web corporativas con la finalidad de difundir sus acciones de RSC y propiciar la interactividad. Para ello, se identifica el espacio dedicado a RSC, se especifica la categoría en la que es incluida y la importancia que se le otorga en medio del resto de contenidos recogidos en las páginas webs corporativas. In english: Corporate Social Responsibility is a concept that defines the model of corporate governance based on responsible, horizontal and interactive accountability as opposed to closed and rail control systems. This type of management has been associated, at an initial moment, with private enterprise in the context of globalization, although gradually being implemented in the public, and consequently in the state-owned broadcasting corporations of the European Union. The three first corporations who have introduced CSR in their management are the BBC in the UK
Mishra, S N
2009-03-18
Applying the time differential perturbed angular correlation (TDPAC) technique we have measured electric and magnetic hyperfine fields of the (111)Cd impurity in equi-atomic rare-earth intermetallic alloys RScGe (R = Ce, Pr and Gd) showing antiferro- and ferromagnetism with unusually high ordering temperatures. The Cd nuclei occupying the Sc site show high magnetic hyperfine fields with saturation values B(hf)(0) = 21 kG, 45 kG and 189 kG in CeScGe, PrScGe and GdScGe, respectively. By comparing the results with the hyperfine field data of Cd in rare-earth metals and estimations from the RKKY model, we find evidence for the presence of additional spin density at the probe nucleus, possibly due to spin polarization of Sc d band electrons. The principal electric field gradient component V(zz) in CeScGe, PrScGe and GdScGe has been determined to be 5.3 × 10(21) V m(-2), 5.5 × 10(21) V m(-2) and 5.6 × 10(21) V m(-2), respectively. Supplementing the experimental measurements, we have carried out ab initio calculations for pure and Cd-doped RScGe compounds with R = Ce, Pr, Nd and Gd using the full potential linearized augmented plane wave (FLAPW) method based on density functional theory (DFT). From the total energies calculated with and without spin polarization we find ferrimagnetic ground states for CeScGe and PrScGe while NdScGe and GdScGe are ferromagnetic. In addition, we find a sizable magnetic moment at the Sc site, increasing from ≈0.10 μ(B) in CeScGe to ≈0.3 μ(B) in GdScGe, confirming the spin polarization of Sc d band electrons. The calculated electric field gradient and magnetic hyperfine fields of the Cd impurity closely agree with the experimental values. We believe spin polarization of Sc 3d band electrons, strongly hybridized with spin polarized 5d band electrons of the rare-earth, enables a long range Ruderman-Kittel-Kasuya-Yosida (RKKY) interaction between RE 4f moments which in turn leads to high magnetic ordering temperatures in
Energy Technology Data Exchange (ETDEWEB)
FOX,B.
2003-03-06
Since its inception, the RHIC Spin Collaboration (RSC) has held semi-regular meetings each year to discuss the physics possibilities and the operational details of the program. Having collected our first data sample of polarized proton-proton collisions in Run02 of RHIC, we are now in the process of examining the performance of both the accelerator and the experiments. From this evaluation, we not only aim to formulate a consensus plan for polarized proton-proton during Run03 of RHIC but also to look more forward into the future to ensure the success of the spin program. In the second meeting of this series (which took place at BNL on April 12, 2002), we focused on Run02 polarization issues. This meeting opened with a presentation by Thomas Roser about his reflections on the outcome from the RHIC retreat during which the Run02 performance was evaluated. Of particular importance, Thomas pointed out that, with the expected beam time and his estimates for machine-tuning requirements, the experiments should limit their beam requests to two or three programs.
International Nuclear Information System (INIS)
FOX, B.
2003-01-01
Since its inception, the RHIC Spin Collaboration (RSC) has held semi-regular meetings each year to discuss the physics possibilities and the operational details of the program. Having collected our first data sample of polarized proton-proton collisions in Run02 of RHIC, we are now in the process of examining the performance of both the accelerator and the experiments. From this evaluation, we not only aim to formulate a consensus plan for polarized proton-proton during Run03 of RHIC but also to look more forward into the future to ensure the success of the spin program. In the second meeting of this series (which took place at BNL on April 12, 2002), we focused on Run02 polarization issues. This meeting opened with a presentation by Thomas Roser about his reflections on the outcome from the RHIC retreat during which the Run02 performance was evaluated. Of particular importance, Thomas pointed out that, with the expected beam time and his estimates for machine-tuning requirements, the experiments should limit their beam requests to two or three programs
Directory of Open Access Journals (Sweden)
Dahham Omar S.
2016-01-01
Full Text Available In this study, the influence of Trans- Polyoctylene Rubber (TOR as a compatibilizer on the cure characteristics, tensile and physical properties of ENR-25/rSC vulcanizate were determined. Five different loading of TOR (2, 4, 6, 8 and 10 phr were prepared and added into the vulcanizate. Results indicated that the scorch time (t2 and cure time (t90 bacame shorter as TOR increased, while minimum torque (ML and maximum torque (MH increased. The incorporation of TOR with the vulcanizates enhanced the tensile strength (Ts, modulus (M100 crosslinking density and hardness values. However, the elongation at break percentage of compatibilized vulcanizates became lower than uncompatibilized vulcanizates.
MO-AB-201-02: The RSO and The RSC: Challenges and Opportunities
Energy Technology Data Exchange (ETDEWEB)
Dimock, C. [University of California Los Angeles (United States)
2015-06-15
The role of the Radiation Safety Officer at a medical facility can be complicated. The complexity of the position is based on the breadth of services provided at the institution and the nature of the radioactive materials license. Medical practices are constantly changing and the use of ionizing radiation continues to rise in this area. Some of the newer medical applications involving radiation have unique regulatory and safety issues that must be addressed. Oversight of the uses of radiation start at the local level (radiation safety officer, radiation safety committee) and are heavily impacted by outside agencies (i.e. Nuclear Regulatory Commission, State Radiologic Health, The Joint Commission (TJC), etc). This session will provide both an overview of regulatory oversight and essential compliance practices as well as practical ways to assess and introduce some of the new applications utilizing radioactive materials into your medical facility. Learning Objectives: Regulatory Compliance and Safety with New Radiotherapies: Spheres and Ra-223 (Lance Phillips) Understand the radioactive materials license amendment process to add new radiotherapies (i.e., SIR-Spheres, Therasphere, Xofigo). Understand the AU approval process for microspheres and Xofigo. Examine the training and handling requirements for new procedures. Understand the process involved with protocol development, SOP in order to define roles and responsibilities. The RSO and The RSC: Challenges and Opportunities (Colin Dimock) Understand how to form an effective Committee. Examine what the Committee does for the Program and the RSO. Understand the importance of Committee engagement. Discuss the balance of the complimentary roles of the RSO and the Committee. The Alphabet Soup of Regulatory Compliance: Being Prepared for Inspections (Linda Kroger) Recognize the various regulatory bodies and organizations with oversight or impact in Nuclear Medicine, Radiology and Radiation Oncology. Examine 10CFR35
MO-AB-201-02: The RSO and The RSC: Challenges and Opportunities
International Nuclear Information System (INIS)
Dimock, C.
2015-01-01
The role of the Radiation Safety Officer at a medical facility can be complicated. The complexity of the position is based on the breadth of services provided at the institution and the nature of the radioactive materials license. Medical practices are constantly changing and the use of ionizing radiation continues to rise in this area. Some of the newer medical applications involving radiation have unique regulatory and safety issues that must be addressed. Oversight of the uses of radiation start at the local level (radiation safety officer, radiation safety committee) and are heavily impacted by outside agencies (i.e. Nuclear Regulatory Commission, State Radiologic Health, The Joint Commission (TJC), etc). This session will provide both an overview of regulatory oversight and essential compliance practices as well as practical ways to assess and introduce some of the new applications utilizing radioactive materials into your medical facility. Learning Objectives: Regulatory Compliance and Safety with New Radiotherapies: Spheres and Ra-223 (Lance Phillips) Understand the radioactive materials license amendment process to add new radiotherapies (i.e., SIR-Spheres, Therasphere, Xofigo). Understand the AU approval process for microspheres and Xofigo. Examine the training and handling requirements for new procedures. Understand the process involved with protocol development, SOP in order to define roles and responsibilities. The RSO and The RSC: Challenges and Opportunities (Colin Dimock) Understand how to form an effective Committee. Examine what the Committee does for the Program and the RSO. Understand the importance of Committee engagement. Discuss the balance of the complimentary roles of the RSO and the Committee. The Alphabet Soup of Regulatory Compliance: Being Prepared for Inspections (Linda Kroger) Recognize the various regulatory bodies and organizations with oversight or impact in Nuclear Medicine, Radiology and Radiation Oncology. Examine 10CFR35
Standing Concertation Commmittee
HR Department
2007-01-01
Ordinary meeting on 2 november 2007 Extraordinary meeting on 12 November 2007 The main items discussed at the meetings of the Standing Concertation Committee on 2 November 2007 and 12 November included: Restaurants Supervisory Committee Report The committee took note of the report by the chairman of the Restaurants Supervisory Committee (RSC), T. Lagrange. In particular, it was recorded that, in Restaurant No. 1, the new kitchen and free flow arrangements had been inaugurated and all works had been commissioned on schedule in October 2007.The contractor, Novae, had taken over maintenance of the new kitchen. Some price increases were to be expected in the coming months due mainly to strong increases in the cost of basic ingredients. A problem with bad smells in the area of Restaurant No. 1 was being taken care of by tuning the ventilation system. The RSC wished to thank the management and staff of Restaurant No. 2 for their cooperation while Restaurant No 1 was ...
Directory of Open Access Journals (Sweden)
Bernal Conesa, Juan Andrés
2016-06-01
Full Text Available La importancia de los sistemas de gestión para la integración de la RSC en la estrategia de la empresa es un recurso vital que ha sido poco estudiado en las empresas tecnológicas. En este artículo se propone un modelo de ecuaciones estructurales para explicar la influencia de la RSC y su integración en el sistema de gestión de la empresa, facilitada por la existencia de sistemas de gestión normalizados previos, y cómo influye dicha integración en la estrategia de la empresa y si esto tiene un reflejo en el performance económico de la empresa tecnológica. El estudio se llevó a cabo en empresas ubicadas en parques científicos y tecnológicos españoles. Los resultados del modelo revelan que existe una relación positiva, directa y estadísticamente significativas entre la integración de la RSC y la estrategia, por un lado, y la integración y el performance, por el otro. Asimismo se evidencia unas relaciones indirectas entre los sistemas de gestión normalizados previos a la implantación de la RSC y el performance y, por tanto, con implicaciones prácticas para la gestión de la RSC en empresas tecnológicas. || The importance of management systems for the integration of CSR in the company strategy is a vital resource that has been little studied in technology companies. In this paper a structural equation model is proposed in order to explain the influence of CSR and its integration into the management system of the company. This influence is facilitated by the existence of previous standardized management systems, and how this integration affects the strategy of the company and if this is a reflection on the economic performance of the technology company. The study was conducted in companies located in Spanish Science and Technology Parks. On the one hand, model results shows that there is a positive, direct and statistically significant relationship between the integration of CSR and strategy; on the other hand, performance and
Energy Technology Data Exchange (ETDEWEB)
Ritter, C [Institut Lauer-Langevin, Grenoble (France); Dhar, S K [TIFR, Mumbai (India); Kulkarni, R [TIFR, Mumbai (India); Provino, A [Inst. SPIN-CNR, Genova (Italy); Univ. of Genova (Italy); Ames Lab., Ames, IA (United States); Paudyal, Durga [Ames Lab., Ames, IA (United States); Manfrinetti, Pietro [Inst. SPIN-CNR, Genova (Italy); Univ. of Genova (Italy); Ames Lab., Ames, IA (United States); Gschneidner, Karl A [Ames Lab., Ames, IA (United States); Iowa State Univ., Ames, IA (United States)
2014-08-14
The synthesis of the new equiatomic RScSb ( R = La-Nd, Sm, Gd-Tm, Lu, Y) compounds has been recently reported. These rare earth compounds crystallize in two different crystal structures, adopting the CeScSi-type ( I 4/ mmm) for the lighter R (La-Nd, Sm) and the CeFeSi-type (P4 /nmm) structure for the heavier R ( R = Gd-Tm, Lu, Y). Here we report the results of neutron diffraction, magnetization and heat capacity measurements on some of these compounds ( R = Ce, Pr, Nd, Gd and Tb). Band structure calculations have also been performed on CeScSb and GdScGe (CeScSi-type), and on GdScSb and TbScSb (CeFeSi-type) to compare and understand the exchange interactions in CeScSi and CeFeSi structure types. The neutron diffraction investigation shows that all five compounds order magnetically, with the highest transition temperature of 66 K in TbScSb and the lowest of about 9 K in CeScSb. The magnetic ground state is simple ferromagnetic (τ = [0 0 0]) in CeScSb, as well in NdScSb for 32 >T > 22 K. Below 22 K a second magnetic transition, with propagation vector τ = [¼ ¼ 0], appears in NdScSb. PrScSb has a magnetic structure within, determined by mostly ferromagnetic interactions and antiferromagnetic alignment of the Pr-sites connected through the I-centering ( τ = [1 0 0]). A cycloidal spiral structure with a temperature dependent propagation vector τ = [δ δ ½] is found in TbScSb. The results of magnetization and heat capacity lend support to the main conclusions derived from neutron diffraction. As inferred from a sharp peak in magnetization, GdScSb orders antiferromagnetically at 56 K. First principles calculations show lateral shift of spin split bands towards lower energy from the Fermi level as the CeScSi-type structure changes to the CeFeSi-type structure. This rigid shift may force the system to transform from exchange split ferromagnetic state to the antiferromagnetic state in RScSb compounds (as seen for example in GdScSb and TbScSb) and is proposed to
How the reverse supply chain impacts the financial performance of original equipment manufacturers
DEFF Research Database (Denmark)
Larsen, Samuel
This thesis examines the financial impact of a firm’s reverse supply chain (RSC). Specifically, the thesis examines the two questions of how the RSC can contribute to the financial performance of the firm and which factors are decisive for the RSC’s financial contribution. The thesis focuses...... on original equipment manufacturers. The thesis results show that the RSC can contribute to the financial performance of the firm in more than 20 different ways, which the thesis defines as functions of the RSC. Examples of RSC-functions are 1) resale of recovered end-products to price-focused market segments...... in the firm’s primary markets, 2) resale to customers in new markets (in e.g. emerging economies), and 3) sale of used materials back the firm’s original material suppliers. The firm’ RSC can conduct several RSC-functions simultaneously and the financial benefits from operating these RSC-functions differ...
PROCEEDINGS OF RIKEN BNL RESEARCH CENTER, VOLUME 37, RHIC SPIN COLLABORATION MEETING VI (PART 2)
International Nuclear Information System (INIS)
Bland, L.; Saito, N.
2001-01-01
The second part of the sixth RHIC Spin Collaboration (RSC) meeting was held on November 15, 2001 at Brookhaven National Laboratory. Previous meetings have elaborated on the new generation of proton spin-structure studies (e.g. gluon polarization and flavor separation of q and bar q polarizations via real W ± production) enabled by studying polarized proton collisions at energies and momentum transfers where perturbative QCD models are expected to be applicable. The focus of this meeting was on many of the experimental issues that must be resolved to achieve these physics goals. This summary is written with the benefit of hindsight following the completion of the first-ever run of a polarized proton collider. This first run can be considered as a successfully completed milestone of the RHIC Spin Collaboration. Other milestones remain important. Long term machine items were identified in Waldo Mackay's talk, the most important being the completion of the spin rotator magnets that will be installed in 2002 to allow the flexible orientation of the proton beam polarization at the PHENM and STAR experiments. At the meeting Waldo discussed a stronger partial snake magnet for the AGS as a means of producing highly polarized proton beams to inject into RHIC. Developments subsequent to this meeting suggest that a superconducting helical dipole magnet may be feasible for the AGS, and is likely to be needed to achieve the 70% beam polarization in RHIC. Longer term items were also presented, including potential increases in luminosity by the addition of electron cooling to RHIC and the possibility of increasing the collision energy by ∼20% by replacement of the DX magnets. These items could be considered for a second generation of RHIC spin experiments. The other topics covered at the meeting were related to polarimetry and to the absolute calibration of the proton beam polarization in RHIC. These topics were divided into short- and long-term solutions to polarimetry issues
PROCEEDINGS OF RIKEN BNL RESEARCH CENTER, VOLUME 37, RHIC SPIN COLLABORATION MEETING VI (PART 2).
Energy Technology Data Exchange (ETDEWEB)
BLAND, L.; SAITO, N.
2001-11-15
The second part of the sixth RHIC Spin Collaboration (RSC) meeting was held on November 15, 2001 at Brookhaven National Laboratory. Previous meetings have elaborated on the new generation of proton spin-structure studies (e.g. gluon polarization and flavor separation of q and {bar q} polarizations via real W{sup {+-}} production) enabled by studying polarized proton collisions at energies and momentum transfers where perturbative QCD models are expected to be applicable. The focus of this meeting was on many of the experimental issues that must be resolved to achieve these physics goals. This summary is written with the benefit of hindsight following the completion of the first-ever run of a polarized proton collider. This first run can be considered as a successfully completed milestone of the RHIC Spin Collaboration. Other milestones remain important. Long term machine items were identified in Waldo Mackay's talk, the most important being the completion of the spin rotator magnets that will be installed in 2002 to allow the flexible orientation of the proton beam polarization at the PHENM and STAR experiments. At the meeting Waldo discussed a stronger partial snake magnet for the AGS as a means of producing highly polarized proton beams to inject into RHIC. Developments subsequent to this meeting suggest that a superconducting helical dipole magnet may be feasible for the AGS, and is likely to be needed to achieve the 70% beam polarization in RHIC. Longer term items were also presented, including potential increases in luminosity by the addition of electron cooling to RHIC and the possibility of increasing the collision energy by {approx}20% by replacement of the DX magnets. These items could be considered for a second generation of RHIC spin experiments. The other topics covered at the meeting were related to polarimetry and to the absolute calibration of the proton beam polarization in RHIC. These topics were divided into short- and long-term solutions to
Directory of Open Access Journals (Sweden)
Hung-Bin Tsai
2017-07-01
Full Text Available Background Renal supportive care (RSC is an important option for elderly individuals reaching end-stage renal disease; however, the frequency of RSC practice is very low among Asian countries. We evaluated the attitude, the knowledge, and the preference for specific topics concerning RSC among participants who worked in different medical professions in Taiwan. Methods A cross-sectional questionnaire-based survey was employed. Healthcare personnel (N = 598 who were involved in caring for end-stage renal disease patients at more than 40 facilities in Taiwan participated in this study. Participants were asked about their motivation for learning about RSC, the topics of RSC they were most and least interested in, their willingness to provide RSC, and to rate their knowledge and perceived importance of different topics. Results The vast majority of respondents (81.9% were self-motivated about RSC, among whom nephrologists (96.8% and care facilitators (administrators/volunteers (45% exhibited the highest and the least motivation, respectively (p < 0.01. Overall, respondents indicated that they had adequate knowledge about the five pre-specified RSC topics between medical professions (p = 0.04. Medical professions and institutional size exerted significant influence on the willingness to provide RSC. Conclusions Our results facilitate the understanding of the knowledge and attitude toward different RSC topics among varied medical professions, and can guide the design of RSC education content for healthcare personnel.
Directory of Open Access Journals (Sweden)
Zhan-Feng Song
2012-11-01
Full Text Available A novel control strategy is proposed in this paper for the rotor side converter (RSC of doubly-fed induction generator (DFIG-based wind power generation systems. It is supposed to enhance the low-voltage ride-through (LVRT capability of DFIGs during great-level grid voltage dips. The strategy consists of a proportional-resonant (PR controller and auxiliary PR controllers. The auxiliary controllers compensate the output voltage of the RSC in case of grid faults, thus limiting the rotor inrush current of DFIG and meeting the requirements of LVRT. Sequential-component decompositions of current are not required in the control system to improve the response of system. Since the resonant compensator is a double-side integrator, the auxiliary controllers can be simplified through coordinate transformation. The feasibility of the control strategy is validated by simulation on a 1.5 MW wind-turbine driven DFIG system. The impact of the RSC converter voltage rating on the LVRT capability of DFIG is investigated. Meanwhile, the influence of angular frequency detection and control parameters are also discussed. Compared with traditional vector control schemes based on PI current controllers, the presented control strategy effectively suppress rotor current and reduce oscillations of DFIG power and torque under grid faults.
Retrosplenial Cortex and Long-Term Memory: Molecules to Behavior
Directory of Open Access Journals (Sweden)
Travis P. Todd
2015-01-01
Full Text Available The retrosplenial cortex (RSC is reciprocally connected with the hippocampus and various parahippocampal cortical regions, suggesting that RSC is well-positioned to contribute to hippocampal-dependent memory. Consistent with this, substantial behavioral evidence indicates that RSC is essential for consolidating and/or retrieving contextual and spatial memories. In addition, there is growing evidence that RSC neurons undergo activity-dependent plastic changes during memory formation and retrieval. In this paper we review both the behavioral and cellular/molecular data and posit that the RSC has a particularly important role in the storage and retrieval of spatial and contextual memories perhaps due its involvement in binding together multiple cues in the environment. We identify remaining questions and avenues for future research that take advantage of emerging methods to selectively manipulate RSC neurons both spatially and temporally and to image the RSC in awake, behaving animals.
Efficient runner safety assessment during early design phase and root cause analysis
International Nuclear Information System (INIS)
Liang, Q W; Lais, S; Gentner, C; Braun, O
2012-01-01
Fatigue related problems in Francis turbines, especially high head Francis turbines, have been published several times in the last years. During operation the runner is exposed to various steady and unsteady hydraulic loads. Therefore the analysis of forced response of the runner structure requires a combined approach of fluid dynamics and structural dynamics. Due to the high complexity of the phenomena and due to the limitation of computer power, the numerical prediction was in the past too expensive and not feasible for the use as standard design tool. However, due to continuous improvement of the knowledge and the simulation tools such complex analysis has become part of the design procedure in ANDRITZ HYDRO. This article describes the application of most advanced analysis techniques in runner safety check (RSC), including steady state CFD analysis, transient CFD analysis considering rotor stator interaction (RSI), static FE analysis and modal analysis in water considering the added mass effect, in the early design phase. This procedure allows a very efficient interaction between the hydraulic designer and the mechanical designer during the design phase, such that a risk of failure can be detected and avoided in an early design stage.The RSC procedure can also be applied to a root cause analysis (RCA) both to find out the cause of failure and to quickly define a technical solution to meet the safety criteria. An efficient application to a RCA of cracks in a Francis runner is quoted in this article as an example. The results of the RCA are presented together with an efficient and inexpensive solution whose effectiveness could be proven again by applying the described RSC technics. It is shown that, with the RSC procedure developed and applied as standard procedure in ANDRITZ HYDRO such a failure is excluded in an early design phase. Moreover, the RSC procedure is compatible with different commercial and open source codes and can be easily adapted to apply for
Efficient runner safety assessment during early design phase and root cause analysis
Liang, Q. W.; Lais, S.; Gentner, C.; Braun, O.
2012-11-01
Fatigue related problems in Francis turbines, especially high head Francis turbines, have been published several times in the last years. During operation the runner is exposed to various steady and unsteady hydraulic loads. Therefore the analysis of forced response of the runner structure requires a combined approach of fluid dynamics and structural dynamics. Due to the high complexity of the phenomena and due to the limitation of computer power, the numerical prediction was in the past too expensive and not feasible for the use as standard design tool. However, due to continuous improvement of the knowledge and the simulation tools such complex analysis has become part of the design procedure in ANDRITZ HYDRO. This article describes the application of most advanced analysis techniques in runner safety check (RSC), including steady state CFD analysis, transient CFD analysis considering rotor stator interaction (RSI), static FE analysis and modal analysis in water considering the added mass effect, in the early design phase. This procedure allows a very efficient interaction between the hydraulic designer and the mechanical designer during the design phase, such that a risk of failure can be detected and avoided in an early design stage.The RSC procedure can also be applied to a root cause analysis (RCA) both to find out the cause of failure and to quickly define a technical solution to meet the safety criteria. An efficient application to a RCA of cracks in a Francis runner is quoted in this article as an example. The results of the RCA are presented together with an efficient and inexpensive solution whose effectiveness could be proven again by applying the described RSC technics. It is shown that, with the RSC procedure developed and applied as standard procedure in ANDRITZ HYDRO such a failure is excluded in an early design phase. Moreover, the RSC procedure is compatible with different commercial and open source codes and can be easily adapted to apply for
Determining the total cost of reverse supply chain operations for original equipment manufacturers
DEFF Research Database (Denmark)
Larsen, Samuel Brüning; Jacobsen, Peter
2014-01-01
When original equipment manufacturers (OEM) examine whether or not to invest in a reverse supply chain (RSC), managers need insight into not only the cost savings and new revenue streams the RSC enables, but also the total cost of the RSC itself. Using case study research the study examines what...... cost parameters constitute the total cost (TC) of the RSC. The specific RSC that the study seeks the TC for consists of 1) end-product refurbishing, 2) component refurbishing, and 3) sales of used materials back to original suppliers or independent recyclers for materials recycling....
Li, Yu-An; Ji, Zhenying; Wang, Xiaobo; Wang, Shifeng; Shi, Huoying
2017-12-21
Streptococcus suis is one of the major pathogens that cause economic losses in the swine industry worldwide. However, current bacterins only provide limited prophylactic protection in the field. An ideal vaccine against S. suis should protect pigs against the clinical diseases caused by multiple serotypes, or at least protect against the dominant serotype in a given geographic region. A new recombinant Salmonella enterica serotype Choleraesuis vaccine vector, rSC0011, that is based on the regulated delayed attenuation system and regulated delayed antigen synthesis system, was developed recently. In this study, an improved recombinant attenuated Salmonella Choleraesuis vector, rSC0016, was developed by incorporating a sopB mutation to ensure adequate safety and maximal immunogenicity. In the spleens of mice, rSC0016 colonized less than rSC0011. rSC0016 and rSC0011 colonized similarly in Peyer's patches of mice. The recombinant vaccine rSC0016(pS-SaoA) induced stronger cellular, humoral, and mucosal immune responses in mice and swine against SaoA, a conserved surface protein that is present in many S. suis serotypes, than did rSC0011(pS-SaoA) without sopB or rSC0018(pS-SaoA), which is an avirulent, chemically attenuated vaccine strain. rSC0016(pS-SaoA) provided 100% protection against S. suis serotype 2 in mice and pigs, and full cross-protection against SS7 in pigs. This new vaccine vector provides a foundation for the development of a universal vaccine against multiple serotypes of S. suis in pigs.
How the reverse supply chain impacts the firm’s financial performance: A manufacturer’s perspective
DEFF Research Database (Denmark)
Larsen, Samuel Brüning; Masi, Donato; Feibert, Diana Cordes
2018-01-01
Purpose – Although manufacturers have traditionally viewed reverse supply chain (RSC) activities as a costly nuisance, more recent research has found that the RSC can contribute to the firm’s financial performance. This paper identifies how the RSC can contribute to the firm’s financial performance...... identified 15 distinct opportunities for RSC-contribution to the firm’s financial performance. The study has identified 56 contingency factors. These are related to market segmentation, customer behavior, product design, and the firm’s distributor network. The study includes an interrelationship network...... between factors and the RSC’s contribution. Practical implications – For managers, the paper shows how the RSC can increase the firm’s financial performance and which contingency factors determine whether operating a RSC will be financially viable if implemented. Originality/Value – While extant...
Todd, Travis P; Jiang, Matthew Y; DeAngeli, Nicole E; Bucci, David J
2017-03-01
Extinction of fear to a Pavlovian conditioned stimulus (CS) is known to be context-specific. When the CS is tested outside the context of extinction, fear returns, or renews. Several studies have demonstrated that renewal depends upon the hippocampus, although there are also studies where renewal was not impacted by hippocampal damage, suggesting that under some conditions context encoding and/or retrieval of extinction depends upon other regions. One candidate region is the retrosplenial cortex (RSC), which is known to contribute to contextual and spatial learning and memory. Using a conditioned-suppression paradigm, Experiment 1 tested the impact of pre-training RSC lesions on renewal of extinguished fear. Consistent with previous studies, lesions of the RSC did not impact acquisition or extinction of conditioned fear to the CS. Further, there was no evidence that RSC lesions impaired renewal, indicating that contextual encoding and/or retrieval of extinction does not depend upon the RSC. In Experiment 2, post-extinction lesions of either the RSC or dorsal hippocampus (DH) also had no impact on renewal. However, in Experiment 3, both RSC and DH lesions did impair performance in an object-in-place procedure, an index of place memory. RSC and DH contributions to extinction and renewal are discussed. Copyright © 2016 Elsevier B.V. All rights reserved.
Sparse orthogonal population representation of spatial context in the retrosplenial cortex.
Mao, Dun; Kandler, Steffen; McNaughton, Bruce L; Bonin, Vincent
2017-08-15
Sparse orthogonal coding is a key feature of hippocampal neural activity, which is believed to increase episodic memory capacity and to assist in navigation. Some retrosplenial cortex (RSC) neurons convey distributed spatial and navigational signals, but place-field representations such as observed in the hippocampus have not been reported. Combining cellular Ca 2+ imaging in RSC of mice with a head-fixed locomotion assay, we identified a population of RSC neurons, located predominantly in superficial layers, whose ensemble activity closely resembles that of hippocampal CA1 place cells during the same task. Like CA1 place cells, these RSC neurons fire in sequences during movement, and show narrowly tuned firing fields that form a sparse, orthogonal code correlated with location. RSC 'place' cell activity is robust to environmental manipulations, showing partial remapping similar to that observed in CA1. This population code for spatial context may assist the RSC in its role in memory and/or navigation.Neurons in the retrosplenial cortex (RSC) encode spatial and navigational signals. Here the authors use calcium imaging to show that, similar to the hippocampus, RSC neurons also encode place cell-like activity in a sparse orthogonal representation, partially anchored to the allocentric cues on the linear track.
Directory of Open Access Journals (Sweden)
Laura Cabeza García
2013-01-01
by the firms related to their social activities.Research Limitations/implications: Our results should be considered with caution because we have used a specific measure of disclosure of social activities and our study is carried out in a specific country and period of time.Originality/value: A reduced number of studies have analysed the influence of firm ownership structure on the disclosure of social activities, and the existing studies have mainly considered the ownership concentration but not the identity of the largest shareholder.Objeto: Este trabajo pretende profundizar en los determinantes de la divulgación de información sobre las acciones sociales que las empresas realizan. En particular, se centra en el papel que puede jugar un factor apenas considerado hasta el momento como es la estructura de propiedad. Diseño/metodología: Con el objetivo anterior, a partir de una muestra de empresas españolas cotizadas en el año 2008 hemos realizado un análisis de regresión lineal para analizar cómo la identidad del principal accionista de la empresa así como otras características empresariales afectan a la transparencia en RSC. Aportaciones y resultados: En contra de lo esperado, los resultados sugieren que la identidad del principal accionista no afecta a la transparencia informativa en RSC. Por el contrario, son otras características, como el tamaño de la empresa, su nivel de endeudamiento así como su nivel de transparencia en general, las que parecen explicar la transparencia sobre acciones socialmente responsables. Limitaciones: La existencia de otros indicadores de transparencia en RSC así como el haber realizado el estudio en un único país y en un momento temporal concreto, hace necesario ser cautos sobre los hallazgos obtenidos. estudio se encuadra en el ámbito de tres estados mexicanos y por tanto, los datos no son generalizables. El trabajo es un estudio exploratorio que nos aproxima a la realidad de las PYMES de México, no se pueden, por
Wood, Charles L.
Federal legislation mandates that all students with disabilities have meaningful access to the general education curriculum and that students with and without disabilities be held equally accountable to the same academic standards (IDEIA, 2004; NCLB, 2001). Many students with disabilities, however, perform poorly in academic content courses, especially at the middle and secondary school levels. Previous research has reported increased notetaking accuracy and quiz scores over lecture content when students completed guided notes compared to taking their own notes. This study evaluated the effects of a pre-quiz review procedure and specially formatted guided notes on middle school special education students' learning of science vocabulary. This study compared the effects of three experimental conditions. (a) Own Notes (ON), (b) Own Notes+Random Study Checks (ON+RSC), and (c) Guided Notes Study Cards+Random Study Checks (GNSC+RSC) on each student's accuracy of notes, next-day quiz scores, and review quiz scores. Each session, the teacher presented 12 science vocabulary terms and definitions during a lecture and students took notes. The students were given 5 minutes to study their notes at the end of each session and were reminded to study their notes at home and in study hall period. In the ON condition students took notes on a sheet of paper with numbered lines from 1 to 12. Just before each next-day quiz in the ON+RSC condition students used write-on response cards to answer two teacher-posed questions over randomly selected vocabulary terms from the previous day's lecture. If the answer on a randomly selected student's response card was correct, that student earned a lottery ticket for inexpensive prizes and a quiz bonus point for herself and each classmate. In the GNSC+RSC condition students took notes on specially formatted guided notes that after the lecture they cut into a set of flashcards that could used for study. The students' mean notetaking accuracy was 75
Squire, Michael D.
2011-01-01
The Mini-Research Module-2 (MRM-2), a Russian module on the International Space Station, does not meet its requirements for micrometeoroid and orbital debris probability of no penetration (PNP). To document this condition, the primary Russian Federal Space Agency ISS contractor, S.P. Korolev Rocket and Space Corporation-Energia (RSC-E), submitted an ISS non-compliance report (NCR) which was presented at the 5R Stage Operations Readiness Review (SORR) in October 2009. In the NCR, RSC-E argued for waiving the PNP requirement based on several factors, one of which was the risk of catastrophic failure was acceptably low at 1 in 11,100. However, NASA independently performed an assessment of the catastrophic risk resulting in a value of 1 in 1380 and believed that the risk at that level was unacceptable. The NASA Engineering and Safety Center was requested to evaluate the two competing catastrophic risk values and determine which was more accurate. This document contains the outcome of the assessment.
