Roc curves for continuous data

CERN Document Server

Krzanowski, Wojtek J

2009-01-01

Since ROC curves have become ubiquitous in many application areas, the various advances have been scattered across disparate articles and texts. ROC Curves for Continuous Data is the first book solely devoted to the subject, bringing together all the relevant material to provide a clear understanding of how to analyze ROC curves.The fundamental theory of ROC curvesThe book first discusses the relationship between the ROC curve and numerous performance measures and then extends the theory into practice by describing how ROC curves are estimated. Further building on the theory, the authors prese

pROC: an open-source package for R and S+ to analyze and compare ROC curves.

Science.gov (United States)

Robin, Xavier; Turck, Natacha; Hainard, Alexandre; Tiberti, Natalia; Lisacek, Frédérique; Sanchez, Jean-Charles; Müller, Markus

2011-03-17

Receiver operating characteristic (ROC) curves are useful tools to evaluate classifiers in biomedical and bioinformatics applications. However, conclusions are often reached through inconsistent use or insufficient statistical analysis. To support researchers in their ROC curves analysis we developed pROC, a package for R and S+ that contains a set of tools displaying, analyzing, smoothing and comparing ROC curves in a user-friendly, object-oriented and flexible interface. With data previously imported into the R or S+ environment, the pROC package builds ROC curves and includes functions for computing confidence intervals, statistical tests for comparing total or partial area under the curve or the operating points of different classifiers, and methods for smoothing ROC curves. Intermediary and final results are visualised in user-friendly interfaces. A case study based on published clinical and biomarker data shows how to perform a typical ROC analysis with pROC. pROC is a package for R and S+ specifically dedicated to ROC analysis. It proposes multiple statistical tests to compare ROC curves, and in particular partial areas under the curve, allowing proper ROC interpretation. pROC is available in two versions: in the R programming language or with a graphical user interface in the S+ statistical software. It is accessible at http://expasy.org/tools/pROC/ under the GNU General Public License. It is also distributed through the CRAN and CSAN public repositories, facilitating its installation.

Investigating the effect of adjusted DuPont ratio and its components on investor's decisions in short and long term

Directory of Open Access Journals (Sweden)

Parvaneh Khaleghi Kasbi

2014-03-01

Full Text Available This paper investigates the effect of adjusted DuPont ratio and its components on investors’ decisions in short and long term. The primary objective of this study is to find the effect of adjusted DuPont ratio and its components on herding behavior of investors in one and several year period. Hence, 85 corporations as the member of Tehran stock exchange over the period 2006-2011 are selected. In order to recognize the herding, by market index consideration, the herded β and in order to hypothesis validity SPSS software and multivariable linear regression have been used. As the results of this study indicate, the adjusted DuPont ratio and its components have more effect on investors’ decisions in short term but in long the period, the effect of this ratio on herding investors’ behavior are reduced. Furthermore, from the two components of adjusted DuPont ratio, profit margin has more effect on investor's decisions.

Introduction to ROC analysis

International Nuclear Information System (INIS)

Kelsey, C.A.; Mettler, F.A.

1988-01-01

An elementary introduction to ROC analysis illustrates how ROC curves depend on observer threshold levels and discusses the relation between ROC curve parameters and other measures of observer performance including accuracy sensitivity specificity true positive fraction, true negative fraction, false positive fraction and false negative fraction

Jacques Delors - President de la Commission Europeenne

Directory of Open Access Journals (Sweden)

Dacian Graţian GAL

2005-02-01

Full Text Available This article refers to the President of the European Commission between 1985- 1995, Jacques Delors. He was the single person who exercised the presidency of the European Commission during 10 years and this period was one of the most important for the European construction: the achievement of the Single Market, the development of the Single Currency Unit project, of the new common politics, the enlargement of the European Union from 12 members to 15 members etc. Due the contribution of his presidency to the European construction, Jacques Delors is one of the parents of the European construction and one of the most important political men of the XX century.  

Rigorous Quantum Field Theory A Festschrift for Jacques Bros

CERN Document Server

Monvel, Anne Boutet; Iagolnitzer, Daniel; Moschella, Ugo

2007-01-01

Jacques Bros has greatly advanced our present understanding of rigorous quantum field theory through numerous fundamental contributions. This book arose from an international symposium held in honour of Jacques Bros on the occasion of his 70th birthday, at the Department of Theoretical Physics of the CEA in Saclay, France. The impact of the work of Jacques Bros is evident in several articles in this book. Quantum fields are regarded as genuine mathematical objects, whose various properties and relevant physical interpretations must be studied in a well-defined mathematical framework. The key topics in this volume include analytic structures of Quantum Field Theory (QFT), renormalization group methods, gauge QFT, stability properties and extension of the axiomatic framework, QFT on models of curved spacetimes, QFT on noncommutative Minkowski spacetime. Contributors: D. Bahns, M. Bertola, R. Brunetti, D. Buchholz, A. Connes, F. Corbetta, S. Doplicher, M. Dubois-Violette, M. Dütsch, H. Epstein, C.J. Fewster, K....

Professor Jacques Cortes prantsuse keele lektoraadis

Index Scriptorium Estoniae

2000-01-01

Juuni alguses külastas filoloogiateaduskonna romaani-germaani filoloogia osakonda Roueni ülikooli professor Jacques Cortes (Prantsusmaa). Ta korraldas 4. õa üliõpilastele prantsuse keele intensiivkursuse ja võttis vastu eksami ning kohtus prantsuse keele lektoraadi õppejõududega : [täistekst

Marion duPont Scott Equine Medical Center offers new treatment for lameness

OpenAIRE

Musick, Marjorie

2006-01-01

The Virginia-Maryland Regional College of Veterinary Medicine's Marion duPont Scott Equine Medical Center has begun offering a new therapy for treating lameness associated with osteoarthritis and cartilage damage in horses, a problem that affects all segments of the equine industry.

ROC analysis of acid demineralized artificial caries

International Nuclear Information System (INIS)

Kang, Byung Cheol

1997-01-01

This study is designed to determine the artificial incipient proximal caries lesion detectability by dentists on Ektaspeed Plus film using ROC analysis. Sixteen premolars and 30 molars, which have 52 proximal caries-like demineralized lesions using acid-gel technique were added to 20 sound premolars and 30 sound molars to make 24 plaster blocks. Each block with 4 teeth and 6 contacting proximal surfaces was placed in an optical bench to take 12 bitewing radiographs with Ektaspeed Plus film. Thirty-six dentists acted as observers to evaluated the proximal lesions using five rating scales for ROC analysis. They were also asked to determine the presence or absence of the proximal caries. The true status of the proximal caries was established by the consensus of three oral and maxillofacila radiologists. For evaluation of intra-observer agreement, 9 dentist reread the radiographs at an interval of 1 month. The Pearson correlation coefficient for the intra-observer agreement was 0.746 (good agreement). Ten observer's data set were degenerated. The mean area under ROC curve from 26 observers was 0.806 and standard deviation was 0.061. The sensitivity and the specificity of the binary response were 0.17 (SD=0.11) and 0.78 (SD=0.17) respectively. The binary response only reveal a single values of sensitivity and the specificity. The ROC analysis to assess the diagnostic accuracy in caries detection, which producing estimates of sensitivities for all specifities, yield more comprehensive measures of diagnostic performance than single values for sensitivity and specificity.

Literatura y derecho en Jacques Derrida

Directory of Open Access Journals (Sweden)

Carlos Antonio Contreras Guala

2013-01-01

Full Text Available Se estudia el vínculo entre literatura y derecho en el pensamiento de Jacques Derrida. Se indican algunos recorridos de lectura y se dilucida lo que se entiende por literatura como institución, y su vínculo y alcances en relación con el plagio y con el derecho a decirlo todo en literatura.

Kaks vaadet Ameerikast Jacques Derridale / Märt Väljataga

Index Scriptorium Estoniae

Väljataga, Märt, 1965-

1998-01-01

Kommentaariks Vikerkaares 1998, nr. 7-8 ilmunud artiklitele: Mark Lilla 'Jacques Derrida poliitika' ja Richard Rorty 'Ironistlikust teooriast privaatsete allusioonideni' (mõlemad tõlkinud Märt Väljataga)

La psiquiatría española y Jacques Lacan antes de 1975

Directory of Open Access Journals (Sweden)

Druet, Anne Cécile

2014-06-01

Full Text Available This article aims to analyse the presence of Jacques Lacan in the domain of Spanish psychiatry before 1975. Firstly, it addresses this question through an examination of the psychiatric press and an analysis of all references made to Lacan (origin, features and development in quantitative and qualitative terms. Secondly, it addresses the history, the context and the consequences of the two lectures that Jacques Lacan gave in Barcelona in 1958 and 1972, at the invitation of some Spanish psychiatrists.El objetivo de este artículo es estudiar la presencia de Jacques Lacan en el ámbito psiquiátrico español antes de 1975. Se aborda en un primer momento esta cuestión a través del escrutinio de la prensa psiquiátrica y del análisis de las referencias a Lacan que aparecen en ella (origen, características, y evolución en términos cuantitativos y cualitativos. Se aborda a continuación la historia, el contexto y las consecuencias de las dos conferencias que Jacques Lacan, invitado por los psiquiatras españoles, dio en Barcelona en 1958 y 1972.

Basic principles of ROC analysis

International Nuclear Information System (INIS)

Metz, C.E.

1978-01-01

The limitations of diagnostic accuracy as a measure of decision performance require introduction of the concepts of the sensitivity and specificity of a diagnostic test. These measures and the related indices, true positive fraction and false positive fraction, are more meaningful than accuracy, yet do not provide a unique description of diagnostic performance because they depend on the arbitrary selection of a decision threshold. The receiver operating characteristic (ROC) curve is shown to be a simple yet complete empirical description of this decision threshold effect, indicating all possible combinations of the relative frequencies of the various kinds of correct and incorrect decisions. Practical experimental techniques for measuring ROC curves are described, and the issues of case selection and curve-fitting are discussed briefly. Possible generalizations of conventional ROC analysis to account for decision performance in complex diagnostic tasks are indicated. ROC analysis is shown to be related in a direct and natural way to cost/benefit analysis of diagnostic decision making. The concepts of average diagnostic cost and average net benefit are developed and used to identify the optimal compromise among various kinds of diagnostic error. Finally, the way in which ROC analysis can be employed to optimize diagnostic strategies is suggested

A Decomposition of Hospital Profitability: An Application of DuPont Analysis to the US Market.

Science.gov (United States)

Turner, Jason; Broom, Kevin; Elliott, Michael; Lee, Jen-Fu

2015-01-01

This paper evaluates the drivers of profitability for a large sample of U.S. hospitals. Following a methodology frequently used by financial analysts, we use a DuPont analysis as a framework to evaluate the quality of earnings. By decomposing returns on equity (ROE) into profit margin, total asset turnover, and capital structure, the DuPont analysis reveals what drives overall profitability. Profit margin, the efficiency with which services are rendered (total asset turnover), and capital structure is calculated for 3,255 U.S. hospitals between 2007 and 2012 using data from the Centers for Medicare & Medicaid Services' Healthcare Cost Report Information System (CMS Form 2552). The sample is then stratified by ownership, size, system affiliation, teaching status, critical access designation, and urban or non-urban location. Those hospital characteristics and interaction terms are then regressed (OLS) against the ROE and the respective DuPont components. Sensitivity to regression methodology is also investigated using a seemingly unrelated regression. When the sample is stratified by hospital characteristics, the results indicate investor-owned hospitals have higher profit margins, higher efficiency, and are substantially more leveraged. Hospitals in systems are found to have higher ROE, margins, and efficiency but are associated with less leverage. In addition, a number of important and significant interactions between teaching status, ownership, location, critical access designation, and inclusion in a system are documented. Many of the significant relationships, most notably not-for-profit ownership, lose significance or are predominately associated with one interaction effect when interaction terms are introduced as explanatory variables. Results are not sensitive to the alternative methodology. The results of the DuPont analysis suggest that although there appears to be convergence in the behavior of NFP and IO hospitals, significant financial differences remain

Vanaks jäänud "noor hunt" Jacques Chirac lahkub, mõru maitse suus / Hent Kalmo

Index Scriptorium Estoniae

Kalmo, Hent, 1979-

2007-01-01

Tagasivaade Prantsusmaa ametist lahkuva presidendi Jacques Chiraci poliitiku-karjäärile. Lisad: Meedia ütleb Chiracile adieu; Jacques Chiraci elu, töö ja lemmikud. Vt. samas: Kaivo Kopli. Mantlipärijad põlgasid ära Chiraci pärandi

Kuidas kirjutatakse ajalugu? / Jacques Le Goff ; interv. Marek Tamm

Index Scriptorium Estoniae

Le Goff, Jacques

2007-01-01

Prantsuse ajaloolase ja ajakirja Annales ühe peatoimetaja J. Le Goff'i teostest. Varem. ilm.: Ajalugu, antropoloogia ja imaginaarsus : intervjuu Jaques Le Goffiga // Le Goff, Jacques. Raha või elu : majandus ja religioon keskajal. - Tallinn, 2001. - Lk. 108-126

Statistical evaluation of diagnostic performance topics in ROC analysis

CERN Document Server

Zou, Kelly H; Bandos, Andriy I; Ohno-Machado, Lucila; Rockette, Howard E

2016-01-01

Statistical evaluation of diagnostic performance in general and Receiver Operating Characteristic (ROC) analysis in particular are important for assessing the performance of medical tests and statistical classifiers, as well as for evaluating predictive models or algorithms. This book presents innovative approaches in ROC analysis, which are relevant to a wide variety of applications, including medical imaging, cancer research, epidemiology, and bioinformatics. Statistical Evaluation of Diagnostic Performance: Topics in ROC Analysis covers areas including monotone-transformation techniques in parametric ROC analysis, ROC methods for combined and pooled biomarkers, Bayesian hierarchical transformation models, sequential designs and inferences in the ROC setting, predictive modeling, multireader ROC analysis, and free-response ROC (FROC) methodology. The book is suitable for graduate-level students and researchers in statistics, biostatistics, epidemiology, public health, biomedical engineering, radiology, medi...

Accrual of ROCs LECs and REGOs

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

This report summarises the findings of a project to identify the technical and administrative difficulties experienced by microgenerators in accessing the benefits of Renewables Obligation Certificates (ROCs), Levy Exemption Certificates (LECs) and Renewable Electricity Guarantees of Origin (REGO). These include cost, administrative complexity and financial risk. Changes allowing bulk processing, meter data provision, sell and buyback contracts, and alignment of ROCs, LECs and REGOs are discussed as well as making the schemes more customer friendly. The background to the project is traced, and an overview of the processes associated with gaining ROCs, LECs and REGOs is presented.

Hippose seminar: Hervé Godignon ja Jacques Verkerk / Raigo Kollom

Index Scriptorium Estoniae

Kollom, Raigo, 1936-

2015-01-01

Ypäjäl 31. jaanuaril toimunud Soome ratsaspordi liidu Hippos aretusseminarist, kus esinesid Soome takistussõidu koondise treener Hervé Godignon ja KWPN tõuraamatu hindamiskomisjoni esimees Jacques Verkerk, kes tutvustas lineaarset hindamist praktikas

Applications of ROC analysis in diagnostic image evaluation

International Nuclear Information System (INIS)

Metz, C.E.

1979-01-01

The need for Receiver Operating Characteristic (ROC) analysis is indicated by a discussion of the limitations of accuracy and of sensitivity and specificity as indices of diagnostic detection or discrmination performance. The concept of a variable decision threshold is shown to lead in a natural way to the ROC curve as a means for specifying diagnostic performance. Practical techniques for measuring ROC curves are described, and directions for possible generalizations of conventional ROC analysis are indicated

Jean-Jacques Rousseau gramatólogo

Directory of Open Access Journals (Sweden)

Jesús Camarero

2009-04-01

Full Text Available An analysis about Jean-Jacques Rousseau’s contribution to the theory of writing and the grammatology. This analysis contains a systematic comparison of the rousseaunian ideas about the language and the writing with another theories of the 17th (Arnauld and Lancelot, 18th (Condillac, Paillasson, Jaucourt and 20th centuries (Saussure. The contrast of Rousseau’s ideas to Saussure’s about writing also, allows to make explicit Rousseau’s grammatological ideas’s big importance and his relation with the grammatology (Gelb,Derrida, Harris, exceeding avant la lettre modern linguistics’s phonocentrism.

El humor geométrico de Jacques Tati

OpenAIRE

Sorando, José M.

2010-01-01

Fijamos hoy nuestra atención en el cineasta francés Jacques Tati. Si tras leer estas líneas se anima a ver sus películas, a quien no lo conozca, le espera una agradable sorpresa; a los que ya lo conocían, la ocasión de volver a disfrutar de su genio, ahora en clave matemática.

DuPont IsoTherming clean fuel technology

Energy Technology Data Exchange (ETDEWEB)

Levinski, E. [E.I. DuPont Co., Wilmington, DE (United States)

2009-07-01

This poster described a hydroprocessing technology that DuPont has acquired from Process Dynamics, Inc. The IsoTherming clean fuel technology significantly reduces sulphur in motor fuels. The technology provides petroleum refiners the solution for meeting ultra low sulphur diesel requirements, at much lower costs than conventional technologies. IsoTherming hydroprocessing operates in a kinetically limited mode, with no mass transfer limitation. Hydrogen is delivered to the reactor in the liquid phase as soluble hydrogen, allowing for much higher space velocities than conventional hydrotreating reactors. Treated diesel is recycled back to the inlet of the reactor, generating less heat and more hydrogen into the reactor. The process results in a more isothermal reactor operation that allows for better yields, fewer light ends and greater catalyst life. The technology reduces coking, because the process provides enough hydrogen in the solution when cracking reactions take place. As a result, the process yields longer catalyst life. Other advantages for refiners include lower total investment; reduced equipment delivery lead times; reduced maintenance and operating costs; and configuration flexibility. tabs., figs.

Transformation-invariant and nonparametric monotone smooth estimation of ROC curves.

Science.gov (United States)

Du, Pang; Tang, Liansheng

2009-01-30

When a new diagnostic test is developed, it is of interest to evaluate its accuracy in distinguishing diseased subjects from non-diseased subjects. The accuracy of the test is often evaluated by receiver operating characteristic (ROC) curves. Smooth ROC estimates are often preferable for continuous test results when the underlying ROC curves are in fact continuous. Nonparametric and parametric methods have been proposed by various authors to obtain smooth ROC curve estimates. However, there are certain drawbacks with the existing methods. Parametric methods need specific model assumptions. Nonparametric methods do not always satisfy the inherent properties of the ROC curves, such as monotonicity and transformation invariance. In this paper we propose a monotone spline approach to obtain smooth monotone ROC curves. Our method ensures important inherent properties of the underlying ROC curves, which include monotonicity, transformation invariance, and boundary constraints. We compare the finite sample performance of the newly proposed ROC method with other ROC smoothing methods in large-scale simulation studies. We illustrate our method through a real life example. Copyright (c) 2008 John Wiley & Sons, Ltd.

The pedagogical perspective of Jacques Maritain

Directory of Open Access Journals (Sweden)

Maria Teresa Viglioglia

2017-02-01

Full Text Available In the extensive bibliography of Jacques Maritain, there is a book dealing with education titled "L'education à la croisée des chemins". It initially consists of the texts of four lectures held in 1943 at the Yale University, in the United States under the title "Education at the Crossroads", published for the first time in 1943. The contents of these conferences has been published by Fayard in 1959 with the title "Pour une philosophie de l’éducation". This essay by Maritain was later re-modeled to the last edition in French (1969. The work outlines the main coordinates of the educational philosophy of Jacques Maritain, and consists of four sections: I. The errors of contemporary pedagogy; II. The educational relationship; III. Liberal education; IV. Complementary tasks. Maritain emphasizes persons' formation as the primary purpose of education to the American pragmatism and European rationalism, noting that every educational project, of every background it may be, always implies a precise anthropology, sometimes implied. The educational relationship is to avoid the double error of a conception "despotic" on the part of the teacher and of a conception "anarchist" by the pupil. Education must tend to unity of knowledge, making sure that the learning process begins from the experience, but always ends in reason. The final chapters relate more specifically to the organization of education in America, but the first two chapters offer a real philosophical approach to education. This is based on a vision of the person who activates the spiritual dimension, undermined by the development of an individual's technical design. "Education at the crossroads" (which is located in the French neo-Thomism, philosophical and theological contemporary movement focused on the recovery of the thought of St. Thomas Aquinas, who is considered, with appropriate adaptations and interpretations, source of knowledge and imperishable spiritual guides speaks to the need

Writing, Repetition, Displacement: An Interview with Jacques Rancière

NARCIS (Netherlands)

Geil, A.

2014-01-01

In this interview, Jacques Rancière clarifies a number of the central concepts and underlying polemics that run throughout his considerable body of work. Touching on key aspects of his intellectual formation, including his experience teaching at the University of Vincennes in Saint-Denis in the wake

Optimal Joint Detection and Estimation That Maximizes ROC-Type Curves.

Science.gov (United States)

Wunderlich, Adam; Goossens, Bart; Abbey, Craig K

2016-09-01

Combined detection-estimation tasks are frequently encountered in medical imaging. Optimal methods for joint detection and estimation are of interest because they provide upper bounds on observer performance, and can potentially be utilized for imaging system optimization, evaluation of observer efficiency, and development of image formation algorithms. We present a unified Bayesian framework for decision rules that maximize receiver operating characteristic (ROC)-type summary curves, including ROC, localization ROC (LROC), estimation ROC (EROC), free-response ROC (FROC), alternative free-response ROC (AFROC), and exponentially-transformed FROC (EFROC) curves, succinctly summarizing previous results. The approach relies on an interpretation of ROC-type summary curves as plots of an expected utility versus an expected disutility (or penalty) for signal-present decisions. We propose a general utility structure that is flexible enough to encompass many ROC variants and yet sufficiently constrained to allow derivation of a linear expected utility equation that is similar to that for simple binary detection. We illustrate our theory with an example comparing decision strategies for joint detection-estimation of a known signal with unknown amplitude. In addition, building on insights from our utility framework, we propose new ROC-type summary curves and associated optimal decision rules for joint detection-estimation tasks with an unknown, potentially-multiple, number of signals in each observation.

Ensaio de Pedagogia Comparada: Jean Jacques Rousseau (1712-1778) X Immanuel Kant (1724-1804) (Essay on Compared Pedagogy: Jean Jacques Rousseau (1712-1778) X Immanuel Kant (1724-1804).

Science.gov (United States)

Fontanella, Francisco Cock

2000-01-01

Finds that, although the thought of Jean Jacques Rousseau is frequently cited as an influence on Immanuel Kant, this has no basis regarding pedagogical influence. Compares the "Projecto" and "Emilio" of Rousseau with Kant's "Pedagogia." (BT)

A monarquia segundo Jean-Jacques Rousseau

Directory of Open Access Journals (Sweden)

Renato Moscateli

2004-12-01

Full Text Available The Swiss philosopher Jean-Jacques Rousseau didn't limit himself to consider how a democratic State could be constructed in substitution to the absolutist monarchies existing at his time. He also dedicated his efforts to understand the monarchic regime itself, being conscientious of the obstacles to be overstepped so that this political form was surpassed in direction to other ones more next to his ideals, in which all the citizens could participate actively of the administration of the government. Thus, the article will handle some aspects of the Rousseau's reflection about the monarchy, from his criticism to the regime until his concrete proposals for possible reforms on it.

Comparison of Paired ROC Curves through a Two-Stage Test.

Science.gov (United States)

Yu, Wenbao; Park, Eunsik; Chang, Yuan-Chin Ivan

2015-01-01

The area under the receiver operating characteristic (ROC) curve (AUC) is a popularly used index when comparing two ROC curves. Statistical tests based on it for analyzing the difference have been well developed. However, this index is less informative when two ROC curves cross and have similar AUCs. In order to detect differences between ROC curves in such situations, a two-stage nonparametric test that uses a shifted area under the ROC curve (sAUC), along with AUCs, is proposed for paired designs. The new procedure is shown, numerically, to be effective in terms of power under a wide range of scenarios; additionally, it outperforms two conventional ROC-type tests, especially when two ROC curves cross each other and have similar AUCs. Larger sAUC implies larger partial AUC at the range of low false-positive rates in this case. Because high specificity is important in many classification tasks, such as medical diagnosis, this is an appealing characteristic. The test also implicitly analyzes the equality of two commonly used binormal ROC curves at every operating point. We also apply the proposed method to synthesized data and two real examples to illustrate its usefulness in practice.

Jacques Ellul and Democracy's "Vital Information" Premise. Journalism Monographs No. 45.

Science.gov (United States)

Christians, Clifford G.

In the course of elaborating "la technique," Jacques Ellul stoutly contradicts the democratic assumption that citizens can have sufficient information to participate knowledgeably in the governing process. "La technique" converts message systems into propagandization networks and erects an inflexible boundary which democracy…

ROC Analysis for Evaluation of Radiation Biodosimetry Technologies

International Nuclear Information System (INIS)

Williams, Benjamin B.; Swartz, Harold M.; Flood, Ann Barry; Demidenko, Eugene

2016-01-01

Receiver operating characteristic (ROC) analysis is a fundamental tool used for the evaluation and comparison of diagnostic systems that provides estimates of the combinations of sensitivity and specificity that can be achieved with a given technique. Along with critical considerations of practical limitations, such as throughput and time to availability of results, ROC analyses can be applied to provide meaningful assessments and comparisons of available biodosimetry methods. Accordingly, guidance from the Food and Drug Administration to evaluate biodosimetry devices recommends using ROC analysis. However, the existing literature for the numerous biodosimetry methods that have been developed to address the needs for triage either do not contain ROC analyses or present ROC analyses where the dose distributions of the study samples are not representative of the populations to be screened. The use of non-representative sample populations can result in a significant spectrum bias, where estimated performance metrics do not accurately characterize the true performance under real-world conditions. Particularly, in scenarios where a large group of people is screened because they were potentially exposed in a large-scale radiation event, directly measured population data do not exist. However, a number of complex simulations have been performed and reported in the literature that provide estimates of the required dose distributions. Based on these simulations and reported data about the output and uncertainties of biodosimetry assays, we illustrate how ROC curves can be generated that incorporate a realistic representative sample. A technique to generate ROC curves for biodosimetry data is presented along with representative ROC curves, summary statistics and discussion based on published data for triage-ready electron paramagnetic resonance in vivo tooth dosimetry, the dicentric chromosome assay and quantitative polymerase chain reaction assay. We argue that this

Compare diagnostic tests using transformation-invariant smoothed ROC curves⋆

Science.gov (United States)

Tang, Liansheng; Du, Pang; Wu, Chengqing

2012-01-01

Receiver operating characteristic (ROC) curve, plotting true positive rates against false positive rates as threshold varies, is an important tool for evaluating biomarkers in diagnostic medicine studies. By definition, ROC curve is monotone increasing from 0 to 1 and is invariant to any monotone transformation of test results. And it is often a curve with certain level of smoothness when test results from the diseased and non-diseased subjects follow continuous distributions. Most existing ROC curve estimation methods do not guarantee all of these properties. One of the exceptions is Du and Tang (2009) which applies certain monotone spline regression procedure to empirical ROC estimates. However, their method does not consider the inherent correlations between empirical ROC estimates. This makes the derivation of the asymptotic properties very difficult. In this paper we propose a penalized weighted least square estimation method, which incorporates the covariance between empirical ROC estimates as a weight matrix. The resulting estimator satisfies all the aforementioned properties, and we show that it is also consistent. Then a resampling approach is used to extend our method for comparisons of two or more diagnostic tests. Our simulations show a significantly improved performance over the existing method, especially for steep ROC curves. We then apply the proposed method to a cancer diagnostic study that compares several newly developed diagnostic biomarkers to a traditional one. PMID:22639484

Evaluating Banking Profit Performance in Ghana during and post Profit Decline: A five Step Du-Pont Approach

Directory of Open Access Journals (Sweden)

Baah Aye Kusi

2015-11-01

Full Text Available In this study we aimed at three objectives. First, identify and rank banks based on a composite score comprising of all five du-pont variables. Second, we identify variables in the five step du-pont set up that are most likely to influence bank ROE during and post profit declining periods. And third, we estimate a model to capture the variables that drive bank ROE during and post profit declining periods. We first establish from our rankings that, foreign banks in Ghana performed better during profit declining periods while the local banks performed better in post profit decline periods using the top ten banks as a benchmark in both periods. Employing Pearson correlation coefficients matrix, we recognized that operating profit margin, asset turnover and leverage were most likely to influence bank ROE in both time periods. We further employ OLS regression and find that bank ROE was impacted by operating profit margin and leverage during profit declining periods and post profit decline while tax effect added up in post profit declining periods.

WE-A-207-00: In Memoriam of Jacques Ovadia - Reinvigorating Scientific Excellence: Electron Beam Therapy - Past, Present and Future

International Nuclear Information System (INIS)

2015-01-01

The Medical Physics community lost one of its early pioneers in radiation oncology physics, Jacques Ovadia, who passed away in April of 2014 at the age of 90. Jacques received his Ph.D. in Nuclear Physics from the University of Illinois at Urbana in 1951. Subsequently, under the guidance of John Laughlin, he was introduced to the field of Medical Physics. When John moved to Memorial Sloan Kettering, Jacques followed him. There he gained clinical experience and expertise in the then cutting-edge field of high energy electron beam therapy. In 1956, Jacques joined Dr. Erich Uhlmann at Michael Reese Hospital in Chicago where one of the country’s first high energy medical linear accelerators had just been installed. During his 35 year tenure, Dr. Ovadia built a strong Medical Physics department that merged in 1984 with that of the University of Chicago. Jacques pioneered the use of high energy electron beams to treat deep seated tumors, multiple-field chest wall irradiation with variable electron energies, and even anticipated the current interest in high energy electron beam grid-therapy. At an early stage, he introduced a simulator, computerized treatment planning and in-house developed record and verify software. He retired in 1990 as Professor emeritus in Radiation and Cellular Biology at the University of Chicago. Dr. Ovadia was an early and strong supporter of AAPM. He was present at the Chicago ROMPS meeting where the decision was made to form an independent professional society for medical physics. He served as AAPM president in 1976. Jacques Ovadia is survived by his wife of 58 years, Florence, their daughter Corinne Graefe and son Marc Ovadia, MD, as well as four grandchildren and one great-grandchild. Jacques’ dynamic and ever enthusiastic personality inspired all who collaborated with him. He will be greatly missed

WE-A-207-00: In Memoriam of Jacques Ovadia - Reinvigorating Scientific Excellence: Electron Beam Therapy - Past, Present and Future

Energy Technology Data Exchange (ETDEWEB)

NONE

2015-06-15

The Medical Physics community lost one of its early pioneers in radiation oncology physics, Jacques Ovadia, who passed away in April of 2014 at the age of 90. Jacques received his Ph.D. in Nuclear Physics from the University of Illinois at Urbana in 1951. Subsequently, under the guidance of John Laughlin, he was introduced to the field of Medical Physics. When John moved to Memorial Sloan Kettering, Jacques followed him. There he gained clinical experience and expertise in the then cutting-edge field of high energy electron beam therapy. In 1956, Jacques joined Dr. Erich Uhlmann at Michael Reese Hospital in Chicago where one of the country’s first high energy medical linear accelerators had just been installed. During his 35 year tenure, Dr. Ovadia built a strong Medical Physics department that merged in 1984 with that of the University of Chicago. Jacques pioneered the use of high energy electron beams to treat deep seated tumors, multiple-field chest wall irradiation with variable electron energies, and even anticipated the current interest in high energy electron beam grid-therapy. At an early stage, he introduced a simulator, computerized treatment planning and in-house developed record and verify software. He retired in 1990 as Professor emeritus in Radiation and Cellular Biology at the University of Chicago. Dr. Ovadia was an early and strong supporter of AAPM. He was present at the Chicago ROMPS meeting where the decision was made to form an independent professional society for medical physics. He served as AAPM president in 1976. Jacques Ovadia is survived by his wife of 58 years, Florence, their daughter Corinne Graefe and son Marc Ovadia, MD, as well as four grandchildren and one great-grandchild. Jacques’ dynamic and ever enthusiastic personality inspired all who collaborated with him. He will be greatly missed.

ROC Analysis of Diagnostic Performance in Liver Scan

International Nuclear Information System (INIS)

Lee, Myung Chul; Moon, Dyuk Hyuk; Koh, Chang Soon; Matumoto, Toru; Tateno, Yukio

1988-01-01

To evaluate diagnostic accuracy of liver scintigraphy we analysed liver scans of 143 normal and 258 patients with various liver diseases. Three ROC curves for SOL, liver cirrhosis and diffuse liver disease were fitted using rating methods and areas under the ROC curves and their standard errors were calculated by the trapezoidal rule and the variance of the Wilcoxon statistic suggested by McNeil. We compared these results with that of National Institute of Radiological Science in Japan. 1) The sensitivity of liver scintigraphy was 74.2% in SOL, 71.8% in liver cirrhosis and 34.8% in diffuse liver disease. The specificity was 96.0% in SOL, 94.2% in liver cirrhosis and 87.6% in diffuse liver disease. 2) ROC curves of SOL and liver cirrhosis approached the upper left-hand corner closer than that of diffuse liver disease. Area (± standard error) under the ROC curve was 0.868±0.024 in SOL and 0.867±0.028 in liver cirrhosis. These were significantly higher than 0.658±0.043 in diffuse liver disease. 3) There was no interobserver difference in terms of ROC curves. But low sensitivity and high specificity of authors' SOL diagnosis suggested we used more strict decision threshold.

Tribute to Dr Jacques Rogge

DEFF Research Database (Denmark)

Bourgois, Jan G; Dumortier, Jasmien; Callewaert, Margot

2017-01-01

'A tribute to Dr J. Rogge' aims to systematically review muscle activity and muscle fatigue during sustained submaximal quasi-isometric knee extension exercise (hiking) related to Olympic dinghy sailing as a tribute to Dr Rogge's merits in the world of sports. Dr Jacques Rogge is not only...... of invasive needle electromyography (EMG) during a specific sailing technique (hiking) on a self-constructed sailing ergometer. Hiking is a bilateral and multi-joint submaximal quasi-isometric movement which dinghy sailors use to optimize boat speed and to prevent the boat from capsizing. Large stresses...... are generated in the anterior muscles that cross the knee and hip joint, mainly employing the quadriceps at an intensity of 30-40% maximal voluntary contraction (MVC), sometimes exceeding 100% MVC. Better sailing level is partially determined by a lower rate of neuromuscular fatigue during hiking and for ≈60...

Can You Hear Me Now? Jean-Jacques Rousseau on Listening Education

Science.gov (United States)

Laverty, Megan J.

2011-01-01

In this essay Megan J. Laverty argues that Jean-Jacques Rousseau's conception of humane communication and his proposal for teaching it have implications for our understanding of the role of listening in education. She develops this argument through a close reading of Rousseau's most substantial work on education, "Emile: Or, On Education". Laverty…

Test for the statistical significance of differences between ROC curves

International Nuclear Information System (INIS)

Metz, C.E.; Kronman, H.B.

1979-01-01

A test for the statistical significance of observed differences between two measured Receiver Operating Characteristic (ROC) curves has been designed and evaluated. The set of observer response data for each ROC curve is assumed to be independent and to arise from a ROC curve having a form which, in the absence of statistical fluctuations in the response data, graphs as a straight line on double normal-deviate axes. To test the significance of an apparent difference between two measured ROC curves, maximum likelihood estimates of the two parameters of each curve and the associated parameter variances and covariance are calculated from the corresponding set of observer response data. An approximate Chi-square statistic with two degrees of freedom is then constructed from the differences between the parameters estimated for each ROC curve and from the variances and covariances of these estimates. This statistic is known to be truly Chi-square distributed only in the limit of large numbers of trials in the observer performance experiments. Performance of the statistic for data arising from a limited number of experimental trials was evaluated. Independent sets of rating scale data arising from the same underlying ROC curve were paired, and the fraction of differences found (falsely) significant was compared to the significance level, α, used with the test. Although test performance was found to be somewhat dependent on both the number of trials in the data and the position of the underlying ROC curve in the ROC space, the results for various significance levels showed the test to be reliable under practical experimental conditions

Wind-driven snow conditions control the occurrence of contemporary marginal mountain permafrost in the Chic-Choc Mountains, south-eastern Canada: a case study from Mont Jacques-Cartier

Science.gov (United States)

Davesne, Gautier; Fortier, Daniel; Domine, Florent; Gray, James T.

2017-06-01

We present data on the distribution and thermophysical properties of snow collected sporadically over 4 decades along with recent data of ground surface temperature from Mont Jacques-Cartier (1268 m a.s.l.), the highest summit in the Appalachians of south-eastern Canada. We demonstrate that the occurrence of contemporary permafrost is necessarily associated with a very thin and wind-packed winter snow cover which brings local azonal topo-climatic conditions on the dome-shaped summit. The aims of this study were (i) to understand the snow distribution pattern and snow thermophysical properties on the Mont Jacques-Cartier summit and (ii) to investigate the impact of snow on the spatial distribution of the ground surface temperature (GST) using temperature sensors deployed over the summit. Results showed that above the local treeline, the summit is characterized by a snow cover typically less than 30 cm thick which is explained by the strong westerly winds interacting with the local surface roughness created by the physiography and surficial geomorphology of the site. The snowpack structure is fairly similar to that observed on windy Arctic tundra with a top dense wind slab (300 to 450 kg m-3) of high thermal conductivity, which facilitates heat transfer between the ground surface and the atmosphere. The mean annual ground surface temperature (MAGST) below this thin and wind-packed snow cover was about -1 °C in 2013 and 2014, for the higher, exposed, blockfield-covered sector of the summit characterized by a sporadic herbaceous cover. In contrast, for the gentle slopes covered with stunted spruce (krummholz), and for the steep leeward slope to the south-east of the summit, the MAGST was around 3 °C in 2013 and 2014. The study concludes that the permafrost on Mont Jacques-Cartier, most widely in the Chic-Choc Mountains and by extension in the southern highest summits of the Appalachians, is therefore likely limited to the barren wind-exposed surface of the summit

Soil salinity data from Bayou Dupont and flanking marshes, New Orleans, LA, 2015-09-16 to 2016-03-30 (NCEI Accession 0151633)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The project restored both structural and habitat functions of Bayou Dupont and flanking marshes. The project created and nourished marsh and restored a ridge on the...

The spiral of thought in the work of Jacques Rancière

NARCIS (Netherlands)

Dasgupta, S.