Directory of Open Access Journals (Sweden)
Pedro Ramiro Pérez
2012-06-01
pobreza y desarrollo humano y sostenible». En este contexto, las organizaciones no gubernamentales de desarrollo se enfrentan a un debate con múltiples aristas: ¿cómo ha de ser la relación de las ONGD con las empresas multinacionales? ¿Tienen que apoyar a las empresas que afirman actuar éticamente y de forma responsable? Con el objetivo último de luchar contra la pobreza, ¿es necesario tejer una alianza entre el “sector privado” y el mundo de la cooperación al desarrollo? Todo ello, en torno a una pregunta central: ¿cuál ha de ser el papel de las ONGD a la hora de llevar a la práctica las políticas de Responsabilidad Social Corporativa (RSC?En el presente trabajo se expone cuál ha sido la evolución que ha experimentado la agenda de la cooperación internacional en la última década en cuanto a la toma en consideración de las grandes corporaciones como agentes de desarrollo. Y es que, partiendo del paradigma de la RSC, las empresas transnacionales y los organismos internacionales han venido articulando un discurso que apuesta por la incorporación del “sector privado” en las estrategias de cooperación como motor de los objetivos de desarrollo humano y de lucha contra la pobreza. Asimismo, en las siguientes páginas se muestran las distintas visiones que, en este marco, existen en el sector de la cooperación al desarrollo, dedicando una especial atención a la caracterización del posicionamiento que las ONGD han ido desarrollando en torno a las posibilidades de colaboración con las empresas transnacionales, así como a algunos ejemplos de “alianzas público-privadas para el desarrollo” puestos en marcha por compañías multinacionales y organizaciones no gubernamentales del Estado español.DOWNLOAD THIS PAPER FROM SSRN: http://ssrn.com/abstract=2083467
Market Assessment and Commercialization Strategy for the Radial Sandia Cooler
Energy Technology Data Exchange (ETDEWEB)
Goetzler, William [Navigant Consulting, Inc., Burlington, MA (United States); Shandross, Richard [Navigant Consulting, Inc., Burlington, MA (United States); Weintraub, Daniel [Navigant Consulting, Inc., Burlington, MA (United States); Young, Jim [Navigant Consulting, Inc., Burlington, MA (United States)
2014-02-01
This market assessment and commercialization report characterizes and assesses the market potential of the rotating heat exchanger technology developed at Sandia National Laboratories (SNL), known as the Radial Sandia Cooler. The RSC is a novel, motor-driven, rotating, finned heat exchanger technology. The RSC was evaluated for the residential, commercial, industrial, and transportation markets. Recommendations for commercialization were made based on assessments of the prototype RSC and the Sandia Cooler technology in general, as well as an in-depth analysis of the six most promising products for initial RSC commercialization.
Prediction of the strength of concrete radiation shielding based on LS-SVM
International Nuclear Information System (INIS)
Juncai, Xu; Qingwen, Ren; Zhenzhong, Shen
2015-01-01
Highlights: • LS-SVM was introduced for prediction of the strength of RSC. • A model for prediction of the strength of RSC was implemented. • The grid search algorithm was used to optimize the parameters of the LS-SVM. • The performance of LS-SVM in predicting the strength of RSC was evaluated. - Abstract: Radiation-shielding concrete (RSC) and conventional concrete differ in strength because of their distinct constituents. Predicting the strength of RSC with different constituents plays a vital role in radiation shielding (RS) engineering design. In this study, a model to predict the strength of RSC is established using a least squares-support vector machine (LS-SVM) through grid search algorithm. The algorithm is used to optimize the parameters of the LS-SVM on the basis of traditional prediction methods for conventional concrete. The predicted results of the LS-SVM model are compared with the experimental data. The results of the prediction are stable and consistent with the experimental results. In addition, the studied parameters exhibit significant effects on the simulation results. Therefore, the proposed method can be applied in predicting the strength of RSC, and the predicted results can be adopted as an important reference for RS engineering design
DEFF Research Database (Denmark)
Sahlin, Kent; Nielsen, Jens Steen; Mogensen, Martin
2006-01-01
Repeated static contractions (RSC) induce large fluctuations in tissue oxygen tension and increase the generation of reactive oxygen species (ROS). This study investigated the effect of RSC on muscle contractility, mitochondrial respiratory function, and in vitro sarcoplasmic reticulum (SR) Ca(2......+) kinetics in human muscle. Ten male subjects performed five bouts of static knee extension with 10-min rest in between. Each bout of RSC (target torque 66% of maximal voluntary contraction torque) was maintained to fatigue. Muscle biopsies were taken preexercise and 0.3 and 24 h postexercise from vastus...... lateralis. Mitochondria were isolated and respiratory function measured after incubation with H(2)O(2) (HPX) or control medium (Con). Mitochondrial function was not affected by RSC during Con. However, RSC exacerbated mitochondrial dysfunction during HPX, resulting in decreased respiratory control index...
CORPORATE SOCIAL RESPONSIBILITY IN THE MINING INDUSTRY: CRITERIA AND INDICATORS
Directory of Open Access Journals (Sweden)
CARLA VINTRÓ
2010-01-01
Full Text Available La Responsabilidad Social Corporativa (RSC incluye aspectos económicos, sociales y medioambientales, y tiene especial importancia en la minería. En este artículo se explora la disciplina de RSC en la industria minera y las sinergias principales con los sistemas de gestión medioambiental, de seguridad y de calidad, la adopción de los cuales ha aumentado durante las últimas décadas. Se propone el establecimiento de un conjunto de criterios de sostenibilidad, ética y capital humano (denominados criterios de RSC. Distintos organismos internacionales han propuesto guías e indicadores de RSC (normalmente utilizados como referencias para cotizaciones bursátiles, pero hay evidencias que el tamaño de la empresa puede actuar como factor moderador en la adopción de estos sistemas. En el artículo se presenta un cuadro de control de RSC fácil de utilizar (formado por 31 indicadores y un índice global, pensado como una medida interna de la mejora continua de la RSC de las empresas.
Directory of Open Access Journals (Sweden)
Sang-Woo Joo
2008-03-01
Full Text Available In this study, the sorptive behavior of reduced sulfur compounds (RSC was investigated using a combination of thermal desorber (TD unit and gas chromatography (GC. To examine the sorptive properties of RSC on textile materials, two types of experiments were conducted under experimental conditions favorable for sorptive processes. In all the experiments, gaseous standards of hydrogen sulfide, methanethiol, dimethyl sulfide, and dimethyl disulfide were supplied to initiate the adsorption processes on textile pieces. The textile pieces were then forced to release those adsorbed RSC under a fixed condition. It was found that the extent of adsorption, if evaluated quantitatively, occurred at approximately 1/1000 to 1/100 of the level of RSC standards supplied originally to induce adsorption. It also indicated that RSC adsorption was affected very sensitively by the initial exposure durations to induce RSC adsorption with an exponential decrease in relative recovery (RR values with increasing exposure time. The relative sorptive patterns, when compared between different RSCs, were affected most sensitively by such factors as molecular weight and/or physical contact conditions.
How the reverse supply chain enables original equipment manufacturers to compete on low price
DEFF Research Database (Denmark)
Larsen, Samuel; Jacobsen, Peter
2015-01-01
-attached services, the purpose of this paper is to examine the relationship between the firm’s RSC processes and overall operating costs. The paper asks the question of how a firm’s RSC processes enable continuous operating cost reductions. The paper’s research method combines a literature review of known RSC......Low price is perhaps the most widely present competitive parameter forcing firms to continuously reduce their operating costs. While much literature has investigated how firms can use their reverse supply chain (RSC) processes to comply with regulations or offer RSC-enabled product......-enabled cost reduction opportunities with a multiple case study that explores unknown opportunities. The most used cost reduction opportunity among the six firms in the study’s case sample is reducing operating costs by replacing purchasing of virgin materials and internal production with recovery of used...
Salaj, Martin; Druga, Rastislav; Cerman, Jiří; Kubová, Hana; Barinka, Filip
2015-11-19
The retrosplenial cortex (RSC) is a mesocortical region broadly involved with memory and navigation. It shares many characteristics with the perirhinal cortex (PRC), both of which appear to be significantly involved in the spreading of epileptic activity. We hypothesized that RSC possesses an interneuronal composition similar to that of PRC. To prove the hypothesis we studied the general pattern of calretinin (CR) and parvalbumin (PV) immunoreactivity in the RSC of the rat brain, its optical density as well as the morphological features and density of CR- and PV-immunoreactive (CR+ and PV+) interneurons. We also analyzed the overall neuronal density on Nissl-stained sections in RSC. Finally, we compared our results with our earlier analysis of PRC (Barinka et al., 2012). Compared to PRC, RSC was observed to have a higher intensity of PV staining and lower intensity of CR staining of neuropil. Vertically-oriented bipolar neurons were the most common morphological type among CR+ neurons. The staining pattern did not allow for a similarly detailed analysis of somatodendritic morphology of PV+ neurons. RSC possessed lower absolute (i.e., neurons/mm(3)) and relative (i.e., percentage of the overall neuronal population) densities of CR+ neurons and similar absolute and lower relative densities of PV+ neurons relative to PRC. CR: PV neuronal ratio in RSC (1:2 in area 29 and 1:2.2 in area 30) differed from PRC (1:1.2 in area 35 and 1:1.7 in area 36). In conclusion, RSC, although similar in many aspects to PRC, differs strikingly in the interneuronal composition relative to PRC. Copyright © 2015 Elsevier B.V. All rights reserved.
Cues, context, and long-term memory: the role of the retrosplenial cortex in spatial cognition
Directory of Open Access Journals (Sweden)
Adam M P Miller
2014-08-01
Full Text Available Spatial navigation requires representations of landmarks and other navigation cues. The retrosplenial cortex (RSC is anatomically positioned between limbic areas important for memory formation, such as the hippocampus and the anterior thalamus, and cortical regions along the dorsal stream known to contribute importantly to long-term spatial representation, such as the posterior parietal cortex. Damage to the RSC severely impairs allocentric representations of the environment, including the ability to derive navigational information from landmarks. The specific deficits seen in tests of human and rodent navigation suggest that the RSC supports allocentric representation by processing the stable features of the environment and the spatial relationships among them. In addition to spatial cognition, the RSC plays a key role in contextual and episodic memory. The RSC also contributes importantly to the acquisition and consolidation of long-term spatial and contextual memory through its interactions with the hippocampus. Within this framework, the RSC plays a dual role as part of the feedforward network providing sensory and mnemonic input to the hippocampus and as a target of the hippocampal-dependent systems consolidation of long-term memory.
Cues, context, and long-term memory: the role of the retrosplenial cortex in spatial cognition.
Miller, Adam M P; Vedder, Lindsey C; Law, L Matthew; Smith, David M
2014-01-01
Spatial navigation requires memory representations of landmarks and other navigation cues. The retrosplenial cortex (RSC) is anatomically positioned between limbic areas important for memory formation, such as the hippocampus (HPC) and the anterior thalamus, and cortical regions along the dorsal stream known to contribute importantly to long-term spatial representation, such as the posterior parietal cortex. Damage to the RSC severely impairs allocentric representations of the environment, including the ability to derive navigational information from landmarks. The specific deficits seen in tests of human and rodent navigation suggest that the RSC supports allocentric representation by processing the stable features of the environment and the spatial relationships among them. In addition to spatial cognition, the RSC plays a key role in contextual and episodic memory. The RSC also contributes importantly to the acquisition and consolidation of long-term spatial and contextual memory through its interactions with the HPC. Within this framework, the RSC plays a dual role as part of the feedforward network providing sensory and mnemonic input to the HPC and as a target of the hippocampal-dependent systems consolidation of long-term memory.
International Nuclear Information System (INIS)
Yang, Cheng-Lang; Lin, Hung-Pin; Chang, Chih-Heng
2010-01-01
This study investigates the linear and nonlinear causality between the total electricity consumption (TEC) and real gross domestic production (RGDP). Unlike previous literature, we solve the undetermined relation between RGDP and electricity consumption by classifying TEC into industrial sector consumption (ISC) and residential sector consumption (RSC) as well as investigating how TEC, ISC, and RSC influence Taiwan's RGDP. By using the Granger's linear causality test, it is shown that (i) there is a bidirectional causality among TEC, ISC, and RGDP, but a neutrality between RSC and RGDP with regard to the linear causality and (ii) there is still a bidirectional causality between TEC and RGDP, but a unidirectional causality between RSC and RGDP with regard to the nonlinear causality. On the basis of (i) and (ii), we suggest that the electricity policy formulators loosen the restriction on ISC and limit RSC in order to achieve the goal of economic growth.
Chen, Y. G.; Yang, H.; Zhang, B. Q.; Liu, Y. L.; Yin, J. C.; Wei, W.; Zhong, Y.
2017-02-01
A novel restraint spraying-Conform (RS-C) process, which directly combines spraying with Conform to process metals in one step, has been proposed. Al-20Si alloy selected as experimental material was successfully fabricated by the RS-C process. The microstructures were dominated with fine and uniform primary silicon phases. The tensile strength and elongation to failure of the Al-20Si alloy were 204 MPa and 7.2% respectively after the RS-C process. The wear resistance of the processed Al-20Si alloy was increased significantly, about 1.7 times over the as-cast ingot. The experimental results indicate that RS-C is a promising near net shape forming technology.
Directory of Open Access Journals (Sweden)
Andrés Navarro
2010-07-01
Full Text Available Las prácticas de divulgación de Responsabilidad Social Corporativa (RSC son cada vez más utilizadas por las grandes compañías como instrumentos para eliminar las asimetrías de información entre los stakeholders. En el caso de las administraciones públicas, aunque las exigencias de los ciudadanos son cada vez mayores en materia de transparencia y de rendición de cuentas, la difusión de información RSC es un tema todavía poco estudiado. Este trabajo pretende realizar una primera aproximación a la difusión de información RSC en las administraciones locales españolas y su finalidad principal es conocer las debilidades y fortalezas que, en materia de RSC, tienen los sistemas de información de estas entidades, identificando oportunidades de mejora que orienten futuras investigaciones. Para ello, hemos analizado los sitios web de 55 grandes gobiernos locales, obteniendo conclusiones sobre la difusión de información general acerca de RSC así como sobre la publicación de información económica, social y medioambiental. Los resultados revelan que las mayores carencias de publicación de información RSC corresponden a la información medioambiental, mientras que la información social es la más divulgada. Asimismo, el tamaño de la entidad, la competencia política y el signo del partido gobernante, no explican el desarrollo de las prácticas de difusión de información RSC.
Tincati, Camilla; Biasin, Mara; Bandera, Alessandra; Violin, Michela; Marchetti, Giulia; Piacentini, Luca; Vago, Gian Luca; Balotta, Claudia; Moroni, Mauro; Franzetti, Fabio; Clerici, Mario; Gori, Andrea
2009-01-01
During the acute phase of HIV infection, large CD4+ T-cell depletion occurs in the gastrointestinal tract. The kinetics of CD4+ T-cell decrease and highly active antiretroviral therapy (HAART)-mediated immune reconstitution were evaluated. Rectosigmoid colonic (RSC) biopsies and blood samples of nine patients with acute HIV infection were collected. CD4+ T-cell count, HIV RNA, intracellular HIV DNA and messenger RNA cytokine expression were evaluated before and after 6 months of HAART. All nine patients presented symptomatic retroviral infection. Early HAART was associated with a sustained and comparable reduction of HIV RNA in plasma, peripheral blood mononuclear cells (PBMCs) and RSC biopsies. HIV DNA decreased in PBMCs, but was only marginally reduced in RSC biopsies. Comparisons between reduction rates of HIV DNA in these two compartments confirmed that HIV DNA clearance was less efficient in RSC biopsies compared with PBMCs. Assessment of immunological profiles in PBMCs and RSC biopsies showed that the T-helper (Th)1-like/Th2-like ratio was sharply decreased in RSC biopsies and increased in PBMCs throughout the study period. A persistent Th2-like profile was detected in RSC biopsies. Efficient clearing of HIV DNA observed in PBMCs correlated with the establishment of a more favourable Th1-like profile. A less efficient clearance of intracellular HIV DNA following early introduction of HAART is associated with persistent immunological impairment in gut-associated lymphoid tissue (GALT), which is reflected by the skewed expression of cytokines in this reservoir. The present study shows that early initiation of HAART, in the short-term, is not effective in containing the establishment of HIV infection and in reversing associated immunological GALT abnormalities.
Refinement Types for TypeScript
Vekris, Panagiotis; Cosman, Benjamin; Jhala, Ranjit
2016-01-01
We present Refined TypeScript (RSC), a lightweight refinement type system for TypeScript, that enables static verification of higher-order, imperative programs. We develop a formal core of RSC that delineates the interaction between refinement types and mutability. Next, we extend the core to account for the imperative and dynamic features of TypeScript. Finally, we evaluate RSC on a set of real world benchmarks, including parts of the Octane benchmarks, D3, Transducers, and the TypeScript co...
39 CFR 6.1 - Regular meetings, annual meeting.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Regular meetings, annual meeting. 6.1 Section 6.1 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE MEETINGS (ARTICLE VI) § 6.1 Regular meetings, annual meeting. The Board shall meet regularly on a schedule...
Linking pre-meeting communication to meeting effectiveness
Allen, J.A.; Lehmann-Willenbrock, N.K.; Landowski, N.
2014-01-01
Purpose – The purpose of this paper is to investigate the importance of communication that occurs just before workplace meetings (i.e. pre-meeting talk). The paper explores how four specific types of pre-meeting talk (small talk, work talk, meeting preparatory talk, and shop talk) impact
Meetings and meeting modeling in smart surroundings
op den Akker, Hendrikus J.A.; Heylen, Dirk K.J.; Nijholt, Antinus; Nishida, T.
2004-01-01
In this paper we survey our research on smart meeting rooms and its relevance for augmented reality meeting support and virtual reality generation of meetings in real-time or off-line. Intelligent real-time and off-line generation requires understanding of what is going on during a meeting. The
Meetings and Meeting Modeling in Smart Environments
Nijholt, Antinus; op den Akker, Hendrikus J.A.; Heylen, Dirk K.J.
In this paper we survey our research on smart meeting rooms and its relevance for augmented reality meeting support and virtual reality generation of meetings in real time or off-line. The research reported here forms part of the European 5th and 6th framework programme projects multi-modal meeting
Energy Technology Data Exchange (ETDEWEB)
Lv, Jianwei [General Hospital of Tianjin Medical University, No. 154, Anshan Road, Heping District, Tianjin 300052 (China); Tianjin Institute of Orthopedics in Traditional Chinese and Western Medicine, No. 155, Munan Road, Tianjin 300050 (China); Sun, Xiaolei; Ma, Jianxiong [Tianjin Institute of Orthopedics in Traditional Chinese and Western Medicine, No. 155, Munan Road, Tianjin 300050 (China); Ma, Xinlong, E-mail: gengxiao502@163.com [General Hospital of Tianjin Medical University, No. 154, Anshan Road, Heping District, Tianjin 300052 (China); Tianjin Institute of Orthopedics in Traditional Chinese and Western Medicine, No. 155, Munan Road, Tianjin 300050 (China); Zhang, Yang; Li, Fengbo; Li, Yanjun; Zhao, Zhihu [Tianjin Institute of Orthopedics in Traditional Chinese and Western Medicine, No. 155, Munan Road, Tianjin 300050 (China)
2015-08-14
Schwann cells (SCs) play an essentially supportive role in the regeneration of injured peripheral nerve system (PNS). As Netrin-1 is crucial for the normal development of nervous system (NS) and can direct the process of damaged PNS regeneration, our study was designed to determine the role of Netrin-1 in RSC96 Schwann cells (an immortalized rat Schwann cell line) proliferation and migration. Our studies demonstrated that Netrin-1 had no effect on RSC96 cells proliferation, while significantly promoted RSC96 cells migration. The Netrin-1-induced RSC96 cells migration was significantly attenuated by inhibition of p38 and PI3K through pretreatment with SB203580 and LY294002 respectively, but not inhibition of MEK1/2 and JNK by U0126-EtOH and SP600125 individually. Treatment with Netrin-1 enhanced the phosphorylation of p38 and Akt. QRT-PCR indicated that Netrin-1 and only its receptors Unc5a, Unc5b and Neogenin were expressed in RSC96 cells, among which Unc5b expressed the most. And UNC5B protein was significantly increased after stimulated by Netrin-1. In conclusion, we show here that Netrin-1-enhanced SCs migration is mediated by activating p38 MAPK and PI3K-Akt signal cascades via receptor UNC5B, which suggests that Netrin-1 could serve as a new therapeutic strategy and has potential application value for PNS regeneration. - Highlights: • Netrin-1 attracts RSC96 Schwann cells migration in a dose dependent manner. • Netrin-1 induced Schwann cells migration is p38 and PI3K-Akt signaling dependent. • UNC5B may be dominant receptor mediating Netrin-1′ effect on RSC96 cells motility. • Netrin-1 may promote peripheral nerve repair by enhancing Schwann cells motility.
Comparison of Software Models for Energy Savings from Cool Roofs
Energy Technology Data Exchange (ETDEWEB)
New, Joshua Ryan [ORNL; Miller, William A [ORNL; Huang, Yu (Joe) [White Box Technologies; Levinson, Ronnen [Lawrence Berkeley National Laboratory (LBNL)
2014-01-01
A web-based Roof Savings Calculator (RSC) has been deployed for the United States Department of Energy as an industry-consensus tool to help building owners, manufacturers, distributors, contractors and researchers easily run complex roof and attic simulations. This tool employs modern web technologies, usability design, and national average defaults as an interface to annual simulations of hour-by-hour, whole-building performance using the world-class simulation tools DOE-2.1E and AtticSim in order to provide estimated annual energy and cost savings. In addition to cool reflective roofs, RSC simulates multiple roof and attic configurations including different roof slopes, above sheathing ventilation, radiant barriers, low-emittance roof surfaces, duct location, duct leakage rates, multiple substrate types, and insulation levels. A base case and energy-efficient alternative can be compared side-by-side to estimate monthly energy. RSC was benchmarked against field data from demonstration homes in Ft. Irwin, California; while cooling savings were similar, heating penalty varied significantly across different simulation engines. RSC results reduce cool roofing cost-effectiveness thus mitigating expected economic incentives for this countermeasure to the urban heat island effect. This paper consolidates comparison of RSC s projected energy savings to other simulation engines including DOE-2.1E, AtticSim, Micropas, and EnergyPlus, and presents preliminary analyses. RSC s algorithms for capturing radiant heat transfer and duct interaction in the attic assembly are considered major contributing factors to increased cooling savings and heating penalties. Comparison to previous simulation-based studies, analysis on the force multiplier of RSC cooling savings and heating penalties, the role of radiative heat exchange in an attic assembly, and changes made for increased accuracy of the duct model are included.
Lin, Chin-Teng; Chiu, Te-Cheng; Wang, Yu-Kai; Chuang, Chun-Hsiang; Gramann, Klaus
2018-01-15
Studies on spatial navigation demonstrate a significant role of the retrosplenial complex (RSC) in the transformation of egocentric and allocentric information into complementary spatial reference frames (SRFs). The tight anatomical connections of the RSC with a wide range of other cortical regions processing spatial information support its vital role within the human navigation network. To better understand how different areas of the navigational network interact, we investigated the dynamic causal interactions of brain regions involved in solving a virtual navigation task. EEG signals were decomposed by independent component analysis (ICA) and subsequently examined for information flow between clusters of independent components (ICs) using direct short-time directed transfer function (sdDTF). The results revealed information flow between the anterior cingulate cortex and the left prefrontal cortex in the theta (4-7 Hz) frequency band and between the prefrontal, motor, parietal, and occipital cortices as well as the RSC in the alpha (8-13 Hz) frequency band. When participants prefered to use distinct reference frames (egocentric vs. allocentric) during navigation was considered, a dominant occipito-parieto-RSC network was identified in allocentric navigators. These results are in line with the assumption that the RSC, parietal, and occipital cortices are involved in transforming egocentric visual-spatial information into an allocentric reference frame. Moreover, the RSC demonstrated the strongest causal flow during changes in orientation, suggesting that this structure directly provides information on heading changes in humans. Copyright © 2017 Elsevier B.V. All rights reserved.
Two New Reformulation Convexification Based Hierarchies for 0-1 MIPs
Directory of Open Access Journals (Sweden)
Hacene Ouzia
2015-01-01
Full Text Available First, we introduce two new reformulation convexification based hierarchies called RTC and RSC for which the rank d continuous relaxations are denoted by P^RTCd and P^RSCd, respectively. These two hierarchies are obtained using two different convexification schemes: term convexification in the case of the RTC hierarchy and standard convexification in the case of the RSC hierarchy. Secondly, we compare the strength of these two hierarchies. We will prove that (i the hierarchy RTC is equivalent to the RLT hierarchy of Sherali-Adams, (ii the hierarchy RTC dominates the hierarchy RSC, and (iii the hierarchy RSC is dominated by the Lift-and-Project hierarchy. Thirdly, for every rank d, we will prove that convTd∩Etd⊆P^RTCd⊆Td and convSd∩Esd⊆P^RSCd⊆Sd where the sets Td and Sd are convex, while Etd and Esd are two nonconvex sets with empty interior (all these sets depend on the convexification step. The first inclusions allow, in some cases, an explicit characterization (in the space of the original variables of the RLT relaxations. Finally, we will discuss weak version of both RTC and RSC hierarchies and we will emphasize some connections between them.
How manufacturers can use their reverse supply chain: a typology of reverse supply chain roles
DEFF Research Database (Denmark)
Larsen, Samuel; Jacobsen, Peter
2014-01-01
While traditional forward supply chains end with customer markets, the reverse supply chain (RSC) both begins and ends with the firm’s markets. The study applies the prevalent conceptual RSC‐description in the theoretical field by Guide and Van Wassenhove (2009). In the description, the RSC begins...... is not explicitly part of the description, this study does include them as disposition strategies. Although some RSC topics have been fairly well‐addressed in extant literature (e.g. product acquisition, inventory models and product disassembly), the RSC‐topic remains under‐explored (Pohkarel and Mutha, 2009...... the reverse logistical processes required for supporting a liberal return policy, etc. Based on extant literature from the supply chain management and OM fields, this study develops a conceptual typology of what roles the RSC can play in the firm’s efforts of achieving higher overall economic profits. Each...
Yang, Wen-Tao; Zhou, Hang; Gu, Jiao-Feng; Zeng, Qing-Ru; Liao, Bo-Han
2017-11-01
A soil spiking experiment at two Cd levels (0.72 and 5.20 mg kg -1 ) was conducted to investigate the effects of rapeseed cake (RSC) at application rates of 0%, 0.75%, 1.5%, and 3.0% (w/w) on iron plaque formation and Cd uptake by rice (Oryza sativa L.) seedlings. The use of RSC did result in a sharp decrease in soil bioavailability of Cd and a significant increase in rice growth, soil pH and organic matter. Application of RSC increased the amount of iron plaque formation and this effectively inhibited the uptake and translocation of Cd into the rice seedlings. RSC was an effective organic additive for increasing rice growth and reducing Cd uptake by rice plant, simultaneously. These results could be used as a reference for the safety use of Cd polluted paddy soil.
The profit potential in reverse supply chain functions for catalyst manufacturers
DEFF Research Database (Denmark)
Larsen, Samuel; Sorth-Olsen, Rasmus; Honoré, Aske Lykke
The reverse supply chain (RSC) contains inherent uncertainties, e.g. the quality level and return volume of used products. By contrast, the catalyst manufacturing industry is characterized by Certainty (manifested in e.g. well-defined and highly controlled production – processes and widespread...... standardization). This paper’s purpose is to examine whether RSC – processes can be profitably applied in this industry. Using case study research the paper examines which RSC - functions that are generally available to manufacturers are profitable for a selected catalyst manufacturer. Results show three...
78 FR 2961 - Sunshine Act Meeting-Closed Meeting
2013-01-15
... COMMODITY FUTURES TRADING COMMISSION Sunshine Act Meeting--Closed Meeting The following notice of a closed meeting is published pursuant to the provisions of the Government in the Sunshine Act, Public Law 94- 409, 5 U.S.C. 552b. AGENCY HOLDING THE MEETING: Commodity Futures Trading Commission. TIME...
78 FR 6306 - Sunshine Act Meeting-Closed Meeting
2013-01-30
... COMMODITY FUTURES TRADING COMMISSION Sunshine Act Meeting--Closed Meeting The following notice of a closed meeting is published pursuant to the provisions of the Government in the Sunshine Act, Public Law 94- 409, 5 U.S.C. 552b. AGENCY HOLDING THE MEETING: Commodity Futures Trading Commission. TIME...
Directory of Open Access Journals (Sweden)
Manuel Larrán Jorge
2015-01-01
Full Text Available Los sucesivos escándalos empresariales han puesto de manifiesto que no es suficiente con la formación exclusivamente técnica que se ofrece a los profesionales de la contabilidad, planteándose así la necesidad de proporcionar una formación en parámetros de responsabilidad social corporativa (RSC. Es por ello que la principal finalidad del presente trabajo es analizar si existen diferencias significativas en la oferta de asignaturas de RSC y de ética empresarial entre las titulaciones de finanzas y contabilidad y el resto de titulaciones relacionadas con la gestión de organizaciones ofertadas por las universidades españolas durante el curso académico 2011/2012. Adicionalmente, se pretende determinar la influencia que tiene en la presencia de asignaturas de RSC y de ética empresarial la naturaleza pública o privada de las universidades españolas, así como si las titulaciones son de grado o posgrado. Los resultados ponen de manifiesto la falta de diferencias significativas en la oferta de asignaturas de RSC y de ética empresarial entre titulaciones ligadas al ámbito contable y el resto de titulaciones relacionadas con la gestión de organizaciones. No obstante, se han obtenido evidencias estadísticamente significativas que infieren la mayor presencia de asignaturas de RSC y de ética empresarial en las titulaciones de grado, así como la mayor inclinación de las universidades privadas por ofertar asignaturas de RSC, principalmente con un enfoque orientado a la ética empresarial.
Yager, Joel; Katzman, Jeffrey W
2017-12-01
Although meetings are central to organizational work, considerable time devoted to meetings in Academic Health Centers appears to be unproductively spent. The primary purposes of this article are to delineate and describe Meeting Disorders, pathological processes resulting in these inefficient and ineffective scenarios, and Meeting Fatigue Disorder (MFD), a clinical syndrome. The paper also offers preliminary approaches to remedies. The authors integrate observations made during tens of thousands of hours in administrative meetings in academic medical settings with information in the literature regarding the nature, causes and potential interventions for dysfunctional groups and meetings. Meeting Disorders, resulting from distinct pathologies of leadership and organization, constitute prevalent subgroups of the bureaucrapathologies, pathological conditions caused by dysfunctional bureaucratic processes that generate excesses of wasted time, effort, and other resources. These disorders also generate frustration and demoralization among participants, contributing to professional burnout. Meeting Fatigue Disorder (MFD) is a subjective condition that develops in individuals who overdose on these experiences and may reflect one manifestation of burnout. Meeting disorders and Meeting Fatigue Disorder occur commonly in bureaucratic life. Resources and potential remedies are available to help ameliorate their more deleterious effects.
29 CFR 2701.2 - Open meetings policy; closure of meetings.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Open meetings policy; closure of meetings. 2701.2 Section... GOVERNMENT IN THE SUNSHINE ACT REGULATIONS § 2701.2 Open meetings policy; closure of meetings. (a) Policy. Commission meetings will generally be open to public observation, including meetings concerning the...
MRN1 implicates chromatin remodeling complexes and architectural factors in mRNA maturation
DEFF Research Database (Denmark)
Düring, Louis; Thorsen, Michael; Petersen, Darima
2012-01-01
A functional relationship between chromatin structure and mRNA processing events has been suggested, however, so far only a few involved factors have been characterized. Here we show that rsc nhp6¿¿ mutants, deficient for the function of the chromatin remodeling factor RSC and the chromatin....... Genetic interactions are observed between 2 µm-MRN1 and the splicing deficient mutants snt309¿, prp3, prp4, and prp22, and additional genetic analyses link MRN1, SNT309, NHP6A/B, SWI/SNF, and RSC supporting the notion of a role of chromatin structure in mRNA processing....
Energy Technology Data Exchange (ETDEWEB)
Fernandez Krekeler, Ubaldo [Administracion Nacional de Electricidad (ANDE), Asuncion (Paraguay)]. E-mail: ufernandez@ieee.org; Cardozo Sanchez, Freddy [Mirant Americas (United States)
2001-07-01
This work presents a determination verification of the compensation range and the location of reactive static compensator (RSC) in 220 kV. The verification is accomplished by analyses of the RSC effects in relation to the losses, loading and system voltage stability. The needed compensation range is investigated in full details, whereas that the required conversion level is directly related to this range. It is concluded that the RSC installation, foreseen for 2002, might be postponed for 2005/10 still without reinforcements in 500 kV. The Limpio substation seems to be the more suitable location in relation to the most analysed cases.
International Nuclear Information System (INIS)
Lauch, R.P.; Mangelson, K.A.
1988-08-01
A radium-removal treatment plant was constructed for the small community of Redhill Forest in the central mountains of Colorado. The plant consists of iron removal using oxidation, filtration, and settling; radium and hardness removal using ion exchange; and radium removal from the waste brine using Dow Chemical Company's Radium Selective Complexer (RSC). The raw water comes from deep wells and has naturally occuring radium and iron concentrations of about 30-40 pC/L and 7-10 mg/L, respectively, and is aerated before entering the main treatment plant to remove radon gas and carbon dioxide. A unique feature of the plant is the process that removes radium from the waste brine. The process removes only radium from the spent ion-exchange regeneration water by permanently complexing the radium on the RSC. The RSC is replaced when exhausted and sent to a final disposal site that is acceptable to state regulatory agencies. The overall plant reduces radium from about 35 pCi/L to less than 4 pCi/L. The RSC system has consistently removed over 99% of the radium from the spent ion exchange regenerant. The average inflow radium concentration to the RSC was about 1180 pCi/L, and the average effluent was about 9 pCi/L
75 FR 73083 - Sunshine Act Meeting; Open Commission Meeting
2010-11-29
... FEDERAL COMMUNICATIONS COMMISSION Sunshine Act Meeting; Open Commission Meeting November 30, 2010. The Federal Communications Commission will hold an Open Meeting on the subjects listed below on... demonstrate accessibility technologies. The meeting site is fully accessible to people using wheelchairs or...