2013-01-01

This critical engagement with the thought of Jacques Rancière analyzes the close connection between his style of argumentation and the substance of his arguments around politics and aesthetics. The spiralling logic of Rancière’s writing style and the details of his specific arguments are

Wind-driven snow conditions control the occurrence of contemporary marginal mountain permafrost in the Chic-Choc Mountains, south-eastern Canada: a case study from Mont Jacques-Cartier

Directory of Open Access Journals (Sweden)

G. Davesne

2017-06-01

Full Text Available We present data on the distribution and thermophysical properties of snow collected sporadically over 4 decades along with recent data of ground surface temperature from Mont Jacques-Cartier (1268 m a.s.l., the highest summit in the Appalachians of south-eastern Canada. We demonstrate that the occurrence of contemporary permafrost is necessarily associated with a very thin and wind-packed winter snow cover which brings local azonal topo-climatic conditions on the dome-shaped summit. The aims of this study were (i to understand the snow distribution pattern and snow thermophysical properties on the Mont Jacques-Cartier summit and (ii to investigate the impact of snow on the spatial distribution of the ground surface temperature (GST using temperature sensors deployed over the summit. Results showed that above the local treeline, the summit is characterized by a snow cover typically less than 30 cm thick which is explained by the strong westerly winds interacting with the local surface roughness created by the physiography and surficial geomorphology of the site. The snowpack structure is fairly similar to that observed on windy Arctic tundra with a top dense wind slab (300 to 450 kg m−3 of high thermal conductivity, which facilitates heat transfer between the ground surface and the atmosphere. The mean annual ground surface temperature (MAGST below this thin and wind-packed snow cover was about −1 °C in 2013 and 2014, for the higher, exposed, blockfield-covered sector of the summit characterized by a sporadic herbaceous cover. In contrast, for the gentle slopes covered with stunted spruce (krummholz, and for the steep leeward slope to the south-east of the summit, the MAGST was around 3 °C in 2013 and 2014. The study concludes that the permafrost on Mont Jacques-Cartier, most widely in the Chic-Choc Mountains and by extension in the southern highest summits of the Appalachians, is therefore likely limited to the barren wind

Jacques Monod and Chance and Necessity.

Science.gov (United States)

Ribatti, Domenico

2015-01-01

Charles Darwin proposed the theory that evolution of live organisms is based on random variation and natural selection. Jacques Monod, in his classic book Chance and Necessity, published 45 years ago, presented his thesis that the biosphere does not contain a predictable class of objects or events, but constitutes a particular occurrence, compatible indeed with the first principles but not deducible from those principles. The biosphere is therefore essentially unpredictable. In his book, Monod expounded at length on the conflict between science and religion. He saw religion as a collection of primitive myths that had been blown to shreds by science. At every turn, Monod emphasized the role of chance in human existence, an idea that is antithetical to essentially every religious doctrine that places humans as some inevitable intention of a Creator.

Reconsidering Emancipatory Education: Staging a Conversation between Paulo Freire and Jacques Ranciere

Science.gov (United States)

Galloway, Sarah

2012-01-01

In this essay Sarah Galloway considers emancipation as a purpose for education through examining the theories of Paulo Freire and Jacques Ranciere. Both theorists are concerned with the prospect of distinguishing between education that might socialize people into what is taken to be an inherently oppressive society and education with emancipation…

Receiver Operating Characteristics (ROCs) in Recognition Memory: A Review

Science.gov (United States)

Yonelinas, Andrew P.; Parks, Colleen M.

2007-01-01

Receiver operating characteristic (ROC) analysis is being used increasingly to examine the memory processes underlying recognition memory. The authors discuss the methodological issues involved in conducting and analyzing ROC results, describe the various models that have been developed to account for these results, review the behavioral empirical…

The Autodidact in Defense of Himself: Jean-Jacques Rousseau and Knut Hamsun.

Science.gov (United States)

Buttry, Dolores

1980-01-01

Describes Jean-Jacques Rousseau and Knut Hamsun as self-educated men who never ceased to warn of the evils of formal education. Quoting from their works, considers their feelings toward education as revealed in Rousseau's "Emile," with its description of ideal education, and in the ill effects of education on Hamsun's characters. (AYC)

Science and the applications of science from Louis Pasteur to Jacques Monod.

Science.gov (United States)

Schwartz, Maxime

2015-06-01

Jacques Monod's ideas on the applications of science came within the scope of a long tradition at the Institut Pasteur. Louis Pasteur, whose scientific career was characterized by a permanent come and go between science and its applications, long opposed the idea of getting any income from his research, until the financial needs of the Institut Pasteur made him change his mind. As for Jacques Monod, he remained a fervent supporter of basic science during his whole scientific career. However, once he became director of the Institut Pasteur, he realized that the applications of research had to be developed to support the institute from a financial point of view. Thus, he reorganized the valorization of research in the institute, through an incitation of scientists to develop projects with possible applications, and by creating a company, Institut Pasteur Production, for which he had a factory built, and which was in charge of producing and commercializing the vaccines and reagents stemming from the research at the Institut Pasteur. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.

Jacques Berque et les villes de l’Islam

Directory of Open Access Journals (Sweden)

Mohamed Kerrou

2011-12-01

Full Text Available Le parcours singulier de Jacques Berque (1910-1995, ajouté à son écriture poétique et à son style érudit et inimitable, a empêché, pour un certain temps, que ses écrits constituent une référence de choix pour les chercheurs en sciences sociales spécialisés dans le monde arabe et musulman. De son vivant, « l’homme des deux rives » fut à la fois sociologue, historien, anthropologue, arabisant, islamologue et, à ses débuts, administrateur colonial – comme son vénéré père Augustin - puis milita...

A bivariate contaminated binormal model for robust fitting of proper ROC curves to a pair of correlated, possibly degenerate, ROC datasets.

Science.gov (United States)

Zhai, Xuetong; Chakraborty, Dev P

2017-06-01

The objective was to design and implement a bivariate extension to the contaminated binormal model (CBM) to fit paired receiver operating characteristic (ROC) datasets-possibly degenerate-with proper ROC curves. Paired datasets yield two correlated ratings per case. Degenerate datasets have no interior operating points and proper ROC curves do not inappropriately cross the chance diagonal. The existing method, developed more than three decades ago utilizes a bivariate extension to the binormal model, implemented in CORROC2 software, which yields improper ROC curves and cannot fit degenerate datasets. CBM can fit proper ROC curves to unpaired (i.e., yielding one rating per case) and degenerate datasets, and there is a clear scientific need to extend it to handle paired datasets. In CBM, nondiseased cases are modeled by a probability density function (pdf) consisting of a unit variance peak centered at zero. Diseased cases are modeled with a mixture distribution whose pdf consists of two unit variance peaks, one centered at positive μ with integrated probability α, the mixing fraction parameter, corresponding to the fraction of diseased cases where the disease was visible to the radiologist, and one centered at zero, with integrated probability (1-α), corresponding to disease that was not visible. It is shown that: (a) for nondiseased cases the bivariate extension is a unit variances bivariate normal distribution centered at (0,0) with a specified correlation ρ 1 ; (b) for diseased cases the bivariate extension is a mixture distribution with four peaks, corresponding to disease not visible in either condition, disease visible in only one condition, contributing two peaks, and disease visible in both conditions. An expression for the likelihood function is derived. A maximum likelihood estimation (MLE) algorithm, CORCBM, was implemented in the R programming language that yields parameter estimates and the covariance matrix of the parameters, and other statistics

RocKeTeria restaurant

Science.gov (United States)

2000-01-01

When StenniSphere at John C. Stennis Space Center in Hancock County, Miss., opened in May 2000, it introduced the RocKeTeria, a new 1960s-style, space-themed restaurant located in the newly expanded visitor center. The restaurant, operated by the owners of Mary's Drive Inn of Biloxi, features an extensive collection of space-related photos from that era, as well as a full menu of home-style cooking.

El Rocío y el turismo de peregrinación

OpenAIRE

Villa Díaz, Águeda

2006-01-01

La palabra Rocío está llena de significados: una virgen, una romería y una aldea vecinas de la marisma del Guadalquivir bautizadas por un fenómeno microclimático, como es la diaria y fecunda presencia de agua en su mínima expresión las gotas de rocío. Pero este nombre evoca, sobre todo, a la devoción a Nuestra Señora del Rocío Patrona de Almonte y a su anual romería de Pentecostés el Rocío Grande. Esta romería ha conocido una gran expansión en los últimos cincuenta años, atrayendo peregrinos ...

ROC analysis of diagnostic performance in liver scintigraphy

International Nuclear Information System (INIS)

Fritz, S.L.; Preston, D.F.; Gallagher, J.H.

1981-01-01

Studies on the accuracy of liver scintigraphy for the detection of metastases were assembled from 38 sources in the medical literature. An ROC curve was fitted to the observed values of sensitivity and specificity using an algorithm developed by Ogilvie and Creelman. This ROC curve fitted the data better than average sensitivity and specificity values in each of four subsets of the data. For the subset dealing with Tc-99m sulfur colloid scintigraphy, performed for detection of suspected metastases and containing data on 2800 scans from 17 independent series, it was not possible to reject the hypothesis that interobserver variation was entirely due to the use of different decision thresholds by the reporting clinicians. Thus the ROC curve obtained is a reasonable baseline estimate of the performance potentially achievable in today's clinical setting. Comparison of new reports with these data is impossible, but is limited by the small sample sizes in most reported series

ROC analysis of diagnostic performance in liver scintigraphy.

Science.gov (United States)

Fritz, S L; Preston, D F; Gallagher, J H

1981-02-01

Studies on the accuracy of liver scintigraphy for the detection of metastases were assembled from 38 sources in the medical literature. An ROC curve was fitted to the observed values of sensitivity and specificity using an algorithm developed by Ogilvie and Creelman. This ROC curve fitted the data better than average sensitivity and specificity values in each of four subsets of the data. For the subset dealing with Tc-99m sulfur colloid scintigraphy, performed for detection of suspected metastases and containing data on 2800 scans from 17 independent series, it was not possible to reject the hypothesis that interobserver variation was entirely due to the use of different decision thresholds by the reporting clinicians. Thus the ROC curve obtained is a reasonable baseline estimate of the performance potentially achievable in today's clinical setting. Comparison of new reports with these data is possible, but is limited by the small sample sizes in most reported series.

A semiparametric separation curve approach for comparing correlated ROC data from multiple markers

Science.gov (United States)

Tang, Liansheng Larry; Zhou, Xiao-Hua

2012-01-01

In this article we propose a separation curve method to identify the range of false positive rates for which two ROC curves differ or one ROC curve is superior to the other. Our method is based on a general multivariate ROC curve model, including interaction terms between discrete covariates and false positive rates. It is applicable with most existing ROC curve models. Furthermore, we introduce a semiparametric least squares ROC estimator and apply the estimator to the separation curve method. We derive a sandwich estimator for the covariance matrix of the semiparametric estimator. We illustrate the application of our separation curve method through two real life examples. PMID:23074360

Construction of joint confidence regions for the optimal true class fractions of Receiver Operating Characteristic (ROC) surfaces and manifolds.

Science.gov (United States)

Bantis, Leonidas E; Nakas, Christos T; Reiser, Benjamin; Myall, Daniel; Dalrymple-Alford, John C

2017-06-01

The three-class approach is used for progressive disorders when clinicians and researchers want to diagnose or classify subjects as members of one of three ordered categories based on a continuous diagnostic marker. The decision thresholds or optimal cut-off points required for this classification are often chosen to maximize the generalized Youden index (Nakas et al., Stat Med 2013; 32: 995-1003). The effectiveness of these chosen cut-off points can be evaluated by estimating their corresponding true class fractions and their associated confidence regions. Recently, in the two-class case, parametric and non-parametric methods were investigated for the construction of confidence regions for the pair of the Youden-index-based optimal sensitivity and specificity fractions that can take into account the correlation introduced between sensitivity and specificity when the optimal cut-off point is estimated from the data (Bantis et al., Biomet 2014; 70: 212-223). A parametric approach based on the Box-Cox transformation to normality often works well while for markers having more complex distributions a non-parametric procedure using logspline density estimation can be used instead. The true class fractions that correspond to the optimal cut-off points estimated by the generalized Youden index are correlated similarly to the two-class case. In this article, we generalize these methods to the three- and to the general k-class case which involves the classification of subjects into three or more ordered categories, where ROC surface or ROC manifold methodology, respectively, is typically employed for the evaluation of the discriminatory capacity of a diagnostic marker. We obtain three- and multi-dimensional joint confidence regions for the optimal true class fractions. We illustrate this with an application to the Trail Making Test Part A that has been used to characterize cognitive impairment in patients with Parkinson's disease.

Dos fases en el uso del nudo borromeo en el último período de la obra de Jacques Lacan Two phases in the use of the borromean know in the last period of the work of Jacques Lacan

Directory of Open Access Journals (Sweden)

Fabián Schejtman

2010-12-01

Full Text Available En el presente trabajo, resultado de una de las líneas de investigación exploradas en el Proyecto UBACyT P022 (2008-2010, aislamos dos fases en el uso que Jacques Lacan hace del nudo borromeo en el último período de su obra y exploramos algunas de las consecuencias clínicas de dicho distingo.In this paper, the result of one of the lines of research explored in the project UBACyT P022 (2008-2010, we isolated two phases in Jacques Lacan's use of the borromean knot in the last period of his work, and explore some of the clinical consequences of that distinction.

Curing Provincialism: Why We Educate the Way We Do. A Conversation with Jacques Barzun.

Science.gov (United States)

American Educator, 2002

2002-01-01

This interview with author and cultural historian Jacques Barzun discusses the origins of history, science, art, literature, and math, calling them the core of intellectual inheritance. Notes how the frameworks they provide enable people to extend their understanding of the world and reach beyond natural, human parochialism. Discusses the…

Receiver operating characteristic (ROC) curves: review of methods with applications in diagnostic medicine

Science.gov (United States)

Obuchowski, Nancy A.; Bullen, Jennifer A.

2018-04-01

Receiver operating characteristic (ROC) analysis is a tool used to describe the discrimination accuracy of a diagnostic test or prediction model. While sensitivity and specificity are the basic metrics of accuracy, they have many limitations when characterizing test accuracy, particularly when comparing the accuracies of competing tests. In this article we review the basic study design features of ROC studies, illustrate sample size calculations, present statistical methods for measuring and comparing accuracy, and highlight commonly used ROC software. We include descriptions of multi-reader ROC study design and analysis, address frequently seen problems of verification and location bias, discuss clustered data, and provide strategies for testing endpoints in ROC studies. The methods are illustrated with a study of transmission ultrasound for diagnosing breast lesions.

Analysis of DuPont and Kodak duplicating films and chemistries in a Fultron spray processor

Science.gov (United States)

Weinstein, M. S.

1972-01-01

A test program was conducted with duPont duplicating film type SR 112 and SCOLOR developer and Kodak duplicating film types 2430, 2422, and FE 2628 (SO-467) and MX-641 developer to determine sensitometric and image quality characteristics of these materials when used with a fultron spray processor. The test results show that the SCOLOR developer foams excessively in the fultron processor when used with or without the addition of an antifoaming agent. The Kodak type FE 2628 film with MX-641 chemistry had the longest linear Log E range at a 1.0 gamma. Sensitometric curves and granularity traces for all film process combinations tested are included.

"Remember" source memory ROCs indicate recollection is a continuous process.

Science.gov (United States)

Slotnick, Scott D

2010-01-01

The dual process model assumes memory is based on recollection (retrieval with specific detail) or familiarity (retrieval without specific detail). A current debate is whether recollection is a threshold process or, like familiarity, is a continuous process. In the present study two continuous models and two threshold models of recollection were evaluated using receiver operating characteristic (ROC) analysis. These models included the continuous signal detection unequal variance model and the threshold dual process model. In the study phase of three experiments, objects were presented to the right or left of fixation. At test, participants made either remember-know responses or item confidence responses followed by source memory (spatial location) confidence ratings. Recollection-based ROCs were generated from source memory confidence ratings associated with "remember" responses (in Experiments 1-2) or the highest item confidence responses (in Experiment 3). Neither threshold model adequately fit any of the recollection-based ROCs. By contrast, one or both of the continuous models adequately fit all of the recollection-based ROCs. The present results indicate recollection and familiarity are both continuous processes.

Le contrôle de l’activité législative de la nation en 1789 : l’opinion de Dupont de Nemours

Directory of Open Access Journals (Sweden)

Anthony Mergey

2014-06-01

Full Text Available On the eve of the French Revolution, Dupont de Nemours became infatuated with constitutional issues that had hitherto been the exclusive domain of some of his fellow physiocrats, in particular Le Mercier de La Rivière. Endorsing the ideas of the time, he was convinced of the necessity of creating a new political regime that would take the features of a moderate monarchy. The prince would thus be submitted to constitutional rules, sovereignty transferred to the nation and the legislative power exercised by its representatives. However, even if sharing authority between the nation and the king was then claimed, the representatives of the nation should not exercise their prerogatives outside a clearly established, defined constitutional framework. Partly consistent with the original physiocratic theories, Dupont de Nemours identified constitutional norms that should be promoted and protected from abuses of the legislature. With this aim in mind, he didn’t plan to resort to a jurisdictional authority, because abuses of Ancien Régime parliaments were still live memories. He decided, in an original way, to entrust the heavy burden of controlling legislative activity to political instances, namely, successively, the people and the monarch. Quite naturally, these suggestions, expressed a few months apart, exposed various forms of control. The examination carried out by the nation appeared as a prerequisite and tended to verify the constitutionality of the law, while the one carried out by the monarch through his veto, as holder of the executive power, was more of a control of opportunity devoid of binding. Although the omnipotence of the revolutionary legicentrism seemed incompatible with such a system of verification of the norm, it remains that Dupont de Nemours was part of a current which considerably developed during the XVIIIth century and which found a certain resonance in the decade following the Revolution.

Accrual of ROCs LECs and REGOs. Phase 3a: pre-determined entitlements to ROCs for small microgenerators

Energy Technology Data Exchange (ETDEWEB)

NONE

2005-07-01

This report describes a proposed scheme to enable microgenerators in the UK to claim Renewable Obligation Certificates (ROCs) on the basis of predetermined estimates of output rather than data from meters. The aim of the scheme, which has been developed following discussions with representatives of the microgeneration community in the UK, is to make it easier for small generators to access to ROCs and thus encourage householders and smaller commercial/business users to install renewable microgeneration technologies. The work was commissioned as part of the review of the Renewables Obligation. The report considers: background information; the Australian scheme for small generating units; eligibility and entitlements; the operation of the scheme; new procedural and legislative requirements; measures to protect and improve the Renewables Obligation; alterative approaches; scheme benefits; and recommendations. An overview of the scheme's key features is given in the report's executive summary.

Jacques Pothier. William Faulkner. Essayer de tout dire.

Directory of Open Access Journals (Sweden)

André Bleikasten

2006-04-01

Full Text Available Jacques Pothier sait de quoi il parle. De Faulkner il a tout lu — les grands romans de Le Bruit et la fureur à Descends, Moïse, bien sûr, mais aussi les premiers poèmes et les premières proses, les textes encore tâtonnants où s’ébauchait l’oeuvre à venir (Le Faune de marbre, « La Colline », Le Père Abraham, etc. et les romans-palimpsestes de la fin, où la fiction faulknérienne, revenant sur ses propres traces, se relisait en se réécrivant. Et Pothier s’est également intéressé de près au Sud,...

El rocío y el turismo de peregrinación

Directory of Open Access Journals (Sweden)

Águeda Villa Díaz

2006-01-01

Full Text Available La palabra Rocío está llena de significados: una virgen, una romería y una aldea —vecinas de la marisma del Guadalquivir— bautizadas por un fenómeno microclimático, como es la diaria y fecunda presencia de agua en su mínima expresión —las gotas de rocío—. Pero este nombre evoca, sobre todo, a la devoción a Nuestra Señora del Rocío —Patrona de Almonte— y a su anual romería de Pentecostés —el Rocío Grande—. Esta romería ha conocido una gran expansión en los últimos cincuenta años, atrayendo peregrinos de puntos cada vez más lejanos, pero su origen es muy antiguo y siempre se ha desarrollado asociada a la aldea. En su imparable proceso de crecimiento, aquella aldea y sus rituales festivos muestran una rápida evolución —adaptable a las nuevas circunstancias— que no desdeña la incorporación de nuevos y dispares elementos, que las modifican sensible y profundamente. De manera que, el Rocío conforma, actualmente, una realidad espacial, social, económica, cultural y simbólica en ebullición. La estrecha vinculación de la aldea y las rutas de peregrinación con los espacios protegidos de Doñana relacionan El Rocío con las políticas de conservación de la naturaleza.

On the form of ROCs constructed from confidence ratings.

Science.gov (United States)

Malmberg, Kenneth J

2002-03-01

A classical question for memory researchers is whether memories vary in an all-or-nothing, discrete manner (e.g., stored vs. not stored, recalled vs. not recalled), or whether they vary along a continuous dimension (e.g., strength, similarity, or familiarity). For yes-no classification tasks, continuous- and discrete-state models predict nonlinear and linear receiver operating characteristics (ROCs), respectively (D. M. Green & J. A. Swets, 1966; N. A. Macmillan & C. D. Creelman, 1991). Recently, several authors have assumed that these predictions are generalizable to confidence ratings tasks (J. Qin, C. L. Raye, M. K. Johnson, & K. J. Mitchell, 2001; S. D. Slotnick, S. A. Klein, C. S. Dodson, & A. P. Shimamura, 2000, and A. P. Yonelinas, 1999). This assumption is shown to be unwarranted by showing that discrete-state ratings models predict both linear and nonlinear ROCs. The critical factor determining the form of the discrete-state ROC is the response strategy adopted by the classifier.

Marketingová strategie u vybraného produktu na příkladu společnosti DuPont

OpenAIRE

Wojnar, Michal

2009-01-01

The bachelor thesis "Marketing Strategy of a Chosen Product on The Example of DuPont" is aimed at analyzing the marketing strategy and marketing mix of the Elvaloy material which is used in paving segment. The main applied methodology is called situation analysis through which the author compares individual key markets, reviews internal and external conditions of the company and studies the competition. The main objective of the thesis is also to present diminishing differences between indust...

Geisinger high-risk osteoporosis clinic (HiROC): 2013-2015 FLS performance analysis.

Science.gov (United States)

Dunn, P; Webb, D; Olenginski, T P

2018-02-01

Geisinger Health System (GHS) high-risk osteoporosis clinic (HiROC), which treats patients with low-trauma, fragility fractures, reports their 2013-2015 performance measures in secondary fracture prevention. This fracture liaison service (FLS) pathway treats 75% of high-risk, drug eligible patients, compared to 13.8% in GHS primary care. This performance points to the need for more FLS programs throughout the world. The purpose of this study is to analyze and report ongoing performance measures in outpatient and inpatient high-risk osteoporosis clinic (HiROC) program designed for patients with low-trauma, fragility fractures. Retrospective chart review of outpatient HiROC (511 patients) and inpatient HiROC (1279 patients) performance from 2013 to 2015 is reported within Geisinger Health System (GHS). Similar to a prior report, we document that Geisinger's branded outpatient and inpatient HiROC pathways continue to function as an all-fracture FLS. Importantly, this analysis emphasizes the importance of FLS care that HiROC's treatment rate of 75% was markedly superior to GHS-PCP care of 13.8%. However, a large percentage of patients (37.8%) were lost to follow-up care. This led to the identification of multiple care gaps/barriers to ideal best practice. FLS programs use case finding strategies and address secondary fracture prevention. GHS HiROC's performance and initiation of drug therapy in this fracture patient population contrasts with GHS-PCP care's much lower rate of treatment, documenting the need for ongoing FLS care. Importantly, the results of this analysis have prompted the beginnings of GHS programmatic changes, designed to narrow the reported care gaps in this mature FLS.

The embodied performance pedagogy of Jacques Lecoq

Science.gov (United States)

Kemp, Rick

2017-01-01

This article proposes that acting is a valuable area of research for the fields of Artificial Intelligence and Simulated Behaviour. This suggestion is supported through applying theories and findings from the field of embodied cognition to the performance pedagogy of French acting teacher Jacques Lecoq (1921-1999). Embodied cognition proposes that thinking and behaviour are properties of the whole human organism, not the brain alone, and that body, brain and cognition are "situated" - engaged with the surrounding environment. This thesis arises from findings that show that sensorial and motor experiences form the neural foundations for mental concepts and that sensorimotor neural networks are partially re-activated by mental and linguistic activity, leading to the concept of "embodied simulation". I give examples of the ways in which Lecoq's conceptualisation of acting technique is implicitly congruent with the principles of embodied cognition, and often explicitly anticipates its precepts.

On the formula of Jacques-Louis Lions for reproducing kernels of harmonic and other functions

Czech Academy of Sciences Publication Activity Database

Engliš, Miroslav; Lukkassen, D.; Peetre, J.; Persson, L. E.

2004-01-01

Roč. 570, - (2004), s. 89-129 ISSN 0075-4102 R&D Projects: GA AV ČR IAA1019005 Institutional research plan: CEZ:AV0Z1019905 Keywords : formula of Jacques-Louis Lions * Sobolev space * Hilber space Subject RIV: BA - General Mathematics Impact factor: 0.885, year: 2004

Euroopa taassünd pärast sõda / Jürgen Habermas, Jacques Derrida ; tõlk. Mati Sirkel

Index Scriptorium Estoniae

Habermas, Jürgen

2003-01-01

"Tuum-Euroopa" ideest. Euroopa peab heitma vaekausile oma kaalu rahvusvahelisel tasandil ja ÜRO raames, et tasakaalustada USA hegemoniaalset unilateralismi, tõdevad autorid. Vt. samas: Jacques Derrida. Miks ma alla kirjutasin?

The Meaning of the Global City: Jacques Ellul's Continued Relevance to 21st-Century Urbanism

Science.gov (United States)

Toly, Noah

2012-01-01

Jacques Ellul's book, "The Meaning of the City," widely recognized as one of the most important twentieth century theological reflections on the city, was also one of his most controversial scholarly contributions. Many urbanists interpreted the book as demeaning the city and diminishing the importance of urban policy, planning, design,…

Comparison of rat epidermal keratinocyte organotypic culture (ROC) with intact human skin

DEFF Research Database (Denmark)

Pappinen, Sari; Hermansson, Martin; Kuntsche, Judith

2008-01-01

study was to compare the stratum corneum lipid content of ROC with the corresponding material from human skin. The lipid composition was determined by thin-layer chromatography (TLC) and mass-spectrometry, and the thermal phase transitions of stratum corneum were studied by differential scanning...... calorimetry (DSC). All major lipid classes of the stratum corneum were present in ROC in a similar ratio as found in human stratum corneum. Compared to human skin, the level of non-hydroxyacid-sphingosine ceramide (NS) was increased in ROC, while alpha-hydroxyacid-phytosphingosine ceramide (AP) and non...... compared to human skin, in agreement with the results from DSC. ROC underwent a lipid lamellar order to disorder transition (T2) at a slightly lower temperature (68 degrees C) than human skin (74 degrees C). These differences in stratum corneum lipid composition and the thermal phase transitions may...

Receiver operator characteristic (ROC) analysis without truth

International Nuclear Information System (INIS)

Henkelman, R.M.; Kay, I.; Bronskill, M.J.

1990-01-01

Receiver operator characteristic (ROC) analysis, the preferred method of evaluating diagnostic imaging tests, requires an independent assessment of the true state of disease, which can be difficult to obtain and is often of questionable accuracy. A new method of analysis is described which does not require independent truth data and which can be used when several accurate tests are being compared. This method uses correlative information to estimate the underlying model of multivariate normal distributions of disease-positive and disease-negative patients. The method is shown to give results equivalent to conventional ROC analysis in a comparison of computed tomography, radionuclide scintigraphy, and magnetic resonance imaging for liver metastasis. When independent truth is available, the method can be extended to incorporate truth data or to evaluate the consistency of the truth data with the imaging data

ROC-ing along: Evaluation and interpretation of receiver operating characteristic curves.

Science.gov (United States)

Carter, Jane V; Pan, Jianmin; Rai, Shesh N; Galandiuk, Susan

2016-06-01

It is vital for clinicians to understand and interpret correctly medical statistics as used in clinical studies. In this review, we address current issues and focus on delivering a simple, yet comprehensive, explanation of common research methodology involving receiver operating characteristic (ROC) curves. ROC curves are used most commonly in medicine as a means of evaluating diagnostic tests. Sample data from a plasma test for the diagnosis of colorectal cancer were used to generate a prediction model. These are actual, unpublished data that have been used to describe the calculation of sensitivity, specificity, positive predictive and negative predictive values, and accuracy. The ROC curves were generated to determine the accuracy of this plasma test. These curves are generated by plotting the sensitivity (true-positive rate) on the y axis and 1 - specificity (false-positive rate) on the x axis. Curves that approach closest to the coordinate (x = 0, y = 1) are more highly predictive, whereas ROC curves that lie close to the line of equality indicate that the result is no better than that obtained by chance. The optimum sensitivity and specificity can be determined from the graph as the point where the minimum distance line crosses the ROC curve. This point corresponds to the Youden index (J), a function of sensitivity and specificity used commonly to rate diagnostic tests. The area under the curve is used to quantify the overall ability of a test to discriminate between 2 outcomes. By following these simple guidelines, interpretation of ROC curves will be less difficult and they can then be interpreted more reliably when writing, reviewing, or analyzing scientific papers. Copyright © 2016 Elsevier Inc. All rights reserved.

Jacques Castan (1929-2014), radiation protection illustrator in the nuclear industry

International Nuclear Information System (INIS)

Guarnieri, Franck; Portelli, Aurelien; Travadel, Sebastien

2017-01-01

Improving risk control allows to reduce them. Showing that they can be controlled and how to do so is essential, and using images is an excellent mean. The work of Jacques Castan (1929-2014), draughtsman at the Radiation Protection Service (SPR) of CEA Marcoule Centre is the perfect illustration of this safety culture. Castan put his artistic talent to inform the general public and visitors about the activities of his Service through wall paintings, posters, comics and board games, giving a reassuring image of the radiation protection role

Overestimation of test performance by ROC analysis: Effect of small sample size

International Nuclear Information System (INIS)

Seeley, G.W.; Borgstrom, M.C.; Patton, D.D.; Myers, K.J.; Barrett, H.H.

1984-01-01

New imaging systems are often observer-rated by ROC techniques. For practical reasons the number of different images, or sample size (SS), is kept small. Any systematic bias due to small SS would bias system evaluation. The authors set about to determine whether the area under the ROC curve (AUC) would be systematically biased by small SS. Monte Carlo techniques were used to simulate observer performance in distinguishing signal (SN) from noise (N) on a 6-point scale; P(SN) = P(N) = .5. Four sample sizes (15, 25, 50 and 100 each of SN and N), three ROC slopes (0.8, 1.0 and 1.25), and three intercepts (0.8, 1.0 and 1.25) were considered. In each of the 36 combinations of SS, slope and intercept, 2000 runs were simulated. Results showed a systematic bias: the observed AUC exceeded the expected AUC in every one of the 36 combinations for all sample sizes, with the smallest sample sizes having the largest bias. This suggests that evaluations of imaging systems using ROC curves based on small sample size systematically overestimate system performance. The effect is consistent but subtle (maximum 10% of AUC standard deviation), and is probably masked by the s.d. in most practical settings. Although there is a statistically significant effect (F = 33.34, P<0.0001) due to sample size, none was found for either the ROC curve slope or intercept. Overestimation of test performance by small SS seems to be an inherent characteristic of the ROC technique that has not previously been described

Art is going elsewhere: and politics has to catch it : an interview with Jacques Rancière

NARCIS (Netherlands)

Dasgupta, S.

2008-01-01

The reflections of the French philosopher JacquesRancière shift in between literature, film, pedagogy, historiography, proletarian history and philosophy. He came to prominence when he contributed to Althusser’s 'Lire lecapital' (1965) and, shortly after, published a fervent critique of Althusser -

Short speech of Mister Jacques Chirac, President of the French Republic

International Nuclear Information System (INIS)

Tubiana, M.; Gwiazdowska, B.; Tolwinski, J.; Bulski, W.; Maseron, J.J.; Gerbaulet, A.

1999-01-01

A century ago, on the 26. december 1898, Mister Henri Becquerel presented at the Academy of Sciences a communication on the radium discovery made by Pierre and Marie Curie. In this issue is published the text of communications made by Mister Jacques Chirac, President of the French Republic and Mister Maurice Tubiana, co president with Mister Georges Charpak of the High Committee for the centenary of the radioactivity discovery, during the ceremonial in the great amphitheater of the Sorbonne. This text is followed by two historical notes about Pierre and Marie Curie and the discovery and medical use of the radium. (N.C.)

ROC analysis in gammagraphic diagnosis of hepatic cirrhosis

International Nuclear Information System (INIS)

Hdez-Armas, J.; Allende, A.; Alarco, R.; Panero, J.; Oton, C.

1982-01-01

An application of the ROC statistical method is described on a sample of 161 patients who underwent hepatic gammagraphy and biopsies obtained by laparsocopy, and of whom 90 were found to have hepatic cirrhosis according to pathological anatomy. Five decision thresholds have been established in the elaboration of the gammagraphic diagnosis of cirrhosis. The true positive fraction (TPF) and false positive fraction (FPF) of these five thresholds are shown on an ordinate axis and an ROC curve is obtained. By means of a simplified cost-benefit analysis the optimal point of operation for this type of diagnosis is determined on this curve, according to which the diagnosis of cirrhosis should be considered positive when alterations in the size of the liver and distribution of the isotope in the liver are found simultaneously with splenomegaly. (orig.)

A Three-Dimensional Receiver Operator Characteristic Surface Diagnostic Metric

Science.gov (United States)

Simon, Donald L.

2011-01-01

Receiver Operator Characteristic (ROC) curves are commonly applied as metrics for quantifying the performance of binary fault detection systems. An ROC curve provides a visual representation of a detection system s True Positive Rate versus False Positive Rate sensitivity as the detection threshold is varied. The area under the curve provides a measure of fault detection performance independent of the applied detection threshold. While the standard ROC curve is well suited for quantifying binary fault detection performance, it is not suitable for quantifying the classification performance of multi-fault classification problems. Furthermore, it does not provide a measure of diagnostic latency. To address these shortcomings, a novel three-dimensional receiver operator characteristic (3D ROC) surface metric has been developed. This is done by generating and applying two separate curves: the standard ROC curve reflecting fault detection performance, and a second curve reflecting fault classification performance. A third dimension, diagnostic latency, is added giving rise to 3D ROC surfaces. Applying numerical integration techniques, the volumes under and between the surfaces are calculated to produce metrics of the diagnostic system s detection and classification performance. This paper will describe the 3D ROC surface metric in detail, and present an example of its application for quantifying the performance of aircraft engine gas path diagnostic methods. Metric limitations and potential enhancements are also discussed

Rocker: Open source, easy-to-use tool for AUC and enrichment calculations and ROC visualization.

Science.gov (United States)

Lätti, Sakari; Niinivehmas, Sanna; Pentikäinen, Olli T

2016-01-01

Receiver operating characteristics (ROC) curve with the calculation of area under curve (AUC) is a useful tool to evaluate the performance of biomedical and chemoinformatics data. For example, in virtual drug screening ROC curves are very often used to visualize the efficiency of the used application to separate active ligands from inactive molecules. Unfortunately, most of the available tools for ROC analysis are implemented into commercially available software packages, or are plugins in statistical software, which are not always the easiest to use. Here, we present Rocker, a simple ROC curve visualization tool that can be used for the generation of publication quality images. Rocker also includes an automatic calculation of the AUC for the ROC curve and Boltzmann-enhanced discrimination of ROC (BEDROC). Furthermore, in virtual screening campaigns it is often important to understand the early enrichment of active ligand identification, for this Rocker offers automated calculation routine. To enable further development of Rocker, it is freely available (MIT-GPL license) for use and modifications from our web-site (http://www.jyu.fi/rocker).

The ROC Toolbox: A toolbox for analyzing receiver-operating characteristics derived from confidence ratings.

Science.gov (United States)

Koen, Joshua D; Barrett, Frederick S; Harlow, Iain M; Yonelinas, Andrew P

2017-08-01

Signal-detection theory, and the analysis of receiver-operating characteristics (ROCs), has played a critical role in the development of theories of episodic memory and perception. The purpose of the current paper is to present the ROC Toolbox. This toolbox is a set of functions written in the Matlab programming language that can be used to fit various common signal detection models to ROC data obtained from confidence rating experiments. The goals for developing the ROC Toolbox were to create a tool (1) that is easy to use and easy for researchers to implement with their own data, (2) that can flexibly define models based on varying study parameters, such as the number of response options (e.g., confidence ratings) and experimental conditions, and (3) that provides optimal routines (e.g., Maximum Likelihood estimation) to obtain parameter estimates and numerous goodness-of-fit measures.The ROC toolbox allows for various different confidence scales and currently includes the models commonly used in recognition memory and perception: (1) the unequal variance signal detection (UVSD) model, (2) the dual process signal detection (DPSD) model, and (3) the mixture signal detection (MSD) model. For each model fit to a given data set the ROC toolbox plots summary information about the best fitting model parameters and various goodness-of-fit measures. Here, we present an overview of the ROC Toolbox, illustrate how it can be used to input and analyse real data, and finish with a brief discussion on features that can be added to the toolbox.

The natural law in the thought of Jacques Maritain

Directory of Open Access Journals (Sweden)

Manuel López-Casquete de Prado

2017-08-01

Full Text Available The importance of the work of the French author Jacques Maritain is beyond doubt. He was one of the initiators of the personalist movement, and had a decisive influence on the Catholic Social Thought from Populorum Progressio (1967; he also inspired the emergence of a large number of Christian-inspired parties. One of the biggest highlights of his career was the participation in the preparatory works of the Universal Declaration of Human Rights, sponsored by the UN in 1948. That occasion offered him an extraordinary opportunity to discuss and make living philosophy of his thesis on natural law. This paper offers a critical review of Maritains’s thinking on natural law and analyzes his participation in the UN Declaration, which guarantees the importance of his philosophical development.

Jacques Lacan and the Other Side of Psychoanalysis: Reflections on Seminar XVII

Directory of Open Access Journals (Sweden)

Lizzy Newman

2006-10-01

Full Text Available pA review of Justin Clemens and Russell Grigg (eds., Jacques Lacan and the Other Side of Psychoanalysis: Reflections on Seminar XVII, Duke University Press, 2006. ISBN: 0-8223-3719-3./ppA new book that brings together 16 essays, mostly all commentaries upon Lacan#39;#39;s Seminar XVII, known as #39;The other Side of Psychoanalysis#39;. Topics include the four discourses, the relation between psychoanalysis and contemporary social discourses, the question of social change, the relationship between psychoanalysis and politics, and the structuring function of the Oedipus complex. /p

Jacques Joseph: Father of modern aesthetic surgery

Directory of Open Access Journals (Sweden)

Bhattacharya Surajit

2008-10-01

Full Text Available When we review the history of modern aesthetic surgery, a name that stands out as bright as a beacon and precious as gold is undoubtedly that of Jacques Joseph. A surgeon, par excellence, far ahead of his time, who chose to think out of the box, Joseph, despite all odds set out to give respectability to Aesthetic Surgery without depriving it of any scientific core values. By his words and deeds proved beyond doubt that only the very best in the field of reconstructive surgery, can visualize the hidden perfection in imperfection and formulate a treatment plan and a surgical strategy to achieve that elusive perfection. The rich surgical literature that he has left behind, the wealth of surgical instruments that he had designed and above all a way of thinking that he propagated, that aesthetic surgery is not frivolous but very serious endeavor, and treating the psychology of the patient is as important as treating his disease, undoubtedly makes him the revered ′Father of Modern Aesthetic Surgery′.

Jacques Le Goff. faut-il vraiment découper l’histoire en tranches?

Directory of Open Access Journals (Sweden)

Abel López

2014-07-01

Full Text Available El primero de abril del 2014 murió Jacques Le Goff, el medievalista francés de mayor influencia dentro y fuera de Europa, de la llamada tercera generación de la Escuela de los Annales. En el mes de enero se publicó. este, su .último libro, recién cumplidos sus noventa años. Sea esta reseña un homenaje a sus valiosas contribuciones a la comprensión de la Edad Media.

Corrected ROC analysis for misclassified binary outcomes.

Science.gov (United States)

Zawistowski, Matthew; Sussman, Jeremy B; Hofer, Timothy P; Bentley, Douglas; Hayward, Rodney A; Wiitala, Wyndy L

2017-06-15

Creating accurate risk prediction models from Big Data resources such as Electronic Health Records (EHRs) is a critical step toward achieving precision medicine. A major challenge in developing these tools is accounting for imperfect aspects of EHR data, particularly the potential for misclassified outcomes. Misclassification, the swapping of case and control outcome labels, is well known to bias effect size estimates for regression prediction models. In this paper, we study the effect of misclassification on accuracy assessment for risk prediction models and find that it leads to bias in the area under the curve (AUC) metric from standard ROC analysis. The extent of the bias is determined by the false positive and false negative misclassification rates as well as disease prevalence. Notably, we show that simply correcting for misclassification while building the prediction model is not sufficient to remove the bias in AUC. We therefore introduce an intuitive misclassification-adjusted ROC procedure that accounts for uncertainty in observed outcomes and produces bias-corrected estimates of the true AUC. The method requires that misclassification rates are either known or can be estimated, quantities typically required for the modeling step. The computational simplicity of our method is a key advantage, making it ideal for efficiently comparing multiple prediction models on very large datasets. Finally, we apply the correction method to a hospitalization prediction model from a cohort of over 1 million patients from the Veterans Health Administrations EHR. Implementations of the ROC correction are provided for Stata and R. Published 2017. This article is a U.S. Government work and is in the public domain in the USA. Published 2017. This article is a U.S. Government work and is in the public domain in the USA.

El precio de la autobiografía: Jacques Derrida, el circunciso

OpenAIRE

Jorge Panesi

1996-01-01

Podría muy bien imaginarse el precio de una autobiografía. O el precio que un filósofo debe pagar para escribir una autobiografía. Tal vez la vida entera. Y en efecto: hay una relación de absoluta necesidad entre lo que Jacques Derrida escribió siempre y la publicación de su curiosa autobiografía en 1991, llamada Circonfession. El precio se paga en forma de literatura y su débito, como se imaginará, queda cargado en las cuentas de la Filosofía. Pero no solamente, puesto que también puede imag...

Consistency Results for the ROC Curves of Fused Classifiers

National Research Council Canada - National Science Library

Bjerkaas, Kristopher

2004-01-01

.... An established performance quantifier is the Receiver Operating Characteristic (ROC) curve, which allows one to view the probability of detection versus the probability of false alarm in one graph...

Jean-Jacques Rousseau on Adult Education and Revolution. Paradigma of Radical, Pedagogical Thought. 2nd Revised Edition.

Science.gov (United States)

Dame, Frederick William

This book explores Jean-Jacques Rousseau's educational philosophy, as expressed in his key works, and applies that philosophy to adult education and revolution. The titles and topics of the book's seven chapters are as follows: (1) "L'Invitation: Raison d'Etre" (prelude, statement, significance, the process, assumptions and limitations);…

Reliability in NDT: ROC study of radiographic weld inspections

International Nuclear Information System (INIS)

Nockemann, C.; Heidt, H.; Thomsen, N.

1991-01-01

The complexity of modern nondestructive testing (NDT) equipment as well as the demand for high reliability in many industries makes it necessary to have a tool to assess different NDT techniques and devices quickly. As for cost benefit considerations, a measure of accuracy has to include not only the number of correctly detected defects but also the corresponding number of false indications. In order to satisfy a variety of security demands this ratio of true and false indications must be known for a wide range of defect dimensions to be included in the defect count. This information will be provided by only one ROC (relative operating characteristic) study of inspection data using the rating confidence method. An expanded ROC version also yields an assessment of the accuracy of the defect classification and of the correctness of the indicated defect importance. All these measures of performance can also be called up for each individual inspector. For demonstrating the power of the method it is applied to ascertain the difference in detection performance of three distinct experimental modalities in the radiographic testing of welded joints. In order to be capable of drawing conclusions reliably, the study is completed by statistical significance tests. The paper shows the usefulness of ROC for performance assessment in NDT and gives an illustration of what can be done with which effort. (Author)

Recent developments in the ROCS/MC code for retrieving local power information in coarse-mesh reactor analysis

International Nuclear Information System (INIS)

Grill, S.F.; Jonsson, A.; Crump, M.W.

1983-01-01

The inclusion of 3-D effects in PWR analysis is necessary for accurate predictions of reactivity, power distributions, and reactivity coefficients. The ROCS/MC code system has been developed by Combustion Engineering to provide 3-D coarse mesh analysis (ROCS) with the capability to retrieve local information on flux, power and burnup (MC). A review of the finite difference representation of the MC diffusion equation, along with recent improvements to the ROCS/MC system are presented. These improvements include the implementation if fine mesh radial boundary conditions and internal calculation of coarse mesh boundary conditions, generalization of the imbedded calculation to account for the local neighboring environment, and the automation of ROCS/MC links to C-E's code system for in-core power distribution monitoring and core-follow analysis. The results of the ROCS/MC verification program are described and show good agreement with C-E's ROCS/PDQ based methodologies

Les relations de la Commision Europeenne Jacques Delors avec l'Association Europeenne de Libre Echange. La creation de l'Espace Economique Europeen

Directory of Open Access Journals (Sweden)

Dacian Graţian GAL

2005-06-01

Full Text Available The subject of this article is the relation between Jacques Delors European Commission and the European Free Trade Association (EFTA during 1985-1995 and the creation of the Economic European Space (EEE. These relations were focused on the economic aspects, due to the fact that Economic European Community and the European Free Trade Association were two opposites economics blocks. The struggle between EEC and EFTA was over during Jacques Delors terms as head of the European Commission with the accession of three EFTA's countries in the EEC. The EEC victory is the consequence of its political implications and not only its economic implications like in the EFTA case.  

Poéticas del intruso. Jacques Rancière, lector de Mallarmé

Directory of Open Access Journals (Sweden)

Alberto Bejarano

2016-01-01

Full Text Available Este artículo analiza el significado de la figura del poeta como “intruso” en la obra de Stéphane Mallarmé, tal como es estudiada por el filósofo y ensayista francés Jacques Rancière en La política de la sirena y La palabra muda. Nuestra intención apunta a mostrar otras definiciones del rol del poeta y del espacio literario en uno de los creadores más destacados del arte contemporáneo.

Ideal observer estimation and generalized ROC analysis for computer-aided diagnosis

International Nuclear Information System (INIS)

Edwards, Darrin C.

2004-01-01

The research presented in this dissertation represents an innovative application of computer-aided diagnosis and signal detection theory to the specific task of early detection of breast cancer in the context of screening mammography. A number of automated schemes have been developed in our laboratory to detect masses and clustered microcalcifications in digitized mammograms, on the one hand, and to classify known lesions as malignant or benign, on the other. The development of fully automated classification schemes is difficult, because the output of a detection scheme will contain false-positive detections in addition to detected malignant and benign lesions, resulting in a three-class classification task. Researchers have so far been unable to extend successful tools for analyzing two-class classification tasks, such as receiver operating characteristic (ROC) analysis, to three-class classification tasks. The goals of our research were to use Bayesian artificial neural networks to estimate ideal observer decision variables to both detect and classify clustered microcalcifications and mass lesions in mammograms, and to derive substantial theoretical results indicating potential avenues of approach toward the three-class classification task. Specifically, we have shown that an ideal observer in an N-class classification task achieves an optimal ROC hypersurface, just as the two-class ideal observer achieves an optimal ROC curve; and that an obvious generalization of a well-known two-class performance metric, the area under the ROC curve, is not useful as a performance metric in classification tasks with more than two classes. This work is significant for three reasons. First, it involves the explicit estimation of feature-based (as opposed to image-based) ideal observer decision variables in the tasks of detecting and classifying mammographic lesions. Second, it directly addresses the three-class classification task of distinguishing malignant lesions, benign

Lenguaje, palabra, discurso en la enseñanza de Jacques Lacan. // Languaje, word, speech in Jacques Lacan`s teaching.

Directory of Open Access Journals (Sweden)

Marcela Ana Negro.

2009-12-01

Full Text Available This article is the result of the analysis of two Lacan’s statements in Seminar 3 in which he differentiates between language, word and speech. The results presented here intend to report that difference, by defining the structure and the rules of each aspect of the symbolic dimension. The author also tries to define the special features of the subject and the Other from the language, word and speech aspects. This research is limited to Lacan’s first contributions (1953-1958. // Este artículo surge como resultado de una investigación a partir de una frase de Lacan del Seminario 3 donde distingue lenguaje, palabra y discurso. El desarrollo que se expone aquí intenta dar cuenta de esa diferencia, situando la estructura y las leyes correspondientes a cada vertiente de la dimensión simbólica. También se intenta articular las particularidades que surgen en cuanto al sujeto y al Otro en cada una de ellas. El trabajo de investigación se circunscribe a los primeros años de la enseñanza de Jacques Lacan (1953-1958.

Der vergeschlechtlichte Staat: zum Verhältnis von Freiheit, Geschlecht und Staat bei Jean-Jacques Rousseau

OpenAIRE

Nagy, Nicola

2017-01-01

"Im Beitrag werden die strategischen und systematischen Funktionen sowie die Bedeutung der von Jean-Jacques Rousseau beschriebenen Geschlechtscharaktere und der darauf bauenden Ordnung des Geschlechterverhältnisses im Rahmen der konkreten Ausgestaltung und Umsetzung seines Modells des Staates sichtbar gemacht. Bemerkenswert ist die Tatsache, dass die Möglichkeitsbedingungen (Gemeinwohlorientierung) von Rousseaus Republik, mit deren Hilfe die Herstellung und der Erhalt der bürgerlichen Freihei...

Transcendence, Taxis, Trust: Richard Kearney and Jacques Derrida

Directory of Open Access Journals (Sweden)

Ulrich Schmiedel

2017-03-01

Full Text Available Whatever else it takes to drive a taxi, it takes trust. Day after day, the driver has to decide whether the other is or is not trustworthy. I take the taxi as a test case to analyze and assess Richard Kearney’s diacritical hermeneutics of the other. I argue that Kearney functionalizes the concept of transcendence in order to connect the transcendence of the finite other to the transcendence of the infinite other. However, in his central critique of the deconstructionists following Jacques Derrida, Kearney counters his connection. While Kearney’s critique of Derrida’s account of absolute alterity is correct and compelling, I argue that Derrida’s critique of a distinction between the trustworthy other and the non-trustworthy other might be more crucial than Kearney contends. Insisting on openness to the other’s otherness, Derrida provokes any hermeneutic of the other to trust in transcendence. The taxi is taken as a test to illustrate the implications which diacritical and deconstructive drivers might have for evaluating the entanglement of ethics and eschatology—inside and outside the taxi.

Enzymatic cybernetics: an unpublished work by Jacques Monod.

Science.gov (United States)

Gayon, Jean

2015-06-01

In 1959, Jacques Monod wrote a manuscript entitled Cybernétique enzymatique [Enzymatic cybernetics]. Never published, this unpublished manuscript presents a synthesis of how Monod interpreted enzymatic adaptation just before the publication of the famous papers of the 1960s on the operon. In addition, Monod offers an example of a philosophy of biology immersed in scientific investigation. Monod's philosophical thoughts are classified into two categories, methodological and ontological. On the methodological side, Monod explicitly hints at his preferences regarding the scientific method in general: hypothetical-deductive method, and use of theoretical models. He also makes heuristic proposals regarding molecular biology: the need to analyse the phenomena in question at the level of individual cells, and the dual aspect of all biological explanation, functional and evolutionary. Ontological issues deal with the notions of information and genetic determinism, "cellular memory", the irrelevance of the notion of "living matter", and the usefulness of a cybernetic comprehension of molecular biology. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.

'The Right Time and the Right Place': An Interview with Jacques Miller.

Science.gov (United States)

Anderson, Warwick

2016-01-01

Professor Jacques F.P. Miller spoke about his career in immunology with Warwick Anderson on 3 February 2014. Born in Nice, France, Miller attended high school and medical school in Sydney, Australia. As a Ph.D. student and postgraduate researcher in London, Miller discovered the immunological function of the thymus gland. Spending the rest of his career at the Walter and Eliza Hall Institute for Medical Research in Melbourne, Miller conducted pioneering research in lymphocyte population dynamics and the mechanisms of the human immune response. With Graham Mitchell, he demonstrated that mammalian lymphocytes can be divided into what became known as T cells and B cells, which interact to produce antibodies.

Large-field image intensifiers versus conventional chest radiography: ROC study with simulated interstitial disease

International Nuclear Information System (INIS)

Winter, L.H.L.; Chakraborty, D.P.; Waes, P.F.G.M.

1988-01-01

Two image intensifier tubes have recently been introduced whose large imaging area makes them suitable for chest imaging (Phillips Pulmodiagnost TLX slit II and Siemens TX 57 large entrance field II). Both modalities present a 10 x 10-cm hard copy image to the radiologist. A receiver operating characteristic (ROC) curve study with simulated interstitial disease was performed to compare the image quality of these image intensifiers with conventional chest images. The relative ranking in terms of decreasing ROC areas was Siemens, conventional, and Philips. Compared with conventional imaging, none of the differences in ROC curve area were statistically significant at the 5% level

Reader characteristics linked to detection of pulmonary nodules on radiographs: ROC vs. JAFROC analyses of performance

Science.gov (United States)

Kohli, Akshay; Robinson, John W.; Ryan, John; McEntee, Mark F.; Brennan, Patrick C.

2011-03-01

The purpose of this study is to explore whether reader characteristics are linked to heightened levels of diagnostic performance in chest radiology using receiver operating characteristic (ROC) and jackknife free response ROC (JAFROC) methodologies. A set of 40 postero-anterior chest radiographs was developed, of which 20 were abnormal containing one or more simulated nodules, of varying subtlety. Images were independently reviewed by 12 boardcertified radiologists including six chest specialists. The observer performance was measured in terms of ROC and JAFROC scores. For the ROC analysis, readers were asked to rate their degree of suspicion for the presence of nodules by using a confidence rating scale (1-6). JAFROC analysis required the readers to locate and rate as many suspicious areas as they wished using the same scale and resultant data were used to generate Az and FOM scores for ROC and JAFROC analyses respectively. Using Pearson methods, scores of performance were correlated with 7 reader characteristics recorded using a questionnaire. JAFROC analysis showed that improved reader performance was significantly (pchest specialty (pchest radiographs (pchest readings per year (pchest radiographs (pchest specialty, hours reading per week and number of radiographs read per year. Also, JAFROC is a more powerful predictor of performance as compared to ROC.

Quantitative evaluation of visual detection performance in medicine: ROC analysis and determination of diagnostic benefit

International Nuclear Information System (INIS)

Metz, C.E.; Starr, S.J.; Lusted, L.B.

1976-01-01

An ROC curve provides an empirical description of the trade-offs which are possible among the various types of correct and incorrect decisions as the human decision-maker varies one or more confidence thresholds. Conventional ROC curves measured in simple decision-making situations can, in some cases, be used to predict human decision performance in more complex situations. By considering both the consequences of the various types of diagnostic decisions and the overhead cost of a diagnostic study, one can use the ROC curve to evaluate the diagnostic usefulness of a study in any particular clinical context. Since the ROC curve describes the possible relationships among the probabilities of the various types of correct and incorrect decisions, it plays a central role in optimizing diagnostic strategies using the general techniques of decision analysis. Applications in radiographic image evaluation are described

The singular side of democracy in Jacques Derrida’s works: engagement politique and (inter)writing

OpenAIRE

Pelgreffi, Igor

2012-01-01

A critical re-appraisal of the relationship between deconstruction and democracy seems today to be advisable. The very bases of the so-called developed democracies are undermined by a process of desocialization of society and by a sort of individualism of indifference. This work will try to outline some preliminary reflections in order to question if, starting from Jacques Derrida’s works, a philosophical analysis of the ‘concept’ of singularity can be a consistent political count...

The Function of the Medieval in Jean-Jacques Rousseau's Nouvelle Heloise : A Rereading of the Abelard and Heloise Motif

NARCIS (Netherlands)

Montoya, Alicia C.

2010-01-01

Jean-Jacques Rousseau's critical rewriting in his Nouvelle H,lo

Auf ein Neues: Ästhetik und Politik: und dazwischen das Spiel: angestoßen durch Jacques Rancière

NARCIS (Netherlands)

Früchtl, J.

2007-01-01

Starting from Jacques Rancière we can conceive the relationship between aesthetics and politics anew, like in German idealism, as a unity of contradiction. Rancière connects this relationship with a romantic concept of 'the political'. But irrespective of that he reconstructs it as a 'historical

An ROC-type measure of diagnostic accuracy when the gold standard is continuous-scale.

Science.gov (United States)

Obuchowski, Nancy A

2006-02-15

ROC curves and summary measures of accuracy derived from them, such as the area under the ROC curve, have become the standard for describing and comparing the accuracy of diagnostic tests. Methods for estimating ROC curves rely on the existence of a gold standard which dichotomizes patients into disease present or absent. There are, however, many examples of diagnostic tests whose gold standards are not binary-scale, but rather continuous-scale. Unnatural dichotomization of these gold standards leads to bias and inconsistency in estimates of diagnostic accuracy. In this paper, we propose a non-parametric estimator of diagnostic test accuracy which does not require dichotomization of the gold standard. This estimator has an interpretation analogous to the area under the ROC curve. We propose a confidence interval for test accuracy and a statistical test for comparing accuracies of tests from paired designs. We compare the performance (i.e. CI coverage, type I error rate, power) of the proposed methods with several alternatives. An example is presented where the accuracies of two quick blood tests for measuring serum iron concentrations are estimated and compared.

Progress in evaluation of human observer visual detection performance using the ROC curve approach

International Nuclear Information System (INIS)

Metz, C.E.; Starr, S.J.; Lusted, L.B.; Rossmann, K.

1976-01-01

The ROC approach to analysis of human observer detection performance as playing a key role in elucidation the relationships among the physical parameters of an imaging operation, the ability of a human observer to use the image to make decisions regarding the state of health or disease in a medical diagnostic situation, and the medical and social utility of those decisions, was studied. The conventional ROC curve describing observer performance in simple detection tasks can be used to predict observer performance in complex detection tasks. The conventional ROC curve thus provides a description of observer detection performance which is useful in situations more relevant clinically than those for which it is measured. Similar predictions regarding observer performance in identification and recognition tasks are currently being sought. The ROC curve can be used to relate signal detectability to various measures of the diagnostic and social benefit derived from a medical imaging procedure. These relationships provide a means for assessing the relative desirability of alternative diagnostic techniques and can be used to evaluate combinations of diagnostic studies

Los nudos de las psicosis en la enseñanza de Jacques Lacán The knots of the psychoses in Jacques Lacan' teaching

Directory of Open Access Journals (Sweden)

Pablo D. Muñoz

2005-12-01

Full Text Available Jacques Lacan ha abordado la psicosis realizando numerosos aportes a la elaboración de su teoría y reconocimiento clínico. Sobre el final de su enseñanza, cuando revisa sus categorías clínicas y las aborda con el soporte de la teoría de nudos, la conceptualiza como una forma particular de anudamiento. En esta novedosa formalización, sin embargo, no se encuentra un abordaje unívoco sino que desde 1971 hasta 1981 presenta diversos tipos de anudamientos. Hasta la actualidad, no se conocen trabajos en que los especialistas los estudien sistemáticamente. El proyecto de investigación UBACyT TP34 (implica una novedad en este sentido pues formula algunas conclusiones sobre el tema. Este trabajo se propone revisarlas y ponerlas en tensión para verificar su adecuación con los textos de Lacan. Tarea imprescindible para poder abordar el objetivo máximo del proyecto becado en curso: explorar el modo en que la concepción nodal reordena la variedad clínica de la psicosis (paranoia, esquizofrenia, parafrenia, manía, melancolía.Jacques Lacan has approached the psychosis carrying out numerous contributions to the elaboration of its theory and clinical recognition. On the end of their teaching, when he revises their clinical categories and it approaches them with the support of the theory of knots, he conceptualizes it like a form peculiar of knotting. In this novel formalization, however, it is not approached in a unified way but rather from 1971 up to 1981 presents diverse knottings types. Until the present time, works are not known in that the specialists study them systematically. The investigation project UBACyT TP34 (1998-2000 implies a novelty in this since sense it formulates some conclusions on the topic. This work intends to revise them and to put them in tension to verify its adaptation with the texts of Lacan. Indispensable task to be able to approach the maximum objective of the project granted a scholarship in course: to explore the

The DuPont, Monsanto, General Electric open-quotes Lasagnaclose quotes Remediation Project - joint R ampersand D and financing

International Nuclear Information System (INIS)

Palmer, P.A.

1995-01-01

The Lasagna project is the first of what we expect will be several large cooperative projects between industry consortia and government to develop improved remediation technologies. In 1992, Monsanto Company began contacting other major corporations to see if they were experiencing similar difficulties in applying cost-effective, or even workable technologies for industrial site remediation. Both General Electric and DuPont were early participants in the effort to develop a meeting with the EPA to discuss technical problems faced in cleanup, research needs, and ways to accelerate development of more cost-effective techniques. This paper provides some background on how this cooperative process came to reality, what the Lasagna process is and how the cooperative arrangements and financing are structured

Jerusalén. La ciudad y la palabra en la obra de Jacques Derrida

OpenAIRE

Garrocho Salcedo, Diego S.

2016-01-01

In this article we may try to track down the use and the presence of Jerusalem in Jacques Derrida works. Between the real city and the word that designates it, the jerusalemite topic rises in Derrida’s writing as a bazillionth symptom of a self-confessed obsession. The Jewishness of the father of Deconstruction is one of the most decisive signs in his relationship with texts and words and, in the case of the thrice holy city it serves to explain one of the speech acts that perhaps he more com...

Jacques Lacan and the Other Side of Psychoanalysis: Reflections on Seminar XVII (Book Review

Directory of Open Access Journals (Sweden)

Lizzy Newman

2006-01-01

Full Text Available A review of Justin Clemens and Russell Grigg (eds., Jacques Lacan and the Other Side of Psychoanalysis: Reflections on Seminar XVII, Duke University Press, 2006. ISBN: 0-8223-3719-3.A new book that brings together 16 essays, mostly all commentaries upon Lacan''s Seminar XVII, known as 'The other Side of Psychoanalysis'. Topics include the four discourses, the relation between psychoanalysis and contemporary social discourses, the question of social change, the relationship between psychoanalysis and politics, and the structuring function of the Oedipus complex.

Theoretical vs. empirical discriminability: the application of ROC methods to eyewitness identification.

Science.gov (United States)

Wixted, John T; Mickes, Laura

2018-01-01

Receiver operating characteristic (ROC) analysis was introduced to the field of eyewitness identification 5 years ago. Since that time, it has been both influential and controversial, and the debate has raised an issue about measuring discriminability that is rarely considered. The issue concerns the distinction between empirical discriminability (measured by area under the ROC curve) vs. underlying/theoretical discriminability (measured by d' or variants of it). Under most circumstances, the two measures will agree about a difference between two conditions in terms of discriminability. However, it is possible for them to disagree, and that fact can lead to confusion about which condition actually yields higher discriminability. For example, if the two conditions have implications for real-world practice (e.g., a comparison of competing lineup formats), should a policymaker rely on the area-under-the-curve measure or the theory-based measure? Here, we illustrate the fact that a given empirical ROC yields as many underlying discriminability measures as there are theories that one is willing to take seriously. No matter which theory is correct, for practical purposes, the singular area-under-the-curve measure best identifies the diagnostically superior procedure. For that reason, area under the ROC curve informs policy in a way that underlying theoretical discriminability never can. At the same time, theoretical measures of discriminability are equally important, but for a different reason. Without an adequate theoretical understanding of the relevant task, the field will be in no position to enhance empirical discriminability.

Correlation of free-response and receiver-operating-characteristic area-under-the-curve estimates: Results from independently conducted FROC/ROC studies in mammography

International Nuclear Information System (INIS)

Zanca, Federica; Hillis, Stephen L.; Claus, Filip; Van Ongeval, Chantal; Celis, Valerie; Provoost, Veerle; Yoon, Hong-Jun; Bosmans, Hilde

2012-01-01

Purpose: From independently conducted free-response receiver operating characteristic (FROC) and receiver operating characteristic (ROC) experiments, to study fixed-reader associations between three estimators: the area under the alternative FROC (AFROC) curve computed from FROC data, the area under the ROC curve computed from FROC highest rating data, and the area under the ROC curve computed from confidence-of-disease ratings. Methods: Two hundred mammograms, 100 of which were abnormal, were processed by two image-processing algorithms and interpreted by four radiologists under the FROC paradigm. From the FROC data, inferred-ROC data were derived, using the highest rating assumption. Eighteen months afterwards, the images were interpreted by the same radiologists under the conventional ROC paradigm; conventional-ROC data (in contrast to inferred-ROC data) were obtained. FROC and ROC (inferred, conventional) data were analyzed using the nonparametric area-under-the-curve (AUC), (AFROC and ROC curve, respectively). Pearson correlation was used to quantify the degree of association between the modality-specific AUC indices and standard errors were computed using the bootstrap-after-bootstrap method. The magnitude of the correlations was assessed by comparison with computed Obuchowski-Rockette fixed reader correlations. Results: Average Pearson correlations (with 95% confidence intervals in square brackets) were: Corr(FROC, inferred ROC) = 0.76[0.64, 0.84] > Corr(inferred ROC, conventional ROC) = 0.40[0.18, 0.58] > Corr (FROC, conventional ROC) = 0.32[0.16, 0.46]. Conclusions: Correlation between FROC and inferred-ROC data AUC estimates was high. Correlation between inferred- and conventional-ROC AUC was similar to the correlation between two modalities for a single reader using one estimation method, suggesting that the highest rating assumption might be questionable.

Use of the ROC anchor in foot and ankle surgery. A retrospective study.

Science.gov (United States)

Kuwada, G T

1999-05-01

A retrospective study was conducted on the use of the ROC (Radial Osteo Compression) soft-tissue anchor in foot and ankle surgery. This article describes how the anchor is deployed, problematic aspects of using the anchor, and complications and success rates associated with the anchor in ankle stabilizations, posterior tibial tendon reconstruction, peroneus brevis tendon reconstruction after fracture of the base of the fifth metatarsal, and detachment and reattachment of the Achilles tendon. The ROC anchor consists of the anchor with nonabsorbable suture attached to the shaft, the deployment handle, and drill bits. The anchor and shaft are snapped into the deployment handle and inserted into the drill hole. Compression of the trigger deploys the anchor into the hole. The ROC anchor was found to be reliable, useful, and relatively easy to deploy, with outcomes similar to those of other soft-tissue anchors.

Sobre os limites da interpretação. O debate entre Umberto Eco e Jacques Derrida

Directory of Open Access Journals (Sweden)

Eduardo Ramalho Rabenhorst

2002-01-01

Full Text Available A proposta do presente trabalho é examinar o debate sobre os limites da atividade interpretativa, tomando por base as propostas do desconstrucionismo de Jacques Derrida e da semiologia de Umberto Eco. Tentaremos mostrar que as discordâncias entre as duas perspectivas poderiam ser suficientemente aplainadas a partir da identificação de um ponto de convergência fornecido pelas idéias de contexto e de compreensão intersubjetiva.

ROC curve analyses of eyewitness identification decisions: An analysis of the recent debate.

Science.gov (United States)

Rotello, Caren M; Chen, Tina

2016-01-01

How should the accuracy of eyewitness identification decisions be measured, so that best practices for identification can be determined? This fundamental question is under intense debate. One side advocates for continued use of a traditional measure of identification accuracy, known as the diagnosticity ratio , whereas the other side argues that receiver operating characteristic curves (ROCs) should be used instead because diagnosticity is confounded with response bias. Diagnosticity proponents have offered several criticisms of ROCs, which we show are either false or irrelevant to the assessment of eyewitness accuracy. We also show that, like diagnosticity, Bayesian measures of identification accuracy confound response bias with witnesses' ability to discriminate guilty from innocent suspects. ROCs are an essential tool for distinguishing memory-based processes from decisional aspects of a response; simulations of different possible identification tasks and response strategies show that they offer important constraints on theory development.

Why did Jacques Monod make the choice of mechanistic determinism?

Science.gov (United States)

Loison, Laurent

2015-06-01

The development of molecular biology placed in the foreground a mechanistic and deterministic conception of the functioning of macromolecules. In this article, I show that this conception was neither obvious, nor necessary. Taking Jacques Monod as a case study, I detail the way he gradually came loose from a statistical understanding of determinism to finally support a mechanistic understanding. The reasons of the choice made by Monod at the beginning of the 1950s can be understood only in the light of the general theoretical schema supported by the concept of mechanistic determinism. This schema articulates three fundamental notions for Monod, namely that of the rigidity of the sequence of the genetic program, that of the intrinsic stability of macromolecules (DNA and proteins), and that of the specificity of molecular interactions. Copyright © 2015 Académie des sciences. Published by Elsevier SAS. All rights reserved.

Face recognition in schizophrenia: do individual and average ROCs tell the same story?

Science.gov (United States)

Tiberghien, Guy; Martin, Clara; Baudouin, Jean-Yves; Franck, Nicolas; Guillaume, Fabrice; Huron, Caroline

2015-01-01

Many studies have shown that recollection process is impaired in patients with schizophrenia, whereas familiarity is generally spared. However, in these studies, the Receiver Operating Characteristic (ROC) presented is average ROC likely to mask individual differences. In the present study using a face-recognition task, we computed the individual ROC of patients with schizophrenia and control participants. Each group was divided into two subgroups on the basis of the type of recognition processes implemented: recognition based on familiarity only and recognition based on familiarity and recollection. The recognition performance of the schizophrenia patients was below that of the control participants only when recognition was based solely on familiarity. For the familiarity-alone patients, the score obtained on the Scale for the Assessment of Positive Symptoms (SAPS) was correlated with the variance of the old-face familiarity. For the familiarity-recollection patients, the score obtained on the Scale for the Assessment of Negative Symptoms (SANS) was correlated with the decision criterion and with the old-face recollection probability. These results show that one cannot ascribe the impaired recognition observed in patients with schizophrenia to a recollection deficit alone. These results show that individual ROC can be used to distinguish between subtypes of schizophrenia and could serve as a basis for setting up specific cognitive remediation therapy for individuals with schizophrenia.

Arte, imagem e fotografia: um diálogo possível entre Roland Barthes, Walter Benjamin e Jacques Rancière = Art, image and photography: a possible dialogue between Roland Barthes, Walter Benjamin and Jacques Rancière

Directory of Open Access Journals (Sweden)

Voigt, André Fabiano

2016-01-01

Full Text Available O presente artigo objetiva estabelecer um diálogo entre três autores que escreveram trabalhos importantes sobre a relação da arte com as imagens e a fotografia. Enquanto os pensamentos de Roland Barthes e Walter Benjamin se assemelham, Jacques Rancière apresenta uma postura dissonante ao analisar arte, imagem e fotografia no interior do que ele chama de regime estético das artes

Jacques Joset, La muerte y la gramática. Los derroteros de Fernando Vallejo

OpenAIRE

Tedeschi, Stefano

2010-01-01

Escribir un libro sobre Fernando Vallejo se presenta como una operación siempre algo arriesgada. El tema es controvertido como pocos en el panorama de la literatura hispanoamericana actual: pasiones incondicionales se mueven alrededor de su nombre, hasta llegar a fanatismos quizás merecedores de otros ámbitos. Además Jacques Joset emprende tan atrevida tarea siendo él, como se recuerda en las primeras páginas, « el editor de Cien años de soledad », el que ha pasado largos días de su vida volc...

Design of a receiver operating characteristic (ROC) study of 10:1 lossy image compression

Science.gov (United States)

Collins, Cary A.; Lane, David; Frank, Mark S.; Hardy, Michael E.; Haynor, David R.; Smith, Donald V.; Parker, James E.; Bender, Gregory N.; Kim, Yongmin

1994-04-01

The digital archiving system at Madigan Army Medical Center (MAMC) uses a 10:1 lossy data compression algorithm for most forms of computed radiography. A systematic study on the potential effect of lossy image compression on patient care has been initiated with a series of studies focused on specific diagnostic tasks. The studies are based upon the receiver operating characteristic (ROC) method of analysis for diagnostic systems. The null hypothesis is that observer performance with approximately 10:1 compressed and decompressed images is not different from using original, uncompressed images for detecting subtle pathologic findings seen on computed radiographs of bone, chest, or abdomen, when viewed on a high-resolution monitor. Our design involves collecting cases from eight pathologic categories. Truth is determined by committee using confirmatory studies performed during routine clinical practice whenever possible. Software has been developed to aid in case collection and to allow reading of the cases for the study using stand-alone Siemens Litebox workstations. Data analysis uses two methods, ROC analysis and free-response ROC (FROC) methods. This study will be one of the largest ROC/FROC studies of its kind and could benefit clinical radiology practice using PACS technology. The study design and results from a pilot FROC study are presented.

Word versus Honor: The Case of Françoise de Rohan vs. Jacques de Savoie

OpenAIRE

McIlvenna, Una

2012-01-01

This paper examines one of the most notorious scandals of sixteenth-century France. In 1557, Françoise de Rohan, a lady-in-waiting to Catherine de Medici, launched a legal battle to get the duke of Nemours, Jacques de Savoie, to recognize their orally-agreed marriage contract and formally recognize the child whom he had fathered with her. Central to Rohan’s case were not only the love-letters Nemours had written to her but also the eye-witness testimonies of her servants, who had overheard th...

Application of identifying transmission spheres for spherical surface testing

Science.gov (United States)

Han, Christopher B.; Ye, Xin; Li, Xueyuan; Wang, Quanzhao; Tang, Shouhong; Han, Sen

2017-06-01

We developed a new application on Microsoft Foundation Classes (MFC) to identify correct transmission spheres (TS) for Spherical Surface Testing (SST). Spherical surfaces are important optical surfaces, and the wide application and high production rate of spherical surfaces necessitates an accurate and highly reliable measuring device. A Fizeau Interferometer is an appropriate tool for SST due to its subnanometer accuracy. It measures the contour of a spherical surface using a common path, which is insensitive to the surrounding circumstances. The Fizeau Interferometer transmits a wide laser beam, creating interference fringes from re-converging light from the transmission sphere and the test surface. To make a successful measurement, the application calculates and determines the appropriate transmission sphere for the test surface. There are 3 main inputs from the test surfaces that are utilized to determine the optimal sizes and F-numbers of the transmission spheres: (1) the curvatures (concave or convex), (2) the Radii of Curvature (ROC), and (3) the aperture sizes. The application will firstly calculate the F-numbers (i.e. ROC divided by aperture) of the test surface, secondly determine the correct aperture size of a convex surface, thirdly verify that the ROC of the test surface must be shorter than the reference surface's ROC of the transmission sphere, and lastly calculate the percentage of area that the test surface will be measured. However, the amount of interferometers and transmission spheres should be optimized when measuring large spherical surfaces to avoid requiring a large amount of interferometers and transmission spheres for each test surface. Current measuring practices involve tedious and potentially inaccurate calculations. This smart application eliminates human calculation errors, optimizes the selection of transmission spheres (including the least number required) and interferometer sizes, and increases efficiency.

Lühike panegüürika Lauri Leesist : temale pühendatud näituse avamise puhul Eesti Rahvusraamatukogus 18. jaanuaril 2002 / Jean-Jacques Subrenat

Index Scriptorium Estoniae

Subrenat, Jean-Jacques

2002-01-01

Prantsuse suursaadiku Eestis Jean-Jacques Subrenat sõnavõtt Rahvusraamatukogu humanitaarteaduste saalis ja Prantsuse saali galeriis näituse "Lauri Leesi kui prantsuse kultuuri ja keele vahendaja Eestis" avamise puhul

Exploration of analysis methods for diagnostic imaging tests: problems with ROC AUC and confidence scores in CT colonography.

Science.gov (United States)

Mallett, Susan; Halligan, Steve; Collins, Gary S; Altman, Doug G

2014-01-01

Different methods of evaluating diagnostic performance when comparing diagnostic tests may lead to different results. We compared two such approaches, sensitivity and specificity with area under the Receiver Operating Characteristic Curve (ROC AUC) for the evaluation of CT colonography for the detection of polyps, either with or without computer assisted detection. In a multireader multicase study of 10 readers and 107 cases we compared sensitivity and specificity, using radiological reporting of the presence or absence of polyps, to ROC AUC calculated from confidence scores concerning the presence of polyps. Both methods were assessed against a reference standard. Here we focus on five readers, selected to illustrate issues in design and analysis. We compared diagnostic measures within readers, showing that differences in results are due to statistical methods. Reader performance varied widely depending on whether sensitivity and specificity or ROC AUC was used. There were problems using confidence scores; in assigning scores to all cases; in use of zero scores when no polyps were identified; the bimodal non-normal distribution of scores; fitting ROC curves due to extrapolation beyond the study data; and the undue influence of a few false positive results. Variation due to use of different ROC methods exceeded differences between test results for ROC AUC. The confidence scores recorded in our study violated many assumptions of ROC AUC methods, rendering these methods inappropriate. The problems we identified will apply to other detection studies using confidence scores. We found sensitivity and specificity were a more reliable and clinically appropriate method to compare diagnostic tests.