America’s Access to Space: Assuring Future Affordability
2010-12-01
multinational endeavor established in 1995 between The Boeing Company’s Space Systems, Russia’s RSC- Energia , Norway’s Aker Kvaerner, and Ukrainian’s...50 The Sea Launch system centers around the Zenit-3SL rocket system built cooperatively between Russia’s RSC Energia , the Ukraine’s SDO
Gallen, Robert T.; Ash, Jordana; Smith, Conner; Franco, Allison; Willford, Jennifer A.
2016-01-01
Reflective supervision and consultation (RS/C) is often defined as a "relationship for learning"(Fenichel, 1992, p.9). As such, measurement tools should include the perspective of each participant in the supervisory relationship when assessing RS/C fidelity, delivery quality, and the supervisee's experience. The Reflective Supervision…
Profits in reverse? An examination of the decisive factors for reverse supply chain profitability
DEFF Research Database (Denmark)
Larsen, Samuel; Jacobsen, Peter
2015-01-01
Although the concept of the reverse supply chain (RSC) is not unknown in industry, an inhibitor for its successful use is low (or no) profitability. A research challenge is investigating ways to establish the RSC as a profit-creating center in the organization. This paper contributes...
Directory of Open Access Journals (Sweden)
Aharon Tziner
2013-01-01
Full Text Available La investigación reciente ha indicado que la Responsabilidad Social Corporativa (RSC es beneficiosa para las organizaciones: la CSR facilita las actitudes, las conductas y la productividad de los empleados en el trabajo y también contribuye a la rentabilidad de las compañías. Recientemente, Aguinis y Glavas (2013 avanzaron una distinción innovadora entre la RSC periférica y la incorporada y convincentemente demos- traron cómo esta distinción podría ayudar a clarificar la incoherencia en la literatura académica asociada a la relación de la RSC con sus antecedentes y resultados. Sin embargo, en esta amplio conjunto de literatura se conoce muy poco sobre las bases psicológicas que pueden definir la manera en que la RSC realmente afecta a estas conductas y actitudes laborales, tanto directa como indirectamente. El propósito de esta nota a aportar luz sobre esta cuestión.
Collectivism and the meaning of suffering.
Sullivan, Daniel; Landau, Mark J; Kay, Aaron C; Rothschild, Zachary K
2012-12-01
People need to understand why an instance of suffering occurred and what purpose it might have. One widespread account of suffering is a repressive suffering construal (RSC): interpreting suffering as occurring because people deviate from social norms and as having the purpose of reinforcing the social order. Based on the theorizing of Emile Durkheim and others, we propose that RSC is associated with social morality-the belief that society dictates morality-and is encouraged by collectivist (as opposed to individualist) sentiments. Study 1 showed that dispositional collectivism predicts both social morality and RSC. Studies 2-4 showed that priming collectivist (vs. individualist) self-construal increases RSC of various types of suffering and that this effect is mediated by increased social morality (Study 4). Study 5 examined behavioral intentions, demonstrating that parents primed with a collectivist self-construal interpreted children's suffering more repressively and showed greater support for corporal punishment of children. (PsycINFO Database Record (c) 2012 APA, all rights reserved).
76 FR 70709 - Sunshine Act Meeting; Emergency Meeting Notice
2011-11-15
... COMMODITY FUTURES TRADING COMMISSION Sunshine Act Meeting; Emergency Meeting Notice This notice that an emergency meeting was held is published pursuant to the provisions of the Government in the Sunshine Act, Public Law 94-409, 5 U.S.C. 552b. AGENCY HOLDING THE MEETING: Commodity Futures Trading...
Retrosplenial Cortex Is Required for the Retrieval of Remote Memory for Auditory Cues
Todd, Travis P.; Mehlman, Max L.; Keene, Christopher S.; DeAngeli, Nicole E.; Bucci, David J.
2016-01-01
The retrosplenial cortex (RSC) has a well-established role in contextual and spatial learning and memory, consistent with its known connectivity with visuo-spatial association areas. In contrast, RSC appears to have little involvement with delay fear conditioning to an auditory cue. However, all previous studies have examined the contribution of…
Analysis of DOE s Roof Savings Calculator with Comparison to other Simulation Engines
Energy Technology Data Exchange (ETDEWEB)
New, Joshua Ryan [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Huang, Yu [White Box Technologies, Salt Lake City, UT (United States); Levinson, Ronnen [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Mellot, Joe [The Garland Company, Cleveland, OH (United States); Sanyal, Jibonananda [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Childs, Kenneth W [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)
2014-01-01
A web-based Roof Savings Calculator (RSC) has been deployed for the Department of Energy as an industry-consensus tool to help building owners, manufacturers, distributors, contractors and researchers easily run complex roof and attic simulations. This tool employs the latest web technologies and usability design to provide an easy input interface to an annual simulation of hour-by-hour, whole-building performance using the world-class simulation tools DOE-2.1E and AtticSim. Building defaults were assigned based on national averages and can provide estimated annual energy and cost savings after the user selects nothing more than building location. In addition to cool reflective roofs, the RSC tool can simulate multiple roof and attic configurations including different roof slopes, above sheathing ventilation, radiant barriers, low-emittance surfaces, HVAC duct location, duct leakage rates, multiple layers of building materials, ceiling and deck insulation levels, and other parameters. A base case and energy-efficient alternative can be compared side-by-side to generate an energy/cost savings estimate between two buildings. The RSC tool was benchmarked against field data for demonstration homes in Ft. Irwin, CA. However, RSC gives different energy savings estimates than previous cool roof simulation tools so more thorough software and empirical validation proved necessary. This report consolidates much of the preliminary analysis for comparison of RSC s projected energy savings to that from other simulation engines.
Directory of Open Access Journals (Sweden)
Steven M. Phelps
2017-10-01
Full Text Available Social behavior is among the most complex and variable of traits. Despite its diversity, we know little about how genetic and developmental factors interact to shape natural variation in social behavior. This review surveys recent work on individual differences in the expression of the vasopressin 1a receptor (V1aR, a major regulator of social behavior, in the neocortex of the socially monogamous prairie vole. V1aR exhibits profound variation in the retrosplenial cortex (RSC, a region critical to spatial and contextual memory. RSC-V1aR abundance is associated with patterns of male space-use and sexual fidelity in the field: males with high RSC-V1aR show high spatial and sexual fidelity to partners, while low RSC-V1aR males are significantly more likely to mate outside the pair-bond. Individual differences in RSC-V1aR are predicted by a set of linked single nucleotide polymorphisms within the avpr1a locus. These alternative alleles have been actively maintained by selection, suggesting that the brain differences represent a balanced polymorphism. Lastly, the alleles occur within regulatory sequences, and result in differential sensitivity to environmental perturbation. Together the data provide insight into how genetic, epigenetic and evolutionary forces interact to shape the social brain.
Remedial action programs annual meeting: Meeting notes
International Nuclear Information System (INIS)
1987-01-01
The US Department of Energy Grand Junction Projects Office was pleased to host the 1987 Remedial Action programs Annual Meeting and herein presents notes from that meeting as prepared (on relatively short notice) by participants. These notes are a summary of the information derived from the workshops, case studies, and ad hoc committee reports rather than formal proceedings. The order of the materials in this report follows the actual sequence of presentations during the annual meeting
International Nuclear Information System (INIS)
Abid, M.; Anwar-ur-Hassan; Ghafoor, A.
2003-01-01
The experiment was conducted to investigate the effect of brackish water irrigation on fresh biomass yield of maize variety Agati-72 and saturated hydraulic conductivity (HC) of silty clay loam soil. Total 20 treatment combinations having different EC/sub iw/ (0.65, 2.0, 4.0, 6.0 and 7.35 dS m/sup -1/), SAR/sub iw/ (3.95, 9.65, 18.0, 26.35 and 32.04 (mmol L/sup -1)/sup 1/2/) and RSC (0.65, 2.0, 4.0, 6.0 and 7.35 mmol/sub c/ L/sup -1/) were applied to 30 cm x 68 cm undisturbed and disturbed soil columns. Results indicated that biomass yield of maize decreased with an increase in EC/sub iw/ from 0.65 to 7.35 dS m/sup -1/ at coded 0 levels of SAR/sub iw/ and RSC in undisturbed soil. The maize tolerated EC/sub iw/ up to 2.0 dS m/sup-1/ at coded 0 levels of SAR/sub iw/ and RSC in disturbed soil. The SAR/sub iw/ up to 18.0 did not affect the yield of crop at coded 0 levels of EC/sub iw/ for the undisturbed and disturbed soils, respectively. The increase in HC was 48% in undisturbed and 54% in disturbed soils with EC/sub iw/ 7.35 dS m/sup -1/ over EC/sub iw/ 0.65 dS m/sup -1/ coded 0 levels of EC/sub iw/ and RSC. The HC decreased with SAR/sub iw/ and RSC at coded 0 levels of EC/sub iw/ and RSC; EC/sub iw/ and SAR/sub iw/ in both the soil columns. (author)
Amateur Hour: Culture, Capital, and the Royal Shakespeare Company's Open Stages Initiative
Flynn, Molly
2017-01-01
In 2011, the Royal Shakespeare Company (RSC) began a series of collaborations with established amateur theatre groups from across the UK. The initiative now known as Open Stages became one of the most ambitious educational outreach programmes ever run by the RSC, engaging hundreds of amateur theatre practitioners in a process of skills sharing and…
DEFF Research Database (Denmark)
Rong, Aiying; Hakonen, Henri; Lahdelma, Risto
2008-01-01
introduce in this paper the DP-RSC1 algorithm, which is a variant of the dynamic programming (DP) algorithm based on linear relaxation of the ON/OFF states of the units and sequential commitment of units one by one. The time complexity of DP-RSC1 is proportional to the number of generating units...
76 FR 59454 - Sunshine Act Meeting; Notice of Public Meeting
2011-09-26
... RAILROAD RETIREMENT BOARD Sunshine Act Meeting; Notice of Public Meeting Notice is hereby given that the Railroad Retirement Board will hold a meeting on October 6, 2011, 10 a.m. at the Board's meeting room on the 8th floor of its headquarters building, 844 North Rush Street, Chicago, Illinois...
Directory of Open Access Journals (Sweden)
Jessica Fernández Vázquez
2012-10-01
Full Text Available La responsabilidad social corporativa (RSC se ha convertido en un activo intangible e imprescindible en la gestión empresarial. Las instituciones son conscientes de que se integran en una comunidad con la que deben mantener un diálogo constante y en la que revierten parte de sus beneficios. De esta forma, la RSC se convierte en una herramienta clave de relaciones públicas a la hora de mejorar su reputación y legitimación social así como para transmitir una identidad corporativa determinada. En el caso de los medios de comunicación, la RSC cobra una doble dimensión: no sólo se trata de aplicar medidas responsables en torno al medio ambiente, grupos de interés, instituciones, etc. sino que debe transmitir la información de forma rigurosa, veraz, objetiva y ética. Teniendo en cuenta esto, decidimos estudiar la RSC de los principales grupos de comunicación en España a partir de la información publicada en sus páginas web.
DEFF Research Database (Denmark)
Blaabjerg, Karoline; Carlsson, N G; Hansen-Møller, Jens
2010-01-01
An in vitro method was used to evaluate the degradation of myo-inositol hexakisphosphate (InsP6) in non-heat-treated wheat (NHW), heat-treated wheat (HW), soybean meal (SBM) or rapeseed cake (RSC) soaked separately or in combination. The feedstuffs were soaked in water (20 °C) and samples were...... heat-treatment and soaking time (P≤0.001). This was mainly due to a smaller proportion of non-degraded InsP6-P at 24 h in HW compared with NHW (0.13 vs. 0.47) (P≤0.001) possibly caused by structural changes imposed by the heat-treatment. In SBM, RSC, SBM/NHW or RSC/NHW, the InsP6 degradation...... was affected by the interaction between phytase addition and soaking time (P≤0.001) as phytase reduced the proportion of non-degraded InsP6-P at 2, 4, 8 or 24 h. Soaking of NHW, SBM or RSC (without phytase) separately resulted in a limited InsP6 degradation, whereas a pronounced InsP6 degradation occurred when...
75 FR 59292 - Meeting of the Advisory Committee; Meeting
2010-09-27
... inclusion on future Joint Board examinations in actuarial mathematics, pension law and methodology referred... closed meeting of the Advisory Committee on Actuarial Examinations. DATES: The meeting will be held on... INFORMATION: Notice is hereby given that the Advisory Committee on Actuarial Examinations will meet at...
A Corticocortical Circuit Directly Links Retrosplenial Cortex to M2 in the Mouse
Radulovic, Jelena
2016-01-01
Retrosplenial cortex (RSC) is a dorsomedial parietal area involved in a range of cognitive functions, including episodic memory, navigation, and spatial memory. Anatomically, the RSC receives inputs from dorsal hippocampal networks and in turn projects to medial neocortical areas. A particularly prominent projection extends rostrally to the posterior secondary motor cortex (M2), suggesting a functional corticocortical link from the RSC to M2 and thus a bridge between hippocampal and neocortical networks involved in mnemonic and sensorimotor aspects of navigation. We investigated the cellular connectivity in this RSC→M2 projection in the mouse using optogenetic photostimulation, retrograde labeling, and electrophysiology. Axons from RSC formed monosynaptic excitatory connections onto M2 pyramidal neurons across layers and projection classes, including corticocortical/intratelencephalic neurons (reciprocally and callosally projecting) in layers 2–6, pyramidal tract neurons (corticocollicular, corticopontine) in layer 5B, and, to a lesser extent, corticothalamic neurons in layer 6. In addition to these direct connections, disynaptic connections were made via posterior parietal cortex (RSC→PPC→M2) and anteromedial thalamus (RSC→AM→M2). In the reverse direction, axons from M2 monosynaptically excited M2-projecting corticocortical neurons in the RSC, especially in the superficial layers of the dysgranular region. These findings establish an excitatory RSC→M2 corticocortical circuit that engages diverse types of excitatory projection neurons in the downstream area, suggesting a basis for direct communication from dorsal hippocampal networks involved in spatial memory and navigation to neocortical networks involved in diverse aspects of sensorimotor integration and motor control. SIGNIFICANCE STATEMENT Corticocortical pathways interconnect cortical areas extensively, but the cellular connectivity in these pathways remains largely uncharacterized. Here, we
76 FR 17967 - Meeting of the Advisory Committee; Meeting
2011-03-31
... Joint Board examinations in actuarial mathematics, pension law and methodology referred to in 29 U.S.C... closed meeting of the Advisory Committee on Actuarial Examinations. DATES: The meeting will be held on... INFORMATION: Notice is hereby given that the Advisory Committee on Actuarial Examinations will meet at Mercer...
77 FR 19034 - Meeting of the Advisory Committee; Meeting
2012-03-29
... Joint Board examinations in actuarial mathematics, pension law and methodology referred to in 29 U.S.C... closed meeting of the Advisory Committee on Actuarial Examinations. DATES: The meeting will be held on... INFORMATION: Notice is hereby given that the Advisory Committee on Actuarial Examinations will meet at...
77 FR 59979 - Meeting of the Advisory Committee; Meeting
2012-10-01
... actuarial mathematics, pension law and methodology referred to in 29 U.S.C. 1242(a)(1)(B). A determination... closed meeting of the Advisory Committee on Actuarial Examinations. DATES: The meeting will be held on... is hereby given that the Advisory Committee on Actuarial Examinations will meet at Towers Watson, 800...
Planning and conducting meetings effectively, part I: planning a meeting.
Harolds, Jay
2011-12-01
Meetings are held by leaders for many purposes, including conveying information, raising morale, asking for opinions, brain storming, making people part of the problem-solving process, building trust, getting to a consensus, and making decisions. However, many meetings waste time, some undermine the leader's power, and some decrease morale. Part I of this series of articles gives some tips on basic planning for decision-making meetings. Part II of this series of articles analyzes selected components of decision-making meetings. Part III of this series will be on how the chairperson keeps decision-making meetings on track to make them efficient and productive.
Online and Off-line Visualization of Meeting Information and Meeting Support
Nijholt, Antinus; Rienks, R.J.; Zwiers, Jakob; Reidsma, Dennis
2006-01-01
In current meeting research we see modest attempts to visualize the information that has been obtained by either capturing and probably more importantly by interpreting the activities that take place during a meeting. The meetings being considered take place in smart meeting rooms. Cameras,
Online and Off-line Visualization of Meeting Information and Meeting Support
Nijholt, Antinus; Seah, H.S.; Rienks, R.J.; Zwiers, Jakob; Reidsma, Dennis
2006-01-01
In current meeting research we see modest attempts to visualize the information that has been obtained by either capturing and, probably more importantly, by interpreting the activities that take place during a meeting. The meetings being considered take place in smart meeting rooms. Cameras,
An APC Offsetting Model in progress
Directory of Open Access Journals (Sweden)
Markus Putnings
2016-12-01
of RSC on a national level shows, 950 vouchers were sent to the participating institutions in 2014. This means that about 60 % of all RSC articles with a German corresponding author could, in theory, be made open access, but in practice not all vouchers were used. The article also makes recommendations how the acceptance of open access vouchers can be raised.
Zhou, Liqiang; Wu, Longhua; Li, Zhu; Yang, Bingfan; Yin, Bin; Luo, Yongming; Christie, Peter
2015-01-01
A glasshouse pot experiment was conducted to study the effects of phytoextraction by Sedum plumbizincicola and application of rapeseed cake (RSC) on heavy metal accumulation by a subsequent rice (Oryza sativa L.) crop in a contaminated paddy soil collected from east China. After phytoextraction by S. plumbizincicola the soil and brown rice Cd concentrations effectively declined. After phytoextraction, RSC application reduced brown rice Cd concentrations in the subsequent rice crop to 0.23-0.28 mg kg(-1), almost down to the standard limit (0.2 mg kg(-1)). After phytoextraction and then application of RSC, the soil solution pH, dissolved organic carbon (DOC) and dissolved organic nitrogen (DON) concentrations increased during early stages of rice growth resulting directly and indirectly in lowering the bioavailability of the heavy metals. Thus the grain yield of the subsequent rice crop increased and the heavy metals in the brown rice declined significantly. In this contaminated acid soil, growing the hyperaccumulator S. plumbizincicola and rice in rotation together with RSC application may therefore be regarded as a viable strategy for safe grain production and bioremediation.
Meetings as a positive boost? How and when meeting satisfaction impacts employee empowerment
Allen, J.A.; Lehmann-Willenbrock, N.K.; Sands, S.
2016-01-01
Meetings constitute an important context for understanding organizational behavior and employee attitudes. Employees spend ever-increasing time in meetings and often complain about their meetings. In contrast, we explore the positive side of meetings and argue that satisfying meetings can empower
75 FR 42125 - Notice of Public Meeting, Dakotas Resource Advisory Council Meeting
2010-07-20
... Public Meeting, Dakotas Resource Advisory Council Meeting AGENCY: Bureau of Land Management, Interior..., Bureau of Land Management (BLM) Dakotas Resource Advisory Council (RAC) will meet as indicated below. DATES: The next regular meeting of the Dakotas Resource Advisory Council will be held on September 2...
Bianco, Massimiliano; Loosemore, Mike; Daniele, Gianlorenzo; Palmieri, Vincenzo; Faina, Marcello; Zeppilli, Paolo
2013-05-01
Several changes have occurred in Olympic boxing (OB) in the last few decades, influencing the results in official competitions. The aim of this study was to assess how the evolution of rules changed the rate of the results that can influence boxers' health. From a web-research, the results of OB tournaments from 1952 to 2011 were reviewed (29,357 bouts). For each event, rate of knockout (KO), referee-stop contest (RSC), RSC-Head (RSCH), RSC-Injury (RSCI), RSC-Outclassed (RSCO), abandon, disqualification and points decisions were recorded. In our analysis we investigated the changes that occurred after the introduction of the standing-count rule (1964), mandatory head guard (1984), computerised scoring system (1992), RSCO (2000-2009) and modification of bout formula 3×3 min rounds (3×3, until 1997, 5×2 min rounds (5×2) until 1999, 4×2 min rounds (4×2) until 2008, 3×3 from 2009). The most important results were: (1) an RSCI rate increase (0.72-2.42%, p<0.03) after the standing-count rule; (2) a lower RSCI (0.60%, p<0.001) and higher RSCH (1.31-4.92%, p<0.001) and RSC (9.71-13.05%, p<0.03) rate with mandatory head guard; (3) a KO rate reduction (6.44-2.09%, p<0.001) with the computerised scoring system; (4) an RSC (13.15-5.91%, p<0.05) and RSCH (4.23-1.41%, p<0.001) rate reduction comparing 5×2-4×2 bouts. In the last six decades, along with rule changes in OB, a clear reduction of health challenging results was observed. In the near future, older rules will be adopted (no head guard and a manual scoring system). Continued medical surveillance is important to ensure that new rule changes do not result in poor medical outcomes for the boxers.
Meetings in Academe: It's Time for an "EXTREME MEETING MAKEOVER!"
Berk, Ronald A.
2012-01-01
Meetings have a bad reputation with faculty. Rarely does one hear a positive word uttered about an upcoming or past meeting. That reputation has metastasized throughout higher education. The primary reason is because meetings can be major time wasters, accomplishing very little, often deteriorating into just another social event, or they may be…
76 FR 21779 - Notice of Public Meeting, Dakotas Resource Advisory Council Meeting
2011-04-18
... Public Meeting, Dakotas Resource Advisory Council Meeting AGENCY: Bureau of Land Management, Interior..., Bureau of Land Management (BLM) Dakotas Resource Advisory Council (RAC), will meet as indicated below. DATES: The next regular meeting of the Dakotas Resource Advisory Council will be held on May 11, 2011 in...
75 FR 15724 - Notice of Public Meeting, Dakotas Resource Advisory Council Meeting
2010-03-30
... Public Meeting, Dakotas Resource Advisory Council Meeting AGENCY: Bureau of Land Management, Interior..., Bureau of Land Management (BLM) Dakotas Resource Advisory Council (RAC) will meet as indicated below. DATES: The next regular meeting of the Dakotas Resource Advisory Council will be held on May 6, 2010, in...
76 FR 43705 - Notice of Public Meeting, Dakotas Resource Advisory Council Meeting
2011-07-21
... Public Meeting, Dakotas Resource Advisory Council Meeting AGENCY: Bureau of Land Management, Interior... Interior, Bureau of Land Management (BLM) Dakotas Resource Advisory Council (RAC), will meet as indicated below. DATES: The next regular meeting of the Dakotas Resource Advisory Council will be held on Aug. 17...
Directory of Open Access Journals (Sweden)
Eva Martínez Caro
2012-12-01
Full Text Available Corporate Social Responsibility (hereinafter CSR may explain the achievement of competitive advan- tages. CSR aims to minimize the negative effects that several aspects of the organization cause in the environment. With the development of a CSR, businesses, in addition to carrying out “good prac- tices” in their activities, could be considered socially responsible agents, improving its image, status and corporate reputation. The relationship between CSR and financial performance has been the subject of controversial discussion for years. This research aims to provide new insights into this debate consi- dering as main objective to analyze how it influences the development of culture in terms of CSR and the contribution to the realization of the strategic dimensions or measures of CSR, on business per- formance. An empirical study with a sample of 226 companies in the agribusiness sector was developed. The results indicate that both the strategic dimen- sions that refer to the social values as CSR measures involving interest groups, influence business results.La Responsabilidad Social Corporativa (en adelante RSC puede explicar el logro de ventajas competiti- vas. La RSC trata de minimizar los efectos negativos que ciertos aspectos de la organización provocan en el ambiente. Con el desarrollo de RSC, las empresas, además de llevar a cabo “buenas prácticas” en sus actividades, podrían ser consideradas agentes social- mente responsables y por consiguiente mejorarán su imagen, prestigio y reputación empresarial. La relación entre RSC y el rendimiento financiero ha sido objeto de un controvertido debate durante años. La presente investigación pretende aportar nuevo conocimiento sobre este debate planteán- dose como objetivo principal analizar cómo influye el fomento de la cultura en materia de RSC y, la contribución a la concreción de las dimensiones estratégicas o medidas de RSC, en los resultados de las empresas. Para ello se
77 FR 22800 - Notice of Public Meeting, Dakotas Resource Advisory Council Meeting
2012-04-17
... Public Meeting, Dakotas Resource Advisory Council Meeting AGENCY: Bureau of Land Management, Interior..., Bureau of Land Management (BLM) Dakotas Resource Advisory Council (RAC) will meet as indicated below. DATES: The next regular meeting of the Dakotas RAC will be held on May 9, 2012, in Spearfish, SD. The...
Directory of Open Access Journals (Sweden)
Andrés Navarro
2010-12-01
Full Text Available Las prácticas de divulgación de Responsabilidad Social Corporativa (RSC son cada vez más utilizadas por las grandes compañías como instrumentos para eliminar las asimetrías de información entre los stakeholders. En el caso de las administraciones públicas, aunque las exigencias de los ciudadanos son cada vez mayores en materia de transparencia y de rendición de cuentas, la difusión de información RSC es un tema todavía poco estudiado. Este trabajo pretende realizar una primera aproximación a la difusión de información RSC en las administraciones locales españolas y su finalidad principal es conocer las debilidades y fortalezas que, en materia de RSC, tienen los sistemas de información de estas entidades, identificando oportunidades de mejora que orienten futuras investigaciones. Para ello, hemos analizado los sitios web de 55 grandes gobiernos locales, obteniendo conclusiones sobre la difusión de información general acerca de RSC así como sobre la publicación de información económica, social y medioambiental. Los resultados revelan que las mayores carencias de publicación de información RSC corresponden a la información medioambiental, mientras que la información social es la más divulgada. Asimismo, el tamaño de la entidad, la competencia política y el signo del partido gobernante, no explican el desarrollo de las prácticas de difusión de información RSC.PALABRAS CLAVE: Responsabilidad Social Corporativa, Administración Pública.ABSTRACTThe disclosure practices of Corporate Social Responsibility (CSR are increasingly used by large companies in order to eliminate information asymmetries between stakeholders. Instead, the disclosure of CSR information for governments is a topic little studied yet, though the demands of citizens are increasing in transparency and accountability. This paper attempts a first approach to information CSR dissemination in Spanish local governments. Its main purpose is to know the
2003-01-01
I should like to invite all members of the CERN Personnel to a meeting on Wednesday 25th June 2003 at 11.00 hrs - Auditorium, bldg. 500 to give a report on the outcome of the June Meetings of Council and its Committees. Closed-circuit transmission of the meeting will be available in the AB Auditorium (Prévessin), the AB Auditorium (Meyrin - bldg. 6), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). Luciano Maiani Director General
Allen, J.A.; Lehmann-Willenbrock, N.K.
2013-01-01
Research interest: We explore how pre-meeting small talk impacts meeting effectiveness through the” ripple effect”, allowing before meeting communication/behaviors to ripple into and impact the scheduled meeting. Method: Data was obtained using an online survey of working adults (N = 252). A new
MeetingVis: Visual Narratives to Assist in Recalling Meeting Context and Content.
Shi, Yang; Bryan, Chris; Bhamidipati, Sridatt; Zhao, Ying; Zhang, Yaoxue; Ma, Kwan-Liu
2018-06-01
In team-based workplaces, reviewing and reflecting on the content from a previously held meeting can lead to better planning and preparation. However, ineffective meeting summaries can impair this process, especially when participants have difficulty remembering what was said and what its context was. To assist with this process, we introduce MeetingVis, a visual narrative-based approach to meeting summarization. MeetingVis is composed of two primary components: (1) a data pipeline that processes the spoken audio from a group discussion, and (2) a visual-based interface that efficiently displays the summarized content. To design MeetingVis, we create a taxonomy of relevant meeting data points, identifying salient elements to promote recall and reflection. These are mapped to an augmented storyline visualization, which combines the display of participant activities, topic evolutions, and task assignments. For evaluation, we conduct a qualitative user study with five groups. Feedback from the study indicates that MeetingVis effectively triggers the recall of subtle details from prior meetings: all study participants were able to remember new details, points, and tasks compared to an unaided, memory-only baseline. This visual-based approaches can also potentially enhance the productivity of both individuals and the whole team.
DEFF Research Database (Denmark)
Fosgerau, Mogens; Engelson, Leonid; Franklin, Joel P.
2014-01-01
Urban congestion causes travel times to exhibit considerable variability, which leads to coordination problems when people have to meet. We analyze a game for the timing of a meeting between two players who must each complete a trip of random duration to reach the meeting, which does not begin...
75 FR 21629 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2010-04-26
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Office of the National Coordinator for Health Information Technology HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National... Information Technology (ONC). The meeting will be open to the public. Name of Committee: HIT Policy Committee...
75 FR 5595 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2010-02-03
... Technology HIT Standards Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National... Health Information Technology (ONC). The meeting will be open to the public. Name of Committee: HIT... Federal Health IT Strategic Plan, and in accordance with policies developed by the HIT Policy Committee...
75 FR 21628 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2010-04-26
... Technology HIT Standards Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National... Information Technology (ONC). The meeting will be open to the public. Name of Committee: HIT Standards... Strategic Plan, and in accordance with policies developed by the HIT Policy Committee. Date and Time: The...
Indian Academy of Sciences (India)
23 Newsletter of the Indian Academy of ScienCE. 57th Annual. Meeting ... Srinivas, Institute for Social and Economic. Change ... "Quantum mechanics and statistical mechanics of anyons" .... Special Issue on Geomagnetic Methods and.
DEFF Research Database (Denmark)
Ravn, Ib
as having to serve organizational stakeholders (such as customers and users), and work must be subjectively meaningful to the modern, well-educated employee. Do meetings answer to these challenges? A survey of 300 knowledge workers in five highly successful, knowledge-intensive corporations in Denmark...... showed that although employees were satisfied with their managers; traditional meeting-management skills, the customer was largely invisible in organizational meetings, and the hearts and minds of the employees were not engaged to any significant degree in meetings. It is concluded that despite massive...
Gutmann, Joanna
2016-01-01
aking Minutes of Meetings guides you through the entire process behind minute taking: arranging the meeting; writing the agenda; creating the optimum environment; structuring the meeting and writing notes up accurately. The minute-taker is one of the most important and powerful people in a meeting and you can use this opportunity to develop your knowledge, broaden your horizons and build credibility within the organization. Taking Minutes of Meetings is an easy to read 'dip-in, dip-out' guide which shows you how to confidently arrange meetings and produce minutes. It provides hands-on advice about the sections of a meeting as well as tips on how to create an agenda, personal preparation, best practice advice on taking notes and how to improve your accuracy. Brand new chapters of this 4th edition include guidance on using technology to maximize effectiveness and practical help with taking minutes for a variety of different types of meetings. The creating success series of books... With over one million copi...
75 FR 39954 - Oversight of Laboratory Developed Tests; Public Meeting; Change of Meeting Location
2010-07-13
...] Oversight of Laboratory Developed Tests; Public Meeting; Change of Meeting Location AGENCY: Food and Drug... location for the upcoming public meeting entitled ``Oversight of Laboratory Developed Tests.'' A new... the public meeting, FDA is announcing in this notice a new location for the public meeting. II. New...
75 FR 42125 - Notice of Public Meeting, Eastern Montana Resource Advisory Council Meeting
2010-07-20
... Public Meeting, Eastern Montana Resource Advisory Council Meeting AGENCY: Bureau of Land Management... Interior, Bureau of Land Management (BLM) Eastern Montana Resource Advisory Council (RAC) will meet as indicated below. DATES: The next regular meeting of the Eastern Montana Resource Advisory Council will be...
75 FR 3489 - Notice of Public Meeting, Eastern Montana Resource Advisory Council Meeting
2010-01-21
... Public Meeting, Eastern Montana Resource Advisory Council Meeting AGENCY: Bureau of Land Management... Interior, Bureau of Land Management (BLM) Eastern Montana Resource Advisory Council (RAC), will meet as indicated below. DATES: The next regular meeting of the Eastern Montana Resource Advisory Council will be...
75 FR 47312 - Board Meeting; Sunshine Act Meetings
2010-08-05
... INTER-AMERICAN FOUNDATION Board Meeting; Sunshine Act Meetings Time and Date: August 9, 2010, 8:30 a.m.-5:30 p.m.. Place: 101 Constitution Avenue, Washington, DC 20001. Status: Closed session as provided in 22 CFR 1004.4(f). Matters to be Considered: Executive Session. Portions to be Closed to the...
78 FR 22225 - Meeting: African Development Foundation, Board of Directors Executive Session Meeting
2013-04-15
...;and investigations, committee meetings, agency decisions and rulings, #0;delegations of authority... Executive Session Meeting Meeting: African Development Foundation, Board of Directors Executive Session Meeting Time: Tuesday, April 23, 2013 11:15 a.m. to 2:15 p.m. Place: 1400 Eye Street NW., Suite 1000...
77 FR 42507 - Notice of Public Meeting, Eastern Montana Resource Advisory Council Meeting
2012-07-19
... Public Meeting, Eastern Montana Resource Advisory Council Meeting AGENCY: Bureau of Land Management... Interior, Bureau of Land Management (BLM) Eastern Montana Resource Advisory Council (RAC) will meet as indicated below. DATES: The next regular meeting of the Eastern Montana RAC will be held on September 19...
77 FR 70807 - Notice of Public Meeting, Eastern Montana Resource Advisory Council Meeting
2012-11-27
... Public Meeting, Eastern Montana Resource Advisory Council Meeting AGENCY: Bureau of Land Management... Interior, Bureau of Land Management (BLM) Eastern Montana Resource Advisory Council (RAC) will meet as indicated below. DATES: The next regular meeting of the Eastern Montana RAC will be held on December 6, 2012...
77 FR 42760 - Notice of Public Meeting, Eastern Montana Resource Advisory Council Meeting
2012-07-20
... Public Meeting, Eastern Montana Resource Advisory Council Meeting AGENCY: Bureau of Land Management... Interior, Bureau of Land Management (BLM) Eastern Montana Resource Advisory Council (RAC) will meet as indicated below. DATES: The next regular meeting of the Eastern Montana RAC will be held on September 19...
The occipital place area represents the local elements of scenes.