Dynamic thresholds and a summary ROC curve: Assessing prognostic accuracy of longitudinal markers.

Science.gov (United States)

Saha-Chaudhuri, P; Heagerty, P J

2018-04-19

Cancer patients, chronic kidney disease patients, and subjects infected with HIV are routinely monitored over time using biomarkers that represent key health status indicators. Furthermore, biomarkers are frequently used to guide initiation of new treatments or to inform changes in intervention strategies. Since key medical decisions can be made on the basis of a longitudinal biomarker, it is important to evaluate the potential accuracy associated with longitudinal monitoring. To characterize the overall accuracy of a time-dependent marker, we introduce a summary ROC curve that displays the overall sensitivity associated with a time-dependent threshold that controls time-varying specificity. The proposed statistical methods are similar to concepts considered in disease screening, yet our methods are novel in choosing a potentially time-dependent threshold to define a positive test, and our methods allow time-specific control of the false-positive rate. The proposed summary ROC curve is a natural averaging of time-dependent incident/dynamic ROC curves and therefore provides a single summary of net error rates that can be achieved in the longitudinal setting. Copyright © 2018 John Wiley & Sons, Ltd.

Spatial resolution requirements in digital radiography of scaphoid fractures. An ROC analysis

International Nuclear Information System (INIS)

Jonsson, A.; Laurin, S.; Karner, G.; Herrlin, K.; Hochbergs, P.; Jonsson, K.; Rudling, O.; Sandstroem, S.; Sloth, M.; Svahn, G.; Pettersson, H.

1996-01-01

Purpose: To investigate the spatial resolution requirements in digital radiography of scaphoid fractures. Material and Methods: Included in the study were 60 scaphoid radiographs with and 60 without fractures of the scaphoid bone. The film-screen images were digitized using pixel sizes of 115, 170, and 340 μm along with 170 μm with a 10:1 wavelet compression. The digital images were displayed on a 1280 x 1024 x 8 bits monitor, and 5 observers evaluated the images in 5 randomized sessions. The results for each pixel size were then compared to the film-screen images by ROC analysis. Results: The mean area under the ROC curves was larger for the film-screen images than for the digital images at all resolutions. However, this difference was not significant when the areas under the ROC curves for the film-screen images were compared to the digital images of 115, 170, and 170 μm with 10:1 compression. There was a significant difference for the 340-μm pixel size in favour of the film-screen images. The mean ROC curves for the digital images were very similar for the 115 and 170 μm pixel sizes, although slightly better for 115 μm. At 170 μm, the compression seemed to have a relatively small negative effect on the diagnostic performance; the deterioration was greater when the pixel size was increased to 340 μm. There was no obvious correlation between diagnostic performance and the experience of the observers in using workstations. Conclusions: The pixel size of 170 μm is adequate for the detection of subtle fractures, even after wavelet compression by a ratio of 10:1. (orig.)

LA ESTÉTICA Y SU DIMENSIÓN POLÍTICA SEGÚN JACQUES RANCIÈRE

OpenAIRE

Ricardo Javier Arcos Palma

2009-01-01

La filosofía de Jacques Rancière acuerda un lugar importante a la estética. Esta última se redefine desde un punto de vista político y ético, no como disciplina, sino como régimen de lo sensible. el presente ensayo pretende acercarse a lo esencial de la estética, su redefinición y su dimensión política, problematizando múltiples relaciones entre política, ética y estética, y poniendo en tensión una lectura crítica de la obra Rancière con otras perspectivas que unen o separan dichos ámbitos....

O mosaico antiglobalização visto sob o prisma de Jacques Rancière

OpenAIRE

Diego Azzi

2007-01-01

Este artigo tem por objetivo apresentar conceitos importantes do pensamento do filósofo francês Jacques Rancière, sobretudo a partir da noção de partilha do sensível. Com base na pesquisa de Mestrado realizada sobre os movimentos antiglobalização, são expostas hipóteses para a compreensão destes como produtores de inscrições dissensuais na ordem sensível policial, reatualizanclo a política em meio a um mosaico de modos de subjetivação e diferenças geracionais. Finalmente, são tecidas consider...

Verification of a model for the detection of intrauterine growth restriction (IUGR) by receiver operating characteristics (ROC)

Science.gov (United States)

Liu, Pengbo; Mongelli, Max; Mondry, Adrian

2004-07-01

The purpose of this study is to verify by Receiver Operating Characteristics (ROC) a mathematical model supporting the hypothesis that IUGR can be diagnosed by estimating growth velocity. The ROC compare computerized simulation results with clinical data from 325 pregnant British women. Each patient had 6 consecutive ultrasound examinations for fetal abdominal circumference (fac). Customized and un-customized fetal weights were calculated according to Hadlock"s formula. IUGR was diagnosed by the clinical standard, i.e. estimated weight below the tenth percentile. Growth velocity was estimated by calculating the changes of fac (Dzfac/dt) at various time intervals from 3 to 10 weeks. Finally, ROC was used to compare the methods. At 3~4 weeks scan interval, the area under the ROC curve is 0.68 for customized data and 0.66 for the uncustomized data with 95% confidence interval. Comparison between simulation data and real pregnancies verified that the model is clinically acceptable.

Pedagical enlightenment and natural education in Jean-Jacques Rousseau

Directory of Open Access Journals (Sweden)

Cristiano Eduardo Wendt

2012-05-01

Full Text Available The essay discusses the importance of Jean-Jacques Rousseau for modern pedagogy, by being grounded on his philosophical-pedagogical work Émile or On Education. It seeks to present the meaning of pedagogical enlightenment as well as the concept of natural education, and the two great novelties brought by Rousseau to the educational realm, i.e., the concept of infancy and of education. In this perspective, it analyzes the three main interpretations to which Rousseau’s enlightenment was submitted along history: As an optimist of reason, primitivist and dialectician of reason. Assuming the Genevan’s thought as a defender of a dialectics of reason, the essay seeks to reflect the unfolding which every concept provokes to its project of natural education and how it reflects in the cognitive and moral development of the infants. At last it deals with the presentation of two innovations which Rousseau brings to the realm of education, the first one which deals with the concept of infancy, and the second one which deals with the pedagogical concept as a whole, by considering the phases of biological, cognitive and moral maturing, where each child is encountered.

Radiological zero point in the Taaone lagoon before starting running the Jacques Chirac hospital in Tahiti

International Nuclear Information System (INIS)

Bouisset, P.

2009-01-01

Within the perspective of the implementation of a radiotherapy and diagnosis department in the future Jacques Chirac hospital in Tahiti, and with the aim of having a radio-ecological zero point in the lagoon where liquid effluents from the hospital will be rejected, this report describes the sampling campaign performed in the Taaone' bay in Tahiti by collecting water and sediments as well as seaweeds and fishes. It also describes how these samples have been prepared and analysed, gives and comments results of radioactivity and ionizing radiations measurements performed on these samples

9. Le contemporain et l’anachronique : un palimpseste inverse chez Jacques Ferron

OpenAIRE

Méchoulan, Éric

2018-01-01

« Derrière le portrait mortuaire de l’abbé Armour Lupien, on n’inscrivit qu’une phrase et elle était de lui : “C’est le fils qui a engendré le Père et, sans Jésus mourant sur le calvaire, il n’y aurait pas de Dieu.” Elle passa inaperçue. »Jacques Ferron, Le Saint-Élias Terminons, comme nous avons commencé, par un exemple littéraire. Non pour les privilèges à accorder en soi à la littérature, mais bien parce que la littérature a justement été instituée dans ce creuset instable de la culture de...

LA ESTÉTICA Y SU DIMENSIÓN POLÍTICA SEGÚN JACQUES RANCIÈRE

Directory of Open Access Journals (Sweden)

Ricardo Javier Arcos Palma

2009-01-01

Full Text Available La filosofía de Jacques Rancière acuerda un lugar importante a la estética. Esta última se redefine desde un punto de vista político y ético, no como disciplina, sino como régimen de lo sensible. El presente ensayo pretende acercarse a lo esencial de la estética, su redefinición y su dimensión política, problematizando múltiples relaciones entre política, ética y estética, y poniendo en tensión una lectura crítica de la obra Rancière con otras perspectivas que unen o separn dichos ámbitos.

ROC generated thresholds for field-assessed aerobic fitness related to body size and cardiometabolic risk in schoolchildren.

Directory of Open Access Journals (Sweden)

Lynne M Boddy

Full Text Available OBJECTIVES: 1. to investigate whether 20 m multi-stage shuttle run performance (20mSRT, an indirect measure of aerobic fitness, could discriminate between healthy and overweight status in 9-10.9 yr old schoolchildren using Receiver Operating Characteristic (ROC analysis; 2. Investigate if cardiometabolic risk differed by aerobic fitness group by applying the ROC cut point to a second, cross-sectional cohort. DESIGN: Analysis of cross-sectional data. PARTICIPANTS: 16,619 9-10.9 year old participants from SportsLinx project and 300 11-13.9 year old participants from the Welsh Schools Health and Fitness Study. OUTCOME MEASURES: SportsLinx; 20mSRT, body mass index (BMI, waist circumference, subscapular and superilliac skinfold thicknesses. Welsh Schools Health and Fitness Study; 20mSRT performance, waist circumference, and clustered cardiometabolic risk. ANALYSES: Three ROC curve analyses were completed, each using 20mSRT performance with ROC curve 1 related to BMI, curve 2 was related to waist circumference and 3 was related to skinfolds (estimated % body fat. These were repeated for both girls and boys. The mean of the three aerobic fitness thresholds was retained for analysis. The thresholds were subsequently applied to clustered cardiometabolic risk data from the Welsh Schools study to assess whether risk differed by aerobic fitness group. RESULTS: The diagnostic accuracy of the ROC generated thresholds was higher than would be expected by chance (all models AUC >0.7. The mean thresholds were 33 and 25 shuttles for boys and girls respectively. Participants classified as 'fit' had significantly lower cardiometabolic risk scores in comparison to those classed as unfit (p<0.001. CONCLUSION: The use of the ROC generated cut points by health professionals, teachers and coaches may provide the opportunity to apply population level 'risk identification and stratification' processes and plan for "at-risk" children to be referred onto intervention

StAR: a simple tool for the statistical comparison of ROC curves

Directory of Open Access Journals (Sweden)

Melo Francisco

2008-06-01

Full Text Available Abstract Background As in many different areas of science and technology, most important problems in bioinformatics rely on the proper development and assessment of binary classifiers. A generalized assessment of the performance of binary classifiers is typically carried out through the analysis of their receiver operating characteristic (ROC curves. The area under the ROC curve (AUC constitutes a popular indicator of the performance of a binary classifier. However, the assessment of the statistical significance of the difference between any two classifiers based on this measure is not a straightforward task, since not many freely available tools exist. Most existing software is either not free, difficult to use or not easy to automate when a comparative assessment of the performance of many binary classifiers is intended. This constitutes the typical scenario for the optimization of parameters when developing new classifiers and also for their performance validation through the comparison to previous art. Results In this work we describe and release new software to assess the statistical significance of the observed difference between the AUCs of any two classifiers for a common task estimated from paired data or unpaired balanced data. The software is able to perform a pairwise comparison of many classifiers in a single run, without requiring any expert or advanced knowledge to use it. The software relies on a non-parametric test for the difference of the AUCs that accounts for the correlation of the ROC curves. The results are displayed graphically and can be easily customized by the user. A human-readable report is generated and the complete data resulting from the analysis are also available for download, which can be used for further analysis with other software. The software is released as a web server that can be used in any client platform and also as a standalone application for the Linux operating system. Conclusion A new software for

El manzano revolucionario de Gustave Flaubert y los ocho materialismo de Jacques Lacan // Gustave Flaubert`s revolutionary apple tree and Lacan`s eight materialisms

Directory of Open Access Journals (Sweden)

David Pavón Cuéllar

2012-12-01

Full Text Available Se examina la actitud ambivalente de Jacques Lacan hacia el materialismo a la luz de una escena puntual en la novela Bouvard et Pécuchet de Gustave Flaubert. Esta escena, en la que un manzano reviste la forma de un revolucionario, nos permite discutir la esencia problemática de la materialidad en Lacan. Se distinguen ocho formas de materialismo en la teoría lacaniana y se muestra su oposición con respecto a otras formas de materialismo rechazadas en la misma teoría. // Jacques Lacan's ambivalent attitude towards materialism is examined at the light of a precise scene in Gustave Flaubert's novel Bouvard et Pécuchet. This scene, in which an apple tree takes the form of a revolutionary, allows us to discuss the problematic essence of materiality in Lacan. Eight forms of materialism are distinguished in Lacanian theory and opposed to other forms of materialism that would be rejected in this theory.

Software for illustrative presentation of basic clinical characteristics of laboratory tests--GraphROC for Windows.

Science.gov (United States)

Kairisto, V; Poola, A

1995-01-01

GraphROC for Windows is a program for clinical test evaluation. It was designed for the handling of large datasets obtained from clinical laboratory databases. In the user interface, graphical and numerical presentations are combined. For simplicity, numerical data is not shown unless requested. Relevant numbers can be "picked up" from the graph by simple mouse operations. Reference distributions can be displayed by using automatically optimized bin widths. Any percentile of the distribution with corresponding confidence limits can be chosen for display. In sensitivity-specificity analysis, both illness- and health-related distributions are shown in the same graph. The following data for any cutoff limit can be shown in a separate click window: clinical sensitivity and specificity with corresponding confidence limits, positive and negative likelihood ratios, positive and negative predictive values and efficiency. Predictive values and clinical efficiency of the cutoff limit can be updated for any prior probability of disease. Receiver Operating Characteristics (ROC) curves can be generated and combined into the same graph for comparison of several different tests. The area under the curve with corresponding confidence interval is calculated for each ROC curve. Numerical results of analyses and graphs can be printed or exported to other Microsoft Windows programs. GraphROC for Windows also employs a new method, developed by us, for the indirect estimation of health-related limits and change limits from mixed distributions of clinical laboratory data.

A Primer on Receiver Operating Characteristic Analysis and Diagnostic Efficiency Statistics for Pediatric Psychology: We Are Ready to ROC

Science.gov (United States)

2014-01-01

Objective To offer a practical demonstration of receiver operating characteristic (ROC) analyses, diagnostic efficiency statistics, and their application to clinical decision making using a popular parent checklist to assess for potential mood disorder. Method Secondary analyses of data from 589 families seeking outpatient mental health services, completing the Child Behavior Checklist and semi-structured diagnostic interviews. Results Internalizing Problems raw scores discriminated mood disorders significantly better than did age- and gender-normed T scores, or an Affective Problems score. Internalizing scores 30 had a diagnostic likelihood ratio of 7.4. Conclusions This study illustrates a series of steps in defining a clinical problem, operationalizing it, selecting a valid study design, and using ROC analyses to generate statistics that support clinical decisions. The ROC framework offers important advantages for clinical interpretation. Appendices include sample scripts using SPSS and R to check assumptions and conduct ROC analyses. PMID:23965298

Mutations in the LRRK2 Roc-COR tandem domain link Parkinson's disease to Wnt signalling pathways.

Science.gov (United States)

Sancho, Rosa M; Law, Bernard M H; Harvey, Kirsten

2009-10-15

Mutations in PARK8, encoding LRRK2, are the most common known cause of Parkinson's disease. The LRRK2 Roc-COR tandem domain exhibits GTPase activity controlling LRRK2 kinase activity via an intramolecular process. We report the interaction of LRRK2 with the dishevelled family of phosphoproteins (DVL1-3), key regulators of Wnt (Wingless/Int) signalling pathways important for axon guidance, synapse formation and neuronal maintenance. Interestingly, DVLs can interact with and mediate the activation of small GTPases with structural similarity to the LRRK2 Roc domain. The LRRK2 Roc-COR domain and the DVL1 DEP domain were necessary and sufficient for LRRK2-DVL1 interaction. Co-expression of DVL1 increased LRRK2 steady-state protein levels, an effect that was dependent on the DEP domain. Strikingly, LRRK2-DVL1-3 interactions were disrupted by the familial PARK8 mutation Y1699C, whereas pathogenic mutations at residues R1441 and R1728 strengthened LRRK2-DVL1 interactions. Co-expression of DVL1 with LRRK2 in mammalian cells resulted in the redistribution of LRRK2 to typical cytoplasmic DVL1 aggregates in HEK293 and SH-SY5Y cells and co-localization in neurites and growth cones of differentiated dopaminergic SH-SY5Y cells. This is the first report of the modulation of a key LRRK2-accessory protein interaction by PARK8 Roc-COR domain mutations segregating with Parkinson's disease. Since the DVL1 DEP domain is known to be involved in the regulation of small GTPases, we propose that: (i) DVLs may influence LRRK2 GTPase activity, and (ii) Roc-COR domain mutations modulating LRRK2-DVL interactions indirectly influence kinase activity. Our findings also link LRRK2 to Wnt signalling pathways, suggesting novel pathogenic mechanisms and new targets for genetic analysis in Parkinson's disease.

Law, Justice and Responsibility in the Philosophy of Jacques Derrida

Directory of Open Access Journals (Sweden)

J Jahangiri

2014-03-01

Full Text Available The works written in Persian about Jacques Derrida or the works translated into Persian about and from him have concentrated on Derrida’s aesthetic tendencies and forgotten his political philosophy and thought. But, we should know that his political philosophy and thought are so rich and working on them is necessary for our philosophical communities. In English-speaking world, it is for a decade that Derrida’s political thought has attracted writers’ and scholars’ attention. The works written in this period have concentrated independently on Derrida’s political philosophy and thought or have ‘politicized’ his aesthetic concepts. In this essay, we are trying to investigate the concepts of law, justice and responsibility in the philosophy of Derrida. First, we will clarify the distinctions between law and justice. For doing so, we will pay attention to Derridean concept of ‘deconstruction’. For Derrida, as we will see, law is ‘deconstructible’ and justice is ‘undeconstructible’. Second, we will investigate the relations between law, justice and responsibility. We will conclude that justice, contrary to law, does not prevent us from taking responsibility.

Thobie Jacques, Les Intérêts culturels français dans l’Empire ottoman finissant. L’enseignement laïque et en partenariat, Peeters, Leuven, 2009, 461 p.

Directory of Open Access Journals (Sweden)

Caroline Piquet

2010-09-01

Full Text Available À l’heure où la France cherche à relancer sa politique culturelle au Moyen-Orient avec l’implantation d’universités et de lycées prestigieux, l’ouvrage de Jacques Thobie vient nourrir la réflexion sur le rôle de l’éducation dans les processus d’expansion politique et le jeu des puissances. Jacques Thobie publie ici le complément à sa thèse désormais célèbre, Intérêts et impérialisme français dans l’Empire Ottoman 1895-1914. L’ouvrage n’est que la première partie d’un travail sur l’enseignemen...

ROUBAUD, Jacques. Brasil, França e osAnimais de todo o mundo. Cosac Naify, 2006

Directory of Open Access Journals (Sweden)

Júlio Abreu

2009-12-01

Full Text Available RESUMO: Os animais de todo mundo (Cosac Naify, 2006, livro de poemas do francês Jacques Roubaud, foi traduzido para o português por Paula Glenadel e Marcus Siscar. Além de ser considerado um poeta importante em sua língua, Roubaud é também matemático e fez parte, na década de 60, do grupo experimental OuLiPo – Ouvroir de la Littérature Potentiel, algo como Oficina de Literatura Potencial, ao qual pertenciam matemáticos e escritores como Raymond Queneau, autor de Zazie no metrô (Cosac Naify, 2009, traduzido por Paulo Werneck.  Roubaud teve outro livro de poemas traduzido no Brasil, Algo preto (Perspectiva, 2005, com tradução de Inês Oseki-Dépré. PALAVRAS-CHAVE: Educação; ensino-aprendizagem; PoemaABSTRACT:The animals of the world (COSAC Naify, 2006, book of poems of the French Jacques Roubaud, was translated into Portuguese by Paula Glenadel and Marcus Siscar. In addition to being considered an important poet in his language, Roubaud is also a mathematician and was part, in the 60s, the experimental group OuLiPo - Ouvroir de la Littérature Potentiel, something like Potential Literature Workshop, which belonged mathematicians and writers like Raymond Queneau, author of Zazie in the metro (COSAC Naify, 2009, translated by Paulo Werneck. Roubaud had another book of poems translated in Brazil, something black (Perspective, 2005, translated by Agnes Oseki-DEPRE. KEYWORDS: Education; teaching and learning; poemRecebido:12/10/2009    Aceito: 17/12/2009

JEAN-JACQUES ROUSSEAU’NUN EMILE’İNDE KADIN EĞİTİMİ

OpenAIRE

GENÇ, Hanife Nalan

2015-01-01

Bu çalışmada Fransız Yazınının Aydınlanma Dönemi yazarlarından olan Jean-Jacques Rousseau’nun ağırlıkla eğitim konusuna adanmış olan Emile (Bir Çocuk Büyüyor) isimli yapıtında kadına bakış açısını irdelemeye çalıştık. İsmi kahramanının ismiyle özdeş olan roman, yazarın kuram ve görüşlerini bilimsel ilkeler ışığında geliştirdiği Emile’in eğitimini konu edinir. Yazıldığı dönemde derin yankılar uyandıran kitap, eğitbilim alanında uygulamaya dönük kuramlar geliştirilmiş ilk yapıt olmasıyla önemli...

Diagnostic accuracy of quantitative 99mTc-MIBI scintimammography according to ROC curve analysis

International Nuclear Information System (INIS)

Kim, J. H.; Lee, H. K.; Seo, J. W.; Cho, N. S.; Cha, K. H.; Lee, T. H.

1998-01-01

99mTc-sestamibi scintimammography (SMM) has been shown to be a useful diagnostic test in the detection of breast cancer and the receiver operating characteristic (ROC) curve analysis provides detailed information of a diagnostic test. The purpose of this study was to evaluate the feasibility and efficacy of quantitative indices of SMM in the detection of malignant breast lesions according to ROC analysis. Prone anterior, lateral planar and supine SPECT imagings were performed on 75 female patients (mean age=43.4 yr) with breast mass (size≥0.8cm) after intravenous injection of 20-30 mCi 99mTc-sestamibi. 45 Malignant (Invasive ductal ca(36), Inv lobular ca(5), Inv duc + lob (1), Inv tubular ca (3)) and 30 benign (fibroadenoma (13), fib cyst(12), Fat necrosis(3), papilloma(1), paraffinoma (1)) lesions were histologically proven. Data were analyzed by creating three regions of interest (ROIs) over designated areas: lesion, normal breast and right chest wall. Lesion to normal (L/NL) and lesion to chest wall (L/CW) ratios were calculated for each patient both on the planar and SPECT. The area under the ROC curve (AUC) was calculated and compared among four semiquantitative indices and an average scintimammographic index (SMM(mean)) from arithmatic mean. ROC curve analysis revealed planar L/N, SPECT L/N and L/CW ratios provide comparable better diagnostic accuracies for detection of breast cancer than planar L/CW ratio (p<0.05), respectively. For quantitative SMM of 75 lesions, malignancy rate was 60%, and Sensitivity, Specificity, Positive Predictive Value, Negative Predictive Value and Accuracy were 0.78, 0.77, 0.84, 0.72 and 0.77, respectively. Quantitative SMM is an useful objective method for differentiating malignant from benign breast lesions

Diagnostic accuracy of quantitative 99mTc-MIBI scintimammography according to ROC curve analysis

Energy Technology Data Exchange (ETDEWEB)

Kim, J. H.; Lee, H. K.; Seo, J. W.; Cho, N. S.; Cha, K. H.; Lee, T. H. [Gachon Medical College, Gil Medical Center, Inchon (Korea, Republic of)

1998-07-01

99mTc-sestamibi scintimammography (SMM) has been shown to be a useful diagnostic test in the detection of breast cancer and the receiver operating characteristic (ROC) curve analysis provides detailed information of a diagnostic test. The purpose of this study was to evaluate the feasibility and efficacy of quantitative indices of SMM in the detection of malignant breast lesions according to ROC analysis. Prone anterior, lateral planar and supine SPECT imagings were performed on 75 female patients (mean age=43.4 yr) with breast mass (size{>=}0.8cm) after intravenous injection of 20-30 mCi 99mTc-sestamibi. 45 Malignant (Invasive ductal ca(36), Inv lobular ca(5), Inv duc + lob (1), Inv tubular ca (3)) and 30 benign (fibroadenoma (13), fib cyst(12), Fat necrosis(3), papilloma(1), paraffinoma (1)) lesions were histologically proven. Data were analyzed by creating three regions of interest (ROIs) over designated areas: lesion, normal breast and right chest wall. Lesion to normal (L/NL) and lesion to chest wall (L/CW) ratios were calculated for each patient both on the planar and SPECT. The area under the ROC curve (AUC) was calculated and compared among four semiquantitative indices and an average scintimammographic index (SMM(mean)) from arithmatic mean. ROC curve analysis revealed planar L/N, SPECT L/N and L/CW ratios provide comparable better diagnostic accuracies for detection of breast cancer than planar L/CW ratio (p<0.05), respectively. For quantitative SMM of 75 lesions, malignancy rate was 60%, and Sensitivity, Specificity, Positive Predictive Value, Negative Predictive Value and Accuracy were 0.78, 0.77, 0.84, 0.72 and 0.77, respectively. Quantitative SMM is an useful objective method for differentiating malignant from benign breast lesions.

Evaluation du stock de coquilles Saint-Jacques de la Manche-Est - Campagne COMOR XXIV N.O. Thalia

OpenAIRE

Vigneau, Joel; Lemoine, Michel

1994-01-01

Tous les ans depuis 1976, le laboratoire "RESSOURCES HALIEUTIQUES" de PORT-EN-BESSIN effectue une campagne d'évaluation sur les coquilles Saint-Jacques en Manche-Est; Les objectifs en sont une évaluation des stocks avec estimation de la biomasse exploitable, de la qualité du recrutement (prochaine génération à entrer dans les captures) et du pré-recrutement (dernière génération née, non encore accessible aux engins par la taille), et des paramètres de croissance. Toutes ces données servent de...

Comparative SAXS and DSC study on stratum corneum structural organization in an epidermal cell culture model (ROC)

DEFF Research Database (Denmark)

Kuntsche, Judith; Herre, Angela; Fahr, Alfred

2013-01-01

barrier similar to that of human stratum corneum is, however, a prerequisite. In this study, the stratum corneum lipid organization in an epidermal cell culture model based on rat epidermal keratinocytes (REK organotypic culture, ROC) was investigated by small-angle X-ray scattering (SAXS) in dependence......Cell cultured skin equivalents present an alternative for dermatological in vitro evaluations of drugs and excipients as they provide the advantage of availability, lower variability and higher assay robustness compared to native skin. For penetration/permeation studies, an adequate stratum corneum...... and SC lipid organization. Cultivation for 21days resulted in further minor changes in the structural organization of ROC SC. The SAXS patterns of ROC SC had overall large similarities with that of human SC and point to the presence of a long periodicity phase with a repeat distance of about 122Å, e...

Jean-Jacques Rousseau's copy of Albrecht von Haller's Historia stirpium indigenarum Helvetiae inchoata (1768).

Science.gov (United States)

Cook, A

2003-04-01

Jean-Jacques Rousseau sold his botanical texts to Daniel Malthus (father of Thomas Malthus) about 1775. Two of these are now in the Old Library, Jesus College, Cambridge, but all the rest have long been thought lost. However, a copy of Albrecht von Haller's Historia stirpium indigenarum Helvetiae inchoata (1768) in the Lindley Library, Royal Horticultural Society, London, bears Rousseau's name and seems to have been annotated by him. The volume contains the bookplate of Jane Dalton, a cousin to whom Malthus willed "all[his] Botanical Books in which the name of Rousseau is written". Haller was well-known to Rousseau, who while in exile in the Swiss Jura (1763-1765), studied under one of Haller's collaborators, Abraham Gagnebin. Rousseau cited Haller's entry 762 when describing a species of Seseli to the Duchess of Portland.

[The apothecaries of the Saint-Honoré district of Paris in the 17th century. The apothecaries Antoine and Jacques Grégoire and Louis XIII’s first painter, Simon Vouet].

Science.gov (United States)

Warolin, Christian

2016-12-01

This article presents the biographies of the apothecaries who lived in the Rue Saint-Honoré in Paris in the 17th century. Two major facts emerge from this study. The first concerns the formation of a family network involving the apothecaries and the royal artists. The apothecaries Antoine and Jacques Grégoire became allied with Simon Vouet, the first painter of Louis XIII . Links were also made between Antoine Grégoire and Jacques Sarazin, the King’s sculptor, and then with Michel Corneille, painter to the King. The famous painting by Simon Vouet hanging in the assembly hall of the Faculty of Pharmacy in Paris is probably the fruit of his collaboration with Jacques Grégoire, his brother-in-law and an erudite botanist. The other notable fact concerns the relations between Anne de Furnes, widow of Antoine Brulon, the rich apothecary to the King Antoine Brulon, and Molière, both in Paris and in the village of Auteuil. The other notable fact concerns the relations between Anne de Furnes, widow of Antoine Brulon, the rich apothecary to the King Antoine Brulon, and Molière, both in Paris and in the village of Auteuil.

ROCS: a Reproducibility Index and Confidence Score for Interaction Proteomics Studies

Directory of Open Access Journals (Sweden)

Dazard Jean-Eudes

2012-06-01

Full Text Available Abstract Background Affinity-Purification Mass-Spectrometry (AP-MS provides a powerful means of identifying protein complexes and interactions. Several important challenges exist in interpreting the results of AP-MS experiments. First, the reproducibility of AP-MS experimental replicates can be low, due both to technical variability and the dynamic nature of protein interactions in the cell. Second, the identification of true protein-protein interactions in AP-MS experiments is subject to inaccuracy due to high false negative and false positive rates. Several experimental approaches can be used to mitigate these drawbacks, including the use of replicated and control experiments and relative quantification to sensitively distinguish true interacting proteins from false ones. Methods To address the issues of reproducibility and accuracy of protein-protein interactions, we introduce a two-step method, called ROCS, which makes use of Indicator Prey Proteins to select reproducible AP-MS experiments, and of Confidence Scores to select specific protein-protein interactions. The Indicator Prey Proteins account for measures of protein identifiability as well as protein reproducibility, effectively allowing removal of outlier experiments that contribute noise and affect downstream inferences. The filtered set of experiments is then used in the Protein-Protein Interaction (PPI scoring step. Prey protein scoring is done by computing a Confidence Score, which accounts for the probability of occurrence of prey proteins in the bait experiments relative to the control experiment, where the significance cutoff parameter is estimated by simultaneously controlling false positives and false negatives against metrics of false discovery rate and biological coherence respectively. In summary, the ROCS method relies on automatic objective criterions for parameter estimation and error-controlled procedures. Results We illustrate the performance of our method by applying

Describing three-class task performance: three-class linear discriminant analysis and three-class ROC analysis

Science.gov (United States)

He, Xin; Frey, Eric C.

2007-03-01

Binary ROC analysis has solid decision-theoretic foundations and a close relationship to linear discriminant analysis (LDA). In particular, for the case of Gaussian equal covariance input data, the area under the ROC curve (AUC) value has a direct relationship to the Hotelling trace. Many attempts have been made to extend binary classification methods to multi-class. For example, Fukunaga extended binary LDA to obtain multi-class LDA, which uses the multi-class Hotelling trace as a figure-of-merit, and we have previously developed a three-class ROC analysis method. This work explores the relationship between conventional multi-class LDA and three-class ROC analysis. First, we developed a linear observer, the three-class Hotelling observer (3-HO). For Gaussian equal covariance data, the 3- HO provides equivalent performance to the three-class ideal observer and, under less strict conditions, maximizes the signal to noise ratio for classification of all pairs of the three classes simultaneously. The 3-HO templates are not the eigenvectors obtained from multi-class LDA. Second, we show that the three-class Hotelling trace, which is the figureof- merit in the conventional three-class extension of LDA, has significant limitations. Third, we demonstrate that, under certain conditions, there is a linear relationship between the eigenvectors obtained from multi-class LDA and 3-HO templates. We conclude that the 3-HO based on decision theory has advantages both in its decision theoretic background and in the usefulness of its figure-of-merit. Additionally, there exists the possibility of interpreting the two linear features extracted by the conventional extension of LDA from a decision theoretic point of view.

Witnessing Fukushima Secondhand: Collage, Archive and Travelling Memory in Jacques Ristorcelli’s Les Écrans

Directory of Open Access Journals (Sweden)

Benoît Crucifix

2016-02-01

Full Text Available Cultural memory in comics studies mostly seems to revolve around nonfictional graphic novels tackling major historical events. Drawing on recent trends in cultural memory studies, this paper focuses on Jacques Ristorcelli‘s 'Les Écrans' (2014 as an experimental counterpoint where memory is animated by the author’s use of collage. Delving into an ‘archive’ of heterogeneous elements, 'Les Écrans' borrows from old war comics in a way that reflexively constructs a discourse on the past of the medium and its memory. Through the analysis of Ristorcelli’s book, this paper highlights how collage can function in comics as a work of memory that reaches back to appropriative practices common to both readers and fine artists.  

The neutrino in all its states - Seminar dedicated to Jacques Bouchez - Slides of the presentations

International Nuclear Information System (INIS)

Spiro, M.; Pessard, H.; Rubbia, A.; Petcov, S.; Cousins, B.; Fechner, M.; Mezetto, M.

2011-01-01

The present scientific seminar, organized in the memory of Jacques Bouchez is centered on neutrino physics and presents the state of the art on experiments, on future projects and on the theory of neutrinos (oscillations and MSW effect). This document is made up of the slides of 7 presentations: 1) The achievements of J.Bouchez; 2) Reactor neutrino experiments from Bugey to double-Chooz (via RENO and Daya-Bay); 3) Neutrinos and accelerators: on the way toward the third flavor (NOMA, OPERA and T2K experiments); 4) Neutrino oscillations and MSW effect; 5) Some statistical questions in neutrino physics; 6) Long baseline oscillations: towards Japan future neutrino oscillation experiments; and 7) Next generation of neutrino oscillation experiments. (A.C.)

Receiver operating characteristic (ROC) curves and the definition of threshold levels to diagnose coronary artery disease on electrocardiographic stress testing. Part I: The use of ROC curves in diagnostic medicine and electrocardiographic markers of ischaemia.

Science.gov (United States)

Barnabei, Luca; Marazìa, Stefania; De Caterina, Raffaele

2007-11-01

A common problem in diagnostic medicine, when performing a diagnostic test, is to obtain an accurate discrimination between 'normal' cases and cases with disease, owing to the overlapping distributions of these populations. In clinical practice, it is exceedingly rare that a chosen cut point will achieve perfect discrimination between normal cases and those with disease, and one has to select the best compromise between sensitivity and specificity by comparing the diagnostic performance of different tests or diagnostic criteria available. Receiver operating characteristic (or receiver operator characteristic, ROC) curves allow systematic and intuitively appealing descriptions of the diagnostic performance of a test and a comparison of the performance of different tests or diagnostic criteria. This review will analyse the basic principles underlying ROC curves and their specific application to the choice of optimal parameters on exercise electrocardiographic (ECG) stress testing. Part I will focus on theoretical description and analysis along with reviewing the common problems related to the diagnosis of myocardial ischaemia by means of exercise ECG stress testing. Part II will be devoted to applying ROC curves to available diagnostic criteria through the analysis of ECG stress test parameters.

Souvenir d’ailleurs. Note sulla scrittura e le immagini di viaggio in Jacques Derrida - Souvenir d’ailleurs. Remarks on the prose and the travelling images in Jacques Derrida

Directory of Open Access Journals (Sweden)

Raoul Kirchmayr

2011-09-01

Full Text Available The travelling images produced by Jacques Derrida when he goes back to his native home in the suburbs of Alger after a trip to Moscow and a stay in Athens introduce the reader to the intricate theme of travelling and emotions. To go, to remain, to go back intertwine with memory, with memories: emotions are the travel, but the relations among them, analyzed with extraordinary sharpness lead us to the depth of the human soul. The article analyzes both the ethic dimension of being-on-a-trip and the exposure to the other and to its taking place as a possibility sprouting from the impossible and the incalculable. This is an event of experience and language at the same time. To be on a trip therefore coincides with a certain pragmatic of language in which the language of the other – that is the language in which I am spoken – can find a place in the language which is defined as our “own”

Dal carnalis concubitus all’heretica pravitate. Sesso, matrimonio ed eresia nel tribunale di Jacques Fournier (1318-1325

Directory of Open Access Journals (Sweden)

Irene Bueno

2009-07-01

Full Text Available Amore, sessualità e matrimonio sono tematiche ricorrenti nei documenti inquisitoriali due-trecenteschi ed entrano con forza nel registro di Jacques Fournier, vescovo-inquisitore di Pamiers (1318-1325. Il significato di questi racconti non si può comprendere senza chiarire quale interesse essi rivestissero agli occhi dell’autorità ecclesiastica: i rapporti adulterini, incestuosi, omosessuali di imputati e imputate sono in effetti mediati dalla figura di Fournier nell’ambito di una corte che sovrappone competenze vescovili e inquisitoriali. Collegando condotte ed affermazioni licenziose alle posizioni antimatrimoniali dei catari, il vescovo stabilisce in sede processuale un nesso fra carnalis concubitus extraconiugale ed heretica pravitate. Ogni trasgressione allo spazio sacro del matrimonio diventa indizio di eresia e contribuisce a disegnare un ritratto dissoluto e vizioso di eretici ed eretiche, funzionale al successo e alla popolarità della repressione.Love, sex, and marriage are recurring themes in inquisition records of the thirteenth and fourteenth centuries, and especially in the register of Jacques Fournier, bishop-inquisitor of Pamiers from 1318 to 1325. The significance of these confessions cannot be  understood without indicating the ecclesiastical authority’s interest: adultery, incest and homosexual relations of the accused are in fact mediated by Fournier within a court that superimposes episcopal and inquisitorial competences. Linking licentious conducts and libertine statements to the anti-matrimonial tenets of the Cathars, the bishop establishes, during the trial, a connection between sexual sin and heretical crime. Any transgression of the sacred space of marriage is understood to be an indication sign of heresy and contributes to depict a dissolute and vicious portrait of the heretical believers, which is ultimately functional to the success and popularity of repression.

Jacques Ellul’s “Anti-Democratic Economy:” Persuading Citizens and Consumers in the Information Society

Directory of Open Access Journals (Sweden)

Artur Matos Alves

2014-03-01

Full Text Available Jacques Ellul's thoughts on the increasingly conspicuous role of persuasion techniques bring to the fore the persuasive and normative effects of new communication techniques at the core of contemporary consumer/citizen culture, as well as the limits of that instrumental stance towards mediated human communication. By drawing insights from authors who shared some of Ellul's concerns, such as Frankfurt School theorists, Vance Packard and Ivan Illich, this paper explores this “normative invasion” of human life by technique as a feature of contemporary information technology politics, specifically in (1 the historical context of normative and material technological colonization, and (2 the intertwining of propaganda and information warfare in the current reshaping of information politics.

Causes of death of thoroughbred racehorses at Octavio Dupont Veterinary Hospital, Brazilian Jockey Club, Rio de Janeiro

Directory of Open Access Journals (Sweden)

Marsel C. Pereira

2012-03-01

Full Text Available There are few studies that approach the epidemiology of deaths in racehorses in a broad manner. The majority focus on a specific affection or procedure. Brazil does not have a program instituted for the monitoring of deaths of horses. By means of a descriptive study in association with a multivariate analysis method, an epidemiologic profile was determined for deaths related to musculoskeletal (MS, gastrointestinal (GI, respiratory (RES systems, neurologic origin (NEU and sudden death (SD for the years of 2002 to 2008, at the Octavio Dupont Veterinary Hospital-Rio de Janeiro (ODVH. Males comprised the majority of deaths and that deaths were related to, decreasing order, MS>GI>SD>NEU>RES, with respect to general mortality rate per large group of determined causes (TSPMr. The majority of deaths registered included horses aged four to five years (ID4-ID5. We observed the following correspondence relations: (3-year period = SM - ID>5 - SD; ID>5 - GI; ID4-5 - MS; SF - ID5 - GI; SF - ID5. The present study points out the importance and necessity of epidemiologic studies of lesions in horses, based on diagnosis for the recognition of predisposing factors and prevention.

Diagnostic tests’ decision-making rules based upon analysis of ROC-curves

Directory of Open Access Journals (Sweden)

Л. В. Батюк

2015-10-01

Full Text Available In this paper we propose the model which substantiates diagnostics decision making based on the analysis of Receiver Operating Characteristic curves (ROC-curves and predicts optimal values of diagnostic indicators of biomedical information. To assess the quality of the test result prediction the standard criteria of the sensitivity and specificity of the model were used. Values of these criteria were calculated for the cases when the sensitivity of the test was greater than specificity by several times, when the number of correct diagnoses was maximal, when the sensitivity of the test was equal to its specificity and the sensitivity of the test was several times greater than the specificity of the test. To assess the significance of the factor characteristics and to compare the prognostic characteristics of models we used mathematical modeling and plotting the ROC-curves. The optimal value of the diagnostic indicator was found to be achieved when the sensitivity of the test is equal to its specificity. The model was adapted to solve the case when the sensitivity of the test is greater than specificity of the test.

Statistical properties of a utility measure of observer performance compared to area under the ROC curve

Science.gov (United States)

Abbey, Craig K.; Samuelson, Frank W.; Gallas, Brandon D.; Boone, John M.; Niklason, Loren T.

2013-03-01

The receiver operating characteristic (ROC) curve has become a common tool for evaluating diagnostic imaging technologies, and the primary endpoint of such evaluations is the area under the curve (AUC), which integrates sensitivity over the entire false positive range. An alternative figure of merit for ROC studies is expected utility (EU), which focuses on the relevant region of the ROC curve as defined by disease prevalence and the relative utility of the task. However if this measure is to be used, it must also have desirable statistical properties keep the burden of observer performance studies as low as possible. Here, we evaluate effect size and variability for EU and AUC. We use two observer performance studies recently submitted to the FDA to compare the EU and AUC endpoints. The studies were conducted using the multi-reader multi-case methodology in which all readers score all cases in all modalities. ROC curves from the study were used to generate both the AUC and EU values for each reader and modality. The EU measure was computed assuming an iso-utility slope of 1.03. We find mean effect sizes, the reader averaged difference between modalities, to be roughly 2.0 times as big for EU as AUC. The standard deviation across readers is roughly 1.4 times as large, suggesting better statistical properties for the EU endpoint. In a simple power analysis of paired comparison across readers, the utility measure required 36% fewer readers on average to achieve 80% statistical power compared to AUC.

Item Strength Influences Source Confidence and Alters Source Memory zROC Slopes

Science.gov (United States)

Starns, Jeffrey J.; Ksander, John C.

2016-01-01

Increasing the number of study trials creates a crossover pattern in source memory zROC slopes; that is, the slope is either below or above 1 depending on which source receives stronger learning. This pattern can be produced if additional learning affects memory processes such as the relative contribution of recollection and familiarity to source…

Medical decision making tools: Bayesian analysis and ROC analysis

International Nuclear Information System (INIS)

Lee, Byung Do

2006-01-01

During the diagnostic process of the various oral and maxillofacial lesions, we should consider the following: 'When should we order diagnostic tests? What tests should be ordered? How should we interpret the results clinically? And how should we use this frequently imperfect information to make optimal medical decision?' For the clinicians to make proper judgement, several decision making tools are suggested. This article discusses the concept of the diagnostic accuracy (sensitivity and specificity values) with several decision making tools such as decision matrix, ROC analysis and Bayesian analysis. The article also explain the introductory concept of ORAD program

SAG/ROC-SCFβ-TrCP E3 Ubiquitin Ligase Promotes Pro-Caspase-3 Degradation as a Mechanism of Apoptosis Protection

Directory of Open Access Journals (Sweden)

Mingjia Tan

2006-12-01

Full Text Available Skp1-cullin-F-box protein (SCF is a multicomponent E3 ubiquitin (Ub ligase that ubiquitinates a number of important biologic molecules such as p27, β-catenin, and lκB for proteasomal degradation, thus regulating cell proliferation and survival. One SCF component, SAG/ROC2/Rbx2/Hrt2, a RING finger protein, was first identified as a redox-inducible protein, which, when overexpressed, inhibited apoptosis both in vitro and in vivo. We report here that sensitive to apoptosis gene (SAG, as well as its family member ROC1/Rbxi, bound to the proinactive form of caspase-3 (pro-caspase-3. Binding was likely mediated through F-box protein, β-transducin repeat-containing protein (β-TrCP, which binds to the first 38 amino acids of pro-caspase-3. Importantly, β-TrCP1 expression significantly shortened the protein half-life of pro-caspase-3, whereas expression of a dominant-negative β-TrCP1 mutant with the F-box domain deleted extended it. An in vitro ubiquitination assay showed that SAG/ROC-SCF -Trcp promoted ubiquitination of pro-caspase-3. Furthermore, endogenous levels of pro-caspase-3 were decreased by overexpression of SAG/ROC-SCFβ-TrCP E3 Ub ligases, but increased on siRNA silencing of SAG, regulator of cullin-1 (ROC1, or β-TrCPs, leading to increased apoptosis by etoposide and TNF-related apoptosis-inducing ligand through increased activation of caspase-3. Thus, pro-caspase-3 appears to be a substrate of SAG/ROC-SCFβ-TrCP E3 Ub ligase, which protects cells from apoptosis through increased apoptosis threshold by reducing the basal level of pro-caspase-3.

L’affaire de la Religieuse de Rivette (1965-1967 “The Nun”, a film by Jacques Rivette

Directory of Open Access Journals (Sweden)

Sabine Rousseau

2012-06-01

Full Text Available Suzanne Simonin, la religieuse de Diderot, film de Jacques Rivette, réalisateur lié aux Cahiers du cinéma et à la Nouvelle Vague, a été censuré par le pouvoir gaulliste en 1966. Quel est le rôle de l’Eglise catholique dans cette interdiction ? A l’intérieur de l’institution, les avis sont partagés. Le père Jean Pihan et Pierre Goursat de l’Office catholique du cinéma, de la radio et la télévision, ont œuvré à cette interdiction en mobilisant les religieuses de l’Union des supérieures majeures. Pour eux, la défense de la morale est une priorité absolue. Mais d’autres chrétiens comme Marc Oraison et Françoise Vandermeersch estiment au contraire que la censure est inutile et que les films doivent être appréciés pour leur valeur esthétique.Suzanne Simonin, la religieuse de Diderot, a film byJacques Rivette, a director connected with LaNouvelle Vague and Les cahiers du cinéma, was censored in 1966 under de Gaulle's presidency. What role did the CatholicChurch play in this decision? Among Christians, there were two different attitudes. Father Jean Pihan and Pierre Goursat from the Office catholique du cinéma, de la radio et de la télévision, rallied the nuns from the Union des supérieures majeures against the film. According to them, morality had to be saved. On the contrary, other Christians, such as Marc Oraison and Françoise Vandermeersch, thought that censorship was useless and that films must be appreciated for their aesthetic qualities.

XVI 'Jacques-Louis Lions' Spanish-French School on Numerical Simulation in Physics and Engineering

CERN Document Server

Roldán, Teo; Torrens, Juan

2016-01-01

This book presents lecture notes from the XVI ‘Jacques-Louis Lions’ Spanish-French School on Numerical Simulation in Physics and Engineering, held in Pamplona (Navarra, Spain) in September 2014. The subjects covered include: numerical analysis of isogeometric methods, convolution quadrature for wave simulations, mathematical methods in image processing and computer vision, modeling and optimization techniques in food processes, bio-processes and bio-systems, and GPU computing for numerical simulation. The book is highly recommended to graduate students in Engineering or Science who want to focus on numerical simulation, either as a research topic or in the field of industrial applications. It can also benefit senior researchers and technicians working in industry who are interested in the use of state-of-the-art numerical techniques in the fields addressed here. Moreover, the book can be used as a textbook for master courses in Mathematics, Physics, or Engineering.

ROC analysis of benefit and limitation in radiotherapy for cancer of the oral cavity

International Nuclear Information System (INIS)

Maciejewski, B.; Zajusz, A.

1993-01-01

The ROC (receiver operating characteristic) analysis of optimization of radiation treatment of cancer of oral cavity was carried out. Material of 210 patients with squamous cell carcinoma of the oral cavity was included into the study. Based on dose-response curves for tumor and late mucosal reactions, iso-utility curves and optimal k values were estimated. Optimal k values decreased from 0.792 to 0.584 with extension of overall treatment time from 35 to 49 days. This may suggest that the planning of additional dose to compensate tumor clonogens repopulation during prolonged treatment does not improve the therapeutic gain in radiotherapy for cancer of the oral cavity. The ROC is a useful model to estimate the optimal radiation treatment for a given tumor because it is independent of any arbitrary consensus or theoretical assumption. (author) 1 tab., 3 figs., 5 refs

História, arte, política: o conceito de regime estético da arte na obra de Jacques Rancière = History, art, politics: the concept of regime aesthetic work of Jacques Rancière

Directory of Open Access Journals (Sweden)

Voigt, André Fabiano

2013-01-01

Full Text Available O presente artigo pretende analisar o conceito de regime estético da arte na obra do filósofo Jacques Rancière como forma de pensar a produção artística contemporânea fora do viés representacionista, comum em boa parte das análises historiográficas contemporâneas. Rancière faz uma articulação inovadora entre história, arte e política, a qual procura evidenciar o caráter acontecimental da obra de arte, em comparação às análises representacionistas, que sempre vinculam a obra ao contexto histórico e à intencionalidade do autor

A New Economic and Political State of Play in the Energy Sector: On Jean-Pierre Hansen and Jacques Percebois, Energy. Economy and politics

International Nuclear Information System (INIS)

Lesourne, J.

2011-01-01

If there is one sector in which the state of play has changed radically over a few decades, it is the energy sector. It has been affected simultaneously by the prospect that the main fossil fuels will become exhausted, by the impact on our planet's climate of the consumption of this fossil energy (implying increased recourse to renewable sources) and by the rapid economic development of large nations consuming increasing quantities of energy. Energy-related policies (particularly economic and technological policies) are, in fact, being developed in an increasingly complex and international context, which is, at times, very difficult to grasp. Fortunately, two specialists in energy matters, Jean-Pierre Hansen and Jacques Percebois, have published a very comprehensive survey of this new economic and political state of play in the energy field: 'Energie. Economie et politiques' [Energy: Economics and Policies] (Brussels: De Boeck, 2010). It clearly is not possible here to go into all the questions they confront, but in this review Jacques Lesourne, who has read the book for Futuribles, clearly demonstrates its importance and presents the reader with the main facets of the work that make it a reference tool for all involved in this sector, including the most highly specialized. (author)

O mosaico antiglobalização visto sob o prisma de Jacques Rancière

Directory of Open Access Journals (Sweden)

Diego Azzi

2007-12-01

Full Text Available Este artigo tem por objetivo apresentar conceitos importantes do pensamento do filósofo francês Jacques Rancière, sobretudo a partir da noção de partilha do sensível. Com base na pesquisa de Mestrado realizada sobre os movimentos antiglobalização, são expostas hipóteses para a compreensão destes como produtores de inscrições dissensuais na ordem sensível policial, reatualizanclo a política em meio a um mosaico de modos de subjetivação e diferenças geracionais. Finalmente, são tecidas considerações acerca da importância do emprego do marco teórico de Rancière para o entendimento propriamente sociológico da política contemporânea.

A SEPARAÇÃO ENTRE ESFERA PÚBLICA E PRIVADA: UM CONFRONTO ENTRE JOHN LOCKE, JEAN-JACQUES ROUSSEAU E CAROLE PATEMAN

OpenAIRE

Cunha de Moura, Samantha Nagle

2014-01-01

RESUMO: O presente artigo busca problematizar a separação entre esfera pública e esfera privada, existente no modelo liberal burguês, como um substrato legitimador da imposição de papeis sociais e sexuais diferenciados para homens e mulheres. Para tanto, o trabalho confronta as ideias fundamentais do pensamento de John Locke e de Jean-Jacques Rousseau, teóricos liberais contratualistas do séc. XVII-XVIII, diante da teoria do contrato sexual da teórica feminista Carole Pateman. Palavras-cha...

Clinical relevance of the ROC and free-response paradigms for comparing imaging system efficacies

International Nuclear Information System (INIS)

Chakraborty, D. P.

2010-01-01

Observer performance studies are widely used to assess medical imaging systems. Unlike technical/engineering measurements observer performance include the entire imaging chain and the radiologist. However, the widely used receiver operating characteristic (ROC) method ignores lesion localisation information. The free-response ROC (FROC) method uses the location information to appropriately reward or penalise correct or incorrect localizations, respectively. This paper describes a method for improving the clinical relevance of FROC studies. The method consists of assigning appropriate risk values to the different lesions that may be present on a single image. A high-risk lesion is one that is critical to detect and act upon, and is assigned a higher risk value than a low-risk lesion, one that is relatively innocuous. Instead of simply counting the number of lesions that are detected, as is done in conventional FROC analysis, a risk-weighted count is used. This has the advantage of rewarding detections of high-risk lesions commensurately more than detections of lower risk lesions. Simulations were used to demonstrate that the new method, termed case-based analysis, results in a higher figure of merit for an expert who detects more high-risk lesions than a naive observer who detects more low-risk lesions, even though both detect the same total number of lesions. Conventional free-response analysis is unable to distinguish between the two types of observers. This paper also comments on the issue of clinical relevance of ROC analysis vs. FROC for tasks that involve lesion localisation. (authors)

iROCS: Integrated accident management framework for coping with beyond-design-basis external events

International Nuclear Information System (INIS)

Kim, Jaewhan; Park, Soo-Yong; Ahn, Kwang-Il; Yang, Joon-Eon

2016-01-01

Highlights: • An integrated mitigating strategy to cope with extreme external events, iROCS, is proposed. • The strategy aims to preserve the integrity of the reactor vessel as well as core cooling. • A case study for an extreme damage state is performed to assess the effectiveness and feasibility of candidate mitigation strategies under an extreme event. - Abstract: The Fukushima Daiichi accident induced by the Great East Japan earthquake and tsunami on March 11, 2011, poses a new challenge to the nuclear society, especially from an accident management viewpoint. This paper presents a new accident management framework called an integrated, RObust Coping Strategy (iROCS) to cope with beyond-design-basis external events (BDBEEs). The iROCS approach is characterized by classification of various plant damage conditions (PDCs) that might be impacted by BDBEEs and corresponding integrated coping strategies for each of PDCs, aiming to maintain and restore core cooling (i.e., to prevent core damage) and to maintain the integrity of the reactor pressure vessel if it is judged that core damage may not be preventable in view of plant conditions. From a case study for an extreme damage condition, it showed that candidate accident management strategies should be evaluated from the viewpoint of effectiveness and feasibility against accident scenarios and extreme damage conditions of the site, especially when employing mobile or portable equipment under BDBEEs within the limited time available to achieve desired goals such as prevention of core damage as well as a reactor vessel failure.

CERN 50th Anniversary Official Celebration : welcome by CERN Director General Robert Aymar to French President Jacques Chirac, to King of Spain Juan Carlos and to President of the Swiss Confederation Joseph Deiss

CERN Multimedia

Patrice Loiez; Michel Blanc

2004-01-01

CERN 50th Anniversary Official Celebration : welcome by CERN Director General Robert Aymar to French President Jacques Chirac, to King of Spain Juan Carlos and to President of the Swiss Confederation Joseph Deiss

Separating Mnemonic Process From Participant and Item Effects in the Assessment of ROC Asymmetries

NARCIS (Netherlands)

Pratte, Michael S.; Rouder, Jeffrey N.; Morey, Richard D.

One of the most influential findings in the study of recognition memory is that receiver operating characteristic (ROC) curves are asymmetric about the negative diagonal. This result has led to the rejection of the equal-variance signal detection model of recognition memory and has provided

Speech of the French President Jacques Chirac delivered on the centenary of the discovery of radioactivity

International Nuclear Information System (INIS)

Anon.

1998-01-01

In this speech, the President of France Jacques Chirac outlines the personality of the great scientists Henri Becquerel, Pierre and Marie Curie, and highlights their hard work and struggle to make science progress. Science always appears as a construction wonderfully logical but behind this facade, the daily life of research workers is made up of doubt, multiple choices, dead ends, errors and misinterpretations. The President wishes the nation to reach a perfect partnership with its scientific community. Science should be a source of inspiration for the industrial world but also a valuable help to solve present and future problems. Because of the universality of most problems, science has always favoured the cooperation between states. This cooperation should be turned into solidarity because whoever we are we live in the same world. (A.C.)

Glutamate dehydrogenase (RocG) in Bacillus licheniformis WX-02: Enzymatic properties and specific functions in glutamic acid synthesis for poly-γ-glutamic acid production.

Science.gov (United States)

Tian, Guangming; Wang, Qin; Wei, Xuetuan; Ma, Xin; Chen, Shouwen

2017-04-01

Poly-γ-glutamic acid (γ-PGA), a natural biopolymer, is widely used in cosmetics, medicine, food, water treatment, and agriculture owing to its features of moisture sequestration, cation chelation, non-toxicity and biodegradability. Intracellular glutamic acid, the substrate of γ-PGA, is a limiting factor for high yield in γ-PGA production. Bacillus subtilis and Bacillus licheniformis are both important γ-PGA producing strains, and B. subtilis synthesizes glutamic acid in vivo using the unique GOGAT/GS pathway. However, little is known about the glutamate synthesis pathway in B. licheniformis. The aim of this work was to characterize the glutamate dehydrogenase (RocG) in glutamic acid synthesis from B. licheniformis with both in vivo and in vitro experiments. By re-directing the carbon flux distribution, the rocG gene deletion mutant WX-02ΔrocG produced intracellular glutamic acid with a concentration of 90ng/log(CFU), which was only 23.7% that of the wild-type WX-02 (380ng/log(CFU)). Furthermore, the γ-PGA yield of mutant WX-02ΔrocG was 5.37g/L, a decrease of 45.3% compared to the wild type (9.82g/L). In vitro enzymatic assays of RocG showed that RocG has higher affinity for 2-oxoglutarate than glutamate, and the glutamate synthesis rate was far above degradation. This is probably the first study to reveal the glutamic acid synthesis pathway and the specific functions of RocG in B. licheniformis. The results indicate that γ-PGA production can be enhanced through improving intracellular glutamic acid synthesis. Copyright © 2017 Elsevier Inc. All rights reserved.

ROC-king onwards: intraepithelial lymphocyte counts, distribution & role in coeliac disease mucosal interpretation.

Science.gov (United States)

Rostami, Kamran; Marsh, Michael N; Johnson, Matt W; Mohaghegh, Hamid; Heal, Calvin; Holmes, Geoffrey; Ensari, Arzu; Aldulaimi, David; Bancel, Brigitte; Bassotti, Gabrio; Bateman, Adrian; Becheanu, Gabriel; Bozzola, Anna; Carroccio, Antonio; Catassi, Carlo; Ciacci, Carolina; Ciobanu, Alexandra; Danciu, Mihai; Derakhshan, Mohammad H; Elli, Luca; Ferrero, Stefano; Fiorentino, Michelangelo; Fiorino, Marilena; Ganji, Azita; Ghaffarzadehgan, Kamran; Going, James J; Ishaq, Sauid; Mandolesi, Alessandra; Mathews, Sherly; Maxim, Roxana; Mulder, Chris J; Neefjes-Borst, Andra; Robert, Marie; Russo, Ilaria; Rostami-Nejad, Mohammad; Sidoni, Angelo; Sotoudeh, Masoud; Villanacci, Vincenzo; Volta, Umberto; Zali, Mohammad R; Srivastava, Amitabh

2017-12-01

Counting intraepithelial lymphocytes (IEL) is central to the histological diagnosis of coeliac disease (CD), but no definitive 'normal' IEL range has ever been published. In this multicentre study, receiver operating characteristic (ROC) curve analysis was used to determine the optimal cut-off between normal and CD (Marsh III lesion) duodenal mucosa, based on IEL counts on >400 mucosal biopsy specimens. The study was designed at the International Meeting on Digestive Pathology, Bucharest 2015. Investigators from 19 centres, eight countries of three continents, recruited 198 patients with Marsh III histology and 203 controls and used one agreed protocol to count IEL/100 enterocytes in well-oriented duodenal biopsies. Demographic and serological data were also collected. The mean ages of CD and control groups were 45.5 (neonate to 82) and 38.3 (2-88) years. Mean IEL count was 54±18/100 enterocytes in CD and 13±8 in normal controls (p=0.0001). ROC analysis indicated an optimal cut-off point of 25 IEL/100 enterocytes, with 99% sensitivity, 92% specificity and 99.5% area under the curve. Other cut-offs between 20 and 40 IEL were less discriminatory. Additionally, there was a sufficiently high number of biopsies to explore IEL counts across the subclassification of the Marsh III lesion. Our ROC curve analyses demonstrate that for Marsh III lesions, a cut-off of 25 IEL/100 enterocytes optimises discrimination between normal control and CD biopsies. No differences in IEL counts were found between Marsh III a, b and c lesions. There was an indication of a continuously graded dose-response by IEL to environmental (gluten) antigenic influence. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

Análise TG-ROC de testes de imunofluorescência no diagnóstico de leishmaniose visceral canina Análisis TG-ROC de pruebas de inmunofluorescencia en el diagnóstico de leishmaniasis visceral canina TG-ROC analysis of immunofluorescence assays in canine visceral leishmaniasis diagnosis

Directory of Open Access Journals (Sweden)

Rita Maria da Silva

2009-12-01

Full Text Available OBJETIVO: Analisar a acurácia do diagnóstico de dois protocolos de imunofluorescência indireta para leishmaniose visceral canina. MÉTODOS: Cães provenientes de inquérito soroepidemiológico realizado em área endêmica nos municípios de Araçatuba e de Andradina, na região noroeste do estado de São Paulo, em 2003, e área não endêmica da região metropolitana de São Paulo, foram utilizados para avaliar comparativamente dois protocolos da reação de imunofluorescência indireta (RIFI para leishmaniose: um utilizando antígeno heterólogo Leishmania major (RIFI-BM e outro utilizando antígeno homólogo Leishmania chagasi (RIFI-CH. Para estimar acurácia utilizou-se a análise two-graph receiver operating characteristic (TG-ROC. A análise TG-ROC comparou as leituras da diluição 1:20 do antígeno homólogo (RIFI-CH, consideradas como teste referência, com as diluições da RIFI-BM (antígeno heterólogo. RESULTADOS: A diluição 1:20 do teste RIFI-CH apresentou o melhor coeficiente de contingência (0,755 e a maior força de associação entre as duas variáveis estudadas (qui-quadrado=124,3, sendo considerada a diluição-referência do teste nas comparações com as diferentes diluições do teste RIFI-BM. Os melhores resultados do RIFI-BM foram obtidos na diluição 1:40, com melhor coeficiente de contingência (0,680 e maior força de associação (qui-quadrado=80,8. Com a mudança do ponto de corte sugerido nesta análise para a diluição 1:40 da RIFI-BM, o valor do parâmetro especificidade aumentou de 57,5% para 97,7%, embora a diluição 1:80 tivesse apresentado a melhor estimativa para sensibilidade (80,2% com o novo ponto de corte. CONCLUSÕES: A análise TG-ROC pode fornecer importantes informações sobre os testes de diagnósticos, além de apresentar sugestões sobre pontos de cortes que podem melhorar as estimativas de sensibilidade e especificidade do teste, e avaliá-los a luz do melhor custo

Utopia as Politics of Emancipation: Miguel Abensour, Jacques Rancière and the Legacies of Utopian Socialism

Directory of Open Access Journals (Sweden)

Federico Tomasello

2017-07-01

Full Text Available Starting from Miguel Abensour’s contribution, the article addresses an interpretation of the concept of utopia aiming to stress its political nature and to place it within the movement of emancipation emerged throughout the nineteenth century. The first part of the article points out four fundamental dimensions of the Abensourian concept of utopia, whilst the second part aims to locate it within the broader context of the French Marxism debates and, in this way, to link it with Jacques Rancière’s thought of utopia. The conclusion provides a critical interpretation of the considered idea of utopia and maps out the political-intellectual environment emerged around that idea in France at the end of the 1990s.

Life-Long Cyberlearning System: A Pilot Project for the "Learning Society" in the ROC.

Science.gov (United States)

Han, Huei-Wen; Wang, Yen-Chao

1999-01-01

Provides an overview of the implementation of lifelong learning in Taiwan, Republic of China (ROC) as part of its educational reform policy and describes a pilot project, the Lifelong Cyberlearning System. Highlights include planning architecture, Web-based learning technology, professional education, industrial and corporate assistance, and…

Optimizing area under the ROC curve using semi-supervised learning.

Science.gov (United States)

Wang, Shijun; Li, Diana; Petrick, Nicholas; Sahiner, Berkman; Linguraru, Marius George; Summers, Ronald M

2015-01-01

Receiver operating characteristic (ROC) analysis is a standard methodology to evaluate the performance of a binary classification system. The area under the ROC curve (AUC) is a performance metric that summarizes how well a classifier separates two classes. Traditional AUC optimization techniques are supervised learning methods that utilize only labeled data (i.e., the true class is known for all data) to train the classifiers. In this work, inspired by semi-supervised and transductive learning, we propose two new AUC optimization algorithms hereby referred to as semi-supervised learning receiver operating characteristic (SSLROC) algorithms, which utilize unlabeled test samples in classifier training to maximize AUC. Unlabeled samples are incorporated into the AUC optimization process, and their ranking relationships to labeled positive and negative training samples are considered as optimization constraints. The introduced test samples will cause the learned decision boundary in a multidimensional feature space to adapt not only to the distribution of labeled training data, but also to the distribution of unlabeled test data. We formulate the semi-supervised AUC optimization problem as a semi-definite programming problem based on the margin maximization theory. The proposed methods SSLROC1 (1-norm) and SSLROC2 (2-norm) were evaluated using 34 (determined by power analysis) randomly selected datasets from the University of California, Irvine machine learning repository. Wilcoxon signed rank tests showed that the proposed methods achieved significant improvement compared with state-of-the-art methods. The proposed methods were also applied to a CT colonography dataset for colonic polyp classification and showed promising results.

La estética y su dimensión política según Jacques Rancière

Directory of Open Access Journals (Sweden)

Ricardo Javier Arcos Palma

2009-10-01

Full Text Available La filosofía de Jacques Rancière acuerda un lugar importante a la estética. Esta última se redefine desde un punto de vista político y ético, no como disciplina, sino como régimen de lo sensible. el presente ensayo pretende acercarse a lo esencial de la estética, su redefinición y su dimensión política, problematizando múltiples relaciones entre política, ética y estética, y poniendo en tensión una lectura crítica de la obra Rancière con otras perspectivas que unen o separan dichos ámbitos.

From Mephistopheles to Isaiah: Jacques Loeb, technical biology and war.

Science.gov (United States)

Fangerau, Heiner

2009-04-01

In 1917, the German-American scientist Jacques Loeb (1859-1924) published a short essay, entitled 'Biology and War', that summarized his disagreement with World War I. He was deeply saddened by the break-up of the international scientific community as a consequence of the actions of bellicose politicians. These actions were in direct opposition to his efforts to promote social reform, mechanistic biology and scientific internationalism. The aim of this paper is to examine Loeb's activities aimed at these efforts before, during and after the war. It attempts to explain how Loeb's scientific work was formed, what was special about it and why it was both successful and attacked. Particular emphasis is placed on how Loeb reacted to the War and the subsequent forced disintegration of his international scientific network. Loeb's attempts to integrate his interpretation of biology into post-war Europe's approach to the life sciences is analysed in connection with his social commitment. It is argued that his emigration to the USA, the circumstances of World War I, the reaction of his German colleagues to it and the demolition of the international scientific community changed: (1) Loeb's feelings towards his old home; (2) the direction of his scientific endeavours; and (3) his engagement in science politics. His correspondence with eminent scientists from all over the world serves as a key to Loeb's efforts in the context of the social elements of scientific networks and perceptions.

A responsabilidade de traduzir o in-traduzível: Jacques Derrida e o desejo de [la] tradução The responsibility of translating the un-translatable: Jacques Derrida and the desire for [la] translation

Directory of Open Access Journals (Sweden)

Paulo Ottoni

2003-01-01

Full Text Available Como pensar a responsabilidade do tradutor/a que se encontra "entre" a diferença de dois sistemas lingüísticos e no "meio" das várias línguas que compõem as línguas envolvidas na tradução? (P. Ottoni. Qual o papel do tradutor ao ter que (conviver com sua língua materna e o idioma do outro? Procurarei discutir estas duas questões para pensar a responsabilidade de traduzir o in-traduzível. Parto de duas hipóteses: 1- falar idiomaticamente seu idioma é o que se chama língua materna, o que não se apropria; e, acolher o outro na sua língua é levar em conta naturalmente seu idioma (J. Derrida; 2 - O tradutor, neste corpo-a-corpo com a língua e o idiomático, está preso numa dupla responsabilidade na operação de tradução: frente ao in-traduzível do idioma, e tendo que apreender de outro modo esta intraduzibilidade. Em resumo, como refletir sobre a responsabilidade de traduzir o in-traduzível Jacques Derrida?How should one consider the responsibility of the translator, who is located "between" the differences of two linguistic systems and "in the middle" of the various idioms constitute each of the languages involved in the translation? (P. Ottoni. What is the role of the translator in inter-acting with both his/her mother tongue and the idiom of the other? These two questions will be discussed in order to reflect on the responsibility of translating the un-translatable. Two hypotheses orient the paper: 1 - an idiom spoken idiomatically is known as the mother tongue and is not appropriated, so that accommodating the other in one's own language automatically considers his/her idiom (J. Derrida and 2 - face-to-face with language and its idioms, the translator is trapped in a double (responsibility bind; faced with something which cannot be translated, he/she is forced to perceive it in another way. In conclusion, how should one consider the responsibility of translating the un-translatable Jacques Derrida?

La antropología de Jacques Maritain: problemas y virtualidades de la distinción individuo - persona

Directory of Open Access Journals (Sweden)

López-Casquete de Prado, Manuel

2014-10-01

Full Text Available Modern academic thinking in fields as diverse as economics, sociology, bioethics, law or politics frequently calls for a reconfiguration of our public institutions from a more humanising anthropological perspective to make them more conducive to people’s happiness. Among the approaches used to focus on this demand, the Thomist distinction between the individual and the persona has come to the fore. One of the most systematic and enlightening theories in this regard is that of French philosopher Jacques Maritain. In this paper we analyse his anthropological approach to conclude that, with positive and negative aspects, it may be of great interest approach to deepen this social debate and so help develop a new anthropological theory more geared towards people and their goals.Una de las reivindicaciones más repetidas en la actual reflexión académica en ámbitos tan dispares como la economía, la sociología, la bioética, el derecho o la política, plantea la necesidad de reconfigurar nuestras instituciones desde una antropología más humanizadora y, por tanto, más orientada a posibilitar la felicidad de la población. Entre las distintas aproximaciones teóricas utilizadas para concretar esta reivindicación, cada vez cobra más fuerza la que pretende recuperar y actualizar la clásica distinción tomista entre individuo y persona. Una de las formulaciones más sistemáticas y clarificadoras a este respecto es la ofrecida por el filósofo francés Jacques Maritain. En este artículo se realiza un análisis crítico de su planteamiento antropológico y se concluye que, con luces y sombras, el sistema de Maritain puede ser de gran interés para profundizar en este debate social y contribuir así a reelaborar nuestras bases antropológicas de modo que podamos alumbrar una sociedad a la medida de la persona y sus fines.

Abismos do reconhecimento: o legado sociofilosófico de Jean-Jacques Rousseau = Abysses of recognition: the sociophilosophical legacy of Jean-Jacques Rousseau

Directory of Open Access Journals (Sweden)

Honneth, Axel

2013-01-01

Full Text Available O texto se ocupa com a questão da interpretação da obra de Jean-Jacques Rousseau, em particular com suas referências sobre a dependência constitutiva em relação aos outros. Vista negativamente na crítica da cultura, mas positivamente nos esboços de um contrato social, o lugar dessa dependência constitutiva da confirmação e estima por parte dos outros está vinculada ao significado dado ao “amor próprio” nos diferentes textos; mas ela abre a possibilidade de interpretar Rousseau como um teórico do reconhecimento. O autor acompanha Rousseau em seu desenvolvimento teórico até o ponto em que ele se tornou consciente das exigências de uma forma sociocontratual, igualitária do reconhecimento mútuo, para depois expor a enorme influência que a ideia bipolar de Rousseau a respeito do reconhecimento social exerceu sobre a teoria social da modernidade: em sua variante negativa, a profunda necessidade dos seres humanos de sobrepujar os respectivos cossujeitos no grau de estima social, reinterpretada por Kant como sendo a força motriz do progresso cultural e social, e em sua variante positiva, o respeito mútuo entre iguais, desenvolvido por Fichte e Hegel na direção de uma teoria do reconhecimento relacionada ao direito e à moralidade. No final, Honneth discute o ceticismo com que Rousseau sempre viu a dependência de outros contida no “amor próprio”, deixando sem solução definitiva a tensão entre a ideia estoica de uma independência pessoal de toda avaliação alheia e a ideia intersubjetivista de uma profunda dependência do outro. (Resumo do editor

Separating Mnemonic Process from Participant and Item Effects in the Assessment of ROC Asymmetries

Science.gov (United States)

Pratte, Michael S.; Rouder, Jeffrey N.; Morey, Richard D.

2010-01-01

One of the most influential findings in the study of recognition memory is that receiver operating characteristic (ROC) curves are asymmetric about the negative diagonal. This result has led to the rejection of the equal-variance signal detection model of recognition memory and has provided motivation for more complex models, such as the…

MODELING URBAN DYNAMICS USING RANDOM FOREST: IMPLEMENTING ROC AND TOC FOR MODEL EVALUATION

Directory of Open Access Journals (Sweden)

M. Ahmadlou

2016-06-01

Full Text Available The importance of spatial accuracy of land use/cover change maps necessitates the use of high performance models. To reach this goal, calibrating machine learning (ML approaches to model land use/cover conversions have received increasing interest among the scholars. This originates from the strength of these techniques as they powerfully account for the complex relationships underlying urban dynamics. Compared to other ML techniques, random forest has rarely been used for modeling urban growth. This paper, drawing on information from the multi-temporal Landsat satellite images of 1985, 2000 and 2015, calibrates a random forest regression (RFR model to quantify the variable importance and simulation of urban change spatial patterns. The results and performance of RFR model were evaluated using two complementary tools, relative operating characteristics (ROC and total operating characteristics (TOC, by overlaying the map of observed change and the modeled suitability map for land use change (error map. The suitability map produced by RFR model showed 82.48% area under curve for the ROC model which indicates a very good performance and highlights its appropriateness for simulating urban growth.

The confined hydrogenoid ion in non-relativistic quantum electrodynamics

CERN Document Server

Amour, L

2006-01-01

We consider a system of a nucleus with an electron together with the quantized electromagnetic field. Instead of fixing the nucleus, the system is confined by its center of mass. This model is used in theoretical physics to explain the Lamb-Dicke and the M\\"ossbauer effects (see [CTDRG]). When an ultraviolet cut-off is imposed we initiate the spectral analysis of the Hamiltonian describing the system and we derive the existence of a ground state. This is achieved without conditions on the fine structure constant. [CTDRG] C. Cohen-Tannoudji, J. Dupont-Roc and G. Grynberg. Processus d'interaction entre photons et atomes. Edition du CNRS, 2001.

A relação entre estética e política na obra de Jacques Rancière

OpenAIRE

Pereira, Pedro Danilo Galdino Vitor

2016-01-01

O presente trabalho discutirá a relação entre estética e política na obra do filósofo francês Jacques Rancière, a partir, principalmente, do conceito de partilha do sensível. Para Rancière há um campo comum que une essas duas esferas do saber humano, a estética primeira que se refere a um a priori da sensibilidade. Neste sentido, tanto a arte quanto a política podem intervir neste tecido da sensibilidade, reconfigurando a partilha do sensível de maneira dissensual. Há, segundo o autor, uma di...

THE IMPACT OF THE CONVERSION OF HISTORICAL COST TO CORRECTED CURRENT COST ON RETURN ON ASSETS AND EQUITY: ANALYSIS FROM DUPONT SYSTEM.