Kamps, Frederik S; Julian, Joshua B; Kubilius, Jonas; Kanwisher, Nancy; Dilks, Daniel D
2016-05-15
Neuroimaging studies have identified three scene-selective regions in human cortex: parahippocampal place area (PPA), retrosplenial complex (RSC), and occipital place area (OPA). However, precisely what scene information each region represents is not clear, especially for the least studied, more posterior OPA. Here we hypothesized that OPA represents local elements of scenes within two independent, yet complementary scene descriptors: spatial boundary (i.e., the layout of external surfaces) and scene content (e.g., internal objects). If OPA processes the local elements of spatial boundary information, then it should respond to these local elements (e.g., walls) themselves, regardless of their spatial arrangement. Indeed, we found that OPA, but not PPA or RSC, responded similarly to images of intact rooms and these same rooms in which the surfaces were fractured and rearranged, disrupting the spatial boundary. Next, if OPA represents the local elements of scene content information, then it should respond more when more such local elements (e.g., furniture) are present. Indeed, we found that OPA, but not PPA or RSC, responded more to multiple than single pieces of furniture. Taken together, these findings reveal that OPA analyzes local scene elements - both in spatial boundary and scene content representation - while PPA and RSC represent global scene properties. Copyright © 2016 Elsevier Inc. All rights reserved.
Responsabilidade Social Corporativa: Um Estudo do Processo de Comunicação dos Varejistas Brasileiros
Directory of Open Access Journals (Sweden)
Lucas Sciencia do Prado
2010-10-01
Full Text Available Este trabalho teve como objetivo principal discutir e analisar como os dez maiores varejistas brasileiros comunicam suas ações de responsabilidade social. Foi desenvolvido um referencial teórico sobre a evolução do conceito da responsabilidade social corporativa (RSC, discutindo a teoria dos stakeholders e o conceito da RSC estratégica. A pesquisa realizada teve caráter exploratório qualitativo. Foram analisados os dez maiores varejistas brasileiros de 2008, seguindo a estrutura de comunicação de ações de RSC proposta no trabalho de Du, Bhattacharya e Sem, para a análise dos resultados. Os dados foram coletados a partir de sites, relatórios de sustentabilidade das empresas e mídias relacionadas. Os resultados mostraram que o modelo proposto pelos autores pode ser considerado um bom referencial para a construção de mensagens no tocante a RSC. Uma contribuição para a evolução da estrutura seria a criação um mecanismo de feedback, que poderia facilitar a compreensão das mensagens pelos seus diversos públicos. DOI: 10.5585/remark.v9i2.2142
La difusión de las prácticas de responsabilidad social en las empresas multinacionales
Directory of Open Access Journals (Sweden)
Mariano Nieto Antolín
2008-12-01
Full Text Available Este artículo se centra en el estudio de la dimensión internacional de la responsabilidad social corporativa (RSC. Se estudia el proceso de difusión que han experimentado las prácticas de RSC en el plano internacional, se identifican distintas concepciones de RSC y se analizan sus efectos sobre la eficiencia. Adicionalmente, se analizan los problemas específicos que plantea a las empresas multinacionales la adopción de criterios socialmente responsables.This article focuses on the international dimension of Corporate Social Responsibility (CSR. The diffusion process of CSR practices in an international context is studied, and different views of CSR are identified. Moreover, this paper analyzes how CSR practices affect firm's efficiency and it also explores the specific problems multinational companies face when adopting socially responsible criteria.
Chris Onions
2002-01-01
DRAFT Agenda for the meeting to be held on Wednesday 4 December 2002 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Fellows, Associates and Summer Student Programmes Particle Data Book distribution Revoking Computer accounts Equipment insurance on site Reports from ACCU representatives on other committees Users' Office news Any Other Business Dates for meetings in 2003 Agenda for the next meeting Anyone wishing to raise any points under item 12 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (74837...
PH Department
2011-01-01
DRAFT Agenda for the meeting to be held on Wednesday 15 June 2011 At 9:15 a.m. in room 60-6-002 Chairperson’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Report on services from GS department Update on Safety at CERN Reports from ACCU representatives on other Committees a. Scientific Information Policy Board (SIPB) b. IT Service Review Meeting (ITSRM) c. GS User Commission Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairperson in writing or by e-mail to Michael.Hauschild@cern.ch Michael Hauschild (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in bra...
Evaluating Reverse Supply Chain Efficiency: Manufacturer's Perspective
DEFF Research Database (Denmark)
Kumar, M.; Tiwari, M. K.; Wong, K. Y.
2014-01-01
The paper aims to illustrate the use of fuzzy data envelopment analysis (DEA) in analyzing reverse supply chain (RSC) performance from the manufacturer's perspective. By using an alternative alpha-cut approach, the fuzzy DEA model was converted into a crisp linear programming problem, thereby...... usually ensures an environmentally friendly supply chain network, companies which have implemented RSC techniques since a longer duration do not necessarily have a more efficient supply chain in general....
EDITORIAL: Nano Meets Spectroscopy Nano Meets Spectroscopy
Birch, David J. S.
2012-08-01
The multidisciplinary two-day Nano Meets Spectroscopy (NMS) event was held at the National Physical Laboratory (NPL), Teddington, UK, in September 2011. The event was planned from the outset to be at the interface of several areas—in particular, spectroscopy and nanoscience, and to bring together topics and people with different approaches to achieving common goals in biomolecular science. Hence the meeting cut across traditional boundaries and brought together researchers using diverse techniques, particularly fluorescence and Raman spectroscopy. Despite engaging common problems, these techniques are frequently seen as mutually exclusive with the two communities rarely interacting at conferences. The meeting was widely seen to have lived up to its billing in good measure. It attracted the maximum capacity of ~120 participants, including 22 distinguished speakers (9 from outside the UK), over 50 posters and a vibrant corporate exhibition comprising 10 leading instrument companies and IOP Publishing. The organizers were Professor David Birch (Chair), Dr Karen Faulds and Professor Duncan Graham of the University of Strathclyde, Professor Cait MacPhee of the University of Edinburgh and Dr Alex Knight of NPL. The event was sponsored by the European Science Foundation, the Institute of Physics, the Royal Society of Chemistry, NPL and the Scottish Universities Physics Alliance. The full programme and abstracts are available at http://sensor.phys.strath.ac.uk/nms/program.php. The programme was quite ambitious in terms of the breadth and depth of scope. The interdisciplinary and synergistic concept of 'X meets Y' played well, cross-fertilization between different fields often being a source of inspiration and progress. Fluorescence and Raman spectroscopy provided the core, but the meeting had little repetition and also attracted contributions on more specialist techniques such as CARS, super-resolution, single molecule and chiral methods. In terms of application the
75 FR 16510 - Meeting of the Advisory Committee; Meeting
2010-04-01
... recommended for inclusion on future Joint Board examinations in actuarial mathematics, pension law and... closed meeting of the Advisory Committee on Actuarial Examinations. DATES: The meeting will be held on.... SUPPLEMENTARY INFORMATION: Notice is hereby given that the Advisory Committee on Actuarial Examinations will...
78 FR 19008 - Meeting of the Advisory Committee; Meeting
2013-03-28
... inclusion on future Joint Board examinations in actuarial mathematics, pension law and methodology referred... closed meeting of the Advisory Committee on Actuarial Examinations. DATES: The meeting will be held on.... SUPPLEMENTARY INFORMATION: Notice is hereby given that the Advisory Committee on Actuarial Examinations will...
77 FR 31894 - Sunshine Act Meeting Notice, Regular Board of Directors Meeting
2012-05-30
...,Washington, DC 20005. STATUS: Open. CONTACT PERSON FOR MORE INFORMATION: Erica Hall, Assistant Corporate... Meeting Minutes V. Approval of the Finance, Budget and Program Committee Meeting Minutes VI. Approval of the Corporate Administration Committee Meeting Minutes VII. Executive Session VIII. Board Elections...
E-Infrastructure Concertation Meeting
Katarina Anthony
2010-01-01
The 8th e-Infrastructure Concertation Meeting was held in the Globe from 4 to 5 November to discuss the development of Europe’s distributed computing and storage resources. Project leaders attend the E-Concertation Meeting at the Globe on 5 November 2010. © Corentin Chevalier E-Infrastructures have become an indispensable tool for scientific research, linking researchers to virtually unlimited e-resources like the grid. The recent e-Infrastructure Concertation Meeting brought together e-Science project leaders to discuss the development of this tool in the European context. The meeting was part of an ongoing initiative to develop a world-class e-infrastructure resource that would establish European leadership in e-Science. The e-Infrastructure Concertation Meeting was organised by the Commission Services (EC) with the support of e-ScienceTalk. “The Concertation meeting at CERN has been a great opportunity for e-ScienceTalk to meet many of the 38 new proje...
Energy Technology Data Exchange (ETDEWEB)
Lynd, Lee
2016-08-28
The 14th biannual Clostridium meeting was held at Dartmouth College from August 28 through 31, 2016. As noted in the meeting program (http://clostridiumxiv.com/wp-content/uploads/2016/09/Clostridium_XIV_program.pdf). the meeting featured 119 registered attendees, 33 oral presentations, 5 of which were given by younger presenters, 40 posters, and 2 keynote presentations, with strong participation by female and international scientists.
77 FR 71828 - Meeting of the Advisory Committee; Meeting
2012-12-04
... recommended for inclusion on future Joint Board examinations in actuarial mathematics and methodology referred... meeting of the Advisory Committee on Actuarial Examinations (portions of which will be open to the public... Committee on Actuarial Examinations will meet at the Internal Revenue Service, 1111 Constitution Avenue NW...
75 FR 76486 - Meeting of the Advisory Committee; Meeting
2010-12-08
... that may be recommended for inclusion on future Joint Board examinations in actuarial mathematics and... meeting of the Advisory Committee on Actuarial Examinations (portions of which will be open to the public... the Advisory Committee on Actuarial Examinations will meet at the Internal Revenue Service, 1111...
75 FR 22168 - Region VI-Houston District; Advisory Council Meeting; Public Meeting
2010-04-27
... SMALL BUSINESS ADMINISTRATION Region VI--Houston District; Advisory Council Meeting; Public Meeting The Small Business Administration-Region VI--Houston Advisory Council, located in the geographical Area of Houston, Texas will hold a federal public meeting on--Thursday, May 20, 2010, starting at 10:30...
Strandroth, Johan; Rizzi, Matteo; Sternlund, Simon; Lie, Anders; Tingvall, Claes
2011-12-01
The aim of the present study was to estimate the correlation between Euro NCAP pedestrian rating scores and injury outcome in real-life car-to-pedestrian crashes, with special focus on long-term disability. Another aim was to determine whether brake assist (BA) systems affect the injury outcome in real-life car-to-pedestrian crashes and to estimate the combined effects in injury reduction of a high Euro NCAP ranking score and BA. In the current study, the Euro NCAP pedestrian scoring was compared with the real-life outcome in pedestrian crashes that occurred in Sweden during 2003 to 2010. The real-life crash data were obtained from the data acquisition system Swedish Traffic Accident Data Acquisition (STRADA), which combines police records and hospital admission data. The medical data consisted of International Classification of Diseases (ICD) diagnoses and Abbreviated Injury Scale (AIS) scoring. In all, approximately 500 pedestrians submitted to hospital were included in the study. Each car model was coded according to Euro NCAP pedestrian scores. In addition, the presence or absence of BA was coded for each car involved. Cars were grouped according to their scoring. Injury outcomes were analyzed with AIS and, at the victim level, with permanent medical impairment. This was done by translating the injury scores for each individual to the risk of serious consequences (RSC) at 1, 5, and 10 percent risk of disability level. This indicates the total risk of a medical disability for each victim, given the severity and location of injuries. The mean RSC (mRSC) was then calculated for each car group and t-tests were conducted to falsify the null hypothesis at p ≤ .05 that the mRSC within the groups was equal. The results showed a significant reduction of injury severity for cars with better pedestrian scoring, although cars with a high score could not be studied due to lack of cases. The reduction in RSC for medium-performing cars in comparison with low-performing cars
Energy Technology Data Exchange (ETDEWEB)
Fitzsimmons, Tim [Dept. of Energy (DOE), Washington DC (United States). Office of Basic Energy Sciences. Division of Materials Sciences and Engineering
2006-05-16
This volume highlights the scientific content of the 2006 Hydrogen Contractors Meeting sponsored by the Division of Materials Sciences and Engineering (DMS&E) on behalf of the Office of Basic Energy Sciences (BES) of the U. S. Department of Energy (DOE). Hydrogen Contractors Meeting held from May 16-19, 2006 at the Crystal Gateway Marriott Hotel Arlington, Virginia. This meeting is the second in a series of research theme-based Contractors Meetings sponsored by DMS&E held in conjunction with our counterparts in the Office of Energy Efficiency and Renewable Energy (EERE) and the first with the Hydrogen, Fuel Cells and Infrastructure Technologies Program. The focus of this year’s meeting is BES funded fundamental research underpinning advancement of hydrogen storage. The major goals of these research efforts are the development of a fundamental scientific base in terms of new concepts, theories and computational tools; new characterization capabilities; and new materials that could be used or mimicked in advancing capabilities for hydrogen storage.
Directory of Open Access Journals (Sweden)
Theodore R. Schatzki
2005-01-01
Full Text Available This essay pursues two goals: (1 to argue that two fundamental types of time—the time of objective reality and “the time of the soul”—meet in human activity and history and (2 to defend the legitimacy of calling a particular version of the second type a kind of time. The essay begins by criticizing Paul Ricoeur’s version of the claim that times of these two sorts meet in history. It then presents an account of human activity based on Heidegger’s Being and Time, according to which certain times of the two types—existential temporality and succession—meet in human activity. The legitimacy of calling existential temporality a kind of time is then defended via an expanded analysis of activity that examines where the two times meet there. The concluding section briefly considers a conception of historical time due to David Carr before showing why history is a broader domain encompassing human activity where the two times meet.
75 FR 28062 - Meeting of the Advisory Committee; Meeting
2010-05-19
... questions which may be recommended for inclusion on future Joint Board examinations in actuarial mathematics... meeting of the Advisory Committee on Actuarial Examinations (a portion of which will be open to the public... the Advisory Committee on Actuarial Examinations will meet in at the Internal Revenue Service Building...
75 FR 52303 - Notice of Meeting; Siskiyou Resource Advisory Committee Meeting at New Location
2010-08-25
... DEPARTMENT OF AGRICULTURE Forest Service Notice of Meeting; Siskiyou Resource Advisory Committee Meeting at New Location SUMMARY: The Siskiyou County Resource Advisory Committee (RAC) will hold its last two meetings in 2010 at a new location. DATES: The meetings will be held on September 20 and October...
Chris Onions (Secretary)
2001-01-01
DRAFT Agenda for the meeting to be held on Wednesday 5 December 2001 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 2. Adoption of the agenda 3. Minutes of the previous meeting 4. Matters arising 5. News from the CERN Management 6. Housing 7. Restaurant Surveillance Committee 8. Users' Office news 9. Election of ACCU chairman 10. Any Other Business 11. Dates for meetings in 2002 12. Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada&am...
Chris Onions (Secretary)
2001-01-01
DRAFT Agenda for the meeting to be held on Wednesday 5 December 2001 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 2. Adoption of the agenda 3. Minutes of the previous meeting 4. Matters arising 5. News from the CERN Management 6. Housing 7. Restaurant Surveillance Committee 8. Users' Office news 9. Election of ACCU chairman 10. Any Other Business 11. Dates for meetings in 2002 12. Agenda for the next meetingAnyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark A. Waananen (75941) Finland A. Kiiskinen (79387) Fr...
2000-01-01
DRAFT Agenda for the meeting to be held on Wednesday 6 December 2000 At 10 a.m. in the 6th floor Conference Room, Main Building Chairman's remarks Adoption of the agenda News from the CERN Management Minutes of the previous meeting Matters arising Equal Opportunities at CERN The Summer Student programme CERN Programme for Physics High School Teachers Users' Office News Any Other Business Dates for Meetings in 2001 Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Secretary in writing via the CERN Users' Office or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets) : Austria G. Neuhofer (74094) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958)...
Chris Onions (Secretary)
2000-01-01
DRAFT Agenda for the meeting to be held on Wednesday 6 December 2000 At 10 a.m. in the 6th floor Conference Room, Main Building Chairman's remarks Adoption of the agenda News from the CERN Management Minutes of the previous meeting Matters arising Equal Opportunities at CERN The Summer Student programme CERN Programme for Physics High School Teachers Users' Office News Any Other Business Dates for Meetings in 2001 Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Secretary in writing via the CERN Users' Office or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets) : Austria G. Neuhofer (74094) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Re...
Díaz Heredia, Isabel
2013-01-01
En este Trabajo Fin de Máster se analiza la Responsabilidad Social Corporativa de las grandes empresas de distribución comercial en España. En él se trata el desarrollo teórico de la RSC, el sector de la distribución comercial y, por último, se realiza un estudio empírico para el análisis del grado de RSC on-line en las grandes empresas de distribución comercial.
Toward a conceptualization of retrohippocampal contributions to learning and memory.
Bucci, David J; Robinson, Siobhan
2014-12-01
A wealth of data supports the notion that the hippocampus binds objects and events together in place and time. In support of this function, a cortical circuit that includes the retrosplenial cortex (RSC) and various structures in the parahippocampal region is thought to provide the hippocampus with essential information regarding the physical and temporal context in which the object/event occurs. However, it remains unclear if and how individual components of this so-called 'where' circuit make unique contributions to processing context-related information. Here we focus on the RSC and the postrhinal cortex (POR; homologous with parahippocampal cortex (PHC) in primates), two of the most strongly interconnected components of the where pathway and the foci of an increasing amount of recent research. Much of the behavioral evidence to date suggests that RSC and POR/PHC work closely together as a functional unit. We begin by briefly reviewing studies that have investigated the involvement of RSC and POR/PHC in contextual and spatial learning, both of which involve learning associations and relationships between the individual stimuli that compose an environment (i.e., where information). However, we propose that potential differences have been overlooked because most studies to date have relied on behavioral paradigms and experimental approaches that are not well suited for distinguishing between different aspects of information processing. We then consider the anatomical differences between RSC and POR/PHC and emerging behavioral evidence that gives rise to a working model of how these regions may differentially contribute to hippocampal-dependent learning and memory. We then discuss experimental designs and behavioral methods that may be useful in testing the model. Finally, approaches are described that may be valuable in probing the nature of information processing and neuroplasticity in the myriad of local circuits that are nested within the where pathway
Directory of Open Access Journals (Sweden)
Md. Rifat Hazari
2017-12-01
Full Text Available Wind farm (WF grid codes require wind generators to have low voltage ride through (LVRT capability, which means that normal power production should be resumed quickly once the nominal grid voltage has been recovered. However, WFs with fixed-speed wind turbines with squirrel cage induction generators (FSWT-SCIGs have failed to fulfill the LVRT requirement, which has a significant impact on power system stability. On the other hand, variable-speed wind turbines with doubly fed induction generators (VSWT-DFIGs have sufficient LVRT augmentation capability and can control the active and reactive power delivered to the grid. However, the DFIG is more expensive than the SCIG due to its AC/DC/AC converter. Therefore, the combined use of SCIGs and DFIGs in a WF could be an effective solution. The design of the rotor-side converter (RSC controller is crucial because the RSC controller contributes to the system stability. The cascaded control strategy based on four conventional PI controllers is widely used to control the RSC of the DFIG, which can inject only a small amount of reactive power during fault conditions. Therefore, the conventional strategy can stabilize the lower rating of the SCIG. In the present paper, a new control strategy based on fuzzy logic is proposed in the RSC controller of the DFIG in order to enhance the LVRT capability of the SCIG in a WF. The proposed fuzzy logic controller (FLC is used to control the reactive power delivered to the grid during fault conditions. Moreover, reactive power injection can be increased in the proposed control strategy. Extensive simulations executed in the PSCAD/EMTDC environment for both the proposed and conventional PI controllers of the RSC of the DFIG reveal that the proposed control strategy can stabilize the higher rating of the SCIG.
Directory of Open Access Journals (Sweden)
Grace E Fox
Full Text Available Ketamine is known to induce psychotic-like symptoms, including delirium and visual hallucinations. It also causes neuronal damage and cell death in the retrosplenial cortex (RSC, an area that is thought to be a part of high visual cortical pathways and at least partially responsible for ketamine's psychotomimetic activities. However, the basic physiological properties of RSC cells as well as their response to ketamine in vivo remained largely unexplored. Here, we combine a computational method, the Inter-Spike Interval Classification Analysis (ISICA, and in vivo recordings to uncover and profile excitatory cell subtypes within layers 2&3 and 5&6 of the RSC in mice within both conscious, sleep, and ketamine-induced unconscious states. We demonstrate two distinct excitatory principal cell sub-populations, namely, high-bursting excitatory principal cells and low-bursting excitatory principal cells, within layers 2&3, and show that this classification is robust over the conscious states, namely quiet awake, and natural unconscious sleep periods. Similarly, we provide evidence of high-bursting and low-bursting excitatory principal cell sub-populations within layers 5&6 that remained distinct during quiet awake and sleep states. We further examined how these subtypes are dynamically altered by ketamine. During ketamine-induced unconscious state, these distinct excitatory principal cell subtypes in both layer 2&3 and layer 5&6 exhibited distinct dynamics. We also uncovered different dynamics of local field potential under various brain states in layer 2&3 and layer 5&6. Interestingly, ketamine administration induced high gamma oscillations in layer 2&3 of the RSC, but not layer 5&6. Our results show that excitatory principal cells within RSC layers 2&3 and 5&6 contain multiple physiologically distinct sub-populations, and they are differentially affected by ketamine.
June 1992 Hall B collaboation meeting
International Nuclear Information System (INIS)
Dennis, L.
1992-01-01
The Hall B collaboration meeting at the CEBAF 1992 Summer Workshop consisted of technical and physics working group meetings, a special beam line devices working group meeting the first meeting of the membership committee, a technical representatives meeting and a full collaboration meeting. Highlights of these meetings are presented in this report
78 FR 76627 - Health Information Technology Standards Committee Advisory Meeting: Notice of Meeting
2013-12-18
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Health Information Technology Standards Committee Advisory Meeting: Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology... committee of the Office of the National Coordinator for Health Information Technology (ONC). These meeting...
Tugué, Tosiyuki; Slaman, Theodore
1989-01-01
These proceedings include the papers presented at the logic meeting held at the Research Institute for Mathematical Sciences, Kyoto University, in the summer of 1987. The meeting mainly covered the current research in various areas of mathematical logic and its applications in Japan. Several lectures were also presented by logicians from other countries, who visited Japan in the summer of 1987.
2010-09-16
... SECURITIES AND EXCHANGE COMMISSION Agency Meeting Federal Register Citation of Previous Announcement: [To be published] Status: Open Meeting. Place: 100 F. Street, NE., Washington, DC. Date and Time of Previously Announced Meeting: September 15, 2010. Change In the Meeting: Room Change. The Joint...
Evaluating meeting support tools
Post, W.M.; Huis in't Veld, M.A.A.; Boogaard, S.A.A. van den
2008-01-01
Many attempts are underway for developing meeting support tools, but less attention is paid to the evaluation of meetingware. This article describes the development and testing of an instrument for evaluating meeting tools. First, we specified the object of evaluation - meetings - by means of a set
Evaluating meeting support tools
Post, W.M.; Huis in 't Veld, M. M.A.; Boogaard, S.A.A. van den
2007-01-01
Many attempts are underway for developing meeting support tools, but less attention is paid to the evaluation of meetingware. This article describes the development and testing of an instrument for evaluating meeting tools. First, we specified the object of evaluation -meetings- by means of a set of
2011-09-01
... UNITED STATES INSTITUTE OF PEACE Meeting AGENCY: United States Institute of Peace. Date/Time... Peace Act, Public Law 98-525. Agenda: September 22, 2011 Board Meeting; Approval of Minutes of the One Hundred Fortieth Meeting (June 23-24, 2011) of the Board of Directors; Chairman's Report; President's...
2012-09-11
... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation. ACTION: Regular meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). Date and Time: The meeting of the Board will be held...
5 CFR 1206.11 - Meeting place.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Meeting place. 1206.11 Section 1206.11 Administrative Personnel MERIT SYSTEMS PROTECTION BOARD ORGANIZATION AND PROCEDURES OPEN MEETINGS Conduct of Meetings § 1206.11 Meeting place. The Board will hold open meetings in meeting rooms designated in the...
78 FR 52997 - Connected Vehicle Research Program Public Meeting; Notice of Public Meeting
2013-08-27
... DEPARTMENT OF TRANSPORTATION Connected Vehicle Research Program Public Meeting; Notice of Public... overview of the ITS JPO Connected Vehicle research program. The meeting will take place September 24 to 26... . The public meeting is the best opportunity to learn details about the Connected Vehicle research...
Standke, Linda
1978-01-01
Focusing on the increased use by trainers of off-site facilities for employee training meetings, this article looks at some improvements and the expanding market in the meeting site industry. It also highlights emerging trends in the industry and covers the growth of meeting planning into a profession. (EM)
Chapman, David S.
The AGU 1990 Fall Meeting, held in San Francisco December 3-7, continued the steady growth trend for the western meeting set over the last decade. About 5200 members registered for the meeting and 3836 papers were given. The scientific kickoff to the meeting was provided by a Union session on initial results of the current Magellan mission to Venus. The mission was also the focus of a public lecture and short film on highlights of the mission and an extensive Union poster session.
2010-12-07
... FARM CREDIT SYSTEM INSURANCE CORPORATION Regular Meeting AGENCY: Farm Credit System Insurance Corporation Board. ACTION: Regular meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). Date and Time: The meeting of the Board will be held...
2012-01-18
... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation Board; Regular Meeting. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the...
2011-01-20
... Meeting SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). Date and Time: The meeting of the Board will be held at the offices of the Farm... meeting of the Board will be open to the [[Page 3630
78 FR 73190 - Sunshine Act Meeting
2013-12-05
... FEDERAL RESERVE SYSTEM Sunshine Act Meeting Agency Holding the Meeting: Board of Governors of the...., Washington, DC 20551. STATUS: Open. On the day of the meeting, you will be able to view the meeting via... webcast of the meeting. A link to the meeting documentation will also be available approximately 20...
2013-07-31
... stakeholders the opportunity to give policy, management, and technical input concerning Trinity River...-FF08EACT00] Trinity Adaptive Management Working Group; Public Meeting, Teleconference and Web-Based Meeting... Trinity Management Council (TMC). DATES: Public meeting, Teleconference, and web-based meeting: TAMWG and...
2013-03-20
... stakeholders the opportunity to give policy, management, and technical input concerning Trinity River...-FF08EACT00] Trinity Adaptive Management Working Group; Public Meeting, Teleconference and Web-Based Meeting... Service, announce a public meeting, teleconference and web-based meeting of the Trinity Adaptive...
2013-08-13
... opportunity to give policy, management, and technical input concerning Trinity River (California) restoration...-FF08EACT00] Trinity Adaptive Management Working Group; Public Meeting, Teleconference and Web-Based Meeting... Service, announce a public meeting, teleconference, and web-based meeting of the Trinity Adaptive...
75 FR 67393 - Notice of Public Meeting, Eastern Montana Resource Advisory Council Meeting
2010-11-02
... Public Meeting, Eastern Montana Resource Advisory Council Meeting AGENCY: Bureau of Land Management... 1972 (FACA), the U.S. Department of the Interior, Bureau of Land Management (BLM) Eastern Montana... Eastern Montana Resource Advisory Council will be held on Dec. 2, 2010 in Billings, Montana. The meeting...
Serving the medicinal chemistry community with Royal Society of Chemistry cheminformatics platforms
Williams, Antony
2015-01-01
The Royal Society of Chemistry (RSC) is a major participant in providing access to chemistry related data via the web. As an internationally renowned society for the chemical sciences, a scientific publisher and the host of the ChemSpider database for the community, RSC continues to make dramatic strides in providing online access to data. ChemSpider provides access to over 30 million chemicals sourced from over 500 data suppliers and linked out to related information on the web. The platform...
Hacia una gestión de marketing socialmente responsable: decisiones de compra y de comunicación
Morillo Moreno, Milangela del Carmen
2009-01-01
En el presente trabajo se aborda el marketing como sistema de pensamiento organizacional, enfocado en el marco de la Responsabilidad Social Corporativa (RSC), para lo cual se consideran varias posturas acerca de su significado. Las decisiones de compra y la comunicación involucran una elevada responsabilidad social. Éstas incluyen el papel de los medios de comunicación como parte integrante de la gestión de marketing. Entre sus principales resultados destacan que la RSC beneficia la colectivi...
2010-09-24
... UNITED STATES ARCTIC RESEARCH COMMISSION Meeting Notice is hereby given that the U.S. Arctic Research Commission will hold its 94th meeting in Fairbanks, AK, on October 6-8, 2010. The business session... approval of the agenda. (2) Approval of the minutes from the 93rd meeting. (3) Commissioners and staff...
2010-04-01
... resources permit. The general principle underlying the conduct of such meetings is that there should be free...) “End-of-Phase 2” meetings and meetings held before submission of a marketing application. At specific... meetings held near completion of Phase 3 and before submission of a marketing application (“pre-NDA...
Lopez-Serra, Lidia; Kelly, Gavin; Patel, Harshil; Stewart, Aengus; Uhlmann, Frank
2014-01-01
The cohesin complex is at the heart of many chromosomal activities, including sister chromatid cohesion and transcriptional regulation1-3. Cohesin loading onto chromosomes depends on the Scc2/Scc4 cohesin loader complex4-6, but the chromatin features that form cohesin loading sites remain poorly understood. Here, we show that the RSC chromatin remodeling complex recruits budding yeast Scc2/Scc4 to broad nucleosome-free regions, that the cohesin loader itself helps to maintain. Consequently, inactivation of the cohesin loader or RSC complex have similar effects on nucleosome positioning, gene expression and sister chromatid cohesion. These results reveal an intimate link between local chromatin structure and higher order chromosome architecture. Our findings pertain to the similarities between two severe human disorders, Cornelia de Lange syndrome, caused by mutations in the human cohesin loader, and Coffin-Siris syndrome, resulting from mutations in human RSC complex components7-9. Both could arise from gene misregulation due to related changes in the nucleosome landscape. PMID:25173104
The Mathematics Teacher Formation and the Teaching for Research and Study Course
Directory of Open Access Journals (Sweden)
Ana Rosa Corica
2013-08-01
Full Text Available The study of didactic devices with the characteristics of RSC in the teachers' mathematics formation at an Argentine university has led to the future teachers elaboration of their own ideas about of the management of the mentioned device at the Argentine high school. In this paper, results of a semi-structured interview to future teachers are shown. The teachers were attending the last year of the teaching training college at an Argentine university. Our intention was to know the receipt that the future teachers have in the management of an education under the characteristics of RSC to manage the above device in their educational practices. One of the difficulties that the future teachers signal is to select the problematic question that allows to stimulate and to provoke the whole process of study. The choice of the mentioned question is assigned to the same teachers. This constitutes a limitation as for the comprehension and later management of an education for RSC.
Inheritance and Gene Mapping of Resistance to Soybean Mosaic Virus Strain SC14 in Soybean
Institute of Scientific and Technical Information of China (English)
Hai-Chao Li; Hai-Jian Zhi; Jun-Yi Gai; Dong-Quan Guo; Yan-Wei Wang; Kai Li; Li Bai; Hua Yang
2006-01-01
Soybean mosaic virus (SMV) is one of the most broadly distributed diseases worldwide. It causes severe yield loss and seed quality deficiency in soybean (Glycine max (L.) Merr.). SMV Strain SC14 isolated from Shanxi Province, China, was a newly identified virulent strain and can infect Kefeng No. 1, a source with wide spectrum resistance. In the present study, soybean accessions, PI96983, Qihuang No. 1 and Qihuang No. 22 were identified to be resistant (R) and Nannong 1138-2, Pixianchadou susceptible (S) to SC14. Segregation analysis of PI96983 × Nannong 1138-2 indicated that a single dominant gene (designated as Rsc14) controlled the resistance to SC14 at both V2 and R1 developmental stages. The same results were obtained for the crosses of Qihuang No. 1 × Nannong 1138-2 and Qihuang No. 22 × Nannong 1138-2 as in PI96983 × Nannong 1138-2 at V2 stage, but at R1 stage,the F1 performed as necrosis (a susceptible symptom other than mosaic), F2 segregated in a ratio of 1R:2N:1S,and the progenies of necrotic (N) F2 individuals segregated also in R, N and S. It indicated that a single gene (designated as Rsc14o, to be different from that of PI96983) controlled the resistance to SC14, its dominance was the same as in PI96983 × Nannong 1138-2 (without symptoms) at V2 stage and not the same at R1 stage. The tightly linked co-dominant simple sequence repeat (SSR) marker Satt334 indicated that all the heterozygous bands were completely corresponding to the necrotic F2 individuals, or all the necrotic F2 individuals were heterozygotes.It was inferred that necrosis might be due to the interaction among SMV strains, resistance genes, genetic background of the resistance genes, and plant development stage. Furthermore, the bulked segregant analysis (BSA) of SSR markers was conducted to map the resistance genes. In F2 of PI96983 × Nannong 1138-2, five SSR markers, Sat_297, Sat_234, Sat_154, Sct_033 and Sat_120, were found closely linked to Rsc14, with genetic distances of 14
9th Transgenic Technology Meeting (TT2010) in Berlin, Germany: a meeting report.
Saunders, Thomas L; Sobieszczuk, Peter
2010-12-01
The first Transgenic Technology (TT) Meeting was organized in 1999 by Johannes Wilbertz, Karolinska Institute, Stockholm, Sweden as a regional meeting. The TT Meetings continued in this way, constantly gathering additional practitioners of transgenic methodologies until the breakthrough in 2005 when the 6th TT Meeting in Barcelona, Spain, hosted by Lluis Montoliu (Centro Nacional de Biotecnologia, Madrid, Spain), generated the momentum to establish the International Society for Transgenic Technologies (ISTT). Since 2006, the ISTT has continued to promote the TT Meetings and provide its membership with a forum to discuss best practices and new methods in the field. The TT2010 Meeting was held at the Max Delbrück Center for Molecular Medicine (Berlin, Germany). Participation at the TT2010 Meeting exceeded the registration capacity and set a new attendance record. Session topics included methods for the generation of rat and mouse models of human disease, fundamental and advanced topics in rodent embryonic stem cells, and the newest transgenic technologies. Short presentations from selected abstracts were of especial interest. Roundtable discussions on transgenic facility establishment and cryoarchiving of mouse lines were favorably received. Students, technical staff, and professors participated in numerous discussions and came away with practical methods and new ideas for research.
Bioinformatics Meets Virology: The European Virus Bioinformatics Center's Second Annual Meeting.
Ibrahim, Bashar; Arkhipova, Ksenia; Andeweg, Arno C; Posada-Céspedes, Susana; Enault, François; Gruber, Arthur; Koonin, Eugene V; Kupczok, Anne; Lemey, Philippe; McHardy, Alice C; McMahon, Dino P; Pickett, Brett E; Robertson, David L; Scheuermann, Richard H; Zhernakova, Alexandra; Zwart, Mark P; Schönhuth, Alexander; Dutilh, Bas E; Marz, Manja
2018-05-14
The Second Annual Meeting of the European Virus Bioinformatics Center (EVBC), held in Utrecht, Netherlands, focused on computational approaches in virology, with topics including (but not limited to) virus discovery, diagnostics, (meta-)genomics, modeling, epidemiology, molecular structure, evolution, and viral ecology. The goals of the Second Annual Meeting were threefold: (i) to bring together virologists and bioinformaticians from across the academic, industrial, professional, and training sectors to share best practice; (ii) to provide a meaningful and interactive scientific environment to promote discussion and collaboration between students, postdoctoral fellows, and both new and established investigators; (iii) to inspire and suggest new research directions and questions. Approximately 120 researchers from around the world attended the Second Annual Meeting of the EVBC this year, including 15 renowned international speakers. This report presents an overview of new developments and novel research findings that emerged during the meeting.
HR Department
2010-01-01
Dear Colleagues, I am pleased to invite you to a public meeting which will be held on Thursday 11 November 2010 at 2:30 p.m., in the Main Auditorium (welcome coffee from 2 p.m.) In this meeting Sigurd Lettow, Director for Administration and General Infrastructure will present the Management’s proposals towards restoring full funding of the Pension Fund. The meeting will follow discussions which took place with the Staff Association, at the Standing Concertation Committee (CCP) of 1 November 2010 and will be held with the Members States, at the Tripartite Employment Conditions Forum (TREF) of 4 November 2010. You will be able to attend this presentation in the Main Auditorium or via the webcast. The Management will also be available to reply to your questions on this subject. Best regards, Anne-Sylvie Catherin
English, C B
1987-05-01
The ability to skillfully lead meetings can contribute to a manager's effectiveness. There are four types of meetings, each serving different needs and requiring different leadership. A manager must know when to hold meetings, what leadership style is appropriate, how and when to use participative management, and how to facilitate a consensus. Considerable planning must be done before a meeting is held. Various leadership and communication skills are required to effectively open, conduct, and close a meeting. Finally, the leader needs to know how to deal with participants who become problems.
Staff Association
2017-01-01
Do you have questions about the elections to the Staff Council, 2017 MERIT exercise, EVE and School, LD to IC exercise, CHIS, the Pension Fund… Come get informed and ask your questions at our public meetings. These public meetings are also an opportunity to get the more information on current issues. Benefit from this occasion to get the latest news and to discuss with the representatives of the statutory body that is the Staff Association!
2016-05-18
generalized closure. 2.2 Fringe Noise Model for Pairwise Beam Combiner Given Nap apertures, recall that the Fourier phase and am- plitude of the...generalized closure phases. Recall from the discussion of n-spectra in Section 1 that clo- sure relations eliminate piston differences in the measure...valid RSC solution can then be obtained by evaluat- ing: θ̂RSC = V−1C D + CU −1 C y ∗ cl,im(C) (55) where D+ C denotes the pseudo-inverse of D. The
Velasco Garc??a, Sara
2014-01-01
En los ??ltimos a??os se ha promovido una nueva cultura de gesti??n empresarial enfocada a la responsabilidad y el bien com??n, denominada Responsabilidad Social Corporativa (en adelante RSC). Ha sufrido un elevado inter??s tanto en el ??mbito empresarial como acad??mico, en lo pol??tico y tambi??n entre la ciudadan??a. Por tanto, este trabajo tiene como objetivo, en primer lugar, contextualizar el t??rmino de la RSC. Adem??s mediante una entrevista en profundidad, se analiza la perspectiva q...
77 FR 57567 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-09-18
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
77 FR 50690 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-08-22
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
77 FR 15760 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-03-16
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
76 FR 39108 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2011-07-05
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS ACTION: Notice of... the public. Name of Committee: HIT Policy Committee. General Function of the Committee: to provide...
77 FR 37407 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-06-21
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
75 FR 21629 - HIT Standards Committee's Workgroup Meetings; Notice of Meetings
2010-04-26
... Technology; HIT Standards Committee's Workgroup Meetings; Notice of Meetings AGENCY: Office of the National... only. Name of Committees: HIT Standards Committee's Workgroups: Clinical Operations Vocabulary... developed by the HIT Policy Committee. Date and Time: The HIT Standards Committee Workgroups will hold the...
76 FR 22397 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2011-04-21
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
77 FR 22787 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-04-17
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
77 FR 27459 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-05-10
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: to provide recommendations to...
76 FR 28783 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2011-05-18
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
76 FR 79684 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2011-12-22
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
75 FR 29762 - HIT Policy Committee's Workgroup Meetings; Notice of Meetings
2010-05-27
... Technology HIT Policy Committee's Workgroup Meetings; Notice of Meetings AGENCY: Office of the National... only. Name of Committees: HIT Policy Committee's Workgroups: Meaningful Use, Privacy & Security Policy... specifications, and certification criteria are needed. Date and Time: The HIT Policy Committee Workgroups will...
77 FR 73660 - HIT Policy Committee Advisory Meetings; Notice of Meetings
2012-12-11
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meetings; Notice of Meetings AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
77 FR 28881 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-05-16
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: to provide recommendations to...
76 FR 46298 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2011-08-02
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
77 FR 65691 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-10-30
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
76 FR 70455 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2011-11-14
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: to provide recommendations to...
77 FR 2727 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-01-19
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
76 FR 14975 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2011-03-18
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: to provide recommendations to...
76 FR 50734 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2011-08-16
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
76 FR 55912 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2011-09-09
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... the public. Name of Committee: HIT Policy Committee. General Function of the Committee: To provide...
77 FR 41788 - HIT Policy Committee Advisory Meeting; Notice of Meeting
2012-07-16
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Policy Committee Advisory Meeting; Notice of Meeting AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice of... of Committee: HIT Policy Committee. General Function of the Committee: To provide recommendations to...
76 FR 39107 - HIT Standards Committee's Workgroup Meetings; Notice of Meetings
2011-07-05
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee's Workgroup Meetings; Notice of Meetings AGENCY: Office of the National Coordinator for Health Information Technology, HHS. ACTION: Notice... of the Office of the National Coordinator for Health Information Technology (ONC). The [[Page 39108...
45 CFR 1703.301 - Meeting place.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Meeting place. 1703.301 Section 1703.301 Public... INFORMATION SCIENCE GOVERNMENT IN THE SUNSHINE ACT Conduct of Meetings § 1703.301 Meeting place. Meetings will be held in meeting rooms designated in the public announcement. Whenever the number of observers is...
PH Department
2011-01-01
DRAFT Agenda for the meeting to be held on Wednesday 9 March 2011 At 9:15 a.m. in room 60-6-002 Chairperson's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Report on services from GS department Update on Safety at CERN The new account management system Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairperson in writing or by e-mail to Michael.Hauschild@cern.ch Michael Hauschild (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria G. Walzel (76592) Belgium ...
76 FR 46298 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-08-02
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held virtually on August 17, 2011...
76 FR 50734 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-08-16
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on September 28, 2011, from 9...
77 FR 2727 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-01-19
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on February 29, 2012, from 9...
76 FR 70455 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-11-14
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on December 14, 2011, from 9...
77 FR 73661 - HIT Standards Committee Advisory Meetings; Notice of Meetings
2012-12-11
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meetings; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: These meetings will be held on the following dates and...
77 FR 65691 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-10-30
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on November 13, 2012, from 9...
77 FR 50690 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-08-22
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on September 19, 2012, from 9...
76 FR 55913 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-09-09
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held virtually on October 21, 2011...
77 FR 65690 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-10-30
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on December 19, 2012, from 9...
Directory of Open Access Journals (Sweden)
Haris Nikšić
2012-12-01
Full Text Available Introduction: Present study describes the antimicrobial activity and free radical scavenging capacity (RSC of essential oil from Mentha longifolia (L. Huds. Aim of this study to investigate the quality, antimicrobial andantioxidant activity of wild species Mentha longifolia essential oil from Bosnia and Herzegovina.Methods: The chemical profi le of essential oil was evaluated by the means of gas chromatography-mass spectrometry (GC-MS and thin-layer chromatography (TLC. Antimicrobial activity was tested against 6bacterial strains. RSC was assessed by measuring the scavenging activity of essential oils on 2,2- diphenyl-1-picrylhydrazil (DPPH.Results: The main constituents of the essential oil of M. longifoliae folium were oxygenated monoterpenes,piperitone oxide (63.58% and 1,8-cineole (12.03%. Essential oil exhibited very strong antibacterial activity.The most important antibacterial activity essential oil was expressed on Gram negative strains: Escherichia coli, Pseudomonas aerginosa and Salmonella enterica. subsp.enterica serotype ABONY. Antioxidant activity was evaluated as a RSC. Investigated essential oil was able to reduce DPPH radicals into the neutral DPPHH form (IC50=10.5 μg/ml and this activity was dose –dependent.Conclusion: The study revealed signifi cant antimicrobial activity of the investigated essential oil. The examined oil exhibited high RSC, which was found to be in correlation to the content of mainly monoterpeneketones and aldehydes. These results indicate that essential oils could serve as safe antioxidant and antiseptic supplements in pharmaceuticals.
Cooperative effects between two acyclovir resistance loci in herpes simplex virus.
Darby, G; Churcher, M J; Larder, B A
1984-01-01
The acyclovir-resistant mutant SC16 R9C2 (H.J. Field, G. Darby, and P. Wildy , J. Gen. Virol. 49:115-124, 1980) has been shown to contain two resistance loci which segregate independently on recombination with wild-type virus. One locus is in thymidine kinase, and the other is in DNA polymerase. Both induced enzymes have altered properties, thymidine kinase showing a low affinity for acyclovir and low activity, and DNA polymerase showing a low affinity for acyclovir triphosphate. Other properties of both enzymes are described which distinguish them from their wild-type counterparts. Recombinants containing either mutant thymidine kinase ( RSC -11) or mutant DNA polymerase ( RSC -26), but not both, have been used to investigate the relative contribution of each lesion to resistance and pathogenicity. Although SC16 R9C2 and both recombinants grow as well as does wild-type virus in tissue culture, they are considerably attenuated in vivo, the greatest attenuation of virulence being seen with SC16 R9C2 and RSC -26. With respect to both acyclovir resistance and in vivo growth, the lesions appear to behave synergistically. Cross resistance studies have shown the recombinant RSC -26, which contains mutant DNA polymerase but which evidently expresses wild-type thymidine kinase, to be cross resistant to both 5-iodo-2'-deoxyuridine and 5-trifluoromethyl-2'-deoxyuridine but not to (E)-5-(2-bromovinyl)-2'-deoxyuridine or 9-beta-D-arabinofuranosyladenine. Images PMID:6328014
Rhabdomyosarcomas in aging A/J mice.
Directory of Open Access Journals (Sweden)
Roger B Sher
Full Text Available Rhabdomyosarcomas (RSCs are skeletal muscle neoplasms found in humans and domestic mammals. The A/J inbred strain developed a high frequency (between 70-80% of adult pleomorphic type (APT RSC at >20 months of age while BALB/cByJ also develop RSC but less frequently. These neoplasms invaded skeletal muscle surrounding either the axial or proximal appendicular skeleton and were characterized by pleomorphic cells with abundant eosinophilic cytoplasm, multiple nuclei, and cross striations. The diagnosis was confirmed by detection of alpha-sarcomeric actin and myogenin in the neoplastic cells using immunocytochemistry. The A/J strain, but not the related BALB/c substrains, is also characterised by a progressive muscular dystrophy homologous to limb-girdle muscular dystrophy type 2B. The association between the development of RSC in similar muscle groups to those most severely affected by the progressive muscular dystrophy suggested that these neoplasms developed from abnormal regeneration of the skeletal muscle exacerbated by the dysferlin mutation. Transcriptome analyses of RSCs revealed marked downregulation of genes in muscular development and function signaling networks. Non-synonymous coding SNPs were found in Myl1, Abra, Sgca, Ttn, and Kcnj12 suggesting these may be important in the pathogenesis of RSC. These studies suggest that A strains of mice can be useful models for dissecting the molecular genetic basis for development, progression, and ultimately for testing novel anticancer therapeutic agents dealing with rhabdomyosarcoma.
2010-01-01
The Agendas and Minutes of the Management Board meetings are accessible to CMS members at: http://indico.cern.ch/categoryDisplay.py?categId=223 The Agendas and Minutes of the Collaboration Board meetings are accessible to CMS members at: http://indico.cern.ch/categoryDisplay.py?categId=174
Staff Association
2014-01-01
Public meetings : Come and talk about your future employment conditions ! The Staff Association will come and present the results of our survey on the 2015 five-yearly review. Following the survey, the topics discussed, will be contract policy, recognition of merit (MARS), working time arrangements and family policy. After each meeting and around a cup of coffee or tea you will be able to continue the discussions. Do not hesitate to join us, the five-yearly review, it is with YOU!
77 FR 16035 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-03-19
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on March 27, 2012, from 9 a.m...
76 FR 79684 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-12-22
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on January 25, 2012, from 9 a...
77 FR 15760 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-03-16
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on April 18, 2012, from 9 a.m...
76 FR 14976 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-03-18
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on April 20, 2011, from 9 a.m...
76 FR 39109 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-07-05
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on July 20, 2011, from 9 a.m...
76 FR 28782 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-05-18
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on June 22, 2011, from 9 a.m...
77 FR 27459 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-05-10
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on June 20, 2012, from 9 a.m...
77 FR 37408 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-06-21
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... be open to the public. Name of Committee: HIT Standards Committee. General Function of the Committee... with policies developed by the HIT Policy Committee. Date and Time: The meeting will be held on July 19...
77 FR 22787 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-04-17
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on May 24, 2012, from 9 a.m...
76 FR 22396 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-04-21
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: to provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on May 18, 2011, from 9 a.m...
77 FR 60438 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-10-03
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on October 17, 2012, from 9 a...
76 FR 9783 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2011-02-22
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on March 29, 2011, from 9 a.m...
77 FR 45353 - HIT Standards Committee Advisory Meeting; Notice of Meeting
2012-07-31
... DEPARTMENT OF HEALTH AND HUMAN SERVICES HIT Standards Committee Advisory Meeting; Notice of... public. Name of Committee: HIT Standards Committee. General Function of the Committee: To provide... developed by the HIT Policy Committee. Date and Time: The meeting will be held on August 15, 2012, from 9:00...
78 FR 32295 - Commission Meeting
2013-05-29
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... business meeting are contained in the Supplementary Information section of this notice. DATES: June 20...
77 FR 10599 - Commission Meeting
2012-02-22
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... business meeting are contained in the Supplementary Information section of this notice. DATES: March 15...
78 FR 12412 - Commission Meeting
2013-02-22
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... business meeting are contained in the Supplementary Information section of this notice. DATES: March 21...
78 FR 52601 - Commission Meeting
2013-08-23
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... meeting are contained in the Supplementary Information section of this notice. DATES: September 19, 2013...
77 FR 70204 - Commission Meeting
2012-11-23
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... meeting are contained in the SUPPLEMENTARY INFORMATION section of this notice. DATES: December 14, 2012...
78 FR 69517 - Commission Meeting
2013-11-19
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... meeting are contained in the Supplementary Information section of this notice. DATES: December 12, 2013...
77 FR 52106 - Commission Meeting
2012-08-28
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... business meeting are contained in the Supplementary Information section of this notice. DATES: September 20...
The Agendas and Minutes of the Management Board meetings are accessible to CMS members at: http://indico.cern.ch/categoryDisplay.py?categId=223 The Agendas and Minutes of the Collaboration Board meetings are accessible to CMS members at: http://indico.cern.ch/categoryDisplay.py?categId=174
Chris Onions
2005-01-01
DRAFT Agenda for the meeting to be held on Wednesday 7 December 2005 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Closure of computer accounts upon CERN contract expiry Reports from ACCU representatives on other committees Users' Office news Election of ACCU Chair Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets). Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) ...
Chris Onions
2005-01-01
DRAFT Agenda for the meeting to be held on Wednesday 8 June 2005 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Logistics at CERN Open Access Publishing Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tsenov (79573) Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Finland K. Lassila-Perini ...
Chris Onions
2005-01-01
DRAFT Agenda for the meeting to be held on Wednesday 9 March 2005 At 9:15 a.m. in room 160-1-009 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Purchasing procedures at CERN Reports from ACCU representatives on other committees Users' Office news CERN Clubs Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tsenov (79573) Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Finland K. Las...
PH Department
2008-01-01
DRAFT Agenda for the meeting to be heldon Wednesday 5 March 2008 At 9:15 a.m. in room 60-6-002 Chairman’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management An update on Safety at CERN The CERN Ombudsperson proposal Childcare initiative Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to mailto:Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) BelgiumnC. Vander Velde (71539) Bulgaria Czech Republic P. Závada (75877) Denm...
2006-01-01
DRAFT Agenda of the meeting to be held on Wednesday 6 September 2006 at 9:15 a.m. in Room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Report on Fellows and Associates Programme Overview of safety at CERN Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under Item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Finland K....
PH Department
2008-01-01
DRAFT Agenda for the meeting to be heldon Wednesday 5 March 2008 At 9:15 a.m. in room 60-6-002 Chairman’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management An update on Safety at CERN The CERN Ombudsperson proposal Childcare initiative Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to mailto:Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) BelgiumnC. Vander Velde (71539) Bulgaria Czech Republic P. Závada (75877) Denm...
PH Department
2008-01-01
DRAFT Agenda for the meeting to be held on Wednesday 10 September 2008 At 9:15 a.m. in Room 60-6-002 Chairman’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management An update on Safety at CERN Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 9 is invited to send them to the Chairman in writing or by e-mail to mailto:Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria, W. Adam (71661) Belgium, C. Vander Velde (71539) Bulgaria Czech Republic, P. Závada (75877) Denmark, J.B. Hansen (...
2007-01-01
DRAFT Agenda for the meeting to be held on Wednesday 7 March 2007 at 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Car-sharing pilot project Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 9 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Finland K. Lassila-Perini (79354) France F. Kunne S. ...
PH Department
2008-01-01
DRAFT Agenda for the meeting to be held on Wednesday 11 June 2008 At 9:15 a.m. in room 60-6-002 Chairman’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management An update on Safety at CERN Childcare initiative Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to mailto:Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria - W. Adam (71661) Belgium - C. Vander Velde (71539) Bulgaria Czech Republic - P. Závada (75877) Denmark - J.B. Hansen...
Chris Onions
2001-01-01
DRAFT Agenda for the meeting to be held on Wednesday 7 March 2001 At 9:15 a.m. in the 6th floor Conference Room, Main Building Chairman's remarks Adoption of the agenda News from the CERN Management Minutes of the previous meeting Matters arising Video-conferencing/recording Fellows programme Operational Circular No. 6 EP Space management Update on Computing Issues Users' Office News Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 12 is invited to send them to the Secretary in writing via the CERN Users' Office or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic...
PH Department
2009-01-01
DRAFT Agenda for the meeting to be held on Wednesday 11 March 2009 At 9:15 a.m. in room 60-6-002 Chairman’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management The CERN Press Office An update on Safety at CERN The Burotel project Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to mailto:Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria G. Walzel () Belgium C. Vander Velde (71539) Bulgaria Czech Republic P. Závada (75877) Denmark...
PH Department
2010-01-01
DRAFT Agenda for the meeting to be held on Wednesday 10 March 2010 At 9:15 a.m. in room 60-6-002 Chairperson’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Report on services from GS department An update on Safety at CERN Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives on ACCU are (CERN internal telephone numbers in brackets): Austria G. Walzel (76592) Belgium C. Vander Velde (Chairperson) (71539) Bulgaria Czech Republic S. Nemecek (71144) ...
PH Department
2011-01-01
DRAFT Agenda for the meeting to be held on Wednesday 7 September 2011 at 9:15 a.m. in room 60-6-002 Chairperson's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Report on services from GS department Report on new CHIS rules Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 9 is invited to send them to the Chairperson in writing or by e-mail to Michael.Hauschild@cern.ch Michael Hauschild (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria M. Jeitler (76307) Belgium C. Vander Velde (Chairperson)...
PH Department
2010-01-01
DRAFT Agenda for the meeting to be held on Wednesday 8 December 2010 at 9:15 a.m. in room 60-6-002 Chairperson's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Report on services from GS department The CERN Ombuds The new account management system Crèche progress + Restaurants Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 12 is invited to send them to the Chairperson in writing or by e-mail to Michael.Hauschild@cern.ch Michael Hauschild (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): ...
PH Department
2009-01-01
DRAFT Agenda for the meeting to be held on Wednesday 10 June 2009At 9:15 a.m. in room 60-6-002 Chairman’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management CERN Social Services User services in GS Department An update on Safety at CERN Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to mailto:Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria - G. Walzel (76592) Belgium - C. Vander Velde (71539) Bulgaria Czech Republic - P. Závada (7587...
PH Department
2010-01-01
DRAFT Agenda for the meeting to be held on Wednesday 8 September 2010 at 9:15 a.m. in Room 60-6-002 Chairperson’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Report on services from GS Department An update on Safety at CERN The CERN Summer Student program Bringing Library services to users Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 12 is invited to send them to the Chairperson in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): ...
Chris Onions
DRAFT Agenda for the meeting to be held on Wednesday 9 December 2009 At 9:15 a.m. in Room 60-6-002 Chairman’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Restaurant No. 1 extension An update on Safety at CERN Reports from ACCU representatives on other committees Users’ Office news Election of the ACCU Chair Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria G. Walzel (76592) Belgium C. Vander Velde (71539) Bulgaria Czech Republic P. Záv...
PH Department
2010-01-01
DRAFT Agenda for the meeting to be held on Wednesday 9 June 2010 At 9:15 a.m. in room 60-6-002 Chairperson’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Report on services from GS department CERN Global Network An update on Safety at CERN Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairperson in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria G. Walzel (76592) ...
GONZALEZ FERRANDIS, ELENA
2014-01-01
[ES] El objeto de este trabajo final de carrera es realizar un plan de empresa para un negocio de nueva creación que consiste en una consultoría de Responsabilidad Social Corporativa (RSC) y comunicación dirigida a PYMES. Con este proyecto, pretendemos desarrollar la idea empresarial, los métodos que conlleva su puesta en marcha y el conocimiento de su viabilidad. Nuestra empresa ayuda a las PYMES a integrar el concepto de RSC en su estrategia a través de servicios de consultoría y comunic...
Barrio Fraile, Estrella
2013-01-01
Estamos ante un nuevo modelo de gestión empresarial donde el protagonismo de los productos y servicios ha dado paso al auge de los valores intangibles, entre los cuales destaca la Responsabilidad Social Corporativa (RSC). Esta nueva situación, exige de una correcta gestión y comunicación de la RSC por parte de las empresas, debido a su influencia en la confianza de los públicos hacia éstas, y por consiguiente en la reputación de las propias empresas. or otro lado, no se puede obviar el contex...
Mari Ripa, Daniel
2016-01-01
La presente Tesis Doctoral analiza la influencia de las iniciativas de la Responsabilidad Social Corporativa (RSC) de las empresas en la salud, seguridad y bienestar de los trabajadores. Para ello, se utiliza una orientación multimétodo, que incluye análisis cualitativos y cuantitativos así como diversas fuentes de datos. En primer lugar, se examina el grado en que 27 estándares de evaluación de RSC cubren las condiciones laborales, a través de una extensa revisión, y qué áreas...
Fast Coordinated Control of DFIG Wind Turbine Generators for Low and High Voltage Ride-Through
DEFF Research Database (Denmark)
Wang, Yun; Wu, Qiuwei; Xu, Honghua
2014-01-01
This paper presents a fast coordinated control scheme of the rotor side converter (RSC), the DC chopper and the grid side converter (GSC) of doubly fed induction generator (DFIG) wind turbine generators (WTGs) which is to improve the low voltage ride through (LVRT) and high voltage ride through...... were proposed considering the characteristics of the DFIG WTGs during voltage changes. The fast coordinated control of RSC and GSC were developed based on the characteristic analysis in order to realize efficient LVRT and HVRT of the DFIG WTGs. The proposed fast coordinated control schemes were...
La responsabilidad social corporativa en el Perú. Realidad versus discurso
León Untiveros, Miguel A.
2010-01-01
En nuestro país, la conciencia de la responsabilidad social corporativa (RSC), al menos a nivel del discurso, ocupa un espacio significativo. Por ello, resulta de suma importancia evaluar su puesta en práctica en atención a su realidad económica y social. Así, en este trabajo presentamos el estado del arte junto con algunas críticas importantes sobre la RSC y su noción más amplia: la sostenibilidad corporativa (partes I al IV). Luego pasamos a contrastar el modelo discursivo con la realidad p...
DEFF Research Database (Denmark)
Larsen, Samuel Brüning; Masi, Donato; Jacobsen, Peter
2017-01-01
The ongoing transition to a Circular Economy is changing the shape of Supply Chains. They are becoming more ‘Closed-Loop’, combining forward and reverse flows of products and materials. Reverse Supply Chains (RSCs), originally considered as a solution for handling waste or recovering residual value...... seven case studies, focusing on original equipment manufacturers (OEMs), show how the RSC can play a strategic, tactical, or operational role for the firm. The paper applies for the first time the concept of strategic alignment to the RSC and practitioners can use the proposed framework to analyse...
77 FR 28420 - Commission Meeting
2012-05-14
... SUSQUEHANNA RIVER BASIN COMMISSION Commission Meeting AGENCY: Susquehanna River Basin Commission. ACTION: Notice. SUMMARY: The Susquehanna River Basin Commission will hold its regular business meeting on... meeting are contained in the Supplementary Information section of this notice. DATES: June 7, 2012, at 9...
75 FR 33306 - Notice of Meeting Location Change and Joint Meeting of FASAB and GASB
2010-06-11
... meeting is to discuss: --Measurement Attributes, --Reporting Model, --Cost Accounting, and --Governance... FEDERAL ACCOUNTING STANDARDS ADVISORY BOARD Notice of Meeting Location Change and Joint Meeting of FASAB and GASB AGENCY: Federal Accounting Standards Advisory Board. ACTION: Notice. Board Action...
78 FR 67201 - Sunshine Act Meeting
2013-11-08
... Institutional Advancement Committee will meet telephonically on November 22, 2013. The meeting will commence at... of the closed session meeting of the Institutional Advancement Committee. The transcript of any... 1973 Rehabilitation Act. Upon request, meeting notices and materials will be made available in...
78 FR 73210 - Sunshine Act Meeting
2013-12-05
... Institutional Advancement Committee will meet telephonically on December 10, 2013. The meeting will commence at... will be made of the closed session meeting of the Institutional Advancement Committee. The transcript... Americans with Disabilities Act and Section 504 of the 1973 Rehabilitation Act. Upon request, meeting...
78 FR 12365 - Sunshine Act Meeting
2013-02-22
... Institutional Advancement Committee will meet telephonically on February 26, 2013. The meeting will commence at... made of the closed session of the Board and Institutional Advancement Committee meetings. The... Rehabilitation Act. Upon request, meeting notices and materials will be made available in alternative formats to...
Mateja Dostal
2016-01-01
This article reports on the analysis of business meeting simulation data investigating the use of Business English (BE) in business meeting simulations at the Faculty of Economics, University of Ljubljana, Slovenia. The research explores the use of business meeting simulations in a higher education setting in order to bring into focus how patterns of linguistic interactions among BE students are structured, with and without a BE teacher’s corrective feedback. The findings provide possible sol...
International Nuclear Information System (INIS)
Braams, B.J.; Chung, H.-K.
2011-01-01
This is the 21st meeting of the International Atomic and Molecular Data Centres Network. The traditional DCN meeting objectives are: to exchange information about activities in the Centres and review progress; to coordinate work in the Centres; to assess priorities in data evaluation and data production; to make plans for specific evaluations; and to evaluate and revise procedures for collection and exchange of bibliographical and numerical data. All of these are objectives for the present meeting too. In addition to the presentations from DCN and prospective DCN members we have two participants from outside the field of fusion data: Dr N. Mason will tell us about coordination of the Virtual Atomic and Molecular Data Centre and Dr S. Simakov will describe the manner in which nuclear structure and cross-section database development is coordinated by our colleagues in the Nuclear Data Section. In the discussions on Thursday and Friday there are two topics that need special attention this year: the future of our bibliographical data compilation and ways in which we can strengthen data evaluation activities, all with emphasis on collision processes and plasma-material interaction. The first 3 Data Centre Network meetings were held in 1977, 1980 and 1982 and the reports of those meetings make interesting reading and can still provide inspiration for the present meeting. I show some excerpts in the presentation. In 1977 the emphasis was on the coordination of the bibliographical database, AMBDAS, and a collision data index, CIAMDA, as the initial activities of the Network and of the newly formed IAEA A+M Data Unit. In 1980 the central topic of discussion at the meeting shifted to the numerical database and to data evaluation. The Network recommended that numerical data be reviewed by a selected group of scientists and that no unevaluated numerical A+M collision data should be distributed by the IAEA. The report of the meeting in 1982 shows that the bibliographical
78 FR 59374 - Sunshine Act Meeting
2013-09-26
... Institutional Advancement Committee will meet telephonically on October 1, 2013. The meeting will commence at 4... meeting of the Institutional Advancement Committee. The transcript of any portion of the closed session... the 1973 Rehabilitation Act. Upon request, meeting notices and materials will be made available in...
78 FR 53480 - Sunshine Act Meeting
2013-08-29
... Institutional Advancement Committee will meet telephonically on September 3, 2013. The meeting will commence at... session meeting of the Institutional Advancement Committee. The transcript of any portion of the closed... Disabilities Act and Section 504 of the 1973 Rehabilitation Act. Upon request, meeting notices and materials...
78 FR 14839 - Sunshine Act Meeting
2013-03-07
... Institutional Advancement Committee will meet telephonically on March 12, 2013 and March 26, 2013. Each meeting... session meeting of the Institutional Advancement Committee. The transcript of any portion of the closed... Act and Section 504 of the 1973 Rehabilitation Act. Upon request, meeting notices and materials will...
78 FR 21978 - Sunshine Act Meeting
2013-04-12
... Institutional Advancement Committee will meet telephonically on April 23, 2013. The meeting will commence at 4... written transcript will be made of each closed session meeting of the Institutional Advancement Committee... the 1973 Rehabilitation Act. Upon request, meeting notices and materials will be made available in...
Meyer, H
1980-10-22
Executives spend about 69% of their time in meeting with at least two other people, according to a recent study out of McGill University. In spite of this, participants do not consider this to be time used wisely and, according to the respondents, the problem seems to be growing worse. Despite the claims of some executives that government regulations or increased corporate complexity underlies the problem, society at large is viewed as the source of the change. Meyer asserts that all institutions have become less authoritarian and the trend away from command has left persuasion and consensus as the basis for corporate level decision-making. Although executives seem to agree that most time is wasted because participants fail to be succinct, the author argues that leaders could improve meetings by choosing the right participants, guiding them briskly through the agenda, and closing the meeting before it degenerates into a shouting match. The article suggests that chief executives are concluding that meeting skills can be learned. Most of the FORTUNE 500 companies have hired outside experts to teach these skills and some companies are building inhouse units for the same purpose. Since meetings have become an integral part of the business day, Meyer concluded that the goal of the executive should be to use the meeting time well.
78 FR 78467 - Connected Vehicle Research Program Public Meeting; Notice of Public Meeting
2013-12-26
... connected vehicle technologies. The primary target audience for the meeting is State and local Departments... meeting is specifically focused for an audience that has followed connected vehicle research and is...
78 FR 8203 - Sunshine Act Meetings
2013-02-05
...: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of... Meeting) (Contact: Ken Karwoski, 301-415-2752) This meeting will be webcast live at the web address--www... Uranium Recovery (Public Meeting) (Contact: Bill von Till, 301-415-0598) This meeting will be webcast live...
78 FR 20356 - Sunshine Act Meeting
2013-04-04
... Institutional Advancement Committee will meet telephonically on April 9, 2013. The meeting will commence at 4:00... verbatim written transcript will be made of each closed session meeting of the Institutional Advancement... Rehabilitation Act. Upon request, meeting notices and materials will be made available in alternative formats to...
75 FR 9451 - Sunshine Act Meetings
2010-03-02
... Tuesday, March 2, 2010 9:30 a.m. Briefing on Uranium Recovery (Public Meeting). (Contact: Dominick Orlando, 301-415-6749.) This meeting will be webcast live at the Web address-- http://www.nrc.gov , Week of... NUCLEAR REGULATORY COMMISSION [NRC-2010-0002] Sunshine Act Meetings Agency Holding the Meetings...
28 CFR 16.202 - Open meetings.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Open meetings. 16.202 Section 16.202 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR DISCLOSURE OF MATERIAL OR INFORMATION Public Observation of Parole Commission Meetings § 16.202 Open meetings. (a) Every portion of every meeting of the...
2013-01-23
... FARM CREDIT SYSTEM INSURANCE CORPORATION Board Meeting AGENCY: Farm Credit System Insurance Corporation. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the offices of the Farm...
2010-09-02
... FARM CREDIT SYSTEM INSURANCE CORPORATION Regular Meeting AGENCY: Farm Credit System Insurance Corporation Board. SUMMARY: Notice is hereby given of the regular meeting of the Farm Credit System Insurance Corporation Board (Board). DATE AND TIME: The meeting of the Board will be held at the offices of the Farm...