Directory of Open Access Journals (Sweden)

Roberto Silva da Penha

2013-12-01

Full Text Available Historical cost is the most used form of accounting valuation, but it does not reflect the effect of currency in time. The Theory of Corrected Current Cost, albeit with limitations, may show evidence of real and relevant accounting information of the entity. In this context, a question can be formulated: What is the impact of the conversion of historical cost to corrected current cost in return on assets and equity? In order to answer this question, the DuPont system was applied in a model company as a tool for analysis. The results showed that the return of assets at historical cost and corrected current cost were 12.11% and 3.14%, respectively, a decrease of 74.07%, and the result of the return on equity, the historical cost and corrected current cost were 20.59% and 4.96%, respectively, decreased 75.91%. Based on these variations it is observed that the impacts of the conversion of the corrected current cost were significant,confirming the importance of the adoption of this practice, whenever possible.

THE ROLE AND PLACE OF LOGISTIC REGRESSION AND ROC ANALYSIS IN SOLVING MEDICAL DIAGNOSTIC TASK

Directory of Open Access Journals (Sweden)

S. G. Grigoryev

2016-01-01

Full Text Available Diagnostics, equally with  prevention and  treatment, is a basis of medical science and practice. For its history the medicine  has accumulated a great variety  of diagnostic methods for different diseases and  pathologic conditions. Nevertheless, new  tests,  methods and  tools are being  developed and recommended to application nowadays. Such  indicators as sensitivity and  specificity which  are defined on the basis  of fourfold contingency  tables   construction or  ROC-analysis method with  ROC  – curve  modelling (Receiver operating characteristic are used  as the  methods to estimate the  diagnostic capability. Fourfold  table  is used  with  the purpose to estimate the method which confirms or denies the diagnosis, i.e. a quality indicator. ROC-curve, being a graph, allows making the estimation of model  quality by subdivision of two classes  on the  basis  of identifying the  point  of cutting off a continuous or discrete quantitative attribute.The method of logistic regression technique is introduced as a tool to develop some  mathematical-statistical forecasting model  of probability of the event the researcher is interested in if there are two possible variants of the outcome. The method of ROC-analysis is chosen and described in detail as a tool to estimate the  model  quality. The capabilities of the named methods are demonstrated by a real example of creation  and  efficiency estimation (sensitivity and  specificity of a forecasting model  of probability of complication development in the form of pyodermatitis in children with  atopic dermatitis.

The role of scintimammography and mammography in recurrent breast cancer. Evaluation of their accuracy using ROC curves

International Nuclear Information System (INIS)

Kolasinska, A.D.; Buscombe, J.R.; Cwikla, J.B.; Hilson, A.J.W.; Holloway, B.; Parbhoo, S.P.; Davidson, T.

2001-01-01

With the increasing demand for breast conservation surgery, the probability of recurrent tumour within the breast increases. Traditionally x-ray mammography (XMM) was used to assess the post-surgical breast, but post-surgery and radiotherapy changes have reduced the accuracy of this method. Scintimammography (SMM) has also been proposed and appears to be more accurate than XMM. A total of 101 women received Tc99m MIBI SMM and 88 had a subsequent XMM. There were 142 sites suspected of loco-regional recurrence breast cancer. During the study the patients did not receive any treatment other then hormonotherapy. SMM was performed by the standard Diggles-Khalkhali method and XMM was performed using standard 2 views. Analysis was performed and the results of each type of imaging compared with histology. In the ROC curve analysis 5 points of certainty were used: from 1 being definitely normal to 5 being definitely cancer; grades 4 and 5 were counted as positive. The overall sensitivity value of SMM was 84% and specificity was 85%, compared with a sensitivity of 52% for XMM and a specificity of 84%. Analysis of areas under ROC curves provides statistically significant difference between SMM and XMM (p < 0.05). Combining the two tests did not significantly improve the diagnostic accuracy of sequence imaging over SMM. ROC curve analysis demonstrates that scintimammography should be the primary investigation in suspected local recurrence following breast conservation surgery. (author)

Beyond ROC Curvature: Strength Effects and Response Time Data Support Continuous-Evidence Models of Recognition Memory

Science.gov (United States)

Dube, Chad; Starns, Jeffrey J.; Rotello, Caren M.; Ratcliff, Roger

2012-01-01

A classic question in the recognition memory literature is whether retrieval is best described as a continuous-evidence process consistent with signal detection theory (SDT), or a threshold process consistent with many multinomial processing tree (MPT) models. Because receiver operating characteristics (ROCs) based on confidence ratings are…

Individual IOL Surface Topography Analysis by the WaveMaster Reflex UV

Directory of Open Access Journals (Sweden)

Marc Kannengießer

2013-01-01

Full Text Available Purpose. In order to establish inspection routines for individual intraocular lenses (IOLs, their surfaces have to be measured separately. Currently available measurement devices lack this functionality. The purpose of this study is to evaluate a new topography measurement device based on wavefront analysis for measuring individual regular and freeform IOL surfaces, the “WaveMaster Reflex UV” (Trioptics, Wedel, Germany. Methods. Measurements were performed on IOLs with increasingly complex surface geometries: spherical surfaces, surfaces modelled by higher-order Zernike terms, and freeform surfaces from biometrical patient data. Two independent parameters were measured: the sample’s radius of curvature (ROC and its residual (difference of sample topography and its best-fit sphere. We used a quantitative analysis method by calculating the residuals’ root-mean-square (RMS and peak-to-Valley (P2V values. Results. The sample’s best-fit ROC differences increased with the sample’s complexity. The sample’s differences of RMS values were 80 nm for spherical surfaces, 97 nm for higher-order samples, and 21 nm for freeform surfaces. Graphical representations of both measurement and design topographies were recorded and compared. Conclusion. The measurements of spherical surfaces expectedly resulted in better values than those of freeform surfaces. Overall, the wavefront analysing method proves to be an effective method for evaluating individual IOL surfaces.

Receiver operating characteristic (ROC) curves and the definition of threshold levels to diagnose coronary artery disease on electrocardiographic stress testing. Part II: the use of ROC curves in the choice of electrocardiographic stress test markers of ischaemia.

Science.gov (United States)

Marazìa, Stefania; Barnabei, Luca; De Caterina, Raffaele

2008-01-01

A common problem in diagnostic medicine, when performing a diagnostic test, is to obtain an accurate discrimination between 'normal' cases and cases with disease, owing to the overlapping distributions of these populations. In clinical practice, it is exceedingly rare that a chosen cut point will achieve perfect discrimination between normal cases and those with disease, and one has to select the best compromise between sensitivity and specificity by comparing the diagnostic performance of different tests or diagnostic criteria available. Receiver operating characteristic (or receiver operator characteristic, ROC) curves allow systematic and intuitively appealing descriptions of the diagnostic performance of a test and a comparison of the performance of different tests or diagnostic criteria. This review will analyse the basic principles underlying ROC curves and their specific application to the choice of optimal parameters on exercise electrocardiographic stress testing. Part II will be devoted to the comparative analysis of various parameters derived from exercise stress testing for the diagnosis of underlying coronary artery disease.

El programa de investigación propuesto por Jacques Lacan en el año 1966: de la verdad como causa para el sujeto

Directory of Open Access Journals (Sweden)

Jaime Iván Hernández España

2014-07-01

Full Text Available In 1966, the psychoanalyst Jacques Lacan publishes Écrits setting an antecedent for his teachings. We consider that this antecedent leaves a very specific proposal for psychoanalysis and a field where the psychoanalyst can make its practice possible: truth as a cause to the subject. However, Lacan warns, from a psychoanalytical science perspective, that we must resist other ways of relationship with truth as a cause. Thus, from his scientific obedience and through a structuralist definition, Lacan also approaches other fields outside the jurisdiction of psychoanalysis: magic, religion, and science.

Additional diagnostic value of 99Tcm-MIBI imaging over 'cold' nodules in 99Tcm thyroid imaging proved by ROC analysis

International Nuclear Information System (INIS)

Mei Ping; Qin Yongde; Wang Saigang; Ruxianguli; Baya; Lv Jie; Xie Bing; Sun Xiaoyan

2007-01-01

Objective: More studies have found that 99 Tc m -MIBI thyroid imaging may provide more differential diagnostic value than traditional 99 Tc m O 4 - thyroid imaging. This study attempted to analyze the receiver operating characteristic (ROC) curves to verify the additional diagnostic value of 99 Tc m -MIBI over 99 Tc m O 4 - thyroid imaging in the differentiation of the 'cold' nodules. Methods: Sixty-eight patients initially diagnosed with 'cold' nodules in 99 Tc m O 4 - thyroid scintigraphy were selected for further 99 Tc m -MIBI thyroid imaging at early (15 min after 99 Tc m -MIBI intravenous injection, ER) and delayed phase (2 h after injection, DR). Semi-quantitative analysis was performed using tumor/normal tissue (T/N) ratio both at ER and DR, with 0.8 defined as the threshold for differential diagnoses. In ROC curves analyses, the ratios from tumor/submaxillary gland (T/S) and tumor/heart (T/H) were derived to obtain the most proper differential diagnostic thresholds. Results: Of all patients with the 'cold' nodules, only eight cases were finally diagnosed on pathology with thyroid malignancy, while other 60 were benign. For differential diagnoses, the sensitivity, specificity and accuracy of semi-quantitative 99 Tc m -MIBI thyroid imaging were 100.0%, 76.7% and 79.4% respectively. However, with thresholds of T/N=0.995, T/S=0.995, T/H=1.005 derived from ROC curves for DR 99 Tc m -MIBI imaging, the differential diagnostic sensitivities were 100.0%, 87.5%, 75.0% and the specificities were 90.0%, 85.0%, 83.3% respectively. The areas under the ROC curves were 0.949, 0.876 and 0. 867 respectively for DR, all significantly larger than those of ER. Statistical difference was also evident between threshold values of 0.8 and 0.995 (χ 2 =6.125, P 99 Tc m -MIBI thyroid imaging provide additional diagnostic value over 99 Tc m O 4 - thyroid imaging for the differentiation of the 'cold' nodules. For 99 Tc m -MIBI thyroid imaging, DR is more valuable than ER in the ROC

Application of three-class ROC analysis to task-based image quality assessment of simultaneous dual-isotope myocardial perfusion SPECT (MPS).

Science.gov (United States)

He, Xin; Song, Xiyun; Frey, Eric C

2008-11-01

The diagnosis of cardiac disease using dual-isotope myocardial perfusion SPECT (MPS) is based on the defect status in both stress and rest images, and can be modeled as a three-class task of classifying patients as having no, reversible, or fixed perfusion defects. Simultaneous acquisition protocols for dual-isotope MPS imaging have gained much interest due to their advantages including perfect registration of the (201)Tl and (99m)Tc images in space and time, increased patient comfort, and higher clinical throughput. As a result of simultaneous acquisition, however, crosstalk contamination, where photons emitted by one isotope contribute to the image of the other isotope, degrades image quality. Minimizing the crosstalk is important in obtaining the best possible image quality. One way to minimize the crosstalk is to optimize the injected activity of the two isotopes by considering the three-class nature of the diagnostic problem. To effectively do so, we have previously developed a three-class receiver operating characteristic (ROC) analysis methodology that extends and unifies the decision theoretic, linear discriminant analysis, and psychophysical foundations of binary ROC analysis in a three-class paradigm. In this work, we applied the proposed three-class ROC methodology to the assessment of the image quality of simultaneous dual-isotope MPS imaging techniques and the determination of the optimal injected activity combination. In addition to this application, the rapid development of diagnostic imaging techniques has produced an increasing number of clinical diagnostic tasks that involve not only disease detection, but also disease characterization and are thus multiclass tasks. This paper provides a practical example of the application of the proposed three-class ROC analysis methodology to medical problems.

Análisis de puntos de rocío y contenidos de humedad de mezclas gaseosas N2-H2O y CH4-H2O

OpenAIRE

D. Bogoya M.; C. Müller, I. Q.; L. R. Oellrich

1995-01-01

EI conocimiento actual del contenido de humedad de mezclas gaseosas saturadas es aún incompleto, especialmente en la región de altas presiones y bajas temperaturas. Por tanto se realizaron medidas experimentales de punta de rocío con los sistemas nitrógeno-agua y metano-agua, a presiones de 3 y 6 MPa y a temperaturas de 258 K a 288 K. Los puntos de rocío se determinaron con el método del espejo de punta de rocío y los contenidos de humedad por medio de la titulación de Karl-Fischer. Los valor...

Not proper ROC curves as new tool for the analysis of differentially expressed genes in microarray experiments

Directory of Open Access Journals (Sweden)

Pistoia Vito

2008-10-01

Full Text Available Abstract Background Most microarray experiments are carried out with the purpose of identifying genes whose expression varies in relation with specific conditions or in response to environmental stimuli. In such studies, genes showing similar mean expression values between two or more groups are considered as not differentially expressed, even if hidden subclasses with different expression values may exist. In this paper we propose a new method for identifying differentially expressed genes, based on the area between the ROC curve and the rising diagonal (ABCR. ABCR represents a more general approach than the standard area under the ROC curve (AUC, because it can identify both proper (i.e., concave and not proper ROC curves (NPRC. In particular, NPRC may correspond to those genes that tend to escape standard selection methods. Results We assessed the performance of our method using data from a publicly available database of 4026 genes, including 14 normal B cell samples (NBC and 20 heterogeneous lymphomas (namely: 9 follicular lymphomas and 11 chronic lymphocytic leukemias. Moreover, NBC also included two sub-classes, i.e., 6 heavily stimulated and 8 slightly or not stimulated samples. We identified 1607 differentially expressed genes with an estimated False Discovery Rate of 15%. Among them, 16 corresponded to NPRC and all escaped standard selection procedures based on AUC and t statistics. Moreover, a simple inspection to the shape of such plots allowed to identify the two subclasses in either one class in 13 cases (81%. Conclusion NPRC represent a new useful tool for the analysis of microarray data.

Jacques Lacan’s “Kant with Sade”: renunciation to desire and sadism in the Kantian categorical imperative

Directory of Open Access Journals (Sweden)

Francisco Conde Soto

2017-06-01

Full Text Available The aim of this study is to evaluate the juxtaposition of Kant’s categorical imperative with Sade’s maxim exposed in several texts of the French psychoanalyst Jacques Lacan. According to Lacan Kant and Sade are two sides of the same coin in reference to their position with respect to desire and enjoyment. His thesis are: 1. Sade’s maxim that the libertine is entitled to vex his neighbor as he pleases essentially meets the requirements of Kant’s categorical imperative. 2. Both Sade and Kant’s theories are examples of only one sadism directed at other subjects the first and directed toward himself in the form of moral duty the second. Reading The Ethics of Psychoanalysis (1959-60 and especially the text “Kant with Sade” (1966 is exposed Lacan’s critique of the categorical imperative of Kant, taken as a paradigm of what it means to be moral.

Multi-probe-based resonance-frequency electrical impedance spectroscopy for detection of suspicious breast lesions: improving performance using partial ROC optimization

Science.gov (United States)

Lederman, Dror; Zheng, Bin; Wang, Xingwei; Wang, Xiao Hui; Gur, David

2011-03-01

We have developed a multi-probe resonance-frequency electrical impedance spectroscope (REIS) system to detect breast abnormalities. Based on assessing asymmetry in REIS signals acquired between left and right breasts, we developed several machine learning classifiers to classify younger women (i.e., under 50YO) into two groups of having high and low risk for developing breast cancer. In this study, we investigated a new method to optimize performance based on the area under a selected partial receiver operating characteristic (ROC) curve when optimizing an artificial neural network (ANN), and tested whether it could improve classification performance. From an ongoing prospective study, we selected a dataset of 174 cases for whom we have both REIS signals and diagnostic status verification. The dataset includes 66 "positive" cases recommended for biopsy due to detection of highly suspicious breast lesions and 108 "negative" cases determined by imaging based examinations. A set of REIS-based feature differences, extracted from the two breasts using a mirror-matched approach, was computed and constituted an initial feature pool. Using a leave-one-case-out cross-validation method, we applied a genetic algorithm (GA) to train the ANN with an optimal subset of features. Two optimization criteria were separately used in GA optimization, namely the area under the entire ROC curve (AUC) and the partial area under the ROC curve, up to a predetermined threshold (i.e., 90% specificity). The results showed that although the ANN optimized using the entire AUC yielded higher overall performance (AUC = 0.83 versus 0.76), the ANN optimized using the partial ROC area criterion achieved substantially higher operational performance (i.e., increasing sensitivity level from 28% to 48% at 95% specificity and/ or from 48% to 58% at 90% specificity).

Nurses as 'guests'--a study of a concept in light of Jacques Derrida's philosophy of hospitality.

Science.gov (United States)

Oresland, Stina; Lutzén, Kim; Norberg, Astrid; Rasmussen, Birgit H; Määttä, Sylvia

2013-04-01

As revealed in previous empirical research, nurses describe their position in home-based nursing care (HBNC) as that of 'guests' in the patient's home. Such a description is problematic as 'guests' might not be considered to belong to the realm of professionalism. As Jacques Derrida's work on hospitality has received wide publicity, sparking theoretical and philosophical discussion about host and guest, the aim of this study was to explore how the concept 'guests' can be understood in the light of Derrida's philosophy of hospitality. The study revealed that (a) guest must be considered a binary concept; and (b) hospitality should be regarded as an exchange of giving and receiving between a host and a guest. The present study demonstrated that it is important to reflect on the meaning of the concepts used by nurses in HBNC. Further theoretical and empirical exploration of the concept 'hospitality' would be fruitful, i.e. what is patients' understanding of 'hospitality' and 'hostility' related to nurses' descriptions of themselves as 'guests' in the patient's home. © 2013 Blackwell Publishing Ltd.

Arte y política: un estudio comparativo de Jacques Rancière y Nelly Richard para el arte latinoamericano

Directory of Open Access Journals (Sweden)

Verónica Capasso

2016-01-01

Full Text Available En este artículo se indagan y comparan las teorías de Jacques Rancière y Nelly Richard sobre la relación entre arte y política desde el pensamiento posfundacional, y se producen reflexiones y análisis de manifestaciones artísticas latinoamericanas vanguardistas o críticas en diálogo con ambas. Para ello, se parte de una presentación de las teorías de Rancière y Richard en términos generales, se focaliza en las ideas que dichos autores tienen de la política y, específicamente, en la conceptualización que hacen del arte y su relación con la política. Al mismo tiempo, se desarrolla una interpretación de producciones artísticas desde una mirada centrada en sus diversas conexiones con lo político, más allá del contenido temático de estas. Se utiliza la perspectiva metodológica cualitativa transdisciplinaria, que articula distintas áreas de conocimiento (filosofía política, sociología, historia del arte. En el caso de los desarrollos de Jacques Rancière, se recurre a herramientas teóricas metropolitanas para resituarlas y repensarlas en función del arte de Latinoamérica. En este sentido, se trata de potenciar sus ideas en el análisis de casos locales. En cuanto a la teoría de Nelly Richard, sus conceptos de arte crítico y vanguardista se ponen en relación con el arte latinoamericano. Finalmente, se propone una comparación en la cual se destacan similitudes y diferencias conceptuales entre ambos en combinación con análisis de casos para abrir el panorama analítico e interpretativo que vincule teorías actuales con estudios de manifestaciones artísticas locales.

Receiver operating characteristic (ROC) curve for classification of {sup 18}F-NaF uptake on PET/CT

Energy Technology Data Exchange (ETDEWEB)

Valadares, Agnes Araujo, E-mail: agnesvaladares@me.com [Universidade de Sao Paulo (HC/FM/USP), SP (Brazil). Hospital das Clinicas. Fac. de Mediciana; Duarte, Paulo Schiavom; Ono, Carla Rachel; Coura-Filho, George Barberio; Sado, Heitor Naoki; Carvalho, Giovanna [Instituto do Cancer do Estado de Sao Paulo Octavio Frias de Oliveira (ICESP), Sao Paulo, SP (Brazil). Servico de Medicina Nuclear; Sapienza, Marcelo Tatit; Buchpiguel, Carlos Alberto [Universidade de Sao Paulo (FM/USP), Sao Paulo, SP (Brazil). Fac. de Medicina. Dept. de Radiologia e Oncologia

2016-01-15

Objective: To assess the cutoff values established by ROC curves to classify {sup 18}F-NaF uptake as normal or malignant. Materials and Methods: PET/CT images were acquired 1 hour after administration of 185 MBq of {sup 18}F-NaF. Volumes of interest (VOIs) were drawn on three regions of the skeleton as follows: proximal right humerus diaphysis (HD), proximal right femoral diaphysis (FD) and first vertebral body (VB1), in a total of 254 patients, totalling 762 VOIs. The uptake in the VOIs was classified as normal or malignant on the basis of the radiopharmaceutical distribution pattern and of the CT images. A total of 675 volumes were classified as normal and 52 were classified as malignant. Thirty-five VOIs classified as indeterminate or nonmalignant lesions were excluded from analysis. The standardized uptake value (SUV) measured on the VOIs were plotted on an ROC curve for each one of the three regions. The area under the ROC (AUC) as well as the best cutoff SUVs to classify the VOIs were calculated. The best cutoff values were established as the ones with higher result of the sum of sensitivity and specificity. Results: The AUCs were 0.933, 0.889 and 0.975 for UD, FD and VB1, respectively. The best SUV cutoffs were 9.0 (sensitivity: 73%; specificity: 99%), 8.4 (sensitivity: 79%; specificity: 94%) and 21.0 (sensitivity: 93%; specificity: 95%) for UD, FD and VB1, respectively. Conclusion: The best cutoff value varies according to bone region of analysis and it is not possible to establish one value for the whole body. (author)

Entretiens Jacques Cordonier, Alain Jacquesson, Jean-Frédéric Jauslin, Hubert Villard

CERN Document Server

2016-01-01

Beaucoup d’usages sont tellement ancrés dans nos vies que l’on ne s’interroge guère sur la manière dont ils sont advenus. Les réseaux informatiques, les échanges qu’ils génèrent, semblent aujourd’hui aussi « naturels » aux digital natives que la conversation à distance par téléphones fixes allait de soi il y a cinquante ans. Pour autant que l’on se pose la question, il est difficile d’imaginer qu’un domaine institutionnel, celui des bibliothèques en l’occurrence, ait joué un rôle important dans l’avènement et l’expansion de ces réseaux, au plan suisse voire international, et, par voie de conséquence, dans le développement et la normalisation des échanges intercantonaux. Cela est néanmoins une réalité. Ce livre d’entretiens fait apparaître en quoi Jacques Cordonier, Alain Jacquesson, Jean-Frédéric Jauslin et Hubert Villard, directeurs romands parmi les plus marquants de la fin du 20 e siècle, chacun avec son regard et sa tessiture, dans son canton ou à ...

Climate-mediated shifts in Neandertal subsistence behaviors at Pech de l'Azé IV and Roc de Marsal (Dordogne Valley, France).

Science.gov (United States)

Hodgkins, Jamie; Marean, Curtis W; Turq, Alain; Sandgathe, Dennis; McPherron, Shannon J P; Dibble, Harold

2016-07-01

Neandertals disappeared from Europe just after 40,000 years ago. Some hypotheses ascribe this to numerous population crashes associated with glacial cycles in the late Pleistocene. The goal of this paper is to test the hypothesis that glacial periods stressed Neandertal populations. If cold climates stressed Neandertals, their subsistence behaviors may have changed-requiring intensified use of prey through more extensive nutrient extraction from faunal carcasses. To test this, an analysis of Neandertal butchering was conducted on medium sized bovid/cervid remains composed of predominately red deer (Cervus elaphus), reindeer (Rangifer tarandus), and roe deer (Capreolus caprelous) deposited during global warm and cold phases from two French sites: Pech de l'Azé IV (Pech IV, Bordes' excavation) and Roc de Marsal (RDM). Analysis of surface modification on high survival long bones and proximal and middle phalanges demonstrates that skeletal elements excavated from the cold levels (RDM Level 4, Pech IV Level I2) at each cave have more cut marks and percussion marks than elements from the warm levels (RDM Level 9, Pech IV Level Y-Z) after controlling for fragment size. At both sites, epiphyseal fragments are rare, and although this pattern can result from carnivore consumption, carnivore tooth marks are almost nonexistent (climate, but may have been a general Neandertal behavioral characteristic, suggesting that these hominids were regularly on the edge of sufficient nutrient availability even during interglacials. Overall, the faunal assemblages from Roc de Marsal and Pech IV provide some support for the hypothesis that Neandertals were processing faunal remains more heavily during glacial periods, suggesting a response to increased nutritional stress during colder time periods. Copyright © 2016 Elsevier Ltd. All rights reserved.

Non-localization and localization ROC analyses using clinically based scoring

Science.gov (United States)

Paquerault, Sophie; Samuelson, Frank W.; Myers, Kyle J.; Smith, Robert C.

2009-02-01

We are investigating the potential for differences in study conclusions when assessing the estimated impact of a computer-aided detection (CAD) system on readers' performance. The data utilized in this investigation were derived from a multi-reader multi-case observer study involving one hundred mammographic background images to which fixed-size and fixed-intensity Gaussian signals were added, generating a low- and high-intensity signal sets. The study setting allowed CAD assessment in two situations: when CAD sensitivity was 1) superior or 2) lower than the average reader. Seven readers were asked to review each set in the unaided and CAD-aided reading modes, mark and rate their findings. Using this data, we studied the effect on study conclusion of three clinically-based receiver operating characteristic (ROC) scoring definitions. These scoring definitions included both location-specific and non-location-specific rules. The results showed agreement in the estimated impact of CAD on the overall reader performance. In the study setting where CAD sensitivity is superior to the average reader, the mean difference in AUC between the CAD-aided read and unaided read was 0.049 (95%CIs: -0.027; 0.130) for the image scoring definition that is based on non-location-specific rules, and 0.104 (95%CIs: 0.036; 0.174) and 0.090 (95%CIs: 0.031; 0.155) for image scoring definitions that are based on location-specific rules. The increases in AUC were statistically significant for the location-specific scoring definitions. It was further observed that the variance on these estimates was reduced when using the location-specific scoring definitions compared to that using a non-location-specific scoring definition. In the study setting where CAD sensitivity is equivalent or lower than the average reader, the mean differences in AUC are slightly above 0.01 for all image scoring definitions. These increases in AUC were not statistical significant for any of the image scoring definitions

Receiver Operating Characteristic (ROC to Determine Cut-Off Points of Biomarkers in Lung Cancer Patients

Directory of Open Access Journals (Sweden)

Heidi L. Weiss

2004-01-01

Full Text Available The role of biomarkers in disease prognosis continues to be an important investigation in many cancer studies. In order for these biomarkers to have practical application in clinical decision making regarding patient treatment and follow-up, it is common to dichotomize patients into those with low vs. high expression levels. In this study, receiver operating characteristic (ROC curves, area under the curve (AUC of the ROC, sensitivity, specificity, as well as likelihood ratios were calculated to determine levels of growth factor biomarkers that best differentiate lung cancer cases versus control subjects. Selected cut-off points for p185erbB-2 and EGFR membrane appear to have good discriminating power to differentiate control tissues versus uninvolved tissues from patients with lung cancer (AUC = 89% and 90%, respectively; while AUC increased to at least 90% for selected cut-off points for p185erbB-2 membrane, EGFR membrane, and FASE when comparing between control versus carcinoma tissues from lung cancer cases. Using data from control subjects compared to patients with lung cancer, we presented a simple and intuitive approach to determine dichotomized levels of biomarkers and validated the value of these biomarkers as surrogate endpoints for cancer outcome.

A Data-Driven Method for Selecting Optimal Models Based on Graphical Visualisation of Differences in Sequentially Fitted ROC Model Parameters

Directory of Open Access Journals (Sweden)

K S Mwitondi

2013-05-01

Full Text Available Differences in modelling techniques and model performance assessments typically impinge on the quality of knowledge extraction from data. We propose an algorithm for determining optimal patterns in data by separately training and testing three decision tree models in the Pima Indians Diabetes and the Bupa Liver Disorders datasets. Model performance is assessed using ROC curves and the Youden Index. Moving differences between sequential fitted parameters are then extracted, and their respective probability density estimations are used to track their variability using an iterative graphical data visualisation technique developed for this purpose. Our results show that the proposed strategy separates the groups more robustly than the plain ROC/Youden approach, eliminates obscurity, and minimizes over-fitting. Further, the algorithm can easily be understood by non-specialists and demonstrates multi-disciplinary compliance.

Funcionalismo y paradigmas sociológicos. Anotaciones críticas a un libro de Jacques Coenen-Huther

Directory of Open Access Journals (Sweden)

LUIS ENRIQUE ALONSO

1987-01-01

Full Text Available En el libro de Jacques Coenen-Huther Le Fonctionnalisme en sociologie: et après? (El Funcionalismo en sociología: ¿y luego? (1984, que se basa en su tesis doctoral, el autor repasa los puntos principales del funcionalismo, que dominaron la Sociología desde la Segunda Guerra Mundial hasta finales de los años 60. Examina la definición de funcionalismo, su relación con la causalidad, y diversas nociones de la función. Discute los paradigmas de los factores sociales y de la acción social, y presenta una evaluación de varios puntos sobre acuerdo y divergencia del funcionalismo con otras tradiciones sociológicas. Coenen-Huther ofrece una síntesis bien documentada de algunos problemas centrales en Sociología. Algunas críticas se hacen a su tratamiento del marxismo y el socialismo, y a su escasa atención a algunas influencias importantes en teoría sociológica, como son el psicoanálisis, el estructuralismo, y el behaviorismo

Diagnostic accuracy of the MMPI-2 with the Mexican criminal personality: The ROC curve analysis

OpenAIRE

Ampudia Rueda, Amada; Sánchez Crespo, Guadalupe; Jiménez Gómez, Fernando 

2016-01-01

The objective of this study is to assess the diagnostic accuracy of the personality of the Mexican criminal with the Minnesota Multiphasic Personality Inventory-2 (MMPI-2). The inventory was administered to 1,740 Mexican participants of which 870 (728 male and 142 female) are prison inmates, processed and/or sentenced for various crimes from various prisons in Mexico City, and the other 870 participants (728 male and 142 female) are not prison inmates. The ROC (Receiver Operating Characterist...

La Distracción de Sí. Jacques Derrida y la Auto-Afección

Directory of Open Access Journals (Sweden)

Cristóbal Durán

2015-08-01

Full Text Available En este texto buscamos hacer inteligible el lugar y los derroteros que sigue el concepto de auto-afección en el pensamiento de Jacques Derrida. Dicho concepto se desarrolla a partir de una interpretación de Kant y el problema de la metafísica, de Heidegger. En la elaboración del concepto en Derrida se enfatiza el momento de distancia en el que el sí-mismo no puede reducir al otro, sino que tiene que hacer patente la demora en su propia formación. Esto implicaría considerar que la mismidad que se constituye en la auto-afección no puede ser separada de una hetero-afección, mediante la cual el otro no puede ser objetivado y no es otra cosa que el sí-mismo en su alteración. La forma de dicho espaciamiento que produce la alteración se pone a prueba en la voz y en la estructura del “oírse-hablar”, la que se revela como un espacio polifónico irreductible a una unidad, donde la auto-afección se desune de sí para retornar como aquello que no espera y como aquello que no puede replegarse en un lugar de reunión.

Duality of the Sign Deconstructed. On the Basis of the Works by Jacques Derrida

Directory of Open Access Journals (Sweden)

Paulina Kłos

2014-11-01

Full Text Available This paper is an inquiry into some parts of the project of deconstruction by Jacques Derrida, who deconstructs but also and before all demystifies the traditional metaphysical language, language that is “larded with” dualistic concepts. The most spectacular dualisms in philosophy, which are taken into consideration by Derrida, are for instance: Plato’s theory of Ideas or Kantian Thing-In-Itself and its phenomena. All they belong to the tradition of logocentrism, which, with its consequences in the form of metaphysics of presence, appears in the writings by Derrida as the systematic desire for the transcendental signified; the final ground, the foundation of all signs. Derrida proposes something contrary to the dualisms of logocentrism: he treats the presentation of the thing itself as the re – presentation, as the image, as the double and in result he endorses the substitution of the presence and the simplicity of the intuitive evidence with the multiplication of meaning. In paper is examined also the line of argumentation where Derrida contradicts the main assumptions about the character of the sign made by Ferdinand de Saussure. The objective is to show how is it in Derrida’s writings that “the manifestation of the thing does not reveal a presence of this thing, but [that] it makes it another sign.”

The validity of using ROC software for analysing visual grading characteristics data: an investigation based on the novel software VGC analyzer

International Nuclear Information System (INIS)

Hansson, Jonny; Maansson, Lars Gunnar; Baath, Magnus

2016-01-01

The purpose of the present work was to investigate the validity of using single-reader-adapted receiver operating characteristics (ROC) software for analysis of visual grading characteristics (VGC) data. VGC data from four published VGC studies on optimisation of X-ray examinations, previously analysed using ROCFIT, were reanalysed using a recently developed software dedicated to VGC analysis (VGC Analyzer), and the outcomes [the mean and 95 % confidence interval (CI) of the area under the VGC curve (AUC VGC ) and the p-value] were compared. The studies included both paired and non-paired data and were reanalysed both for the fixed-reader and the random-reader situations. The results showed good agreement between the softwares for the mean AUC VGC . For non-paired data, wider CIs were obtained with VGC Analyzer than previously reported, whereas for paired data, the previously reported CIs were similar or even broader. Similar observations were made for the p-values. The results indicate that the use of single-reader-adapted ROC software such as ROCFIT for analysing non-paired VGC data may lead to an increased risk of committing Type I errors, especially in the random-reader situation. On the other hand, the use of ROC software for analysis of paired VGC data may lead to an increased risk of committing Type II errors, especially in the fixed-reader situation. (authors)

Measuring diagnostic and predictive accuracy in disease management: an introduction to receiver operating characteristic (ROC) analysis.

Science.gov (United States)

Linden, Ariel

2006-04-01

Diagnostic or predictive accuracy concerns are common in all phases of a disease management (DM) programme, and ultimately play an influential role in the assessment of programme effectiveness. Areas, such as the identification of diseased patients, predictive modelling of future health status and costs and risk stratification, are just a few of the domains in which assessment of accuracy is beneficial, if not critical. The most commonly used analytical model for this purpose is the standard 2 x 2 table method in which sensitivity and specificity are calculated. However, there are several limitations to this approach, including the reliance on a single defined criterion or cut-off for determining a true-positive result, use of non-standardized measurement instruments and sensitivity to outcome prevalence. This paper introduces the receiver operator characteristic (ROC) analysis as a more appropriate and useful technique for assessing diagnostic and predictive accuracy in DM. Its advantages include; testing accuracy across the entire range of scores and thereby not requiring a predetermined cut-off point, easily examined visual and statistical comparisons across tests or scores, and independence from outcome prevalence. Therefore the implementation of ROC as an evaluation tool should be strongly considered in the various phases of a DM programme.

Stuck between a ROC and a hard place? Barriers to the take up of green energy in the UK

International Nuclear Information System (INIS)

Diaz-Rainey, Ivan; Ashton, John K.

2008-01-01

This paper examines the UK mechanisms for ensuring future investment in renewable energy through consumer adoption of green energy tariffs and the Renewable Obligation Certificate (ROC) system. Using a national survey and focus groups the stated willingness by UK customers to pay a premium for renewable or green energy and actual take up of such tariffs is assessed. Substantial differences between willingness to pay for and the adoption of green energy tariffs are reported. This disparity is linked to a range of factors including consumer confusion, lack of supply, complexities of constructing 'green source' tariffs under the ROC system and a lack of customer trust. It is concluded that the re-definition of the green energy market in favour of 'green source' tariffs, greater direct compliance with the Renewable Obligation by addressing supply constraints, and efforts in providing clearer information and choices for consumers via a compulsory green energy accreditation scheme are required if willing consumers' are to contribute to investment in renewable energy

Plateletpheresis efficiency and mathematical correction of software-derived platelet yield prediction: A linear regression and ROC modeling approach.

Science.gov (United States)

Jaime-Pérez, José Carlos; Jiménez-Castillo, Raúl Alberto; Vázquez-Hernández, Karina Elizabeth; Salazar-Riojas, Rosario; Méndez-Ramírez, Nereida; Gómez-Almaguer, David

2017-10-01

Advances in automated cell separators have improved the efficiency of plateletpheresis and the possibility of obtaining double products (DP). We assessed cell processor accuracy of predicted platelet (PLT) yields with the goal of a better prediction of DP collections. This retrospective proof-of-concept study included 302 plateletpheresis procedures performed on a Trima Accel v6.0 at the apheresis unit of a hematology department. Donor variables, software predicted yield and actual PLT yield were statistically evaluated. Software prediction was optimized by linear regression analysis and its optimal cut-off to obtain a DP assessed by receiver operating characteristic curve (ROC) modeling. Three hundred and two plateletpheresis procedures were performed; in 271 (89.7%) occasions, donors were men and in 31 (10.3%) women. Pre-donation PLT count had the best direct correlation with actual PLT yield (r = 0.486. P Simple correction derived from linear regression analysis accurately corrected this underestimation and ROC analysis identified a precise cut-off to reliably predict a DP. © 2016 Wiley Periodicals, Inc.

Jacques Loeb (1859-1924) and His Forgotten Contributions to Electrolyte and Acid-Base Physiology in The Organism as a Whole.

Science.gov (United States)

Sgambato, Francesco; Sgambato, Ester; De Santo, Natale Gaspare

2016-02-01

Jacques Loeb (1859-1924) was the founder of the Journal of General Physiology which he co-directed in association with W.J.V. Osterhout in the years 1918-1924. Having worked (1889-1891)at the Marine Zoological Station of Naples, newly founded by Anton Dohrn, he was imprinted for life. A strong investigator used to perform the experiments personally. Loeb was engaged lifelong in the explanation of life on physico-chemical basis. He touched various fields (being a creative scientist full of ideas), and centered on the exchanges of electrolytes, acids and bases between the body and sea water in fish. He identified two equations: {[K+]+[Na+]}: {[Ca++]+[Mg++]} (Loebs 1st equation) {[K+]+[Na+]}: {[H+]+[Ca++]+[Mg++]} (Loebs final equation) Even nowadays these equations may have applications in a wide list of electrolyte and acid-base disturbances. Unfortunately his heredity has been dissipated.

77 FR 1707 - National Toxicology Program (NTP) Final Process for Preparation of the Report on Carcinogens (RoC)

Science.gov (United States)

2012-01-11

... the RoC. The process is available on the NTP Web site ( http://ntp.niehs.nih.gov/go/rocprocess ) or by... Counselors public meeting (76 FR 68461) on December 15, 2011 ( http://ntp.niehs.nih.gov/go/9741 ). The NTP... Web site ( http://ntp.niehs.nih.gov/go/rocprocess ) or by contacting Dr. Lunn (see ADDRESSES...