2011-02-18
... DEPARTMENT OF THE TREASURY United States Mint Public Meeting ACTION: Notification of Citizens Coinage Advisory Committee March 1, 2011, Public Meeting. SUMMARY: Pursuant to United States Code, Title... (CCAC) public meeting scheduled for March 1, 2011. Date: March 1, 2011. Time: 10 a.m. to 1 p.m. Location...
49 CFR 552.7 - Public meeting.
2010-10-01
... 49 Transportation 6 2010-10-01 2010-10-01 false Public meeting. 552.7 Section 552.7 Transportation... Public meeting. If the Associate Administrator decides that a public meeting on the subject of the... public meeting for publication in the Federal Register to advise interested persons of the time, place...
78 FR 69086 - Sunshine Act Meeting
2013-11-18
... FEDERAL ELECTION COMMISSION Sunshine Act Meeting AGENCY: Federal Election Commission. Federal... 19, 2013 at 10:00 a.m. PLACE: 999 E Street NW., Washington, DC. STATUS: This meeting will be closed to the public. CHANGES IN THE MEETING: The meeting will begin at 11:00 a.m. ITEMS TO BE DISCUSSED...
78 FR 70539 - Sunshine Act Meeting
2013-11-26
... COMMODITY FUTURES TRADING COMMISSION Sunshine Act Meeting AGENCY HOLDING THE MEETING: Commodity Futures Trading Commission. TIME AND DATE: 10:00 a.m., Friday, December 13, 2013. PLACE: 1155 21st St. NW... meetings change, an announcement of the change, along with the new time, date and location of the meeting...
2011-10-17
... APPALACHIAN STATES LOW-LEVEL RADIOACTIVE WASTE COMMISSION Annual Meeting Time and Date: 10 a.m.-12..., PA 17101. Status: The meeting will be open to the public. Matters to be Considered: Portions Open to the Public: The primary purpose of this meeting is to (1) Review the independent auditors' report of...
2010-10-22
... APPALACHIAN STATES LOW-LEVEL RADIOACTIVE WASTE COMMISSION Annual Meeting Time And Date: 10 a.m.-12..., PA 17101. Status: The meeting will be open to the public. Matters To Be Considered Portions Open to the Public: The primary purpose of this meeting is to (1) Review the independent auditors' report of...
2010-12-20
... ARCTIC RESEARCH COMMISSION Meeting Notice Notice is hereby given that the U.S. Arctic Research Commission will hold its 95th meeting in Anchorage, AK, on January 21, 2011. The business session, open to... agenda. (2) Approval of the minutes from the 94th meeting. (3) Commissioners and staff reports. (4...
2013-10-29
... APPALACHIAN STATES LOW-LEVEL RADIOACTIVE WASTE COMMISSION Annual Meeting Time and Date: 10 a.m.-12... 17101. Status: The meeting will be open to the public. Matters To Be Considered: Portions Open To The Public: The primary purpose of this meeting is to (1) Review the independent auditors' report of...
2012-10-11
... APPALACHIAN STATES LOW-LEVEL RADIOACTIVE WASTE COMMISSION Annual Meeting Time and Date: 10 a.m.-12... 17101. Status: The meeting will be open to the public. Matters To Be Considered Portions Open to the Public: The primary purpose of this meeting is to (1) Review the independent auditors' report of...
78 FR 6399 - Overseas Security Advisory Council (OSAC) Meeting Notice; Closed Meeting
2013-01-30
... that the meeting will be closed to the public. The meeting will focus on an examination of corporate... proprietary commercial information that is privileged and confidential, and will discuss law enforcement... protection of U.S. business information overseas. For more information, contact Marsha Thurman, Overseas...
76 FR 65318 - Overseas Security Advisory Council (OSAC) Meeting Notice; Closed Meeting
2011-10-20
... that the meeting will be closed to the public. The meeting will focus on an examination of corporate... commercial information that is privileged and confidential, and will discuss law enforcement investigative... U.S. business information overseas. For more information, contact Marsha Thurman, Overseas Security...
78 FR 45286 - Overseas Security Advisory Council (OSAC) Meeting Notice Closed Meeting
2013-07-26
... that the meeting will be closed to the public. The meeting will focus on an examination of corporate... commercial information that is privileged and confidential, and will discuss law enforcement investigative... protection of U.S. business information overseas. For more information, contact Marsha Thurman, Overseas...
77 FR 27110 - Overseas Security Advisory Council (OSAC) Meeting Notice; Closed Meeting
2012-05-08
... that the meeting will be closed to the public. The meeting will focus on an examination of corporate... commercial information that is privileged and confidential, and will discuss law enforcement investigative... U.S. business information overseas. For more information, contact Marsha Thurman, Overseas Security...
Meeting of senior officials on managing nuclear knowledge. Meeting report
International Nuclear Information System (INIS)
2002-01-01
In response to the recommendations of several Agency advisory committees, e.g. INSAG, SAGNE 2002, SAGNA, SAGTAC, to address issues related to nuclear knowledge management, the IAEA convened a meeting on Managing Nuclear Knowledge with senior representatives from Member States. The purpose of the meeting was to sharpen awareness and understanding of the emerging concerns about the maintenance and preservation of knowledge and expertise in nuclear science, technology and applications and to better comprehend the role of the Agency in this process. The meeting was attended by more than 70 participants from 35 Member States and 4 international organizations, representing academic leaders, senior level executives, managers and governmental officials. This report includes general recommendations, summary of the keynote of the Member States, statements on the role of the IAEA and International cooperation in managing nuclear knowledge
78 FR 69141 - Sunshine Act Meeting
2013-11-18
... POSTAL REGULATORY COMMISSION Sunshine Act Meeting TIME AND DATE: Wednesday, December 11, 2013, at.... STATUS: Part of this meeting will be open to the public. The rest of the meeting will be closed to the... December 11, 2013 meeting includes the items identified below. PORTIONS OPEN TO THE PUBLIC: 1. Report from...
Let’s have a meeting: How hospitals use scheduled meetings to support cross-boundary collaboration
DEFF Research Database (Denmark)
Prætorius, Thim; Hasle, Peter; Nielsen, Anders Paarup
2018-01-01
of meetings, we add to previous research studying when meetings are used (e.g., task and input uncertainty). In particular, we focus on meetings’ role for achieving collaboration across occupational and departmental boundaries and for developing the collaboration skills component of organizational social...... and help those involved to solve concrete care tasks. Meetings are often inter-disciplinary, thereby having the potential to develop relations, common goals and trust (organizational social capital components) across occupational and departmental boundaries. For hospital managers, our findings...... are important because they can use meetings to respond to the pressing need for more and better intra-organizational health care collaboration. Using meetings sensibly also allows hospitals to benefit from the positive outcomes of collaboration and social capital (e.g., knowledge sharing, performance...
Chris Onions
2006-01-01
DRAFT Agenda of the meeting to be held on Wednesday 8 March 2006 At 9:15 a.m. in Room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Proposal for a centralised access control service Report from PH Space Management Policy Board Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under Item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives on ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) ...
PH Department
2008-01-01
DRAFT Agenda for the meeting to be held on Wednesday 11 June 2008 At 9:15 a.m. in Room 60-6-002 1.\tChairman’s remarks 2.\tAdoption of the agenda 3.\tMinutes of the previous meeting 4.\tMatters arising 5.\tNews from the CERN Management 6.\tAn update on safety at CERN 7.\tChildcare initiative 8.\tReports from ACCU representatives on other committees 9.\tUsers’ Office news 10.\tAny Other Business 11.\tAgenda for the next meeting Anyone wishing to raise any points under Item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium C. Vander Velde (71539) Bulgaria Czech Republic P. Závada (75...
Chris Onions
2004-01-01
DRAFT Agenda for the meeting to be held on Wednesday 9 June 2004 at 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Update on CERN's 50th anniversary celebrations Report from the EPOG (European Particle Physics Outreach Group) Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark P. Hansen (75941...
Chris Onions
2005-01-01
DRAFT Agenda for the meeting to be held on Wednesday 7 September 2005 At 9:15 a.m. in room 60-6-002 Chairman’s remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Logistics at CERN Reports from ACCU representatives on other committees Users’ Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Finland K. Lassila-Perini (79354) France F. Bauer S. Laplace...
Chris Onions
2004-01-01
DRAFT Agenda for the meeting to be held on Wednesday 8 September 2004 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management The Visits Service Lifetime of Computer Accounts Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tsenov (79573) Czech Republic P. Závada (75877) Denmark P. Hansen (75941) Finland K. Lassila-Perini (79354) France F. Bauer (7...
Chris Onions
2006-01-01
DRAFT Agendafor the meeting to be held on Wednesday 8 March 2006At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Proposal for a centralised access control service Report from PH Space Management Policy Board Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Fin...
2006-01-01
DRAFT Agenda for the meeting to be held on Wednesday 6 December 2006 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Safety at CERN Car sharing pilot project CERN Public Web Sites and Intranet Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Finl...
Chris Onions
2004-01-01
DRAFT Agenda for the meeting to be held on Wednesday 8 December 2004 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting The effects of the reorganization of CERN's structure, one year on Matters arising News from the CERN Management Computer Security The new CERN Dosimeter Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tsenov (79573) Czech Republic P. Závada (75877) Denmark P. Hansen (7594...
Chris Onions
2007-01-01
DRAFT Agenda for the meeting to be held on Wednesday 13 June 2007 at 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Dosimetry at CERN Status of collaborative tools at CERN Reports from ACCU representatives on other committees Users' Office newss Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Finland K. Lassila-Perini (7935...
Chris Onions
2004-01-01
DRAFT Agenda for the meeting to be held on Wednesday 8 September 2004 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management The Visits Service Lifetime of Computer Accounts Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tsenov (79573) Czech Republic P. Závada (75877) Denmark P. Hansen (75941) Finland K. Lassila-Perini (79354) France F. Bauer (...
2006-01-01
DRAFT Agenda for the meeting to be held on Wednesday 6 December 2006 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Safety at CERN Car sharing pilot project CERN Public Web Sites and Intranet Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Finl...
Chris Onions
2004-01-01
DRAFT Agenda for the meeting to be held on Wednesday 8 December 2004 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting The effects of the reorganization of CERN's structure, one year on Matters arising News from the CERN Management Computer Security The new CERN Dosimeter Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tsenov (79573) Czech Republic P. Závada (75877) Denmark P. Hansen (75941) Finl...
Chris Onions
2004-01-01
DRAFT Agenda for the meeting to be held on Wednesday 9 June 2004 at 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Update on CERN's 50th anniversary celebrations Report from the EPOG (European Particle Physics Outreach Group) Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tsenov (79573) Czech Republic P. Závada (75877) Denmark P. Hansen (75941) Finlan...
2007-01-01
DRAFT Agenda for the meeting to be held on Wednesday 7 March 2007 at 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Car-sharing pilot project Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 9 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) Denmark J.B. Hansen (75941) Finland K. Lassila-Perini (79354) France F. Kunne S. La...
2004-01-01
DRAFT Agenda for the meeting to be held on Wednesday 10 March 2004 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 6. The PH Department 2. Adoption of the agenda 7. Reports from ACCU representatives on other committees 3. Minutes of the previous meeting 8. Users' Office news 4. News from the CERN Management 9. Any Other Business 5. Matters arising 10. Agenda for the next meeting Anyone wishing to raise any points under item 9 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Norway H. Helstrup (73601) Belgium G. Wilquet (74664) Poland Z. Hajduk (75917) Bulgaria R. Tsenov (79573) Portugal P. Bordalo (74704) Czech Republic P. Závada ...
Chris Onions
2004-01-01
DRAFT Agenda for the meeting to be held on Wednesday 10 March 2004 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting News from the CERN Management Matters arising The PH Department Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 9 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark P. Hansen (75941) Finland E. Tuominen (71534) France F. Bauer (71247) L. Serin...
Chris Onions/EP (Secretary)
2001-01-01
DRAFT Agenda for the meeting to be held on Wednesday 6 June 2001 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda News from the CERN Management Minutes of the previous meeting Matters arising EP Space management Cars Housing EDH from the User's point of view VRVS Users' Office News Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 12 is invited to send them to the Secretary in writing via the CERN Users' Office or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark A. Waananen (75941) Finland A. Kiiskinen (79387) France M. Déj...
Chris Onions (Secretary)
2001-01-01
DRAFT Agenda for the meeting to be held on Wednesday 6 June 2001 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda News from the CERN Management Minutes of the previous meeting Matters arising Logistics and Self-service stores EP Space management follow-up How to improve IT User Support? Users' Office News Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Secretary in writing via the CERN Users' Office or by e-mail to Roger.Jones@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark A. Waananen (75941) Finland A. Kiis...
Chris Onions (Secretary)
2001-01-01
DRAFT Agenda for the meeting to be held on Wednesday 12 September 2001 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda News from the CERN Management Minutes of the previous meeting Matters arising Logistics and Self-service stores EP Space management follow-up How to improve IT User Support? Users' Office News Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Secretary in writing via the CERN Users' Office or by e-mail to Roger.Jones@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark A. Waananen (75941) Finland A. Kiiskin...
2003-01-01
DRAFT Agenda for the meeting to be held on Wednesday 10 September 2003 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 7. Equal Opportunities Commission 2. Adoption of the agenda 8. Registration plans for portables 3. Minutes of the previous meeting 9. Reports from ACCU representatives on other committees 4. Matters arising 10. Users' Office news 5. News from the CERN Management 11. Any Other Business 6. The Press Office 12. Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Norway H. Helstrup (73601) Belgium G. Wilquet (74664) Poland Z. Hajduk (75917) Bulgar...
2003-01-01
DRAFT Agenda for the meeting to be held on Wednesday 5 March 2003 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 7. Equipment insurance on site 2. Adoption of the agenda,8. ACCU reporting mechanisms in the different countries 3. Minutes of the previous meeting9. Reports from ACCU representatives on other committees 4. Matters arising10. Users' Office news 5. News from the CERN Management11. Any Other Business 6. CHIS news and follow-up of survey12. Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661)NorwayH. Helstrup (73601) Belgium G. Wilquet (74664) Poland Z. Hajduk (7591...
Chris Onions
2002-01-01
DRAFT Agenda for the meeting to be held on Wednesday 11 September 2002 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Health Insurance Questionnaire Host States Relations Service Update on EP Space management Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark A. Waananen (75941) Finland E. Tuominen (71534) France F. Bauer (71247) L. Serin (...
2003-01-01
DRAFT Agenda for the meeting to be held on Wednesday 10 December 2003 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 8. Report from IT division on Computing matters 2. Adoption of the agenda 9. Young Particle Physicists Association 3. Minutes of the previous meeting 10. Reports from ACCU representatives on other committees 4. Matters arising 11. Users' Office news 5. News from the CERN Management 12. Election of the ACCU Chair 6. Report from the new Director-General 13. Any Other Business 7. CERN's 50th anniversary 14. Agenda for the next meeting Anyone wishing to raise any points under item 13 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Ada...
2003-01-01
DRAFT Agenda for the meeting to be held on Wednesday 5 March 2003 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 7. Equipment insurance on site 2. Adoption of the agenda 8. ACCU reporting mechanisms in the different countries 3. Minutes of the previous meeting 9. Reports from ACCU representatives on other committees 4. Matters arising 10. Users' Office news 5. News from the CERN Management 11. Any Other Business 6. Health Insurance news and follow-up of survey 12. Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Norway H. Helstrup (73601) Belgium G. Wil...
2003-01-01
DRAFT Agenda for the meeting to be held on Wednesday 11 June 2003 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 7. Reports from ACCU representatives 2. Adoption of the agenda on other committees 3. Minutes of the previous meeting 8. Users' Office news 4. Matters arising 9. Any Other Business 5. News from the CERN Management 10. Agenda for the next meeting 6. Property Protection at CERN Anyone wishing to raise any points under item 9 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Norway H. Helstrup (73601) Belgium G. Wilquet (74664) Poland Z. Hajduk (75917) Bulgaria R. Tsenov (74837) Portugal P. Bordalo (74704) Czech Republic ...
2003-01-01
DRAFT Agenda for the meeting to be held on Wednesday 10 September 2003 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 8. Registration plans for portables 2. Adoption of the agenda 9. Reports from ACCU representatives 3. Minutes of the previous meeting on other committees 4. Matters arising 10. Users' Office news 5. News from the CERN Management 11. Any Other Business 6. The Press Office 12. Agenda for the next meeting 7. Equal Opportunities Commission Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): AustriaW. Adam (71661) Norway H. Helstrup (73601) Belgium G. Wilquet (74664) Poland Z. Hajduk (75917) Bulgari...
2003-01-01
DRAFT Agenda for the meeting to be held on Wednesday 10 December 2003 At 9:15 a.m. in room 60-6-002 1. Chairman's remarks 8. Report from IT division on Computing matters 2. Adoption of the agenda 9. Young Particle Physicists Association 3. Minutes of the previous meeting 10. Reports from ACCU representatives on other committees 4. Matters arising 11. Users' Office news 5. News from the CERN Management 12. Election of the ACCU Chair 6. Report from the new Director-General 13. Any Other Business 7. CERN's 50th anniversary 14. Agenda for the next meeting Anyone wishing to raise any points under item 13 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (716...
Chris Onions
2002-01-01
DRAFT Agenda for the meeting to be held on Wednesday 6 March 2002 At 9:15 a.m. in the Council Chamber Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Follow-up on Space Management Users' Desktop needs PIE procedures Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark A. Waananen (75941) Finland E. Tuominen (71534) France F. Bauer L. Serin (712...
Chris Onions
2002-01-01
DRAFT Agenda for the meeting to be held on Wednesday 12 June 2002 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management PIE procedures CERN Cars EP Electronics Advisory Board Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark A. Waananen (75941) Finland E. Tuominen (71534) France F. Bauer (71247) L. Serin (71143) Germany H. Kroha...
2000-01-01
DRAFT Agenda for the meeting to be held on Wednesday 13 September 2000 At 10 a.m. in the 6th floor Conference Room, Main Building 1. Chairman's remarks 2. Adoption of the agenda 3. News from the CERN Management 4. Minutes of the previous meeting 5. Matters arising 6. Report from the Scientific Information Policy Board 7. Report from ETT Division: The Press Office 8. Update on Computing Issues 9. Users' Office News 10. Any Other Business 11. Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Secretary in writing via the CERN Users' Office or by e-mail to Bryan Pattison (Secretary). ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets) : Austria G. Neuhofer (74094) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Z vada (75...
Bryan Pattison
2000-01-01
DRAFT Agenda for the meeting to be held on Wednesday 13 September 2000 At 10 a.m. in the 6th floor Conference Room, Main Building1. Chairman's remarks2. Adoption of the agenda3. News from the CERN Management4. Minutes of the previous meeting5. Matters arising6. Report from the Scientific Information Policy Board7. Report from ETT Division: The Press Office8. Update on Computing Issues9. Users' Office News10. Any Other Business11. Agenda for the next meetingAnyone wishing to raise any points under item 10 is invited to send them to the Secretary in writing via the CERN Users' Office or by e-mail toBryan Pattison(Secretary).ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets) :Austria G. Neuhofer (74094)Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958)Czech Republic P. Závada (75877)Den...
Chris Onions
2002-01-01
DRAFT Agenda for the meeting to be held on Wednesday 12 June 2002 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management PIE procedures CERN Cars EP Electronics Advisory Board Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria R. Tzenov (77958) Czech Republic P. Závada (75877) Denmark A. Waananen (75941) Finland E. Tuominen (71534) France F. Bauer (71247) L. Serin (71143) Germany H. Kroha ...
PH Department
2009-01-01
DRAFT Agenda for the meeting to be held on Wednesday 11 March 2009 At 9:15 a.m. in room 60-6-002 1.\tChairman’s remarks 2.\tAdoption of the agenda 3.\tMinutes of the previous meeting 4.\tMatters arising 5.\tNews from the CERN Management 6.\tThe CERN Press Office 7.\tAn update on Safety at CERN 8.\tThe Burotel project 9.\tReports from ACCU representatives on other committees 10.\tUsers’ Office news 11.\tAny Other Business 12.\tAgenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to mailto:Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria G. Walzel () Belgium C. Vander Velde (71539) Bulgaria C...
Chris Onions
2006-01-01
DRAFT Agenda for the meeting to be held on Wednesday 14 June 2006 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Car sharing pilot project The CERN Document Server : the portal to Open Access Videoconferencing and collaborative tools at CERN Reports from ACCU representatives on other committees Users' Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (7...
Chris Onions
2006-01-01
DRAFT Agenda for the meeting to be held on Wednesday 14 June 2006 At 9:15 a.m. in room 60-6-002 Chairman's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Car sharing pilot project The CERN Document Server : the portal to Open Access Videoconferencing and collaborative tools at CERN Reports from ACCU representatives on other committees Users'Office news Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria Czech Republic P. Závada (75877) ...
78 FR 57632 - Sunshine Act Meeting
2013-09-19
... EXPORT-IMPORT BANK Sunshine Act Meeting ACTION: Notice of a Partially Open Meeting of the Board of... a.m. The meeting will be held at Ex-Im Bank in Room 321, 811 Vermont Avenue NW., Washington, DC...: The meeting will be open to public observation for Item No. 1 only. FURTHER INFORMATION: Members of...
78 FR 55696 - Sunshine Act Meeting
2013-09-11
... EXPORT-IMPORT BANK Sunshine Act Meeting ACTION: Notice of a Partially Open Meeting of the Board of...:00 p.m. The meeting will be held at Ex-Im Bank in Room 321, 811 Vermont Avenue NW., Washington, DC...: The meeting will be open to public observation for Item No. 1 only. FURTHER INFORMATION: Members of...
76 FR 59119 - Sunshine Act Meetings
2011-09-23
... MEETING: 9 a.m.-12 p.m., Wednesday, September 21, 2011. CHANGES TO OPEN MEETING: Time change to 10 a.m.-11 a.m. REVISED AGENDA: Matters To Be Considered: Briefing Matter: Table Saws-- Advance Notice of....) ANNOUNCED TIME AND DATE OF CLOSED MEETING: 2-3 p.m., Wednesday, September 21, 2011. CLOSED MEETING CANCELLED...
ITER technical advisory committee meeting
International Nuclear Information System (INIS)
Fujiwara, M.
2001-01-01
The 17th Meeting of the ITER Technical Advisory Committee (TAC-17) was held on February 19-22, the ITER Garching Work Site in Germany. The objective of the meeting was to review the Draft Final Design Report of ITER-FEAT and assess the ability of the self-consistent overall design both to satisfy the technical objectives previously defined and to meet the cost limitations. TAC-17 was also organized to confirm that the design and critical elements, with emphasis on the key recommendations made at previous TAC meetings, are such as to extend the confidence in starting ITER construction. It was also intended to provide the ITER Council, scheduled to meet on 27 and 28 February in Toronto, with a technical assessment and key recommendations of the above mentioned report
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Meetings. 401.5 Section 401.5 Foreign Relations INTERNATIONAL JOINT COMMISSION, UNITED STATES AND CANADA RULES OF PROCEDURE General § 401.5 Meetings. (a... meeting shall be open to the public, it shall give such advance notice to this effect as it considers...
Town Meeting and Community Engagement.
Uline, Cynthia L.
1998-01-01
Draws upon the history of the American town meeting as a vehicle for understanding this institution. Considers how a New England public school district has used town meetings effectively as a reform vehicle. Town meetings should be considered an honorable, truly democratic forum, not a symbolic gesture to improve public relations. (24 references)…
10 CFR 76.39 - Public meeting.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Public meeting. 76.39 Section 76.39 Energy NUCLEAR... meeting. (a) A public meeting will be held on an application for renewal if the Director, in his or her discretion, determines that a meeting is in the public interest with respect to a decision on the application...
78 FR 72883 - Sunshine Act Meeting
2013-12-04
... EXPORT-IMPORT BANK OF THE UNITED STATES Sunshine Act Meeting ACTION: Notice of an Open Meeting of..., December 12, 2013 at 9:30 a.m. The meeting will be held at Ex-Im Bank in Room 321, 811 Vermont Avenue NW... No. 2 Ex-Im Bank's Environmental Procedures and Guidelines PUBLIC PARTICIPATION: The meeting will be...
2010-04-01
... information with respect to a meeting, the scheduling of a meeting, the establishment of the agenda of a meeting, or any change in the scheduling, agenda, or the open or closed status of a meeting; or (ii.... [42 FR 15312, Mar. 21, 1977, as amended at 42 FR 22865, Nov. 11, 1977. Redesignated at 52 FR 11010...
Next HR Department public meeting
2016-01-01
Dear Colleagues, I am pleased to invite you to the next public meeting organized by the HR Department, which will take place on Tuesday 28 June at 3 p.m. in the Council Chamber. A drink will be served after the meeting as of 16:30 This meeting will be the opportunity to revisit the specificities of the Career Structure measures and Benchmark Jobs, what they entail and how they will be implemented, and to answer your questions. This meeting is also important for me on a personal note, as I will bid you farewell, at least for a few years, taking special leave as of 1 August 2016 to take up the position of Director-General for Human Resources at the European Central Bank in Frankfurt. Should you not be able to attend the meeting, it can also be followed via Webcast and the recording will be made available on Indico. I look forward to meeting you. Best regards, Anne-Sylvie Catherin Head of the Human Resources Department
Meeting of senior officials on managing nuclear knowledge. Summary meeting report
International Nuclear Information System (INIS)
2002-01-01
In response to the recommendations of several Agency advisory committees, e.g. INSAG, SAGNE 2002, SAGNA, SAGTAC, to address issues related to nuclear knowledge management, the IAEA convened a meeting on Managing Nuclear Knowledge with senior representatives from Member States. The purpose of the meeting was to sharpen awareness and understanding of the emerging concerns about the maintenance and preservation of knowledge and expertise in nuclear science, technology and applications and to better comprehend the role of the Agency in this process. The meeting was attended by more than 70 participants from 35 Member States and 4 international organizations, representing academic leaders, senior level executives, managers and governmental officials. This report includes statements and recommendation on possible activities to be undertaken by the IAEA
2004-01-01
I would like to invite all members of the CERN Personnel to a meeting on Tuesday 13 January 2004 at 4:00 p.m. - Main Auditorium (bldg. 500) to convey my best wishes for the new year and to present a perspective of CERN's future activities. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). A simultaneous translation into English will be available in the main Auditorium. Robert AYMAR
ITER technical advisory committee meeting
International Nuclear Information System (INIS)
Fujiwara, M.
1999-01-01
The ITER Technical Advisory Committee (TAC) meeting took place on December 20-22, 1999 at the Naka Joint Work Site. The objective of this meeting was to review the document 'Technical Basis for ITER-FEAT Outline Design (ODR)' issued by the Director on December 10. It was also aimed at providing the ITER Meeting scheduled for January 19-20, 2000 in Tokyo with a technical assessment of ODR and recommendations for the optimization of the anticipated plasma performance and engineering design, based on the guidelines approved by the Council in June 1998 and recommendations of the last TAC meeting
77 FR 34029 - National Security Education Board Members Meeting; Cancellation of Meeting
2012-06-08
... DEPARTMENT OF DEFENSE Office of the Secretary National Security Education Board Members Meeting... of the National Security Education Board. This meeting was to be held on June 20, 2012, from 8:30 a.m. to 2 p.m. at Defense Language and National Security Education Office, 1101 Wilson Boulevard, Suite...
Earlam, S; Glover, C; Davies, M; Fordy, C; Allen-Mersh, T G
1997-05-01
Since systemic and regional (HAI) fluorinated pyrimidine chemotherapies offer similar survival benefit in treatment of colorectal liver metastases (CLM), we sought to identify their impact on quality of life (QoL), which might be a useful indicator of treatment preference. We compared QoL in 135 CLM patients managed by symptom control (n = 49 patients), systemic fluorouracil (5FU)/folinic acid (n = 35), or hepatic arterial floxuridine (FUDR) (n = 51). Full blood count and liver function tests, World Health Organization (WHO) toxicity criteria, and QoL (Rotterdam Symptom Checklist [RSC], the Sickness Impact Profile [SIP], and the Hospital Anxiety and Depression scale [HAD]) were measured monthly in all patients. The HAD anxiety score was significantly increased in symptom control compared with chemotherapy patients 1 month after randomization. There was a significant increase in RSC physical score (repeated measures, P = .05), and in scores for sore mouth (P < .01), dry mouth (P < .01), and tingling hands and feet (P < .01) in systemic chemotherapy compared with symptom control patients. Significant QoL differences (repeated measures and Mann-Whitney U [MWU]) between HAI and symptom control patients were not detected. Systemic chemotherapy patients lived for significantly longer (log-rank test, P < or = .0001) with abnormal HAD anxiety, RSC psychosocial, or RSC sore mouth scores compared with HAI patients, but there were no overall survival differences. Randomization to symptom control only was associated with increased anxiety. QoL with systemic chemotherapy was impaired by side effects. HAI was associated with similar survival to systemic chemotherapy but with better sustained QoL.
Practicing What We Teach: Adherence to Healthy Meeting Guidelines at Extension Meetings and Events
Directory of Open Access Journals (Sweden)
Carol A. Smathers
2018-02-01
Full Text Available Cooperative Extension promotes healthy behaviors, including nutritious eating and physical activity. Research-based healthy meeting guidelines pertaining to foods and beverages served at Extension-sponsored events have been adopted in some states. The extent of adherence to Healthy Eating at Meetings guidelines was assessed by observing foods and beverages served at Extension-sponsored events across one state. Over a four-month period, 69 events involving foods and/or beverages were observed, including 33 events on a state university’s campus and 46 events across 36 counties. Observed events included meetings, workshops and conferences for faculty and staff, agricultural trainings and field days for the public, 4-H camps and special activities for youth and their families, and county and state fair events. Photos and menus of the foods and beverages served were assessed using a seven-item scorecard based on the Healthy Eating at Meetings guidelines. The average score for adherence to the guidelines was 57%, with a range of 10%-93%. Results suggest that adopting healthy meeting guidelines may not be enough to ensure that nutritious foods are served and that healthy eating is modeled at Extension-sponsored events. This study indicates that further research to explore Extension professionals’ knowledge of and attitudes toward healthy meeting guidelines is needed.
Entrepreneurship meet-up at CERN
CERN. Geneva
2015-01-01
Are you interested in innovation and entrepreneurship? Do you think about starting a company, or do just want to be inspired? Then maybe you would be interested in coming to the CERN entrepreneurship meet-up. The meet-up is an informal after work gathering every other week. Often with external guest speakers sharing their knowledge. Learn more at cern.ch/kt/meet-up
11th National Meeting of Organic Chemistry and 4th Meeting of Therapeutic Chemistry
Sousa, Maria Emília; Araújo, Maria João; do Vale, Maria Luísa; Andrade, Paula B.; Branco, Paula; Gomes, Paula; Moreira, Rui; Pinho e Melo, Teresa M.V.D.; Freitas, Victor
2016-01-01
For the first time under the auspices of Sociedade Portuguesa de Química, the competences of two important fields of Chemistry are brought together into a single event, the 11st National Organic Chemistry Meeting and the the 4th National Medicinal Chemistry Meeting, to highlight complementarities and to promote new synergies. Abstracts of plenary lectures, oral communications, and posters presented during the meeting are collected in this report. PMID:27102166
11th National Meeting of Organic Chemistry and 4th Meeting of Therapeutic Chemistry
Directory of Open Access Journals (Sweden)
Maria Emília Sousa
2016-03-01
Full Text Available For the first time under the auspices of Sociedade Portuguesa de Química, the competences of two important fields of Chemistry are brought together into a single event, the 11st National Organic Chemistry Meeting and the the 4th National Medicinal Chemistry Meeting, to highlight complementarities and to promote new synergies. Abstracts of plenary lectures, oral communications, and posters presented during the meeting are collected in this report.
Positions of disulfide bonds in rye (Secale cereale) seed chitinase-a.
Yamagami, T; Funatsu, G; Ishiguro, M
2000-06-01
The positions of disulfide bonds of rye seed chitinase-a (RSC-a) were identified by the isolation of disulfide-containing peptides produced with enzymatic and/or chemical cleavages of RSC-a, followed by sequencing them. An unequivocal assignment of disulfide bonds in this enzyme was as follows: Cys3-Cysl8, Cys12-Cys24, Cys15-Cys42, Cys17-Cys31, and Cys35-Cys39 in the chitin-binding domain (CB domain), Cys82-Cys144, Cys156-Cys164, and Cys282-Cys295 in the catalytic domain (Cat domain), and Cys263 was a free form.
Posmodernidad y ética empresarial
Directory of Open Access Journals (Sweden)
Olaskoaga Larrauri, Jon
2013-12-01
Full Text Available Este artículo desarrolla una hipótesis sobre las razones que han conducido al éxito del concepto de Responsabilidad Social Corporativa (RSC tanto en la literatura como en la práctica de la gestión empresarial. La hipótesis se construye a partir de la teoría de las modas en la gestión y propone la existencia de afinidades electivas, en el sentido weberiano del término, entre la extensión de las políticas de RSC y el advenimiento de la sociedad posmoderna.
DEFF Research Database (Denmark)
Weissbuch, I.; Zepik, H.; Bolbach, G.
2003-01-01
-assembled into two-dimensional (2D) ordered crystallites at the air-aqueous solution interface. As model systems we studied NE-stearoyl-lysine thioethyl ester (C-18-TE-Lys), gamma-stearyl-glutamic thioethyl ester (C-18-TE-Glu), N-alpha-carboxyanhydride of gamma-stearyl-glutamic acid (C-18-Glu NCA) and gamma......-aqueous solution interface after injection of appropriate catalysts into the water subphase. The experimental relative abundance of oligopeptides with homochiral sequence generated from (R,S)-C-18-TE-Lys and (R,S)-C-18-TE-Glu, as determined by mass spectrometry on enantioselectively deuterium-labeled samples...
Directory of Open Access Journals (Sweden)
Dr. Jon Olaskoaga Larrauri
2013-12-01
Full Text Available Este artículo desarrolla una hipótesis sobre las razones que han conducido al éxito del concepto de Responsabilidad Social Corporativa (RSC tanto en la literatura como en la práctica de la gestión empresarial. La hipótesis se construye a partir de la teoría de las modas en la gestión y propone la existencia de afinidades electivas, en el sentido weberiano del término, entre la extensión de las políticas de RSC y el advenimiento de la sociedad posmoderna.