Evaluation of the Surface Water Distribution in North-Central Namibia Based on MODIS and AMSR Series

Directory of Open Access Journals (Sweden)

Hiroki Mizuochi

2014-08-01

Full Text Available Semi-arid North-central Namibia has high potential for rice cultivation because large seasonal wetlands (oshana form during the rainy season. Evaluating the distribution of surface water would reveal the area potentially suitable for rice cultivation. In this study, we detected the distribution of surface water with high spatial and temporal resolution by using two types of complementary satellite data: MODIS (MODerate-resolution Imaging Spectroradiometer and AMSR-E (Advanced Microwave Scanning Radiometer–Earth Observing System, using AMSR2 after AMSR-E became unavailable. We combined the modified normalized-difference water index (MNDWI from the MODIS data with the normalized-difference polarization index (NDPI from the AMSR-E and AMSR2 data to determine the area of surface water. We developed a simple gap-filling method (“database unmixing” with the two indices, thereby providing daily 500-m-resolution MNDWI maps of north-central Namibia regardless of whether the sky was clear. Moreover, through receiver-operator characteristics (ROC analysis, we determined the threshold MNDWI (−0.316 for wetlands. Using ROC analysis, MNDWI had moderate performance (the area under the ROC curve was 0.747, and the recognition error for seasonal wetlands and dry land was 21.2%. The threshold MNDWI let us calculate probability of water presence (PWP maps for the rainy season and the whole year. The PWP maps revealed the total area potentially suitable for rice cultivation: 1255 km2 (1.6% of the study area.

PARADOXURILE CONCEPŢIEI POLITICE ÎN OPERA LUI JEAN-JACQUES ROUSSEAU

Directory of Open Access Journals (Sweden)

Alexandru MAZILU

2015-12-01

Full Text Available Ideile lui Rousseau au avut un impact major asupra societăţii la sfârşitul sec. al XVIII-lea şi pe parcursul întregii perioade a sec. al XIX-lea. Aceste idei au imprimat un suflu modern cugetului său, fiind considerat şi un ideologist politic, o voce puternică a Revoluţiei Franceze şi un pioner al curentului romantic. În legătură cu domeniul nostru de studiu, paradoxurile concepţiei politice ale lui Rousseau se referă la contradicţia dintre aspiraţiile modernităţii şi criticile violente ale progresului social. El pune accentul pe contradicţia dintre încrede-rea deplină în ,,contractul social”, ca pattern cultural şi lipsa de încredere în ,,educaţia socială”. Unicul mod de a depăşi aceste contradicţii este abordarea noului model al filosofiei educaţiei bazat pe reforme radicale pentru a facilita autodezvoltarea individului.   THE PARADOXES OF POLITICAL CONCEPTION IN THE WORK OF JEAN-JACQUES ROUSSEAUHis ideas have a big impact on the society at the end of the 18th century and the whole 19th century period. These ideas transform his spirit into a modern one, as well as a political ideologist, main voice of the French Revolution and pioneer of the Romantic Movement. Related to our article subject, Rousseau's political conceptual paradoxes refer to the contradiction between moderni-ty aspiration and the violent critic of the social progress. He emphasizes the contradiction between full trust of the "social contract", as a cultural pattern and the distrust of the "social education." The only way to leave the contradictions behind is his new education philosophy pattern based on a radical reform in order for the individual to develop himself.

CERN 50th Anniversary Official Celebration : one of the high momentsof the day: the signing of the golden book by the King of Spain Juan Carlos, the President of the Republic of France Jacques Chirac and the President of the Swiss Confederation Joseph Deiss

CERN Multimedia

Patrice Loiez

2004-01-01

CERN 50th Anniversary Official Celebration : one of the high momentsof the day: the signing of the golden book by the King of Spain Juan Carlos, the President of the Republic of France Jacques Chirac and the President of the Swiss Confederation Joseph Deiss

CERN 50th Anniversary Official Celebration : one of the high moments of the day the signing of the golden book by the King of Spain Juan Carlos, the President of the Republic of France, Jacques Chirac and the President of the Swiss Confederation, Joseph Deiss

CERN Multimedia

Patrice Loeiz

2004-01-01

CERN 50th Anniversary Official Celebration : one of the high moments of the day the signing of the golden book by the King of Spain Juan Carlos, the President of the Republic of France, Jacques Chirac and the President of the Swiss Confederation, Joseph Deiss

FCJ-160 Politics is Serious Business: Jacques Rancière, Griefing, and the Re-Partitioning of the (NonSensical

Directory of Open Access Journals (Sweden)

Steve Holmes

2013-12-01

Full Text Available This article contextualises certain elements of ‘griefing’ as a form of political action in virtual world by drawing on the political philosophy of Jacques Rancière. A small but growing number of scholars are starting to view griefing as an avant-garde, anarchist, or hacktivist political activity. I suggest that Rancière offers a more specific articulation of what constitutes political action and activism for griefing collectives because his understanding of politics is entirely grounded in relationship to the types of communities and individual political equality. The article focuses specifically on the Patriotic Nigras activities in the Great Habbo Raid of 2006 in an attempt to understand how a Rancièreian framework can provide some analytical tools for articulating politics in virtual worlds. I conclude that the PN do not ultimately realise a Rancièreian framework. They challenge not partitions of the sensible, but partitions of the nonsensical specific to the different operation of politics and community formation in virtual worlds.

X-ray structural study of Ge(001):Te 1x1 performed at the advanced photon source. Current status of the surface-interface structure beamline at SPring-8

CERN Document Server

Sakata, O

2002-01-01

This article is composed of two parts. In the first half, we describe a study that we performed at 5ID-C of the Dupont- Northwestern University-Dow (DND) CAT in the Advanced Photon Source, the Argonne National Laboratory for 1998 to 2000. A surface structure of Ge(001):Te 1x1 was determined by least-squares fits of x-ray scattered intensities with calculations based on some surface atomic structural models. The fitted structural model has a characteristic that a direction of a Ge-Ge dimer bond on the first Ge atomic layer is perpendicular to a Te missing row. It was distinct from those based on first-principles total energy calculations. In the second half, we introduce up-to-the-minute status of BL13XU for surface-interface structural studies at SPring-8. Scientific research goals we desire are mentioned as well. (author)

Driving change: an interview with Ford Motor Company's Jacques Nasser. Interview by Suzy Wetlaufer.

Science.gov (United States)

Nasser, J

1999-01-01

What happens when the world is changing but your organization isn't? And what if that organization has 340,000 employees in 200 countries? In this interview, Jacques Nasser, the new CEO of Ford Motor Company, talks with HBR editor Suzy Wetlaufer about these challenges and explains how his company is overcoming them through a unique education program. Since its very beginnings, says Nasser, Ford has comprised dozens of far-flung divisions and units, each with its own "fiefdom" mind-set. The fiefdoms didn't share information, let alone great ideas. Such behavior stifled creativity and drove up costs. Today's global environment demands a new and different way of doing business, says Nasser, and to that end, Ford has launched a multifaceted teaching initiative that will reach every one of Ford's employees by year-end. The goal of the program: to help employees view the company in its entirety as shareholders do, and then act that way too. At the heart of the initiative is the teachable point of view, a five-part written explanation of what a person knows and believes about what it takes to succeed in business. It is more than just a document to be discussed and then filed. It has proven to be a powerful tool for organizational transformation, and not only at Ford. In a commentary accompanying Nasser's interview, Noel Tichy, leadership expert and consultant to Ford describes the building blocks of the teachable point of view and explores how it can be implemented in any organization determined to change for the better.

The impact of faceplate surface characteristics on detection of pulmonary nodules

Science.gov (United States)

Toomey, R. J.; Ryan, J. T.; McEntee, M. F.; McNulty, J.; Evanoff, M. G.; Cuffe, F.; Yoneda, T.; Stowe, J.; Brennan, P. C.

2009-02-01

Introduction In order to prevent specular reflections, many monitor faceplates have features such as tiny dimples on their surface to diffuse ambient light incident on the monitor, however, this "anti-glare" surface may also diffuse the image itself. The purpose of the study was to determine whether the surface characteristics of monitor faceplates influence the detection of pulmonary nodules under low and high ambient lighting conditions. Methods and Materials Separate observer performance studies were conducted at each of two light levels (250 lux). Twelve examining radiologists with the American Board of Radiology participated in the darker condition and eleven in the brighter condition. All observers read on both smooth "glare" and dimpled "anti-glare" faceplates in a single lighting condition. A counterbalanced methodology was utilized to minimise memory effects. In each reading, observers were presented with thirty chest images in random order, of which half contained a single simulated pulmonary nodule. They were asked to give their confidence that each image did or did not contain a nodule and to mark the suspicious location. ROC analysis was applied to resultant data. Results No statistically significant differences were seen in the trapezoidal area under the ROC curve (AUC), sensitivity, specificity or average time per case at either light level for chest specialists or radiologists from other specialities. Conclusion The characteristics of the faceplate surfaces do not appear to affect detection of pulmonary nodules. Further work into other image types is being conducted.

Salivary oxytocin concentrations in response to running, sexual self-stimulation, breastfeeding and the TSST: The Regensburg Oxytocin Challenge (ROC) study.

Science.gov (United States)

Jong, Trynke R de; Menon, Rohit; Bludau, Anna; Grund, Thomas; Biermeier, Verena; Klampfl, Stefanie M; Jurek, Benjamin; Bosch, Oliver J; Hellhammer, Juliane; Neumann, Inga D

2015-12-01

Intranasal oxytocin (OXT) application is emerging as a potential treatment for socio-emotional disorders associated with abnormalities in OXT system (re-) activity. The crucial identification of patients with such abnormalities could be streamlined by the assessment of basal and stimulus-induced OXT concentrations in saliva, using a simple, stress-free sampling procedure (i.e. an OXT challenge test). We therefore established the Regensburg Oxytocin Challenge (ROC) test to further validate salivary OXT concentrations as a practical, reliable and sensitive biomarker. OXT concentrations were quantified by radioimmunoassay in samples collected at home by healthy adult male and female volunteers before and after running ("Run") or sexual self-stimulation ("Sex"). In lactating women, salivary OXT concentrations were quantified before, during and after breastfeeding. Salivary OXT along with salivary cortisol and heart rate were monitored in healthy adult participants undergoing the Trier Social Stress Test (TSST). The home-based "Run" and "Sex" challenges as well as the laboratory-based TSST caused quantifiable, rapid, and consistent increases in salivary OXT (approximately 2.5-fold after 10-15min), which were similar for men and women. Breastfeeding did not result in measurably increased salivary OXT levels, probably because the short pulses of OXT release characteristic for lactation were missed. Taken together, ROC tests reliably assess the responsiveness of the OXT system (i.e., the increase in salivary OXT concentrations as compared to basal levels) to challenges such as "Run" and "Sex" at home or psychosocial stress (TSST) in the laboratory. Further studies with larger sample numbers are essentially needed in order to reveal individual differences in ROC test outcomes depending on, for example, genetic or environmental factors. Copyright © 2015 Elsevier Ltd. All rights reserved.

The status of hazardous waste management in Taiwan, R.O.C

International Nuclear Information System (INIS)

Chen, L.L.G.

1989-01-01

A large quantity of industrial waste (such as waste oils FCB's, cadmium, etc.) is produced daily in Taiwan, R.O.C.. A 1985 survey found that the amount of waste generated equalled approximately 30 million tons per year. Hazardous waste represents 9.7% of this total. Based on statistics from this same 1985 survey, 72% of the factories disposed of their waste without intermediate treatment. This paper reports that since most methods used for treatment of hazardous wastes were implemented incorrectly, the proper treatment of such waste has become the focal point of environmental protection in Taiwan. From July, 1987 the short-term program for industrial waste control has had as its first priority the control of toxic, infectious and corrosive hazardous waste. At the same time, a registration system for permission, reporting and results inspection for hazardous wastes is being developed. An industrial waste exchange and reclamation system is also being developed. It is predicted that a complete hazardous waste management program can be developed within the next four years

O IMPACTO DA CONVERSÃO DO CUSTO HISTÓRICO AO CUSTO CORRENTE CORRIGIDO NO RETORNO SOBRE ATIVOS E PATRIMÔNIO LÍQUIDO: ANÁLISE A PARTIR DO SISTEMA DUPONT.

Directory of Open Access Journals (Sweden)

Roberto Silva da Penha

2013-07-01

Full Text Available Historical cost is the most used form of accounting valuation, but it does not reflect the effect of currency in time. The Theory of Corrected Current Cost, albeit with limitations, may show evidence of real and relevant accounting information of the entity. In this context, a question can be formulated: What is the impact of the conversion of historical cost to corrected current cost in return on assets and equity? In order to answer this question, the DuPont system was applied in a model company as a tool for analysis. The results showed that the return of assets at historical cost and corrected current cost were 12.11% and 3.14%, respectively, a decrease of 74.07%, and the result of the return on equity, the historical cost and corrected current cost were 20.59% and 4.96%, respectively, decreased 75.91%. Based on these variations it is observed that the impacts of the conversion of the corrected current cost were significant, confirming the importance of the adoption of this practice, whenever possible.

Discriminatory power of MRI for differentiation of adrenal non-adenomas vs adenomas evaluated by means of ROC analysis: Can biopsy be obviated?

Energy Technology Data Exchange (ETDEWEB)

Slapa, R.Z.; Jakubowski, W.; Krolicki, L. [Department of Imaging, Warsaw Medical School (Poland); Januszewicz, A. [Department of Hypertension, National Institute of Cardiology, Warsaw (Poland); Kasperlik-Zaluska, A.A. [Department of Endocrinology, Center for Postgraduate Medical Education, Warsaw (Poland); Dabrowska, E.; Feltynowski, T. [Department of Hypertension, Warsaw Medical School, Warsaw (Poland); Fijuth, J. [Department of Teleradiotherapy, Institute of Oncology, Warsaw (Poland); Tarnawski, R. [Department of Radiotherapy, Institute of Oncology, Gliwice Branch, Gliwice (Poland)

2000-01-01

The purpose of our study was to evaluate the discriminatory power of MRI in high-field magnet (1.5 T) for differentiation of adrenal non-adenomas vs adenomas assessing the following parameters separately and in combination: mean diameter of adrenal mass; previously described and new ratios as well as index calculated from signal intensity (SI) on SE T2-weighted images, chemical shift imaging (CSI), and Gd-DTPA-enhanced dynamic studies. One hundred eight adrenal masses (36 non-hyperfunctioning adenomas, 27 pheochromocytomas, 23 aldosterone-secreting adenomas, 20 malignant masses and 2 cortisol-secreting adenomas) in 95 patients were evaluated with SE sequences, CSI and Gd-DTPA dynamic studies. Indices and ratios of SI for all examined MRI methods were calculated and examined retrospectively for significance of differences between the groups with calculation of sensitivity and specificity. Receiver operating characteristics (ROC) analysis of calculated parameters in combination was performed. The multifactorial analysis of all four parameters, including size of the tumor, T2{sub liver} index, CSI ratio reflecting lipid content in the tumor and Wo{sub max/last} ratio reflecting maximal washout of contrast agent from the tumor had 100 % sensitivity and 100 % specificity in characterization of adrenal non-adenoma. The best performance of combination of mean tumor diameter with single MRI SI parameter was achieved in combination with T2{sub liver} index for all adrenal masses (area under ROC 0.987) and CSI ratio for non-hyperfunctioning adrenal masses (area under ROC 0.991). Magnetic resonance imaging enables sensitive and specific diagnosis of adrenal non-adenoma. (orig.)

Development of a robot for decontamination of reactor well and maintenance pit wall surfaces

International Nuclear Information System (INIS)

Miyakawa, Minoru; Nozawa, Katsuro; Mizutani, Takeshi; Onozuka, Kazuaki; Morita, Isamu

1984-01-01

A robot has been developed at Hamaoka BWR Power Plant of Chubu Electric Power Company, Inc., which performs the decontamination of the wall surfaces of reactor wells and maintenance pits. The robot is controlled with a control box through a micro-computer. The mechanical structure and working principle of this robot is explained. One of the special features of this robot is that it perceives the steps on a wall, and washes the vertical and horizontal surfaces with two different types of brushes. As the material for the bristles of the brushes, nylon with alumina as abrasive (TAINEX-A made by Dupont Ltd.) was selected after some experience. The design specifications of the brushes were determined, based on the results of intensive performance test, which are shown in this report. The efficiency of this robot was proved by applying it to the decontamination of the reactor wells in the periodic inspection and maintenance of Unit 1 and Unit 2 in the Hamaoka BWR Power Plant. As the result of this decontamination, the contamination level was reduced from about 10 -3 μCi/cm 2 to about 10 -5 μCi/cm 2 . The measured results of contamination after the first and third decontamination works are listed for various parts of the well surfaces. (Aoki, K.)

PROMETHEE-ROC Model for Assessing the Readiness of Technology for Generating Energy

Directory of Open Access Journals (Sweden)

Danielle Costa Morais

2015-01-01

Full Text Available This paper puts forward a proposal for a multicriteria decision model for prioritizing technologies that are critical for power generation in the energy sector. It deals with the context of imprecise information regarding importance of criteria; then an integration of surrogate weights with the PROMETHEE method is undertaken in order to approach this context. In this type of strategic decision problem, how to deal with imprecise information is always a challenge. The use of surrogate weights presents a significant contribution and it can facilitate the assignment of weights in a decision ranking problem, which requires the decision-maker (DM to order the criteria by their importance for the decision problem. Thus for this situation of assessing the readiness of technology for generating energy where the DM is able and feels comfortable to order all criteria by their relative importance, the proposed approach of surrogate weights in the PROMETHEE II method, the PROMETHEE-ROC model, is shown to be an adequate approach.

The diagnosis of small solitary pulmonary nodule: comparison of standard and inverse digital images on a high resolution monitor using ROC analysis

International Nuclear Information System (INIS)

Choi, Byeong Kyoo; Lee, In Sun; Seo, Joon Beom; Lee, Jin Seong; Song, Koun Sik; Lim, Tae Hwan

2002-01-01

To study the impact of inversion of soft-copy chest radiographs on the detection of small solitary pulmonary nodules using a high-resolution monitor. The study group consisted of 80 patients who had undergone posterior chest radiography; 40 had a solitary noncalcified pulmonary nodule approximately 1 cm in diameter, and 40 were control subjects. Standard and inverse digital images using the inversion tool on a PACS system were displayed on high-resolution monitors (2048x2560x8 bit). Ten radiologists were requested to rank each image using a five-point scale (1=definitely negative, 3=equivocal or indeterminate, 5=definite nodule), and the data were interpreted using receiver operating characteristic (ROC) analysis. The area under the ROC curve for pooled data of standard image sets was significantly larger than that of inverse image sets (0.8893 and 0.8095, respectively; p 0.05). For detecting small solitary pulmonary nodules, inverse digital images were significantly inferior to standard digital images

ROC evaluation of SPECT myocardial lesion detectability with and without single iteration non-uniform Chang attenuation compensation using an anthropomorphic female phantom

International Nuclear Information System (INIS)

Jang, S.; Jaszczak, R.J.; Duke Univ. Medical Center, Durham, NC; Gilland, D.R.; Turkington, T.G.; Coleman, R.E.; Tsui, B.M.W.; Metz, C.E.

1998-01-01

The purpose of this work was to evaluate lesion detectability with and without nonuniform attenuation compensation (AC) in myocardial perfusion SPECT imaging in women using an anthropomorphic phantom and receiver operating characteristics (ROC) methodology. Breast attenuation causes artifacts in reconstructed images and may increase the difficulty of diagnosis of myocardial perfusion imaging in women. The null hypothesis tested using the ROC study was that nonuniform AC does not change the lesion detectability in myocardial perfusion SPECT imaging in women. The authors used a filtered backprojection (FBP) reconstruction algorithm and Chang's single iteration method for AC. In conclusion, with the proposed myocardial defect model nuclear medicine physicians demonstrated no significant difference for the detection of the anterior wall defect; however, a greater accuracy for the detection of the inferior wall defect was observed without nonuniform AC than with it. Medical physicists did not demonstrate any statistically significant difference in defect detection accuracy with or without nonuniform AC in the female phantom

Análisis de puntos de rocío y contenidos de humedad de mezclas gaseosas N2-H2O y CH4-H2O

Directory of Open Access Journals (Sweden)

D. Bogoya M.

1995-01-01

Full Text Available EI conocimiento actual del contenido de humedad de mezclas gaseosas saturadas es aún incompleto, especialmente en la región de altas presiones y bajas temperaturas. Por tanto se realizaron medidas experimentales de punta de rocío con los sistemas nitrógeno-agua y metano-agua, a presiones de 3 y 6 MPa y a temperaturas de 258 K a 288 K. Los puntos de rocío se determinaron con el método del espejo de punta de rocío y los contenidos de humedad por medio de la titulación de Karl-Fischer. Los valores experimentales se compararon con correlaciones de la literatura. El método de Sharma-Campbell resultó ser la mejor descripción del sistema nitrógeno-agua. Para temperaturas inferiores a 273 K la suposición de comportamiento de gas ideal mostro ser suficiente para el sistema metano-agua, mientras que para temperaturas superiores a 273 K los cálculos mediante el principio de estados correspondientes con dos parámetros, en combinación con una corrección de fugacidad, manifestó ser la mejor.

ROC analysis for evaluating the detectability of image unsharpness due to the patient's movement. Phantom study comparing preview and diagnostic LCDs

International Nuclear Information System (INIS)

Tanaka, Rie; Shiraishi, Junji; Takamori, Miho; Watari, Chihiro

2011-01-01

The purpose of this study was to evaluate the detectability of image unsharpness due to a patient's movement, a receiver operating characteristic (ROC) analysis was conducted to compare the diagnostic and preview liquid-crystal displays (LCDs). Phantom images that simulated a patient's movement were obtained by using a moving metronome and acrylic plates with a computed radiography (CR) system. A total of 104 images were classified into five groups according to the degrees of image unsharpness determined based on the metronome velocity and exposure time. In an ROC observer study (n=6), a 2-megapixel diagnostic monochrome LCD (2M-LCD) and a 1.3-megapixel general color LCD for preview (1.3M-LCD) were compared in terms of the detection of image unsharpness due to the movement. A statistical test was performed using the multi-reader multi-case (MRMC) method. In the results, the average areas under the ROC curve values for the detection of image unsharpness using the 2M-LCD and 1.3M-LCD were 0.952 and 0.850, respectively. The detection of image unsharpness using the 2M-LCD was significantly better than that using the 1.3M-LCD (p<0.05). In addition, some images with slight unsharpness were identified correctly only using the 2M-LCD. The results suggest that the low-resolution LCD (id est (i.e.), the 1.3M-LCD for preview) had a limitation in identifying image unsharpness due to the patient's movement. Slight unsharpness could be missed in primary image checks performed on a preview monitor equipped with an imaging system. Therefore, the high-resolution LCD (i.e., a 2M-LCD) is necessary when using radiography for diagnostics. (author)

Diagnostic accuracy of atypical p-ANCA in autoimmune hepatitis using ROC- and multivariate regression analysis.

Science.gov (United States)

Terjung, B; Bogsch, F; Klein, R; Söhne, J; Reichel, C; Wasmuth, J-C; Beuers, U; Sauerbruch, T; Spengler, U

2004-09-29

Antineutrophil cytoplasmic antibodies (atypical p-ANCA) are detected at high prevalence in sera from patients with autoimmune hepatitis (AIH), but their diagnostic relevance for AIH has not been systematically evaluated so far. Here, we studied sera from 357 patients with autoimmune (autoimmune hepatitis n=175, primary sclerosing cholangitis (PSC) n=35, primary biliary cirrhosis n=45), non-autoimmune chronic liver disease (alcoholic liver cirrhosis n=62; chronic hepatitis C virus infection (HCV) n=21) or healthy controls (n=19) for the presence of various non-organ specific autoantibodies. Atypical p-ANCA, antinuclear antibodies (ANA), antibodies against smooth muscles (SMA), antibodies against liver/kidney microsomes (anti-Lkm1) and antimitochondrial antibodies (AMA) were detected by indirect immunofluorescence microscopy, antibodies against the M2 antigen (anti-M2), antibodies against soluble liver antigen (anti-SLA/LP) and anti-Lkm1 by using enzyme linked immunosorbent assays. To define the diagnostic precision of the autoantibodies, results of autoantibody testing were analyzed by receiver operating characteristics (ROC) and forward conditional logistic regression analysis. Atypical p-ANCA were detected at high prevalence in sera from patients with AIH (81%) and PSC (94%). ROC- and logistic regression analysis revealed atypical p-ANCA and SMA, but not ANA as significant diagnostic seromarkers for AIH (atypical p-ANCA: AUC 0.754+/-0.026, odds ratio [OR] 3.4; SMA: 0.652+/-0.028, OR 4.1). Atypical p-ANCA also emerged as the only diagnostically relevant seromarker for PSC (AUC 0.690+/-0.04, OR 3.4). None of the tested antibodies yielded a significant diagnostic accuracy for patients with alcoholic liver cirrhosis, HCV or healthy controls. Atypical p-ANCA along with SMA represent a seromarker with high diagnostic accuracy for AIH and should be explicitly considered in a revised version of the diagnostic score for AIH.

The Politics of Aesthetics and the Hatred of Democracy according to Jacques Rancière

Directory of Open Access Journals (Sweden)

Pedro Hussak van Velthen Ramos

2015-04-01

Full Text Available Among readers of Jacques Rancière there is a discussion about the possibility of aesthetics substituting for real political action. This is because while the French author elaborates on the conception of the emancipated spectator, he states that the political task of art cannot be the removal of the spectator from her “passive” condition into the dimension of political action, but only the suspension of the relationship between “active” and “passive”. However, in Aisthesis, published in 2011, Rancière warns the reader that it is not a case of abandoning the aesthetic utopia, even if any teleological view is withdrawn. In this article, I intend to discuss these paradoxes by confronting the considerations of Le Spectateur émancipé and La Haine de la démocratie, trying to show that if politics itself presupposes action, the politics of aesthetics must be understood as a non-identification process that takes subjects out of the places that were “addressed” to them beforehand. In La Haine de la démocratie one of the symptoms of the crisis of representative democracy is presented by the fact that it produces oligarchies and, on the other hand, new social dynamics appear as the conquest of a new citizenship that confronts these political oligarchies. Noting that demonstrations today, whether in Turkey, Spain, or New York, are similar to artistic happenings, Rancière can say that where there is aesthetics there is democracy. Understanding this last statement is the aim of the present article.

75 FR 51845 - Chrysler Group, LLC Manufacturing Division St. Louis North Plant Including On-Site Leased Workers...

Science.gov (United States)

2010-08-23

... produce performance coating solutions for vehicles. The company reports that workers leased from DuPont Performance Coatings, a wholly-owned subsidiary of E.I. DuPont de Nemours Company, OEM, were employed on-site..., C R Associates, Syncreon, Robinson Solutions and Dupont Performance Coatings Fenton, MO; Amended...

Cognitive Vulnerabilities and Depression in Young Adults: An ROC Curves Analysis.

Science.gov (United States)

Balsamo, Michela; Imperatori, Claudio; Sergi, Maria Rita; Belvederi Murri, Martino; Continisio, Massimo; Tamburello, Antonino; Innamorati, Marco; Saggino, Aristide

2013-01-01

Objectives and Methods. The aim of the present study was to evaluate, by means of receiver operating characteristic (ROC) curves, whether cognitive vulnerabilities (CV), as measured by three well-known instruments (the Beck Hopelessness Scale, BHS; the Life Orientation Test-Revised, LOT-R; and the Attitudes Toward Self-Revised, ATS-R), independently discriminate between subjects with different severities of depression. Participants were 467 young adults (336 females and 131 males), recruited from the general population. The subjects were also administered the Beck Depression Inventory-II (BDI-II). Results. Four first-order (BHS Optimism/Low Standard; BHS Pessimism; Generalized Self-Criticism; and LOT Optimism) and two higher-order factors (Pessimism/Negative Attitudes Toward Self, Optimism) were extracted using Principal Axis Factoring analysis. Although all first-order and second-order factors were able to discriminate individuals with different depression severities, the Pessimism factor had the best performance in discriminating individuals with moderate to severe depression from those with lower depression severity. Conclusion. In the screening of young adults at risk of depression, clinicians have to pay particular attention to the expression of pessimism about the future.

La subjetivación política más allá de la esfera pública: Michel Foucault, Jacques Rancière y Simone Weil

Directory of Open Access Journals (Sweden)

Emilse Galvis

2016-01-01

Full Text Available Se afirma que la subjetivación política no puede pensarse al margen de las manifestaciones éticas, artísticas y espirituales de la política, en cuanto que despliegan de distintas maneras unos efectos sobre lo que es asumido como común, y reconfiguran nuevas formas de concebir el sujeto político en caminos inusuales de la subjetivación. Se problematiza la subjetivación política a partir de tres lecturas: la crítica, con base en los planteamientos de Michel Foucault; una cierta interpretación de las prácticas artísticas, en Jacques Rancière; y una concepción de la espiritualidad y la política a la luz de los planteamientos de Simone Weil.

From rubber tree homeland to rubber tree plantation: Jacques Huber and his studies on the culture of heveas in the East (1911-1912

Directory of Open Access Journals (Sweden)

Anna Raquel de Matos Castro

2009-12-01

Full Text Available The paper deals with the trip of the Swiss botanist Jacques Huber (1867-1914 to the main eastern rubber producing countries between 1911 and 1912. This trip was intended to develop studies on the cultivation of Hevea brasiliensis in that region. Huber was commissioned with the task by the State of Pará governor João Coelho, who wanted to find solutions to the downfall of the regional economy. The economy of Amazonia was primarily based on rubber extractivism and was seriously endangered due the market controlled by England from eastern plantations. Back to Brazil, Huber published a report with information about the society, economy and environment where the rubber trees were cultivated. The report compiles scientific observations and the topics that motivated the regional elites in that context. In addition to the brief analyses of the report, photographs took by Huber in the East of rubber trees plantations, tree tapping and local workers are published.

An ROC study detecting ability of idiopathic pulmonary fibrosis using digital radiography

International Nuclear Information System (INIS)

Chung, Eun Chul; Im, Jung Gi; Han, Man Chung; Kim, Jong Hyo

1991-01-01

One potential advantage of the digital radiography system is its ability to enhance image quality by various types of processing. Digital unsharp masking is one of the simplest and most useful forms of enhancing processes. The efficacy of unsharp masking in radiological diagnosis has not been investigated thoroughly. To evaluate the effects of unsharp masking in film-digital chest images, 3 observers were shown 150 test radiographs. These test radiographs consisted of 50 unprocessed images (25 normals and 25 patients with idiopathic pulmonary fibrosis with honey combing) and their 100 processed images by using 450 and 15-sized masks respectively. An ROC analysis of these data suggests that unsharp masking is more effective in detecting idiopathic pulmonary fibrosis than unprocessed image (ρ < 0.05), and so it may improve diagnostic accuracy for interstitial fibrosis. In addition, the smaller mask size (15) is more effective than the larger one (mask size 45) (ρ < 0.05). By using this analytic approach, an optimal parameter in digital chest radiography may be investigated in many other forms of pulmonary disease such as pulmonary nodule or mediastinal mass

An ROC study detecting ability of idiopathic pulmonary fibrosis using digital radiography

Energy Technology Data Exchange (ETDEWEB)

Chung, Eun Chul; Im, Jung Gi; Han, Man Chung; Kim, Jong Hyo [College of Medicine, Ewha Womens University, Seoul (Korea, Republic of)

1991-03-15

One potential advantage of the digital radiography system is its ability to enhance image quality by various types of processing. Digital unsharp masking is one of the simplest and most useful forms of enhancing processes. The efficacy of unsharp masking in radiological diagnosis has not been investigated thoroughly. To evaluate the effects of unsharp masking in film-digital chest images, 3 observers were shown 150 test radiographs. These test radiographs consisted of 50 unprocessed images (25 normals and 25 patients with idiopathic pulmonary fibrosis with honey combing) and their 100 processed images by using 450 and 15-sized masks respectively. An ROC analysis of these data suggests that unsharp masking is more effective in detecting idiopathic pulmonary fibrosis than unprocessed image ({rho} < 0.05), and so it may improve diagnostic accuracy for interstitial fibrosis. In addition, the smaller mask size (15) is more effective than the larger one (mask size 45) ({rho} < 0.05). By using this analytic approach, an optimal parameter in digital chest radiography may be investigated in many other forms of pulmonary disease such as pulmonary nodule or mediastinal mass.

A statistical approach to evaluate the performance of cardiac biomarkers in predicting death due to acute myocardial infarction: time-dependent ROC curve

Science.gov (United States)

Karaismailoğlu, Eda; Dikmen, Zeliha Günnur; Akbıyık, Filiz; Karaağaoğlu, Ahmet Ergun

2018-04-30

Background/aim: Myoglobin, cardiac troponin T, B-type natriuretic peptide (BNP), and creatine kinase isoenzyme MB (CK-MB) are frequently used biomarkers for evaluating risk of patients admitted to an emergency department with chest pain. Recently, time- dependent receiver operating characteristic (ROC) analysis has been used to evaluate the predictive power of biomarkers where disease status can change over time. We aimed to determine the best set of biomarkers that estimate cardiac death during follow-up time. We also obtained optimal cut-off values of these biomarkers, which differentiates between patients with and without risk of death. A web tool was developed to estimate time intervals in risk. Materials and methods: A total of 410 patients admitted to the emergency department with chest pain and shortness of breath were included. Cox regression analysis was used to determine an optimal set of biomarkers that can be used for estimating cardiac death and to combine the significant biomarkers. Time-dependent ROC analysis was performed for evaluating performances of significant biomarkers and a combined biomarker during 240 h. The bootstrap method was used to compare statistical significance and the Youden index was used to determine optimal cut-off values. Results : Myoglobin and BNP were significant by multivariate Cox regression analysis. Areas under the time-dependent ROC curves of myoglobin and BNP were about 0.80 during 240 h, and that of the combined biomarker (myoglobin + BNP) increased to 0.90 during the first 180 h. Conclusion: Although myoglobin is not clinically specific to a cardiac event, in our study both myoglobin and BNP were found to be statistically significant for estimating cardiac death. Using this combined biomarker may increase the power of prediction. Our web tool can be useful for evaluating the risk status of new patients and helping clinicians in making decisions.

A comparison of confidence/credible interval methods for the area under the ROC curve for continuous diagnostic tests with small sample size.

Science.gov (United States)

Feng, Dai; Cortese, Giuliana; Baumgartner, Richard

2017-12-01

The receiver operating characteristic (ROC) curve is frequently used as a measure of accuracy of continuous markers in diagnostic tests. The area under the ROC curve (AUC) is arguably the most widely used summary index for the ROC curve. Although the small sample size scenario is common in medical tests, a comprehensive study of small sample size properties of various methods for the construction of the confidence/credible interval (CI) for the AUC has been by and large missing in the literature. In this paper, we describe and compare 29 non-parametric and parametric methods for the construction of the CI for the AUC when the number of available observations is small. The methods considered include not only those that have been widely adopted, but also those that have been less frequently mentioned or, to our knowledge, never applied to the AUC context. To compare different methods, we carried out a simulation study with data generated from binormal models with equal and unequal variances and from exponential models with various parameters and with equal and unequal small sample sizes. We found that the larger the true AUC value and the smaller the sample size, the larger the discrepancy among the results of different approaches. When the model is correctly specified, the parametric approaches tend to outperform the non-parametric ones. Moreover, in the non-parametric domain, we found that a method based on the Mann-Whitney statistic is in general superior to the others. We further elucidate potential issues and provide possible solutions to along with general guidance on the CI construction for the AUC when the sample size is small. Finally, we illustrate the utility of different methods through real life examples.

The role of stenosis ratio as a predictor of surgical satisfaction in patients with lumbar spinal canal stenosis: a receiver-operator characteristic (ROC) curve analysis.

Science.gov (United States)

Mohammadi, Hassanreza R; Azimi, Parisa; Benzel, Edward C; Shahzadi, Sohrab; Azhari, Shirzad

2016-09-01

The aim of this study was to elucidate independent factors that predict surgical satisfaction in lumbar spinal canal stenosis (LSCS) patients. Patients who underwent surgery were grouped based on the age, gender, duration of symptoms, walking distance, Neurogenic Claudication Outcome Score (NCOS) and the stenosis ratio (SR) described by Lurencin. We recorded on 2-year patient satisfaction using standardized measure. The optimal cut-off points in SR, NCOS and walking distance for predicting surgical satisfaction were estimated from sensitivity and specificity calculations and receiver operator characteristic (ROC) curves. One hundred fifty consecutive patients (51 male, 99 female, mean age 62.4±10.9 years) were followed up for 34±13 months (range 24-49). One, two, three and four level stenosis was observed in 10.7%, 39.3%, 36.0 % and 14.0% of patients, respectively. Post-surgical satisfaction was 78.5% at the 2 years follow up. In ROC curve analysis, the asymptotic significance is less than 0.05 in SR and the optimal cut-off value of SR to predict worsening surgical satisfaction was measured as more than 0.52, with 85.4% sensitivity and 77.4% specificity (AUC 0.798, 95% CI 0.73-0.90; Ppatients with degenerative lumbar stenosis considered for surgical treatment. Using a ROC curve analysis, a radiological feature, the SR, demonstrated superiority in predicting patient satisfaction, compared to functional and clinical characteristics such as walking distance and NCOS.

Jacques Poloni-Simard, La Mosaïque indienne. Mobilité, stratification sociale et métissage dans le corregimiento de Cuenca (Équateur) du xvie au xviiie siècle

OpenAIRE

Gruzinski, Serge

2008-01-01

L’étude de Jacques Poloni-Simard captivera tous ceux qui s’intéressent à l’histoire économique et sociale de l’Amérique espagnole, à la fois parce qu’elle ajoute un nouveau chapitre à l’historiographie de l’Équateur et qu’elle développe une approche de bout en bout fondée sur une méthodologie originale et rigoureuse. Les Indiens de Cuenca et de sa région sont au cœur d’un ouvrage qui, sous la forme d’un triptyque, rassemble et analyse tout ce que les sources espagnoles peuvent nous apporter s...