La Responsabilidad Social Corporativa en empresas de comunicación en Latinoamérica
Directory of Open Access Journals (Sweden)
Karina Valarezo González
2013-06-01
Full Text Available Este ensayo se refiere a la aplicación de políticas de Responsabilidad Social Corporativa (RSC en los medios de comunicación. Este tema va más allá de la dimensión económica y de las responsabilidades jurídico-legales de las empresas. Tiene relación con los compromisos, los recursos, las competencias y las capacidades que pueden desarrollar las empresas de medios en beneficio de la sociedad en general. La RSC de las empresas de comunicación se debe estudiar desde una perspectiva tanto pública como privada.
77 FR 17055 - Sunshine Act Meeting; Deletion of Agenda Items From March 21, 2012 Open Meeting
2012-03-23
... FEDERAL COMMUNICATIONS COMMISSION Sunshine Act Meeting; Deletion of Agenda Items From March 21, 2012 Open Meeting March 20, 2012. The following items have been deleted from the list of Agenda items scheduled for consideration at the Wednesday, March 21, 2012, Open Meeting and previously listed in the...
78 FR 13904 - Millennium Challenge Corporation Board of Directors Meeting; Sunshine Act Meetings
2013-03-01
... MILLENNIUM CHALLENGE CORPORATION [MCC FR 13-01] Millennium Challenge Corporation Board of Directors Meeting; Sunshine Act Meetings AGENCY: Millennium Challenge Corporation. TIME AND DATE: 10:00 a.m... CONSIDERED: The Board of Directors (the ``Board'') of the Millennium Challenge Corporation (``MCC'') will...
2007-01-01
DRAFT Agenda for the meeting to be held on Wednesday 5 December 2007 at 9:15 a.m. in room 60-6-002 1.\tChairman’s remarks7.\tEmergency Services at CERN 2.\tAdoption of the agenda\t8.\tThe Meyrin Tram project 3.\tMinutes of the previous meeting9.\tReports from ACCU representatives on other committees 4.\tMatters arising10.\tUsers’ Office news 5.\tNews from the CERN Management11.\tElection of ACCU Chair 6. LHC 2008 start-up events 6.\tLogistics and transport at CERN 12.\tAny Other Business 13.\tAgenda for the next meeting Anyone wishing to raise any points under item 12 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Aust...
2007-01-01
DRAFT Agenda for the meeting to be held on Wednesday 5 December 2007 At 9:15 a.m. in room 60-6-002 1.\tChairman’s remarks 2.\tAdoption of the agenda 3.\tMinutes of the previous meeting 4.\tMatters arising 5.\tNews from the CERN Management 6.\tLHC 2008 start-up events 7.\tEmergency Services at CERN 8.\tThe Meyrin Tram project 9.\tReports from ACCU representatives on other committees 10.\tUsers’ Office news 11.\tElection of ACCU Chair 12.\tAny Other Business 13.\tAgenda for the next meeting Anyone wishing to raise any points under item 12 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium G. Wilq...
2007-01-01
DRAFT Agenda for the meeting to be held on Wednesday 12 September 2007 at 9:15 a.m. in room 60-6-002 1.\tChairman’s remarks7.\tCar sharing pilot project 2.\tAdoption of the agenda\t8.\tReports from ACCU representatives on other committees 3.\tMinutes of the previous meeting9.\tUsers’ Office newss 4.\tMatters arising10.\tAny Other Business 5.\tNews from the CERN Management11.\tAgenda for the next meeting 6.\tLogistics and transport at CERN Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria\tW. Adam (71661)NorwayG. Løvhøiden (73176)Belgium\tG. Wilquet (74664)PolandM. Witek (78967)...
2007-01-01
DRAFT Agenda for the meeting to be held on Wednesday 13 June 2007 at 9:15 a.m. in room 60-6-002 1.\tChairman’s remarks 6.\tDosimetry at CERN 2.\tAdoption of the agenda 7.\tStatus of collaborative tools at CERN 3.\tMinutes of the previous meeting 8.\tReports from ACCU representatives on other committees 4.\tMatters arising 9.\tUsers’ Office newss 5.\tNews from the CERN Management 10.\tAny Other Business 11.\tAgenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Norway G. Løvhøiden (73176) Belgium G. Wilquet (74664) Poland M. Witek (78967) Bulgaria Portugal...
PH Department
2008-01-01
DRAFT Agenda for the meeting to be held on Wednesday 3 December 2008 at 9:15 a.m. in Room 60-6-002 1.\tChairman’s remarks 2.\tAdoption of the agenda 3.\tMinutes of the previous meeting 4.\tMatters arising 5.\tNews from the CERN Management 6.\tReport from the new Director-General 7.\tReport on the Fellows and Associates programme 8.\tAn update on Safety at CERN 9.\tReports from ACCU representatives on other committees 10.\tUsers’ Office news 11.\tAny Other Business 12.\tAgenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria W. Adam (71661) Belgium C. ...
2007-01-01
DRAFT Agenda for the meeting to be held on Wednesday 12 September 2007 at 9:15 a.m. in room 60-6-002 1.\tChairman’s remarks6.\tLogistics and transport at CERN2.\tAdoption of the agenda\t7.\tCar sharing pilot project3.\tMinutes of the previous meeting8.\tReports from ACCU representatives on other committees4.\tMatters arising9.\tUsers’ Office newss5.\tNews from the CERN Management10.\tAny Other Business11.\tAgenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria\tW. Adam (71661)NorwayG. Løvhøiden (73176)Belgium\tG. Wilquet (74664)PolandM. Witek (78967)Bulgaria\tPortugalP...
PH Department
2009-01-01
DRAFT Agenda for the meeting to be held on Wednesday 9 September 2009 At 9:15 a.m. in room 60-6-002 1.\tChairman’s remarks 2.\tAdoption of the agenda 3.\tMinutes of the previous meeting 4.\tMatters arising 5.\tNews from the CERN Management 6.\tCode of conduct 7.\tEqual Opportunities at CERN 8.\tAn update on safety at CERN 9.\tThe CERN shuttle service 10.\tReports from ACCU representatives on other committees 11.\tUsers’ Office news 12.\tOther business 13.\tAgenda of the next meeting Anyone wishing to raise any points under item 12 is invited to send them to the Chairman in writing or by e-mail to mailto:Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives on ACCU are (CERN internal telephone numbers in brackets): Austria G. Walzel (76592) Belgium C. Vander Velde (71539) Bulgaria Czech Re...
PH Department
2009-01-01
DRAFT Agenda for the meeting to be held on Wednesday 9 September 2009 At 9:15 a.m. in room 60-6-002 1.\tChairman’s remarks 2.\tAdoption of the agenda 3.\tMinutes of the previous meeting 4.\tMatters arising 5.\tNews from the CERN Management 6.\tCode of Conduct 7.\tEqual Opportunities at CERN 8.\tAn update on Safety at CERN 9.\tThe CERN shuttle service 10.\tReports from ACCU representatives on other committees 11.\tUsers’ Office news 12.\tAny Other Business 13.\tAgenda for the next meeting Anyone wishing to raise any points under item 12 is invited to send them to the Chairman in writing or by e-mail to mailto:Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets): Austria G. Walzel (76592) Belgium C. Vander Velde (71539) Bulgaria Cze...
Energy Technology Data Exchange (ETDEWEB)
Vallejo, C.; Rodriguez Campos, E.
2010-07-01
From the beginning of Enusa industrial activity, this one has been characterized for developing its business with a strict sense of responsibility: towards its employed, the environment and its local community. These responsible practices have acquired a major strategic importance along the time, until they become institutionalized and known as Corporate Social Responsibility (CSR). This article shows some of the initiatives with which Enusa tries to contribute with an added value: human, environmental and social, beyond the economic value. (Author)
Indian Academy of Sciences (India)
July 1989 No.19 Newsletter of the Indian Academy of Sciences. 55th Annual. Meeting ... in the world, keeping alive atthe same time his research interests, abreast .... theory made a comeback with many new ideas and with the success of the ...
2006-01-01
I would like to invite all members of the CERN Personnel to a meeting on Thursday 18 January 2007 at 3:00 p.m. Main Auditorium (bldg.. 500) to convey my best wishes for the new year, to review CERN's activities during 2006 and to present the perspectives for this special year of the LHC start-up. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg.. 31) and the AT Auditorium (bldg.. 30). Simultaneous translation into English will be available in the main Auditorium. Robert AYMAR
International Nuclear Information System (INIS)
1973-01-01
One of the main aims of the IAEA is to foster the exchange of scientific and technical information and one of the main ways of doing this is to convene international scientific meetings. They range from large international conferences bringing together several hundred scientists, smaller symposia attended by an average of 150 to 250 participants and seminars designed to instruct rather than inform, to smaller panels and study groups of 10 to 30 experts brought together to advise on a particular programme or to develop a set of regulations. The topics of these meetings cover every part of the Agency's activities and form a backbone of many of its programmes. (author)
Robert Aymar
2005-01-01
I would like to invite all members of the CERN Personnel to a meeting on Thursday 12 January 2006 at 4:00 p.m. - Main Auditorium (bldg. 500) to convey my best wishes for the new year, to review CERN's activities during 2005 and to present the perspectives for this coming year. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (bldg. 31) and the AT Auditorium (bldg. 30). A simultaneous translation into English will be available in the main Auditorium. Best wishes for the festive season Robert AYMAR
2015-01-01
Agenda for the meeting to be held on Tuesday, 8 September 2015 at 9.15 a.m. in Room Georges Charpak (Room F, 60-6-015) Chairperson's remarks Adoption of the agenda Minutes of the previous meeting Report on services from GS department Report on services from IT department News from the CERN Management 60 years of the Staff Association The CERN Ombuds Opportunities to visit CERN Users’ Office News Matters arising Any other business ACCU Meetings 2016 (proposal) Agenda for the next meeting Anyone wishing to raise any points under “Any other business” is invited to send them to the Chairperson in writing or by e-mail to ACCU.Secretary@cern.ch. Michael Hauschild (Secretary) ACCU is a forum for discussion between the CERN Management and representatives of the CERN users in order to review the practical means taken by CERN to support the work of Use...
2016-01-01
Agenda for the meeting to be held on Tuesday, 6 September 2016 at 9.15 a.m. in room Georges Charpak (Room F, 60-6-015). Chairperson's remarks Adoption of the agenda Minutes of the previous meeting News from the CERN Management Report on services from SMB Department Report on services from IT Department The International School Ferney-Voltaire / St. Genis The CERN Alumni Project Changes in rules to obtain dosimeters Changes of CHIS health insurance rules for MPAs Matters arising Any Other Business ACCU meetings 2017 Agenda for the next meeting The Advisory Committee of CERN Users (ACCU) is a forum for discussion between the CERN Management and representatives of the CERN Users in order to review the practical means taken by CERN to support the work of Users of the Laboratory. The User Representatives to ACCU are: Austria M. Jeitler (manfred.jeitler@cern.ch) Belgium M. T...
2013-01-01
DRAFT Agenda for the meeting to be held on Wednesday 11 September 2013 at 9.15 a.m. in Room 60-6-002 1. Chairperson's remarks 2. Adoption of the agenda 3. Minutes of the previous meeting 4. News from the CERN Management 5. Report on services from GS Department 6. Progress on health insurance for Users 7. Users’ Office News 8. Reports from ACCU representatives on other Committees a. Scientific Information Policy Board (SIPB) b. IT Service Review Meeting 9. Matters arising 10. Any Other Business 11. Agenda for the next meeting Anyone wishing to raise any points under “Any Other Business” is invited to send them to the Chairperson in writing or by e-mail. Michael Hauschild (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for t...
PH Department
2011-01-01
DRAFT Agenda for the meeting to be held on Wednesday 7 December 2011 at 9:15 a.m. in room 60-6-002 Chairperson's remarks Adoption of the agenda Minutes of the previous meeting Matters arising News from the CERN Management Report on services from GS department Users’ Office news Report on new CHIS rules Creche status Report on Summer Students Users Organization in the U.S. (US LUO) Reports from ACCU representatives on other Committees Accommodation Facilities Working Group Any Other Business Agenda for the next meeting Anyone wishing to raise any points under item 13 is invited to send them to the Chairperson in writing or by e-mail to mailto:Michael.Hauschild@cern.ch subject = Next ACCU meeting. Michael Hauschild (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review th...
ORF Alignment: NC_001139 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ex subunit RSC1) ... Length = 101 ... Query: 9 ... LQKLLKTQYDAVFHLKDENGIEIYPIFN...VLPPKKEYPDYYIIIRNPISLNTLKKRLPHYT 68 ... LQKLLKTQYDAVFHLKDENGIEIYPIFNVLPPKKEYPDYYIIIRNPISLNTLKKRLPHYT Sbjct: 1 ... LQKLLKTQYDAVFHLKDENGIEIYPIFNVLPPKKEYPDYYIIIRNPISLNTLKKRLPHYT 60 ...
Third ITER International Industry Liaison Meeting
International Nuclear Information System (INIS)
Dautovich, D.
2000-01-01
Following previous meetings held in 1996 in San Diego and in 1997 in Tokyo, the Third ITER International Industry Liaison Meeting (IILM) meeting was held under the European Chairmanship in Toronto, Canada, November 7-9, 2000. The intention of such meetings is to provide a forum for industrialists of the ITER EDA parties and other interested countries to develop common understandings on important issues of the timing and nature of Industry involvement in the ITER project. This article describes the main views from Industry on the preconstruction and construction phases and the cost and benefit schemes, while summarizing the progress made by the ITER project since the Tokyo meeting
77 FR 50157 - Notice of Public Meeting, Eastern Washington Resource Advisory Council Meeting
2012-08-20
...; HAG 12-0260] Notice of Public Meeting, Eastern Washington Resource Advisory Council Meeting AGENCY.... Department of the Interior, Bureau of Land Management (BLM) Eastern Washington Resource Advisory Council... Bureau of Land Management's Eastern Washington and San Juan Resource Management Plan and the U.S. Forest...
75 FR 13134 - Notice of Meeting
2010-03-18
...)(6). Grant applications for the Medical Liability and Safety Innovation Projects (R21) applications... disclosure under the above- cited statutes. SEP Meeting on: Medical Liability and Safety Innovation Projects... meeting) Place: Doubletree Bethesda Hotel & Executive Meeting Center, 8120 Wisconsin Avenue, Conference...
75 FR 17167 - Sunshine Act Meetings; Correction
2010-04-05
... NATIONAL COUNCIL ON DISABILITY Sunshine Act Meetings; Correction AGENCY: National Council on Disability. ACTION: Notice; correction. Type: Quarterly meeting. SUMMARY: NCD published a Sunshine Act Meeting Notice in the Federal Register on March 11, 2010, notifying the public of a quarterly meeting in...
Bunch, Paul M; Wortman, Jeremy R; Andriole, Katherine P
2016-03-01
Viewers of electronic education exhibits at the 2013 and 2014 Radiological Society of North America meetings had the opportunity to "like" exhibits, as one might "like" a Facebook or an Instagram post. The purposes of this study were (1) to evaluate for a relationship between exhibit popularity and receiving an award or RadioGraphics invitation, (2) to evaluate for a relationship between exhibit recognition and subsequent popularity, and (3) to quantify and compare the electronic education exhibit likes at the 2013 and the 2014 meetings. Exhibit likes were recorded at the midpoints and ends of both meetings. Data analyses were performed by means of one-way analysis of variance and chi-square tests. There were similar numbers of electronic education exhibits at the 2013 (1856) and 2014 (1793) meetings with no significant difference between meeting years in the number of exhibits chosen for awards (423 vs. 404, P = 0.88) or for RadioGraphics solicitation (190 vs. 169, P = 0.46). In both meeting years, there were statistically significant associations between initial and overall exhibit popularity and exhibit recognition, as well as between exhibit recognition and subsequent popularity. A 152% increase in total likes recorded was observed at the 2014 meeting as compared to the 2013 meeting (11074 vs. 4391, P < 0.0001). Popular exhibits were significantly more likely to receive awards and RadioGraphics invitations. Receiving an award or RadioGraphics invitation was associated with subsequent increased exhibit popularity. Significantly more likes were recorded at the 2014 Radiological Society of North America meeting than at the 2013 meeting. Copyright © 2015 The Association of University Radiologists. Published by Elsevier Inc. All rights reserved.
75 FR 4882 - Meeting of the ACRS Subcommittee on EPR; Notice of Meeting
2010-01-29
... NUCLEAR REGULATORY COMMISSION Advisory Committee On Reactor Safeguards (ACRS) Meeting of the ACRS Subcommittee on EPR; Notice of Meeting The ACRS U.S. Evolutionary Power Reactor (EPR) Subcommittee will hold a... with Open Items concerning the U.S. EPR Design Certification (DCD) Application and the Calvert Cliffs...
76 FR 9049 - Notice of Public Meeting, Eastern Montana Resource Advisory Council Meeting
2011-02-16
... Public Meeting, Eastern Montana Resource Advisory Council Meeting AGENCY: Bureau of Land Management... 1972 (FACA), the U.S. Department of the Interior, Bureau of Land Management (BLM) Eastern Montana... Eastern Montana Resource Advisory Council will be held on Mar. 24, 2011 in Miles City, Montana. The...
77 FR 23495 - Notice of Public Meeting, Eastern Washington Resource Advisory Council Meeting
2012-04-19
...; HAG 12-0164] Notice of Public Meeting, Eastern Washington Resource Advisory Council Meeting AGENCY... 1972, the U.S. Department of the Interior, Bureau of Land Management (BLM) Eastern Washington Resource... of Land Management's Eastern Washington and San Juan Resource Management Plan, and the U.S. Forest...
75 FR 13135 - Notice of Meeting
2010-03-18
...). Grant applications for the Medical Liability and Safety Demonstration Projects (R18) applications are to... disclosure under the above-cited statutes. SEP Meeting on: Medical Liability and Safety Demonstration... remainder of the meeting). Place: Doubletree Bethesda Hotel & Executive Meeting Center, 8120 Wisconsin...
49 CFR 260.19 - Preapplication meeting.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preapplication meeting. 260.19 Section 260.19 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Financial Assistance § 260.19 Preapplication meeting. Potential Applicants may request a meeting with the...
78 FR 69711 - Sunshine Act Meeting
2013-11-20
... meeting will be webcast live at the Web address-- http://www.nrc.gov/ . * * * * * * The schedule for.../public-meetings/schedule.html . * * * * * The NRC provides reasonable accommodation to individuals with disabilities where appropriate. If you need a reasonable accommodation to participate in these public meetings...
78 FR 9430 - Sunshine Act Meeting Notice
2013-02-08
... Corporation's Institutional Advancement Committee will meet telephonically on February 13, 2013. The meeting... will be made of the closed session of the Board and Institutional Advancement Committee meetings. The... Rehabilitation Act. Upon request, meeting notices and materials will be made available in alternative formats to...
78 FR 45568 - Sunshine Act Meeting Notice
2013-07-29
... Corporation's Institutional Advancement Committee will meet telephonically on August 6, 2013. The meeting will... transcript will be made of the closed session meeting of the Institutional Advancement Committee. The... Disabilities Act and Section 504 of the 1973 Rehabilitation Act. Upon request, meeting notices and materials...
78 FR 40515 - Sunshine Act Meeting Notice
2013-07-05
... Corporation's Institutional Advancement Committee will meet telephonically on July 9, 2013. The meeting will... transcript will be made of the closed session meeting of the Institutional Advancement Committee. The... the 1973 Rehabilitation Act. Upon request, meeting notices and materials will be made available in...
78 FR 33862 - Sunshine Act Meeting; Notice
2013-06-05
... Corporation's Institutional Advancement Committee will meet telephonically on June 11, 2013. The meeting will... transcript will be made of the closed session meeting of the Institutional Advancement Committee. The... and Section 504 of the 1973 Rehabilitation Act. Upon request, meeting notices and materials will be...
75 FR 4428 - Sunshine Act Meeting Notice
2010-01-27
....m. Briefing on Uranium Recovery (Public Meeting). (Contact: Dominick Orlando, 301-415-6749.) This... NUCLEAR REGULATORY COMMISSION [NRC-2010-0002] Sunshine Act Meeting Notice DATES: Weeks of January... Plans (Public Meeting). (Contact: Quynh Nguyen, 301-415-5844.) This meeting will be webcast live at the...
77 FR 74543 - Federal Advisory Committee Meeting
2012-12-14
... SMALL BUSINESS ADMINISTRATION National Women's Business Council Federal Advisory Committee Meeting... for the next meeting of the National Women's Business Council (NWBC). The meeting will be open to the... the meeting of the National Women's Business Council. The National Women's Business Council is tasked...
International Nuclear Information System (INIS)
Lemmel, H.D.
1977-10-01
This second ''NRDC meeting'' combined the 13th ''four centers meeting'' (consultants' meeting of the four neutron nuclear data centers) with the third ''CPND meeting'' (consultants' meeting on charged particle nuclear data compilation). In Part I of the meeting, the neutron data centers held a special session on neutron data matters, in particular on the jointly operated neutron data index CINDA, whereas all items of more general interest, in particular the data exchange system EXFOR, were treated in Part II of the meeting
Fifteenth LAMPF users group meeting
International Nuclear Information System (INIS)
Cochran, D.R.F.
1982-03-01
The Fifteenth LAMPF Users Group Meeting was held November 2-3, 1981 at the Clinton P. Anderson Meson Physical Facility. The program of papers scheduled to be presented was amended to include a Report from Washington by Clarence R. Richardson, US Department of Energy. The general meeting ended with a round-table working group discussion concerning the Planning for a Kaon Factory. Individual items from the meeting were prepared separately for the data base
78 FR 26809 - Sunshine Act Meetings
2013-05-08
... Corporation's Institutional Advancement Committee will meet telephonically on May 14, 2013. The meeting will... Institutional Advancement Committee. The transcript of any portion of the closed session falling within the... Rehabilitation Act. Upon request, meeting notices and materials will be made available in alternative formats to...
Meet-U: Educating through research immersion.
Abdollahi, Nika; Albani, Alexandre; Anthony, Eric; Baud, Agnes; Cardon, Mélissa; Clerc, Robert; Czernecki, Dariusz; Conte, Romain; David, Laurent; Delaune, Agathe; Djerroud, Samia; Fourgoux, Pauline; Guiglielmoni, Nadège; Laurentie, Jeanne; Lehmann, Nathalie; Lochard, Camille; Montagne, Rémi; Myrodia, Vasiliki; Opuu, Vaitea; Parey, Elise; Polit, Lélia; Privé, Sylvain; Quignot, Chloé; Ruiz-Cuevas, Maria; Sissoko, Mariam; Sompairac, Nicolas; Vallerix, Audrey; Verrecchia, Violaine; Delarue, Marc; Guérois, Raphael; Ponty, Yann; Sacquin-Mora, Sophie; Carbone, Alessandra; Froidevaux, Christine; Le Crom, Stéphane; Lespinet, Olivier; Weigt, Martin; Abboud, Samer; Bernardes, Juliana; Bouvier, Guillaume; Dequeker, Chloé; Ferré, Arnaud; Fuchs, Patrick; Lelandais, Gaëlle; Poulain, Pierre; Richard, Hugues; Schweke, Hugo; Laine, Elodie; Lopes, Anne
2018-03-01
We present a new educational initiative called Meet-U that aims to train students for collaborative work in computational biology and to bridge the gap between education and research. Meet-U mimics the setup of collaborative research projects and takes advantage of the most popular tools for collaborative work and of cloud computing. Students are grouped in teams of 4-5 people and have to realize a project from A to Z that answers a challenging question in biology. Meet-U promotes "coopetition," as the students collaborate within and across the teams and are also in competition with each other to develop the best final product. Meet-U fosters interactions between different actors of education and research through the organization of a meeting day, open to everyone, where the students present their work to a jury of researchers and jury members give research seminars. This very unique combination of education and research is strongly motivating for the students and provides a formidable opportunity for a scientific community to unite and increase its visibility. We report on our experience with Meet-U in two French universities with master's students in bioinformatics and modeling, with protein-protein docking as the subject of the course. Meet-U is easy to implement and can be straightforwardly transferred to other fields and/or universities. All the information and data are available at www.meet-u.org.
75 FR 33307 - Employee Thrift Advisory Council Meeting; Sunshine Act; Notice of Meeting
2010-06-11
... FEDERAL RETIREMENT THRIFT INVESTMENT BOARD Employee Thrift Advisory Council Meeting; Sunshine Act; Notice of Meeting Time and Date: 10 a.m. (Eastern Time), June 24, 2010. Place: 4th Floor, Conference Room, 1250 H Street, NW., Washington, DC 20005. Status: All parts open to the public. Matters To Be...
A List of Astronomical Meetings Available via Mosaic
Bryson, E.; Crabtree, D.
We have been making a list of astronomical and related meetings available electronically for a number of years. Recently, several meeting organizers have made information about their meetings available via anonymous ftp or even NCSA Mosaic. We have produced a new version of our electronic meeting list available via NCSA Mosaic which provides links to the information being provided electronically. Depending upon the amount of information being provided for an individual meeting, it may be possible for a user browsing the list of meetings to click on the meeting of interest, fill out a registration form, download maps, browse abstracts, etc. We hope the availability of this service will encourage other meeting organizers to make information about their meetings available electronically and to take advantage of new technology such as NCSA Mosaic. URL: http:// cadcwww.dao.nrc.calmeetings/meetings.html
2007-01-01
I would like to invite all members of the CERN Personnel to a meeting on Wednesday 16 January 2008 at 3:00 p.m. Main Auditorium (bldg 500) to convey my best wishes for the new year, to review CERN’s activities during 2007 and to present the perspectives for 2008, the year of the LHC start-up. Closed-circuit transmission of the meeting will be available in the Council Chamber and in the AB Auditorium (Meyrin), the AB Auditorium (Prévessin), the IT Auditorium (Bldg. 31) and the AT Auditorium (Bldg. 30). Simultaneous translation into English will be available in the main Auditorium. Best wishes for the festive season! Robert AYMAR
Staff Association
2012-01-01
MARS PENSIONS CONTRACT POLICY GENERAL INFORMATION PUBLIC MEETINGS COME AND BE INFORMED! Public meetings Monday 15 Oct. 2 pm Amphi IT, 31-3-004 Meyrin Wednesday 17 Oct. 10 am Amphi BE, 864-1-D02 Prévessin Thursday 18 Oct. 10 am Salle du Conseil/ Council Chamber 503-1-001 Meyrin Thursday 18 Oct. 2 pm Filtration Plant, 222-R-001(in English) Meyrin Overview of the topics to be discussed Recognition of Merit – MARS Outcome of last exercise 2007 to 2012 : lessons learned Pension Fund Capital preservation policy : what is it ? Contract policy LC2IC statistics SA proposal General information CVI 2013 Voluntary programmes (PRP, SLS)
78 FR 50373 - Sunshine Act Meeting
2013-08-19
...;and investigations, committee meetings, agency decisions and rulings, #0;delegations of authority... Meeting DATE AND TIME: Wednesday, August 21, 2013, 8:30 a.m. EDT. PLACE: Cohen Building, Room 3321, 330 Independence Ave. SW., Washington, DC 20237. SUBJECT: Notice of Meeting of the Broadcasting Board of Governors...
EDITORIAL The 23rd Nordic Semiconductor Meeting The 23rd Nordic Semiconductor Meeting
Ólafsson, Sveinn; Sveinbjörnsson, Einar
2010-12-01
A Nordic Semiconductor Meeting is held every other year with the venue rotating amongst the Nordic countries of Denmark, Finland, Iceland, Norway and Sweden. The focus of these meetings remains 'original research and science being carried out on semiconductor materials, devices and systems'. Reports on industrial activity have usually featured. The topics have ranged from fundamental research on point defects in a semiconductor to system architecture of semiconductor electronic devices. Proceedings from these events are regularly published as a topical issue of Physica Scripta. All of the papers in this topical issue have undergone critical peer review and we wish to thank the reviewers and the authors for their cooperation, which has been instrumental in meeting the high scientific standards and quality of the series. This meeting of the 23rd Nordic Semiconductor community, NSM 2009, was held at Háskólatorg at the campus of the University of Iceland, Reykjavik, Iceland, 14-17 June 2009. Support was provided by the University of Iceland. Almost 50 participants presented a broad range of topics covering semiconductor materials and devices as well as related material science interests. The conference provided a forum for Nordic and international scientists to present and discuss new results and ideas concerning the fundamentals and applications of semiconductor materials. The meeting aim was to advance the progress of Nordic science and thus aid in future worldwide technological advances concerning technology, education, energy and the environment. Topics Theory and fundamental physics of semiconductors Emerging semiconductor technologies (for example III-V integration on Si, novel Si devices, graphene) Energy and semiconductors Optical phenomena and optical devices MEMS and sensors Program 14 June Registration 13:00-17:00 15 June Meeting program 09:30-17:00 and Poster Session I 16 June Meeting program 09:30-17:00 and Poster Session II 17 June Excursion and dinner
77 FR 24492 - Employee Thrift Advisory Council Meeting; Notice of Sunshine Act Meeting
2012-04-24
... FEDERAL RETIREMENT THRIFT INVESTMENT BOARD Employee Thrift Advisory Council Meeting; Notice of Sunshine Act Meeting TIME AND DATE: 9 a.m. (Eastern Time) April 30, 2012. PLACE: 10th Floor Training Room, 77 K Street NE., Washington, DC 20002. STATUS: Parts will be open to the public and parts closed to...
The eighth national electromagnetics meeting. Extended abstracts
Energy Technology Data Exchange (ETDEWEB)
Eloranta, E.; Jokela, K. [eds.
1998-09-01
The National Electromagnetics Meeting has been arranged annually since 1991 in Finland. The purpose of the meeting is to convene the persons working with problems of electromagnetics and to enhance the interaction between different research groups in different disciplines. The eighth meeting was held at the Radiation and Nuclear Safety Authority (STUK) August 27, 1998. The meeting is also the national meeting of the URSI (L`Union Radio-Scientifique Internationals)(Commission B: Fields and Waves) and the IEEE MTT/AP/ED Finland Chapter (Institute of Electrical and Electronics Engineers, Inc.). The report includes the extended abstracts of the presentations given in the National Electromagnetics Meeting at STUK. (orig.)
The eighth national electromagnetics meeting. Extended abstracts
International Nuclear Information System (INIS)
Eloranta, E.; Jokela, K.
1998-01-01
The National Electromagnetics Meeting has been arranged annually since 1991 in Finland. The purpose of the meeting is to convene the persons working with problems of electromagnetics and to enhance the interaction between different research groups in different disciplines. The eighth meeting was held at the Radiation and Nuclear Safety Authority (STUK) August 27, 1998. The meeting is also the national meeting of the URSI (L'Union Radio-Scientifique Internationals)(Commission B: Fields and Waves) and the IEEE MTT/AP/ED Finland Chapter (Institute of Electrical and Electronics Engineers, Inc.). The report includes the extended abstracts of the presentations given in the National Electromagnetics Meeting at STUK. (orig.)
2006-01-01
DRAFT Agenda for the meeting to be held on Wednesday 6 September 2006 at 9:15 a.m. in room 60-6-002 1. Chairman's remarks 2. Adoption of the agenda 3. Minutes of the previous meeting 4. Matters arising 5. News from the CERN Management 6. Report on Fellows and Associates programme 7. Overview of safety at CERN 8. Reports from ACCU representatives on other committees 9. Users' Office news 10. Any Other Business 11. Agenda for the next meeting Anyone wishing to raise any points under item 10 is invited to send them to the Chairman in writing or by e-mail to Christopher.Onions@cern.ch Chris Onions (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of the Laboratory. The User Representatives to ACCU are (CERN internal telephone numbers in brackets):Austria W. Adam (71661) Belgium G. Wilquet (74664) Bulgaria ...
2010-01-01
... time until a quorum is in attendance. (d) Attendance at meetings. Attendance at Committee meetings is... discussion of, the economic and financial situation and outlook; Committee discussion of monetary policy and...
29 CFR 102.138 - Definition of meeting.
2010-07-01
... 29 Labor 2 2010-07-01 2010-07-01 false Definition of meeting. 102.138 Section 102.138 Labor Regulations Relating to Labor NATIONAL LABOR RELATIONS BOARD RULES AND REGULATIONS, SERIES 8 Open Meetings § 102.138 Definition of meeting. For purposes of this subpart, meeting shall mean the deliberations of...
Meetings, Gatherings and Events in Smart Environments
Nijholt, Antinus; Spencer, S.N
2004-01-01
We survey our research on smart meeting rooms and its relevance for augmented reality meeting support and virtual reality generation of meetings in real-time or off-line. Our aim is to research representations of what takes place during meetings in order to allow generation, e.g. in virtual reality,
78 FR 77736 - Sunshine Act Meetings
2013-12-24
..., 2013, January 6, 13, 20, 27, 2014. PLACE: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of December 23, 2013 There are no meetings scheduled... Casks (Public Meeting); (Contact: Kevin Witt, 301-415-2145) This meeting will be webcast live at the Web...
75 FR 47877 - Notice of Meeting
2010-08-09
... Second Street, SW., Washington, DC 20593-0001. The primary purpose of the September 2 meeting is to... associated circulars. The primary purpose of the September 10 meeting is to prepare for the sixty-first... meeting include: --Harmful aquatic organisms in ballast water --Recycling of ships --Prevention of air...
78 FR 39781 - Sunshine Act Meeting
2013-07-02
... LEGAL SERVICES CORPORATION Sunshine Act Meeting Notice Date and Time: The Legal Services... disrupting the meeting, please refrain from placing the call on hold if doing so will trigger recorded music or other sound. From time to time, the Chair may solicit comments from the public. Status of Meeting...
78 FR 33114 - Sunshine Act Meetings
2013-06-03
... LEGAL SERVICES CORPORATION Sunshine Act Meetings ACTION: Notice. Date And Time: The Legal Services... meeting, please refrain from placing the call on hold if doing so will trigger recorded music or other sound. From time to time, the Chair may solicit comments from the public. Status Of Meeting: Open...
78 FR 52768 - Sunshine Act Meeting
2013-08-26
... FEDERAL DEPOSIT INSURANCE CORPORATION Sunshine Act Meeting Pursuant to the provisions of the... Corporation's Board of Directors will meet in open session at 10:00 a.m. on Wednesday, August 28, 2013, to... Directors' Meetings. Memorandum and resolution re: Final Rule Regarding the Retention of Records of an...
2012-01-01
DRAFT Agenda for the meeting to be held on Friday 15 June 2012 at 9:15 a.m. in room 60-6-002 1. Chairperson's remarks 2. Adoption of the agenda 3. Minutes of the previous meeting 4. Matters arising 5. Experience with the Service Desk 6. Guidelines for private festivities on CERN sites 7. News from the CERN Management 8. Report on services from GS department 9. Reports from ACCU representatives on other Committees a. IT Service Review Meeting 10. Users’ Office news 11. Any Other Business 12. Agenda for the next meeting Anyone wishing to raise any points under item 11 is invited to send them to the Chairperson in writing or by e-mail to Michael.Hauschild@cern.ch Michael Hauschild (Secretary) ACCU is the forum for discussion between the CERN Management and the representatives of CERN Users to review the practical means taken by CERN for the work of Users of ...
29 CFR 1612.3 - Open meeting policy.
2010-07-01
... 29 Labor 4 2010-07-01 2010-07-01 false Open meeting policy. 1612.3 Section 1612.3 Labor... ACT REGULATIONS § 1612.3 Open meeting policy. (a) All meetings of the Commission shall be conducted in... adequate acoustics for persons in attendance at the meeting. (d) Observers may take still photographs and...
A folk theory of meetings -- and beyond
DEFF Research Database (Denmark)
Ravn, Ib
2013-01-01
with managers and employees we extracted six common assumptions about meetings, termed a folk theory of meetings, which most office workers seem to carry in the back of their minds. Findings This folk theory holds meetings to be places for excessive talk, whether by a domineering leader or highly vocal...... participants, the purpose of which is to walk through the items on the agenda and dispose of each. This bleak and conservative concept of a meeting impedes intellectual as well as practical progress. Practical implications An alternative theory of meetings is proposed, one based on the group facilitation...... training, this view of meetings—and the widely available facilitation tools that go with it—may render meetings at work the subject of conscious organizational development. Originality/value The proposed "folk theory of meetings" is novel, as is the contrast provided with the facilitation approach...
77 FR 33252 - Sunshine Act Meeting
2012-06-05
.... PLACE: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and closed. Week of June 4, 2012 Thursday, June 7, 2012 9:25 a.m. Affirmation Session (Public Meeting... meeting will be webcast live at the Web address--www.nrc.gov. 9:30 a.m. Meeting with the Advisory...
78 FR 16893 - Sunshine Act Meetings
2013-03-19
...: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. [[Page... Flannery, 301-415-0223) This meeting will be webcast live at the Web address--www.nrc.gov. Week of April 8... Accident (Public Meeting) (Contact: William D. Reckley, 301- 415-7490) This meeting will be webcast live at...
24 CFR 107.40 - Compliance meeting.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Compliance meeting. 107.40 Section... NONDISCRIMINATION AND EQUAL OPPORTUNITY IN HOUSING UNDER EXECUTIVE ORDER 11063 § 107.40 Compliance meeting. (a... allegedly in violation (respondent) shall be sent a Notice of Compliance Meeting and requested to attend a...
24 CFR 245.120 - Meeting space.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Meeting space. 245.120 Section 245... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.120 Meeting space. (a) Owners of... of any community room or other available space appropriate for meetings that is part of the...
Directory of Open Access Journals (Sweden)
Marcos A. Navarro
2017-10-01
Full Text Available RESUMO Estudos com impacto de desastres naturais sobre a fauna são raros na literatura científica. Considerando Lontra longicaudis (Olfers, 1818, informações publicadas não foram encontradas. O presente estudo buscou determinar se os deslizamentos de terra ocorridos em março de 2011 em parte das montanhas da Serra da Prata (Paraná, Brasil afetaram de alguma forma a ocorrência da Lontra Neotropical no local impactado. Com esse propósito, a área estudada compreendeu um rio afetado (Rio Santa Cruz - RSC da face leste dessa serra que foi comparado com outro não afetado (Rio das Pombas - RP, localizado na mesma face da serra e com características semelhantes às originais do RSC. A área de estudo está situada no Parque Nacional de Saint-Hilaire/Lange (PNSHL. Foram realizadas sete campanhas a partir do limite altitudinal do PNSHL (60 m s.n.m para montante entre agosto de 2012 e julho de 2013. As campanhas consistiram de busca ativa por vestígios (fezes, pegadas, arranhados e tocas de lontras ao longo de 3 km de margens e leito. Registros de outros mamíferos também foram observados. Cada evidência foi anotada em caderneta de campo, fotografada e georreferenciada. As tocas foram monitoradas ao longo das campanhas. Considerando as lontras, foram registrados 102 vestígios (11 arranhados, 11 pegadas e 80 fezes e 17 tocas no rio não afetado (RP; e o rio afetado (RSC apresentou apenas quatro vestígios (três pegadas, uma amostra fecal e uma toca. Registros de outros mamíferos denotaram a presença de oito táxons no RP e 14 táxons no RSC. As diferenças conspícuas entre a quantidade de vestígios da presença das lontras indicam que o desastre natural afetou a população de lontras do RSC e mesmo dois anos após o evento as lontras retornaram apenas discretamente ao rio afetado. Por outro lado, outras espécies de mamíferos como Cuniculus paca (Linnaeus, 1758, reocuparam as margens abundantemente.
Shen, Yang-Wu; Ke, De-Ping; Sun, Yuan-Zhang; Daniel, Kirschen; Wang, Yi-Shen; Hu, Yuan-Chao
2015-07-01
A novel transient rotor current control scheme is proposed in this paper for a doubly-fed induction generator (DFIG) equipped with a superconducting magnetic energy storage (SMES) device to enhance its transient voltage and frequency support capacity during grid faults. The SMES connected to the DC-link capacitor of the DFIG is controlled to regulate the transient dc-link voltage so that the whole capacity of the grid side converter (GSC) is dedicated to injecting reactive power to the grid for the transient voltage support. However, the rotor-side converter (RSC) has different control tasks for different periods of the grid fault. Firstly, for Period I, the RSC injects the demagnetizing current to ensure the controllability of the rotor voltage. Then, since the dc stator flux degenerates rapidly in Period II, the required demagnetizing current is low in Period II and the RSC uses the spare capacity to additionally generate the reactive (priority) and active current so that the transient voltage capability is corroborated and the DFIG also positively responds to the system frequency dynamic at the earliest time. Finally, a small amount of demagnetizing current is provided after the fault clearance. Most of the RSC capacity is used to inject the active current to further support the frequency recovery of the system. Simulations are carried out on a simple power system with a wind farm. Comparisons with other commonly used control methods are performed to validate the proposed control method. Project supported by the National Natural Science Foundation of China (Grant No. 51307124) and the Major Program of the National Natural Science Foundation of China (Grant No. 51190105).
A study on the properties of blended regenerated spent catalyst and cement sandcrete blocks
International Nuclear Information System (INIS)
Amissah, Emmanuel Kofi
2016-07-01
Sandcrete is widely used as building material. Its properties greatly depend on the properties and proportions of its constituents. The main binder material to produce sandcrete is the Portland cement. The uncertainty about future availability of commonly used Portland materials concomitantly with the environmental problems such as greenhouse gases emissions and high cost of clinker consumption are highlighting the need of identifying other materials for the construction industry, which will aid in minimizing the clinker consumption and reduce the greenhouse gas emissions and cost in the production of cement. The purpose of this study is to examine the properties of sandcrete blocks produced with blended Regenerated Spent Catalyst and cement. In this work, two different series of sandcrete mixtures in which cement was partially replaced with Regenerated Spent Catalyst(RSC) within the range of 5% to 20% (by mass) with an increment of 5%. 100% cement sandcrete was also prepared as reference sandcrete. The physical properties studied were compressive strength, water absorption and setting time. Chemical property studied was chloride content. Comparison of data between the control and that of cement with additives were made. The results obtained in this study clearly indicated that substituting Portland cement up to 20wt. % RSC gave sandcrete strengths higher than the 32.5N/mm 2 , which corresponds to that of Portland cement. The replacement of Portland cement with 10 wt. % of RSC gave the highest strength of 34.0 N/mm 2 . Thus, Regenerated Spent Catalyst may be utilized as effective mineral additive for designing durable sandcrete structures. The optimum amount of RSC recommended to be added as an additive to the Portland cement is 10%. (au)
The XXIIIrd Phage/Virus Assembly Meeting.
Serwer, Philip
2014-01-01
The XXIIIrd Phage/Virus Assembly (PVA) meeting returned to its birthplace in Lake Arrowhead, CA on September 8-13, 2013 (Fig. 1). The original meeting occurred in 1968, organized by Bob Edgar (Caltech, Pasadena, CA USA), Fred Eiserling (University of California, Los Angeles, Los Angeles, CA USA) and Bill Wood (Caltech, Pasadena, CA USA). The organizers of the 2013 meeting were Bill Gelbart (University of California, Los Angeles, Los Angeles, CA USA) and Jack Johnson (Scripps Research Institute, La Jolla, CA USA). This meeting specializes in an egalitarian format. Students are distinguished from senior faculty primarily by the signs of age. With the exception of historically based introductory talks, all talks were allotted the same time and freedom. This tradition began when the meeting was phage-only and has been continued now that all viruses are included. Many were the animated conversations about basic questions. New and international participants were present, a sign that the field has significant attraction, as it should, based on details below. The meeting was also characterized by a sense of humor and generally good times, a chance to both enjoy the science and forget the funding malaise to which many participants are exposed. I will present some of the meeting content, without attempting to be comprehensive.
12 CFR 407.2 - Closing meetings.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Closing meetings. 407.2 Section 407.2 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES REGULATIONS GOVERNING PUBLIC OBSERVATION OF EX-IM BANK MEETINGS § 407.2 Closing meetings. (a) Except where Eximbank finds that the public interest requires...
77 FR 10575 - Sunshine Act Meetings
2012-02-22
...: Commissioners' Conference Room, 11555 Rockville Pike, Rockville, Maryland. STATUS: Public and Closed. Week of... meeting will be webcast live at the Web address--www.nrc.gov. 9 a.m.--Briefing on Fort Calhoun (Public Meeting) (Contact: Jeff Clark, 817-860-8147). This meeting will be webcast live at the Web address--www...
78 FR 57154 - Sunshine Act Meeting
2013-09-17
... FEDERAL RETIREMENT THRIFT INVESTMENT BOARD Sunshine Act Meeting TIME AND DATE: 9:00 a.m. (Eastern Time) September 23, 2013. PLACE: 10th Floor Board Meeting Room, 77 K Street NE., Washington, DC 20002... of the Minutes of the August 9, 2013 Board Member Meeting 2. Thrift Savings Plan Activity Reports by...
24 CFR 108.25 - Compliance meeting.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Compliance meeting. 108.25 Section... COMPLIANCE PROCEDURES FOR AFFIRMATIVE FAIR HOUSING MARKETING § 108.25 Compliance meeting. (a) Scheduling meeting. If an applicant fails to comply with requirements under § 108.15 or § 108.20 or it appears that...
78 FR 78810 - Sunshine Act Meeting
2013-12-27
... CHEMICAL SAFETY AND HAZARD INVESTIGATION BOARD Sunshine Act Meeting TIME AND DATE: January 30... Investigation Board (CSB) will convene a public meeting on January 30, 2014, starting at 6:30 p.m. PST at the Brodniak Auditorium, Anacortes High School, 1600 20th St., Anacortes, WA 98221. At the public meeting, the...
Meeting after meeting: 20 years of discoveries by the members of the Exocytosis-Endocytosis Club.
Niedergang, Florence; Gasman, Stéphane; Vitale, Nicolas; Desnos, Claire; Lamaze, Christophe
2017-09-01
Twenty years ago, a group of French cell biologists merged two scientific clubs with the aim of bringing together researchers in the fields of Endocytosis and Exocytosis. Founded in 1997, the first annual meeting of the Exocytosis Club was held in 1998. The Endocytosis Club held quarterly meetings from its founding in 1999. The first joint annual meeting of the Exocytosis-Endocytosis Club took place in Paris in April, 2001. What started as a modest gathering of enthusiastic scientists working in the field of cell trafficking has gone from strength to strength, rapidly becoming an unmissable yearly meeting, vividly demonstrating the high quality of science performed in our community and beyond. On the occasion of the 20th meeting of our club, we want to provide historic insight into the fields of exocytosis and endocytosis, and by extension, to subcellular trafficking, highlighting how French scientists have contributed to major advances in these fields. Today, the Exocytosis-Endocytosis Club represents a vibrant and friendly community that will hold its 20th meeting at the Presqu'Ile de Giens, near Toulon in the South of France, on May 11-13, 2017. © 2017 Société Française des Microscopies and Société de Biologie Cellulaire de France. Published by John Wiley & Sons Ltd.
76 FR 70984 - National Assessment Governing Board; Meeting
2011-11-16
...: This notice sets forth the schedule and proposed agenda of the upcoming meeting of the National... or at [email protected] no later than November 21, 2011. We will attempt to meet requests after... will review and approve the meeting agenda and meeting minutes from the August 2011 Board meeting...
2010-03-08
... ARCTIC RESEARCH COMMISSION [USARC 10-018] 92nd Meeting February 16, 2010. Notice is hereby given that the U.S. Arctic Research Commission will hold its 92nd meeting in Miami, FL, on March 15, 2010... to order and approval of the agenda. (2) Approval of the minutes from the 91st meeting. (3...
van Eerde, W.; Buengeler, C.; Allen, J.A.; Lehmann-Willenbrock, N.; Rogelberg, S.G.
2015-01-01
Previous research on work meetings has mainly been conducted in the Anglo-Saxon context. In this chapter, we add an international perspective that addresses this question: Does the national context of the meeting influence how it is structured and perceived? We provide a descriptive-comparative
Barrels XXX meeting report: Barrels in Baltimore.
Shin, Hyeyoung; Bitzidou, Malamati; Palaguachi, Fernando; Brumberg, Joshua C
2018-03-01
The Barrels meeting annually brings together researchers focused on the rodent whisker to cortical barrel system prior to the Society for Neuroscience meeting. The 2017 meeting focused on the classification of cortical interneurons, the role interneurons have in shaping brain dynamics, and finally on the circuitry underlying oral sensations. The meeting highlighted the latest advancements in this rapidly advancing field.
U.S. Transport Task Force 2010 Meeting
International Nuclear Information System (INIS)
Diamond, P.H.
2011-01-01
The Transport Task Force (TTF) Meeting is a venue for vigorous scientific discourse and discussion on topics in transport and turbulence in fusion plasmas. Its participation is international. The 2010 meeting was highly effective, with 139 registered participants and 131 presentations. This is remarkable for an even year (IAEA year) meeting. The meeting clearly fostered progress in understanding and control of turbulent transport.
39 CFR 6.2 - Special meetings.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Special meetings. 6.2 Section 6.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE MEETINGS (ARTICLE VI) § 6.2 Special meetings. Consistent with the provisions of §§ 6.6 and 7.5 of these bylaws, the Chairman...
General Staff Meeting, 17 Dec 2002
CERN. Geneva. Audiovisual Unit
2002-01-01
I would like to invite all members of the CERN Personnel to a meeting, to give a report on the outcome of the December Council Meetings. Closed-circuit transmission of the meeting will be available in the SL Auditorium (Prévessin), the IT Auditorium (bldg. 31), the LHC Auditorium (bldg. 30) and the PS Auditorium (bldg. 6).
78 FR 57665 - Sunshine Act Meeting
2013-09-19
... NATIONAL COUNCIL ON DISABILITY Sunshine Act Meeting TIME AND DATES: The Members of the National Council on Disability (NCD) will hold a quarterly meeting on Monday, October 7, 9:00 a.m.-5:15 p.m. (GMT), and Tuesday, October 8, 2013, 9:00 a.m.-12:15 p.m. (GMT). PLACE: The meeting will occur in Topeka...
NATO Foreign Ministers December 2017 Meeting : What will emerge from NATO’s December meeting?
Haar, Roberta
2017-01-01
What are the prospects of anything concrete emerging from the recent Foreign Ministers meeting at NATO Headquarters in Brussels? Should we anticipate that ministers attending the meeting will be able to build broad international support for any policies that might advance the alliance’s interests in
2017 Midwest Zebrafish Meeting Report.
Sandquist, Elizabeth; Petersen, Sarah C; Smith, Cody J
2017-12-01
The 2017 Midwest Zebrafish meeting was held from June 16 to 18 at the University of Cincinnati, sponsored by the Cincinnati Children's Hospital Divisions of Developmental Biology, Molecular Cardiovascular Biology, and Gastroenterology, Hepatology, and Nutrition. The meeting, organized by Saulius Sumanas, Joshua Waxman, and Chunyue Yin, hosted >130 attendees from 16 different states. Scientific sessions were focused on morphogenesis, neural development, novel technologies, and disease models, with Steve Ekker, Stephen Potter, and Lila Solnica-Krezel presenting keynote talks. In this article, we highlight the results and emerging themes from the meeting.
78 FR 62357 - Sunshine Act Meeting Notice
2013-10-21
... Governors (BBG) will be meeting at the time and location listed above. Items on the Board's consent agenda include the minutes of the August 21, 2013 meeting and resolutions concerning proposed meeting dates for...
Learning to Facilitate (Online) Meetings
DEFF Research Database (Denmark)
Reimann, Peter; Bull, Susan; Vatrapu, Ravi
2013-01-01
We describe an approach to teaching collaboration skills directly by building on competences for meeting facilitation. (Online) meetings provide a rich arena to practice collaboration since they can serve multiple purposes: learning, problem solving, decision making, idea generation and advancement...
IFPA meeting 2009 workshops report
DEFF Research Database (Denmark)
Lash, G.E.; Burton, G.J.; Chamley, L.W.
2010-01-01
Workshops are an important part of the annual meeting of the International Federation of Placenta Associations (IFPA). At IFPA Meeting 2009 diverse topics were discussed in twelve themed workshops. Topics covered included: immune response to pregnancy; signaling between fetus and placenta...
myrmeet | meetings | Resources | public
Indian Academy of Sciences (India)
error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from 29–30 June 2018 in Infosys, Mysuru ...
International Nuclear Information System (INIS)
Luo Delong
2005-01-01
The Eleventh ITER Negotiations Meeting (N-11) and the Twelfth Negotiators' Standing Sub-Group (NSSG-12 convened on October 19-25, 2005 at the Kempinski Hotel Chengdu, Sichuan Province. China was the host of this meeting. Delegations from China, the European Union, Japan, the Republic of Korea, the Russian Federation and the United States of America, as well as members from the International Team, met there to continue their work to reach agreement on the joint implementation of the ITER international fusion energy R and D project. The delegations accepted the Vice Minister of Science and Technology, Mr. LIU Yanhua, and State Councillor, Mr. SHI Dinghuan as Moderators for N-11 and NSSG-12, respectively, and Mr. LUO Delong as Secretary for both meetings. At the Meeting, delegates discussed and made substantial progress on a full range of legal, technical, and administrative topics, including staffing for ITER, policies for managing the project and its procurements, and the continuing joint drafting of the agreement on establishing the international ITER Organization to implement the project. Delegates also explored the possibility of India joining the Negotiations. In the light of the reports presented to the Meeting from the recent joint exploratory mission to India, delegates identified a series of steps for the near future leading towards a possible agreement among all the Parties to India's accession. The Negotiations Meeting also discussed the progress report of NSSG and forward planning and future tasks. The Negotiators agreed that substantial progress was made on all topics, and delegations are optimistic that the Joint Implementation Agreement and related Annexes and instruments could be initialed in spring of 2006. As decided by all delegations, the next Twelfth ITER Negotiations Meeting will be held in Korea on 6 December, 2005
Attai, Deanna J; Radford, Diane M; Cowher, Michael S
2016-10-01
Twitter social media is being used to disseminate medical meeting information. Meeting attendees and other interested parties have the ability to follow and participate in conversations related to meeting content. We analyzed Twitter activity generated from the 2013-2016 American Society of Breast Surgeons Annual Meetings. The Symplur Signals database was used to determine number of tweets, tweets per user, and impressions for each meeting. The number of unique physicians, patients/caregivers/advocates, and industry participants was determined. Physician tweeters were cross-referenced with membership and attendance rosters. Tweet transcripts were analyzed for content and tweets were categorized as either scientific, social, administrative, industry promotion, or irrelevant. From 2013 to 2016, the number of tweets increased by 600 %, the number of Twitter users increased by 450 %, and the number of physician tweeters increased by 457 %. The number of impressions (tweets × followers) increased from more than 3.5 million to almost 20.5 million, an increase of 469 %. The majority of tweets were informative (70-80 %); social tweets ranged from 13 to 23 %. A small percentage (3-6 %) of tweets were related to administrative matters. There were very few industry or irrelevant tweets. Twitter social media use at the American Society of Breast Surgeons annual meeting showed a substantial increase during the time period evaluated. The use of Twitter during professional meetings is a tremendous opportunity to share information. The authors feel that medical conference organizers should encourage Twitter participation and should be educating attendees on the proper use of Twitter.
78 FR 5184 - Subcommittee Meetings
2013-01-24
... DEPARTMENT OF HEALTH AND HUMAN SERVICES Agency for Healthcare Research and Quality Subcommittee Meetings AGENCY: Agency for Healthcare Research and Quality (AHRQ), HHS. ACTION: Notice of Five AHRQ... February 21 and closed for remainder of the meeting) 4. Healthcare Information Technology Research (HITR...
IFPA meeting 2008 workshops report
DEFF Research Database (Denmark)
Lash, G.E.; Ansari, T.; Bischof, P.
2009-01-01
Workshops are an important part of the IFPA annual meeting. At the IFPA meeting 2008 diverse topics were discussed in 12 themed workshops. Topics covered included: immunology of placentation; galectins and trophoblast invasion; signaling in implantation and invasion; markers to identify trophoblast...
The "Total Immersion" Meeting Environment.
Finkel, Coleman
1980-01-01
The designing of intelligently planned meeting facilities can aid management communication and learning. The author examines the psychology of meeting attendance; architectural considerations (lighting, windows, color, etc.); design elements and learning modes (furniture, walls, audiovisuals, materials); and the idea of "total immersion meeting…
Annotating and measuring meeting behavior
van Dijk, Elisabeth M.A.G.; Nijholt, Antinus; Heylen, Dirk K.J.; Noldus, L.P.J.J.; Grieco, F; Loijens, L.W.S.; Zimmerman, P.H.
2005-01-01
Within the AMI (Augmented Multi-party Interaction) project technologies will be developed that can facilitate human interaction in the context of instrumented meeting rooms, which includes remote participant support and the possibility to browse through past meetings. The project collects data on
Proceedings of the 4. 2003 energy meetings
International Nuclear Information System (INIS)
2002-12-01
The energy meetings is the biggest annual event for French local communities in the energy domain. The public is mainly composed of officials, representatives from local communities, institutions, private organisations and associations. The aim of the meetings is to debate and exchange on the actions to be implemented at the regional scale by local authorities in order to meet the climate and energy challenges of the century. This edition of the energy meetings has permitted to point out the role of Territorial authorities in undertaking concrete actions aiming at exploiting the energy saving, renewable energy and decentralized power generation resources of their respective regions. The meetings were organised around 3 plenary sessions and 16 workshops. These proceedings brings together the available material: a detailed programme, a summary of the meetings, a synthesis of the workshops, and the abstracts describing each workshop
Proceedings of the 3. 2001 energy meetings
International Nuclear Information System (INIS)
2001-10-01
The energy meetings is the biggest annual event for French local communities in the energy domain. The public is mainly composed of officials, representatives from local communities, institutions, private organisations and associations. The aim of the meetings is to debate and exchange on the actions to be implemented at the regional scale by local authorities in order to meet the climate and energy challenges of the century. In front of the worrying growing up of the transportation sector and its contribution to the greenhouse effect, these third energy meetings shed light on the tools available to local authorities in order to attempt to control the escalation of this phenomenon. The meetings were organised around 16 workshops. These proceedings brings together the available material: a detailed programme, a summary of the meetings, a synthesis of the workshops, and the abstracts describing each workshop
78 FR 48910 - Notice of Sunshine Act Meeting
2013-08-12
... Corporation's Institutional Advancement Committee will meet telephonically on August 20, 2013. The meeting... of the closed session meeting of the Institutional Advancement Committee. The transcript of any... with Disabilities Act and Section 504 of the 1973 Rehabilitation Act. Upon request, meeting notices and...
75 FR 59747 - NASA Advisory Council; Meeting.
2010-09-28
... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [Notice: (10-113)] NASA Advisory Council; Meeting. AGENCY: National Aeronautics and Space Administration. ACTION: Notice of meeting. SUMMARY: In accordance... Space Administration announces a meeting of the NASA Advisory Council. DATES: Wednesday, October 6, 2010...
Training managers to facilitate their meetings: An intervention study
DEFF Research Database (Denmark)
Ravn, Ib
2014-01-01
-based intervention effort to improve organisational meetings. It reconceptualises classical meeting management, offering instead the practice of ‘meeting facilitation’: a more active and supportive approach, in which the manager-as-facilitator guides and directs conversations in meetings towards a positive goal...... showed that in the employees’ judgement, there were significant improvements in their managers’ competencies in both new meeting facilitation and classical meeting management, whereas other meeting outcomes resisted change.......Meetings in organisations are a common object of popular frustration. They are often run by managers who picked up their meeting skills from their superiors a generation previously, thus perpetuating obsolescent practices unsuited to today’s world of work. This paper reports on a research...
African Journals Online (AJOL)
chifaou.amzat
2011-10-19
Oct 19, 2011 ... rural hometowns, where they unite with their rural-based colleagues for ... extent have they empowered the women-folk in the public sphere? ...... It would be safe, therefore, for one to conceptualise the 'August Meeting'.
Notification of upcoming AGU Council meeting
Williams, Billy
2012-10-01
The AGU Council will meet on Sunday, 2 December 2012, at the InterContinental Hotel in San Francisco, Calif. The meeting, which is open to all AGU members, will include discussions of AGU's new Grand Challenge Project (a project that will be introduced to members at the 2012 Fall Meeting), the proposed AGU scientific ethics policy, publishing strategies, future plans for honors and recognition, and leadership transition as new members join the Council. This year the Council experimented with a new approach to conducting business. By holding virtual meetings throughout the year, Council members have been able to act in a more timely manner and provide input on important membership and science issues on the Board of Directors' agenda. The Council Leadership Team—an elected subset of the Council—also experimented with a new approach, meeting every month to keep moving projects forward. This approach has increased communication and improved effectiveness in Council decision making.
Socialization at the morning meeting
DEFF Research Database (Denmark)
Rimestad, L.; Gravengaard, Gitte
2016-01-01
In this ethnographic study we examine how journalism interns present ideas at morning meetings in the professional environment of a media organization. We analyse not only the idea presentation at the meeting itself, but also how editors treat the idea presentation, and how the interns perceive...
75 FR 6413 - Sunshine Act Meeting Notice
2010-02-09
... a.m. Briefing on Uranium Recovery (Public Meeting). (Contact: Dominick Orlando, 301-415-6749.) This... NUCLEAR REGULATORY COMMISSION [NRC-2010-0002] Sunshine Act Meeting Notice DATES: Weeks of February.... Briefing on Regional Programs--Programs, Performance, and Future Plans (Public Meeting). (Contact: Richard...
Providing for organizational memory in computer supported meetings
Schwabe, Gerhard
1994-01-01
Meeting memory features are poorly integrated into current group support systems (GSS). In this article, I discuss how to introduce meeting memory functionality into a GSS. The article first introduces the benefits of effective meetings and organizational memory to an organization. Then, the following challenges to design are discussed: How to store semantically rich output, how to build up the meeting memory with a minimum of additional effort, how to integrate meeting memory into organizati...
78 FR 15110 - National Women's Business Council; Meeting
2013-03-08
... SMALL BUSINESS ADMINISTRATION National Women's Business Council; Meeting AGENCY: U.S. Small... Women's Business Council (NWBC). The meeting will be open to the public. DATES: The meeting will be held... (5 U.S.C., Appendix 2), SBA announces the meeting of the National Women's Business Council. The...
PREFACE: Brazil MRS Meeting 2014
2015-11-01
The annual meetings, organized by the Brazilian materials research society - B-MRS, are amongst the most import discussion forums in the area of materials science and engineering in Brazil, with a growing interest from the national and international scientific society. In the last 4 years, more than 1,500 participants have attended the B-MRS meetings, promoting an auspicious environment for presentation and discussion of scientific and technological works in the materials science area. The XIII Brazilian Materials Research Society Meeting was held from 28 September to 02 October, 2014, in João Pessoa, PB, Brazil. The Meeting congregated more than 1650 participants from the whole of Brazil and from 28 other countries. More than 2100 abstracts were accepted for presentation, distributed along 19 Symposia following the format used in traditional meetings of Materials Research Societies. These involved topics such as: synthesis of new materials, computer simulations, optical, magnetic and electronic properties, traditional materials as clays and cements, advanced metals, carbon and graphene nanostructures, nanomaterials for nanostructures, energy storage systems, composites, surface engineering and others. A novelty was a symposium dedicated to innovation and technology transfer in materials research. The program also included 7 Plenary Lectures presented by internationally renowned researchers: Alberto Salleo from Stanford University, United States of America; Roberto Dovesi from Universita' degli Studi di Torino, Italy; Luís Antonio F. M. Dias Carlos from Universidade de Aveiro, Portugal; Jean Marie Dubois from Institut Jean-Lamour, France; Sir Colin Humphreys from University of Cambridge, England; Karl Leo from Technische Universität Dresden, Germany; Robert Chang from Northwestern University, Evanston, United States of America. The numbers of participants in the B-MRS meetings have been growing continuously, and in this meeting we had almost 2200 presentations
76 FR 20375 - Meetings of Humanities Panel
2011-04-12
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities ACTION: Notice of additional meeting. SUMMARY: Pursuant to the... the following meeting of the Humanities Panel will be held at the Old Post Office, 1100 Pennsylvania...
76 FR 70168 - Meetings of Humanities Panel
2011-11-10
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of additional meeting. SUMMARY: Pursuant to the... the following meeting of the Humanities Panel will be held at the Old Post Office, 1100 Pennsylvania...
76 FR 41826 - Meetings of Humanities Panel
2011-07-15
... NATIONAL FOUNDATION ON THE ARTS AND THE HUMANITIES Meetings of Humanities Panel AGENCY: The National Endowment for the Humanities. ACTION: Notice of additional meeting. SUMMARY: Pursuant to the... the following meeting of the Humanities Panel will be held at the Old Post Office, 1100 Pennsylvania...
78 FR 61404 - Federal Salary Council; Meeting
2013-10-03
... OFFICE OF PERSONNEL MANAGEMENT Federal Salary Council; Meeting AGENCY: Office of Personnel Management. ACTION: Notice of meeting. SUMMARY: The Federal Salary Council will meet on November 5, 2013, at... recommendations cover the establishment or modification of locality pay areas, the coverage of salary surveys, the...
75 FR 63215 - Federal Salary Council Meeting
2010-10-14
... OFFICE OF PERSONNEL MANAGEMENT Federal Salary Council Meeting AGENCY: Office of Personnel Management. ACTION: Notice of Meeting. SUMMARY: The Federal Salary Council will meet on October 29, 2010, at... recommendations cover the establishment or modification of locality pay areas, the coverage of salary surveys, the...
76 FR 59175 - Federal Salary Council; Meeting
2011-09-23
... OFFICE OF PERSONNEL MANAGEMENT Federal Salary Council; Meeting AGENCY: Office of Personnel Management. ACTION: Notice of meeting. SUMMARY: The Federal Salary Council will meet on November 4, 2011, at... recommendations cover the establishment or modification of locality pay areas, the coverage of salary surveys, the...
Water Cluster Leaders Meeting Summary Report 2016
As part of its efforts to support environmental technology innovation clusters, U.S. EPA hosted a Water Technology Innovation Cluster Leaders Meeting on September 25, 2016, in New Orleans, Louisiana. The meeting was an opportunity for cluster leaders from across the globe to meet...
78 FR 36602 - Sunshine Act Meeting; Notice
2013-06-18
... Corporation's Institutional Advancement Committee will meet telephonically on June 25, 2013. The meeting will... session meeting of the Institutional Advancement Committee. The transcript of any portion of the closed... complies with the Americans with Disabilities Act and Section 504 of the 1973 Rehabilitation Act. Upon...
78 FR 30339 - Sunshine Act Meeting Notice
2013-05-22
... trigger recorded music or other sound. From time to time, the presiding Chair may solicit comments from... LEGAL SERVICES CORPORATION Sunshine Act Meeting Notice DATE AND TIME: The Legal Services Corporation's Institutional Advancement Committee will meet telephonically on May 28, 2013. The meeting will...
76 FR 36156 - Meetings of Humanities Panel
2011-06-21
...: Room 415. PROGRAM: This meeting will review applications for Literary Theory and Film in Fellowships... 415. PROGRAM: This meeting will review applications for Literature, Philosophy, and the Arts in Awards...: Room 315. PROGRAM: This meeting will review applications for Philosophy I in Fellowships Program...
Three images of interdisciplinary team meetings.
Crepeau, E B
1994-08-01
Teams are an essential aspect of health care today, especially in rehabilitation or chronic illness where the course of care is frequently long, complex, and unpredictable. The coordinative function of teams and their interdisciplinary aspects are thought to improve patient care because team members bring their unique professional skills together to address patient problems. This coordination is enacted through the team meeting, which typically results in an integrated care plan. This professional image of team meetings is explicit and addresses the description and provision of care as objective and rational activities. In contrast, the constructed and ritualistic images of health care team meetings are implicit and concern the less objective and rational aspects of planning care. The constructed image pertains to the definitional activity of team members as they try to understand patient troubles and achieve consensus. This process involves the individual clinical reasoning of team members and the collective reasoning of the group. The ritualistic image is that aspect of team meetings in which the team affirms and reaffirms its collective identity. Drawing from field research of geropsychiatric team meetings, this article defines and explicates these images, focusing on the constructed and ritualistic aspects of team meetings and the influence of these images on group function.