Rocking at 81 and Rolling at 34: ROC Cut-Off Scores for the Negative Acts Questionnaire–Revised in Serbia

Science.gov (United States)

Petrović, Ivana B.; Vukelić, Milica; Čizmić, Svetlana

2017-01-01

Researchers are still searching for the ways to identify different categories of employees according to their exposure to negative acts and psychological experience of workplace bullying. We followed Notelaers and Einarsen’s application of the ROC analysis to determine the NAQ-R cut-off scores applying a “lower” and “higher” threshold. The main goal of this research was to develop and test different gold standards of personal and organizational relevance in determining the NAQ-R cut-off scores in a specific cultural and economic context of Serbia. Apart from combining self-labeling as a victim with self-perceived health, the objectives were to test the gold standards developed as a combination of self-labeling with life satisfaction, self-labeling with intention to leave and a complex gold standard based on self-labeling, self-perceived health, life satisfaction and intention to leave taken together. The ROC analysis on Serbian workforce data supports applying of different gold standards. For identifying employees in a preliminary stage of bullying, the most applicable was the gold standard based on self-labeling and intention to leave (score 34 and higher). The most accurate identification of victims could be based on the most complex gold standard (score 81 and higher). This research encourages further investigation of gold standards in different cultures. PMID:28119652

Recognition Memory zROC Slopes for Items with Correct versus Incorrect Source Decisions Discriminate the Dual Process and Unequal Variance Signal Detection Models

Science.gov (United States)

Starns, Jeffrey J.; Rotello, Caren M.; Hautus, Michael J.

2014-01-01

We tested the dual process and unequal variance signal detection models by jointly modeling recognition and source confidence ratings. The 2 approaches make unique predictions for the slope of the recognition memory zROC function for items with correct versus incorrect source decisions. The standard bivariate Gaussian version of the unequal…

9. Three aphorisms from Diderot, The Philosopher and Marshal ***’s Wife Have a Deep Chat, 1774; Jean-Jacques Rousseau (1712-1778), Émile, or On Education, 1762; and Frederick the Great of Prussia (1712-17

OpenAIRE

2017-01-01

Portrait of Rousseau by Maurice Quentin de La Tour (after 1753) https://commons.wikimedia.org/wiki/File:Jean-Jacques_Rousseau_(painted_portrait).jpg ⁂ Philosophy is as far from impiety as religion is from fanaticism, but from fanaticism to barbarism is only a step.Diderot Adultery and love between men are allowed in many countries, but you will not find a single one in which you are allowed to break your word. This is because society can rub along perfectly well with adulterers and men who l...

Development of a robot for decontamination of reactor well and maintenance pit wall surfaces

Energy Technology Data Exchange (ETDEWEB)

Miyakawa, Minoru; Nozawa, Katsuro; Mizutani, Takeshi; Onozuka, Kazuaki; Morita, Isamu

1984-03-01

A robot has been developed at Hamaoka BWR Power Plant of Chubu Electric Power Company, Inc., which performs the decontamination of the wall surfaces of reactor wells and maintenance pits. The robot is controlled with a control box through a micro-computer. The mechanical structure and working principle of this robot is explained. One of the special features of this robot is that it perceives the steps on a wall, and washes the vertical and horizontal surfaces with two different types of brushes. As the material for the bristles of the brushes, nylon with alumina as abrasive (TAINEX-A made by Dupont Ltd.) was selected after some experience. The design specifications of the brushes were determined, based on the results of intensive performance test, which are shown in this report. The efficiency of this robot was proved by applying it to the decontamination of the reactor wells in the periodic inspection and maintenance of Unit 1 and Unit 2 in the Hamaoka BWR Power Plant. As the result of this decontamination, the contamination level was reduced from 10/sup 3/ ..mu..Ci/cm/sup 2/ to about 10/sup 5/ ..mu..Ci/cm/sup 2/. The measured results of contamination after the first and third decontamination works are listed for various parts of the well surfaces.

Conformational and spectroscopic study of xanthogen ethyl formates, ROC(S)SC(O)OCH₂CH₃. Isolation of CH₃CH₂OC(O)SH.

Science.gov (United States)

Juncal, Luciana C; Cozzarín, Melina V; Romano, Rosana M

2015-03-15

ROC(S)SC(O)OCH2CH3, with R=CH3-, (CH3)2CH- and CH3(CH2)2-, were obtained through the reaction between potassium xanthate salts, ROC(S)SK, and ethyl chloroformate, ClC(O)OCH2CH3. The liquid compounds were identified and characterized by (1)H and (13)C NMR and mass spectrometry. The conformations adopted by the molecules were studied by DFT methods. 6 conformers were theoretically predicted for R=CH3- and (CH3)2CH-, while the conformational flexibility of the n-propyl substituent increases the total number of feasible rotamers to 21. For the three molecules, the conformers can be associated in 3 groups, being the most stable the AS forms - the C=S double bond anti (A) with respect to the C-S single bond and the S-C single bond syn (S) with respect to the C=O double bond - followed by AA and SS conformers. The vibrational spectra were interpreted in terms of the predicted conformational equilibrium, presenting the ν(C=O) spectral region signals corresponding to the three groups of conformers. A moderated pre-resonance Raman enhancement of the ν(C=S) vibrational mode of CH3(CH2)2OC(S)SC(O)OCH2CH3 was detected, when the excitation radiation approaches the energy of a n→π∗ electronic transition associated with the C=S chromophore. UV-visible spectra in different solvents were measured and interpreted in terms of TD-DFT calculations. The unknown molecule CH3CH2OC(O)SH was isolated by the UV-visible photolysis of CH3OC(S)SC(O)OCH2CH3 isolated in Ar matrix, and also obtained as a side-product of the reaction between potassium xanthate salts, ROC(S)SK, and ethyl chloroformate, ClC(O)OCH2CH3. Copyright © 2014 Elsevier B.V. All rights reserved.

Energy shift and Casimir-Polder force for an atom out of thermal equilibrium near a dielectric substrate

Science.gov (United States)

Zhou, Wenting; Yu, Hongwei

2014-09-01

We study the energy shift and the Casimir-Polder force of an atom out of thermal equilibrium near the surface of a dielectric substrate. We first generalize, adopting the local source hypothesis, the formalism proposed by Dalibard, Dupont-Roc, and Cohen-Tannoudji [J. Phys. (Paris) 43, 1617 (1982), 10.1051/jphys:0198200430110161700; J. Phys. (Paris) 45, 637 (1984), 10.1051/jphys:01984004504063700], which separates the contributions of thermal fluctuations and radiation reaction to the energy shift and allows a distinct treatment of atoms in the ground and excited states, to the case out of thermal equilibrium, and then we use the generalized formalism to calculate the energy shift and the Casimir-Polder force of an isotropically polarizable neutral atom. We identify the effects of the thermal fluctuations that originate from the substrate and the environment and discuss in detail how the Casimir-Polder force out of thermal equilibrium behaves in three different distance regions in both the low-temperature limit and the high-temperature limit for both the ground-state and excited-state atoms, with special attention devoted to the distinctive features as opposed to thermal equilibrium. In particular, we recover the distinctive behavior of the atom-wall force out of thermal equilibrium at large distances in the low-temperature limit recently found in a different theoretical framework, and furthermore we give a concrete region where this behavior holds.

Los orígenes filosóficos de la noción de soberanía nacional en el contractualismo político de Thomas Hobbes, John Locke y Jean-Jacques Rousseau

OpenAIRE

Vichinkeski Teixeira,Anderson

2014-01-01

El artículo examina cómo las proposiciones teóricas de Thomas Hobbes, John Locke y Jean-Jacques Rousseau sobre la función del contrato social han tenido una profunda conexión con la noción de soberanía nacional, desde su fundamentación filosófica hasta sus límites. Para eso, se estudia en los tres filósofos el estado de naturaleza y la concepción de hombre, el proceso de formación del contrato social y la condición del hombre en el Estado, según las formas de Estado y de Gobierno preferidas d...

Quantifying Contaminant Mass for the Feasibility Study of the DuPont Chambers Works FUSRAP Site - 13510

Energy Technology Data Exchange (ETDEWEB)

Young, Carl; Rahman, Mahmudur; Johnson, Ann; Owe, Stephan [Cabrera Services Inc., 1106 N. Charles St., Ste. 300, Baltimore, MD 21201 (United States)

2013-07-01

The U.S. Army Corps of Engineers (USACE) - Philadelphia District is conducting an environmental restoration at the DuPont Chambers Works in Deepwater, New Jersey under the Formerly Utilized Sites Remedial Action Program (FUSRAP). Discrete locations are contaminated with natural uranium, thorium-230 and radium-226. The USACE is proposing a preferred remedial alternative consisting of excavation and offsite disposal to address soil contamination followed by monitored natural attenuation to address residual groundwater contamination. Methods were developed to quantify the error associated with contaminant volume estimates and use mass balance calculations of the uranium plume to estimate the removal efficiency of the proposed alternative. During the remedial investigation, the USACE collected approximately 500 soil samples at various depths. As the first step of contaminant mass estimation, soil analytical data was segmented into several depth intervals. Second, using contouring software, analytical data for each depth interval was contoured to determine lateral extent of contamination. Six different contouring algorithms were used to generate alternative interpretations of the lateral extent of the soil contamination. Finally, geographical information system software was used to produce a three dimensional model in order to present both lateral and vertical extent of the soil contamination and to estimate the volume of impacted soil for each depth interval. The average soil volume from all six contouring methods was used to determine the estimated volume of impacted soil. This method also allowed an estimate of a standard deviation of the waste volume estimate. It was determined that the margin of error for the method was plus or minus 17% of the waste volume, which is within the acceptable construction contingency for cost estimation. USACE collected approximately 190 groundwater samples from 40 monitor wells. It is expected that excavation and disposal of

Joint confidence region estimation for area under ROC curve and Youden index.

Science.gov (United States)

Yin, Jingjing; Tian, Lili

2014-03-15

In the field of diagnostic studies, the area under the ROC curve (AUC) serves as an overall measure of a biomarker/diagnostic test's accuracy. Youden index, defined as the overall correct classification rate minus one at the optimal cut-off point, is another popular index. For continuous biomarkers of binary disease status, although researchers mainly evaluate the diagnostic accuracy using AUC, for the purpose of making diagnosis, Youden index provides an important and direct measure of the diagnostic accuracy at the optimal threshold and hence should be taken into consideration in addition to AUC. Furthermore, AUC and Youden index are generally correlated. In this paper, we initiate the idea of evaluating diagnostic accuracy based on AUC and Youden index simultaneously. As the first step toward this direction, this paper only focuses on the confidence region estimation of AUC and Youden index for a single marker. We present both parametric and non-parametric approaches for estimating joint confidence region of AUC and Youden index. We carry out extensive simulation study to evaluate the performance of the proposed methods. In the end, we apply the proposed methods to a real data set. Copyright © 2013 John Wiley & Sons, Ltd.

A ROC-based feature selection method for computer-aided detection and diagnosis

Science.gov (United States)

Wang, Songyuan; Zhang, Guopeng; Liao, Qimei; Zhang, Junying; Jiao, Chun; Lu, Hongbing

2014-03-01

Image-based computer-aided detection and diagnosis (CAD) has been a very active research topic aiming to assist physicians to detect lesions and distinguish them from benign to malignant. However, the datasets fed into a classifier usually suffer from small number of samples, as well as significantly less samples available in one class (have a disease) than the other, resulting in the classifier's suboptimal performance. How to identifying the most characterizing features of the observed data for lesion detection is critical to improve the sensitivity and minimize false positives of a CAD system. In this study, we propose a novel feature selection method mR-FAST that combines the minimal-redundancymaximal relevance (mRMR) framework with a selection metric FAST (feature assessment by sliding thresholds) based on the area under a ROC curve (AUC) generated on optimal simple linear discriminants. With three feature datasets extracted from CAD systems for colon polyps and bladder cancer, we show that the space of candidate features selected by mR-FAST is more characterizing for lesion detection with higher AUC, enabling to find a compact subset of superior features at low cost.

3D CT versus axial helical CT versus conventional tomography in the classification of acetabular fractures: A ROC analysis

International Nuclear Information System (INIS)

Kickuth, Ralph; Laufer, Ulf; Hartung, Guido; Gruening, Christian; Stueckle, Christoph; Kirchner, Johannes

2002-01-01

AIM: To assess the diagnostic power of three-dimensional computed tomography (3D CT), axial helical computed tomography (CT) and conventional tomography in the classification of acetabular fractures by interdisciplinary review. MATERIALS AND METHODS: Receiver operating characteristics (ROCs) were assessed for two radiologists and two surgeons blinded to the presence of acetabular fractures in an animal model (a total of 62 porcine hips, 40 of them with artificial acetabular fractures). Main target parameter was the diagnostic accuracy in the classification of the artificial fractures following Judet et al. RESULTS: ROC analysis for radiologists showed A z values of 0·83 for 3D CT, 0·81 for axial helical CT, and 0·78 for conventional tomography; differences between the three techniques were not significant (P = 0·46-0·73). A z values for the surgeons were 0·87 for 3D CT, 0·68 for axial helical CT, and 0·60 for conventional tomography; 3D CT was significantly better than axial helical CT (P = 0·01) and conventional tomography (P = 0·001). The differences between axial helical CT and conventional tomography were not significant (P = 0·37). CONCLUSION: Acetabular fractures are best classified by 3D CT, followed by axial helical CT and conventional tomography when assessed by surgeons. 3D CT did not provide any additional significant benefit in the classification performed by radiologists. Kickuth, R. et al. (2002)

Enregistrer, ordonner et contrôler: les documents diplomatiques dans les "Registra Secreta " de Jacques II d'Aragon

Directory of Open Access Journals (Sweden)

Péquignot, Stéphane

2002-06-01

Full Text Available The study of the internal organisation of Jayme II´s Registra secreta shows the existence of a specific «system» for the gathering of diplomatical registered papers in chapters called legatio. However, this method of classification does not exclude other ones and these registers can be considered as an experimental laboratory for the arrangement and the location of registered documents. The composition of the registers and the interventions of the scribes within conduce then to look for the functions they are assigned with: allowing an easier control of the uses of the documentation by the king´s ambassadors, the Registra secreta take part, at the chancery, in a living memory of the administration of diplomatical matters.

L'étude de l'économie interne des Registra secreta de Jacques II montre l'existence d'un «système» spécifique de rassemblement de la documentation diplomatique sous des rubriques legatio. Ce mode de classification n'est cependant pas exclusif, et les registres constituent un véritable lieu d'expérimentation pour l'ordonnancement et le repérage de la documentation enregistrée. L'examen de la tenue des registres conduit alors à celui des fonctions qui leur sont assignées: en facilitant le contrôle des usages de la documentation par les ambassadeurs du roi, ils participent à la chancellerie dune mémoire active de l'administration des affaires diplomatiques.

Thorvaldsens Jason med det gyldne skind som ophævelsen af antikken

DEFF Research Database (Denmark)

Holm, Henrik

2003-01-01

Bertel Thorveldsen, Norma Bryson, Jacques Derrida, Sigmund Freud, Jacques Lacan, Kunsthistorie, æstetik, skulptur......Bertel Thorveldsen, Norma Bryson, Jacques Derrida, Sigmund Freud, Jacques Lacan, Kunsthistorie, æstetik, skulptur...

ROC [Receiver Operating Characteristics] study of maximum likelihood estimator human brain image reconstructions in PET [Positron Emission Tomography] clinical practice

International Nuclear Information System (INIS)

Llacer, J.; Veklerov, E.; Nolan, D.; Grafton, S.T.; Mazziotta, J.C.; Hawkins, R.A.; Hoh, C.K.; Hoffman, E.J.

1990-10-01

This paper will report on the progress to date in carrying out Receiver Operating Characteristics (ROC) studies comparing Maximum Likelihood Estimator (MLE) and Filtered Backprojection (FBP) reconstructions of normal and abnormal human brain PET data in a clinical setting. A previous statistical study of reconstructions of the Hoffman brain phantom with real data indicated that the pixel-to-pixel standard deviation in feasible MLE images is approximately proportional to the square root of the number of counts in a region, as opposed to a standard deviation which is high and largely independent of the number of counts in FBP. A preliminary ROC study carried out with 10 non-medical observers performing a relatively simple detectability task indicates that, for the majority of observers, lower standard deviation translates itself into a statistically significant detectability advantage in MLE reconstructions. The initial results of ongoing tests with four experienced neurologists/nuclear medicine physicians are presented. Normal cases of 18 F -- fluorodeoxyglucose (FDG) cerebral metabolism studies and abnormal cases in which a variety of lesions have been introduced into normal data sets have been evaluated. We report on the results of reading the reconstructions of 90 data sets, each corresponding to a single brain slice. It has become apparent that the design of the study based on reading single brain slices is too insensitive and we propose a variation based on reading three consecutive slices at a time, rating only the center slice. 9 refs., 2 figs., 1 tab

Observer performance in detecting multiple radiographic signals: prediction and analysis using a generalized ROC approach

International Nuclear Information System (INIS)

Metz, C.E.; Starr, S.J.; Lusted, L.B.

1975-01-01

The theories of decision processes and signal detection provide a framework for the evaluation of observer performance. Some radiologic procedures involve a search for multiple similar lesions, as in gallstone or pneumoconiosis examinations. A model is presented which attempts to predict, from the conventional receiver operating characteristic (ROC) curve describing the detectability of a single visual signal in a radiograph, observer performance in an experiment requiring detection of more than one such signal. An experiment is described which tests the validity of this model for the case of detecting the presence of zero, one, or two low-contrast radiographic images of a two-mm.-diameter lucite bead embedded in radiographic mottle. Results from six observers, including three radiologists, confirm the validity of the model and suggest that human observer performance for relatively complex detection tasks can be predicted from the results of simpler experiments

Maintenance of influenza virus infectivity on the surfaces of personal protective equipment and clothing used in healthcare settings.

Science.gov (United States)

Sakaguchi, Hiroko; Wada, Koji; Kajioka, Jitsuo; Watanabe, Mayumi; Nakano, Ryuichi; Hirose, Tatsuko; Ohta, Hiroshi; Aizawa, Yoshiharu

2010-11-01

The maintenance of infectivity of influenza viruses on the surfaces of personal protective equipment and clothing is an important factor in terms of controlling viral cross-infection in the environment and preventing contact infection. The aim of this study was to determine if laboratory-grown influenza A (H1N1) virus maintained infectivity on the surfaces of personal protective equipment and clothing used in healthcare settings. Influenza A virus (0.5 mL) was deposited on the surface of a rubber glove, an N95 particulate respirator, a surgical mask made of non-woven fabric, a gown made of Dupont Tyvek, a coated wooden desk, and stainless steel. Each sample was left for 1, 8, and 24 h, and hemagglutination (HA) and 50% tissue culture infective dose (TCID(50))/mL were measured. The HA titer of this influenza A virus did not decrease in any of the materials tested even after 24 h. The infectivity of influenza A virus measured by TCID(50) was maintained for 8 h on the surface of all materials, with the exception of the rubber glove for which virus infectivity was maintained for 24 h. Our results indicate that the replacement/renewal of personal protective equipment and clothing by healthcare professionals in cases of exposure to secretions and droplets containing viruses spread by patients is an appropriate procedure to prevent cross-infection.

Diagnostic yield of ink-jet prints from digital radiographs for the assessment of approximal carious lesions: ROC-analysis

International Nuclear Information System (INIS)

Schulze, Ralf K.W.; Grimm, Stefanie; Schulze, Dirk; Voss, Kai; Keller, Hans-Peter; Wedel, Matthias

2011-01-01

Aims: To investigate the diagnostic quality of different quality, individually calibrated ink-jet printers for the very challenging dental radiographic task of approximal carious lesion detection. Materials and methods: A test-pattern evaluating resolution, contrast and homogeneity of the ink-jet prints was developed. 50 standardized dental radiographs each showing two neighbouring teeth in natural contact were printed on glossy paper with calibrated, randomly selected ink-jet printers (Canon S520 and iP4500, Epson Stylus Photo R2400). Printing size equalled the viewing size on a 17'' cathode-ray-tube monitor daily quality-tested according to German regulations. The true caries status was determined from serial sectioning and microscopic evaluation. 16 experienced observers evaluated the radiographs on a five-point confidence scale on all prints plus the viewing monitor with respect to the visibility of a carious lesion. A non-parametric Receiver-Operating Characteristics (ROC-) analysis was performed explicitly designed for the evaluation of readings stemming from identical samples but different modality. Significant differences are expressed by a critical ratio z exceeding ±2. Diagnostic accuracy was determined by the area (Az) underneath the ROC-curves. Results: Average Az-values ranged between 0.62 (S520 and R2400) and 0.64 (monitor, iP4500), with no significant difference between modalities (P = 0.172). Neither significant (range mean z: -0.40 (S520) and -0.11 (iP4500)) nor clinically relevant differences were found between printers and viewing monitor. Conclusions: Our results for a challenging task in dental radiography indicate that calibrated, off-the-shelf ink-jet printers are able to reproduce (dental) radiographs at quality levels sufficient for radiographic diagnosis in a typical dental working environment.

Diagnostic yield of ink-jet prints from digital radiographs for the assessment of approximal carious lesions: ROC-analysis

Energy Technology Data Exchange (ETDEWEB)

Schulze, Ralf K.W., E-mail: rschulze@mail.uni-mainz.de [Poliklinik fuer Zahnaerztliche Chirurgie, University Medical Center of the Johannes Gutenberg-University, Augustusplatz 2, D-55131 Mainz (Germany); Grimm, Stefanie, E-mail: StefanieGrimm@gmx.de [Poliklinik fuer Zahnaerztliche Chirurgie, University Medical Center of the Johannes Gutenberg-University, Augustusplatz 2, D-55131 Mainz (Germany); Schulze, Dirk, E-mail: dirk.schulze@uniklinik-freiburg.de [Klinik fuer Mund,- Kiefer- und Gesichtschirurgie, Sektion Roentgen, Universitaetsklinikum Freiburg, Hugstetterstr. 55, D-79106 Freiburg (Germany); Voss, Kai, E-mail: zahnarzt@drvoss.eu [Zahnaerztekammer Schleswig-Holstein, Vorstand fuer Praxisfuehrung, Westring 496, D- 24106 Kiel (Germany); Keller, Hans-Peter, E-mail: hans-peter.keller@din.de [NA Dental (NADENT) im DIN, Alexander-Wellendorff-Str. 2, D-75172 Pforzheim (Germany); Wedel, Matthias, E-mail: matthias.wedel@siemens.com [Siemens AG, Medical Solutions, Postfach 32 60, D-91050 Erlangen (Germany)

2011-08-15

Aims: To investigate the diagnostic quality of different quality, individually calibrated ink-jet printers for the very challenging dental radiographic task of approximal carious lesion detection. Materials and methods: A test-pattern evaluating resolution, contrast and homogeneity of the ink-jet prints was developed. 50 standardized dental radiographs each showing two neighbouring teeth in natural contact were printed on glossy paper with calibrated, randomly selected ink-jet printers (Canon S520 and iP4500, Epson Stylus Photo R2400). Printing size equalled the viewing size on a 17'' cathode-ray-tube monitor daily quality-tested according to German regulations. The true caries status was determined from serial sectioning and microscopic evaluation. 16 experienced observers evaluated the radiographs on a five-point confidence scale on all prints plus the viewing monitor with respect to the visibility of a carious lesion. A non-parametric Receiver-Operating Characteristics (ROC-) analysis was performed explicitly designed for the evaluation of readings stemming from identical samples but different modality. Significant differences are expressed by a critical ratio z exceeding {+-}2. Diagnostic accuracy was determined by the area (Az) underneath the ROC-curves. Results: Average Az-values ranged between 0.62 (S520 and R2400) and 0.64 (monitor, iP4500), with no significant difference between modalities (P = 0.172). Neither significant (range mean z: -0.40 (S520) and -0.11 (iP4500)) nor clinically relevant differences were found between printers and viewing monitor. Conclusions: Our results for a challenging task in dental radiography indicate that calibrated, off-the-shelf ink-jet printers are able to reproduce (dental) radiographs at quality levels sufficient for radiographic diagnosis in a typical dental working environment.

Dynawave froth scrubbing technology

International Nuclear Information System (INIS)

McLean, J.E.

1989-01-01

The DynaWave family of scrubbers was developed and patented by DuPont in the 1970's and is used extensively within the company. Because the technology was treated as confidential, information about the scrubbers was not published outside of DuPont. In 1986 Monsanto Enviro-Chem was asked to install a Reverse Jet scrubber at DuPont's Burnside spent acid recovery pant to replace an aging spray humidifying tower. Enviro-Chem was impressed with the technology and entered into a licensing agreement with DuPont in late 1987. This paper addresses the application of DynaWave froth scrubbing technology to metallurgical plant process and effluent gas streams. Froth scrubber design principles an sampling results from pilot plant trails on fluid bed roaster off-gas are presented

76 FR 14393 - Notice of Receipt of Requests for Amendments To Delete Uses in Certain Pesticide Registrations

Science.gov (United States)

2011-03-16

... Aldicarb Aldicarb Use on Coffee. Pesticide. 352-604 DuPont Tanos Famoxadone & Cymoxanil.. Leaf Petioles...: Manager, U.S.-- Registration, DuPont Crop Protection, 1007 Market Street, Wilmington, DE 19898-0001. 8536...

Pictures of Childhood: a close study of Sir Joshua Reynolds`s The Strawberry Girl, including a selection of his paintings of children, read in light of his The Discourses on Art and Jean-Jacques Rousseau`s Emile, or On Education.

OpenAIRE

Nordby, Oda Nygaard

2015-01-01

Pictures of Childhood is a study of Sir Joshua Reynolds s paintings of children in light of Reynolds s The Discourses on Art, 1769-1790, and Jean-Jacques Rousseau s Emile, or On Education, 1762. A close reading of The Discourses on Art reveals that Reynolds thought art should seek a general truth, and that art should make an impression on the beholder s imagination and feeling. In Emile, Rousseau abandons original sin. This led to a perception of childhood as a happy and content phase of life...

Analyzing ROC curves using the effective set-size model

Science.gov (United States)

Samuelson, Frank W.; Abbey, Craig K.; He, Xin

2018-03-01

The Effective Set-Size model has been used to describe uncertainty in various signal detection experiments. The model regards images as if they were an effective number (M*) of searchable locations, where the observer treats each location as a location-known-exactly detection task with signals having average detectability d'. The model assumes a rational observer behaves as if he searches an effective number of independent locations and follows signal detection theory at each location. Thus the location-known-exactly detectability (d') and the effective number of independent locations M* fully characterize search performance. In this model the image rating in a single-response task is assumed to be the maximum response that the observer would assign to these many locations. The model has been used by a number of other researchers, and is well corroborated. We examine this model as a way of differentiating imaging tasks that radiologists perform. Tasks involving more searching or location uncertainty may have higher estimated M* values. In this work we applied the Effective Set-Size model to a number of medical imaging data sets. The data sets include radiologists reading screening and diagnostic mammography with and without computer-aided diagnosis (CAD), and breast tomosynthesis. We developed an algorithm to fit the model parameters using two-sample maximum-likelihood ordinal regression, similar to the classic bi-normal model. The resulting model ROC curves are rational and fit the observed data well. We find that the distributions of M* and d' differ significantly among these data sets, and differ between pairs of imaging systems within studies. For example, on average tomosynthesis increased readers' d' values, while CAD reduced the M* parameters. We demonstrate that the model parameters M* and d' are correlated. We conclude that the Effective Set-Size model may be a useful way of differentiating location uncertainty from the diagnostic uncertainty in medical

Rancièrean Atomism: Clarifying the Debate between Jacques Rancière and Alain Badiou

Directory of Open Access Journals (Sweden)

Joseph M. Spencer

2015-12-01

Full Text Available In the late 1970s and the 1980s, a number of radical left political theorists focused their philosophical attention on the relevance of ancient atomism, revitalizing a tradition that went back to Karl Marx's work on his dissertation. This essay looks at the uses of atomism by two thinkers in particular, Jacques Rancière and Alain Badiou, in order to see how their discussions of and references to ancient materialism help to shed light on their fundamental disagreements about the nature of community and equality.First, this paper argues that what Badiou and Rancière most obviously share in their assessments of atomism is a negative judgment regarding the post-swerve constitution of the world, while what most obviously distinguishes their positions is their differing judgments regarding the preswerve rain of the atoms in the void (which Badiou assesses negatively and Rancière positively. Becoming clear both about how Badiou and Rancière respond to what comes before and after the atomistic swerve helps to clarify an implicit response on Rancière’s part to what has become Badiou’s chief objection to Rancière’s political theory. Second, this paper argues that the fact that Badiou assesses both what comes before and what comes after the swerve as negative, while Rancière assesses only what comes after the swerve as negative (because he assesses the pre-swerve rain of the atoms in the void positively, makes clear that their most essential point of difference concerns the status of the swerve that mediates between before and after. Working through the complexities of Badiou’s analysis of the swerve and uncovering Rancière’s extremely subtle analysis of the swerve helps to clarify a major aspect of what has become Rancière’s chief criticism of Badiou’s conception of philosophy.

Lesion type and reader experience affect the diagnostic accuracy of breast MRI: A multiple reader ROC study

Energy Technology Data Exchange (ETDEWEB)

Baltzer, Pascal A.T., E-mail: patbaltzer@gmail.com [Department of Biomedical Imaging and Imge-guided Therapy, Medical University of Vienna, Währinger Gürtel 18-20, 1090 Vienna (Austria); Kaiser, Werner Alois [Department of Diagnostic and Interventional Radiology, University Hospital Jena, Erlanger Allee 101, 07740 Jena (Germany); Dietzel, Matthias, E-mail: dietzelmatthias2@hotmail.com [Department of Neuroradiology, University Hospital Erlangen, Schwabachanlage 6, 91054 Erlangen (Germany)

2015-01-15

Highlights: • The main findings of our study are, that reader experience and lesion type (i.e., mass versus non-mass enhancement) are independent predictors of the diagnostic accuracy of breast MRI. • Specifically, benign and malignant non-mass lesions cannot be differentiated with sufficient accuracy, especially if readers are not experienced. • We conclude that future research in breast MRI should focus on non-mass lesions, as these are the problem makers in modern breast MRI. - Abstract: Purpose: To evaluate the influence of lesion type (mass versus non-mass) and reader experience on the diagnostic performance of breast MRI (BMRI) in a non-screening setting. Materials and methods: Consecutive patients (mean age, 55 ± 12 years) with breast lesions that were verified by biopsy or surgery, and who had had BMRI as part of their diagnostic workup, were eligible for this retrospective single-center study. Cancers diagnosed by biopsy before BMRI were excluded to eliminate biological and interpretation bias due to biopsy or chemotherapy effects (n = 103). Six blinded readers (experience level, high (HE, n = 2); intermediate (IE, n = 2); and low (LE, n = 2)) evaluated all examinations and assigned independent MRI BI-RADS ratings. Lesion type (mass, non-mass, focal) was noted. Receiver operating characteristics (ROC) and logistic regression analysis was performed to compare diagnostic accuracies. Results: There were 259 histologically verified lesions (123 malignant, 136 benign) investigated. There were 169 mass (103 malignant, 66 benign) and 48 non-mass lesions (19 malignant, 29 benign). Another 42 lesions that met the inclusion criteria were biopsied due to conventional findings (i.e., microcalcifications, architectural distortions), but did not enhance on MRI (41 benign, one DCIS). ROC analysis revealed a total area under the curve (AUC) between 0.834 (LE) and 0.935 (HI). Logistic regression identified a significant effect of non-mass lesions (P < 0.0001) and

Comparing risk of failure models in water supply networks using ROC curves

International Nuclear Information System (INIS)

Debon, A.; Carrion, A.; Cabrera, E.; Solano, H.

2010-01-01

The problem of predicting the failure of water mains has been considered from different perspectives and using several methodologies in engineering literature. Nowadays, it is important to be able to accurately calculate the failure probabilities of pipes over time, since water company profits and service quality for citizens depend on pipe survival; forecasting pipe failures could have important economic and social implications. Quantitative tools (such as managerial or statistical indicators and reliable databases) are required in order to assess the current and future state of networks. Companies managing these networks are trying to establish models for evaluating the risk of failure in order to develop a proactive approach to the renewal process, instead of using traditional reactive pipe substitution schemes. The main objective of this paper is to compare models for evaluating the risk of failure in water supply networks. Using real data from a water supply company, this study has identified which network characteristics affect the risk of failure and which models better fit data to predict service breakdown. The comparison using the receiver operating characteristics (ROC) graph leads us to the conclusion that the best model is a generalized linear model. Also, we propose a procedure that can be applied to a pipe failure database, allowing the most appropriate decision rule to be chosen.

Comparing risk of failure models in water supply networks using ROC curves

Energy Technology Data Exchange (ETDEWEB)

Debon, A., E-mail: andeau@eio.upv.e [Centro de Gestion de la Calidad y del Cambio, Dpt. Estadistica e Investigacion Operativa Aplicadas y Calidad, Universidad Politecnica de Valencia, E-46022 Valencia (Spain); Carrion, A. [Centro de Gestion de la Calidad y del Cambio, Dpt. Estadistica e Investigacion Operativa Aplicadas y Calidad, Universidad Politecnica de Valencia, E-46022 Valencia (Spain); Cabrera, E. [Dpto. De Ingenieria Hidraulica Y Medio Ambiente, Instituto Tecnologico del Agua, Universidad Politecnica de Valencia, E-46022 Valencia (Spain); Solano, H. [Universidad Diego Portales, Santiago (Chile)

2010-01-15

The problem of predicting the failure of water mains has been considered from different perspectives and using several methodologies in engineering literature. Nowadays, it is important to be able to accurately calculate the failure probabilities of pipes over time, since water company profits and service quality for citizens depend on pipe survival; forecasting pipe failures could have important economic and social implications. Quantitative tools (such as managerial or statistical indicators and reliable databases) are required in order to assess the current and future state of networks. Companies managing these networks are trying to establish models for evaluating the risk of failure in order to develop a proactive approach to the renewal process, instead of using traditional reactive pipe substitution schemes. The main objective of this paper is to compare models for evaluating the risk of failure in water supply networks. Using real data from a water supply company, this study has identified which network characteristics affect the risk of failure and which models better fit data to predict service breakdown. The comparison using the receiver operating characteristics (ROC) graph leads us to the conclusion that the best model is a generalized linear model. Also, we propose a procedure that can be applied to a pipe failure database, allowing the most appropriate decision rule to be chosen.

Use of the ROC model for optimalization in radiotherapy for head and neck cancers. Pt. 2. Cancer of the oral cavity

International Nuclear Information System (INIS)

Maciejewski, B.; Zajusz, A.; Rota, L.

1993-01-01

The ROC model is used to estimate optimal radiation treatment for cancer of the oral cavity. For 210 patients with cancer of the oral cavity iso-utility curves and k values were determined for various tumors stages and overall treatment times. Optimal k value decreases from 0.792 to 0.584 when overall treatment time is prolonged from 35 to 49 days. It may suggest that the planning of extra dose to balance the effect of extension of overall treatment time does not really improve therapeutic gain. (author)

In-house validation study of the DuPont Qualicon BAX system Q7 instrument with the BAX system PCR Assay for Salmonella (modification of AOAC Official Method 2003.09 and AOAC Research Institute Performance-Tested Method 100201).

Science.gov (United States)

Tice, George; Andaloro, Bridget; White, H Kirk; Bolton, Lance; Wang, Siqun; Davis, Eugene; Wallace, Morgan

2009-01-01

In 2006, DuPont Qualicon introduced the BAX system Q7 instrument for use with its assays. To demonstrate the equivalence of the new and old instruments, a validation study was conducted using the BAX system PCR Assay for Salmonella, AOAC Official Method 2003.09, on three food types. The foods were simultaneously analyzed with the BAX system Q7 instrument and either the U.S. Food and Drug Administration Bacteriological Analytical Manual or the U.S. Department of Agriculture-Food Safety and Inspection Service Microbiology Laboratory Guidebook reference method for detecting Salmonella. Comparable performance between the BAX system and the reference methods was observed. Of the 75 paired samples analyzed, 39 samples were positive by both the BAX system and reference methods, and 36 samples were negative by both the BAX system and reference methods, demonstrating 100% correlation. Inclusivity and exclusivity for the BAX system Q7 instrument were also established by testing 50 Salmonella strains and 20 non-Salmonella isolates. All Salmonella strains returned positive results, and all non-Salmonella isolates returned a negative response.

Conformational and spectroscopic study of xanthogen ethyl formates, ROC(S)SC(O)OCH2CH3. Isolation of CH3CH2OC(O)SH

Science.gov (United States)

Juncal, Luciana C.; Cozzarín, Melina V.; Romano, Rosana M.

2015-03-01

ROC(S)SC(O)OCH2CH3, with R = CH3sbnd , (CH3)2CHsbnd and CH3(CH2)2sbnd , were obtained through the reaction between potassium xanthate salts, ROC(S)SK, and ethyl chloroformate, ClC(O)OCH2CH3. The liquid compounds were identified and characterized by 1H and 13C NMR and mass spectrometry. The conformations adopted by the molecules were studied by DFT methods. 6 conformers were theoretically predicted for R = CH3sbnd and (CH3)2CHsbnd , while the conformational flexibility of the n-propyl substituent increases the total number of feasible rotamers to 21. For the three molecules, the conformers can be associated in 3 groups, being the most stable the AS forms - the Cdbnd S double bond anti (A) with respect to the Csbnd S single bond and the Ssbnd C single bond syn (S) with respect to the Cdbnd O double bond - followed by AA and SS conformers. The vibrational spectra were interpreted in terms of the predicted conformational equilibrium, presenting the ν(Cdbnd O) spectral region signals corresponding to the three groups of conformers. A moderated pre-resonance Raman enhancement of the ν(Cdbnd S) vibrational mode of CH3(CH2)2OC(S)SC(O)OCH2CH3 was detected, when the excitation radiation approaches the energy of a n → π∗ electronic transition associated with the Cdbnd S chromophore. UV-visible spectra in different solvents were measured and interpreted in terms of TD-DFT calculations. The unknown molecule CH3CH2OC(O)SH was isolated by the UV-visible photolysis of CH3OC(S)SC(O)OCH2CH3 isolated in Ar matrix, and also obtained as a side-product of the reaction between potassium xanthate salts, ROC(S)SK, and ethyl chloroformate, ClC(O)OCH2CH3.

Violencia laboral externa en el ámbito de urgencias generales del Hospital Universitario Virgen del Rocío de Sevilla

Directory of Open Access Journals (Sweden)

Tatiana Chagoyen Barroso

Full Text Available Introducción: En los últimos años se ha incrementado la violencia laboral, y un sector de los más afectados es el sanitario. En la actualidad, está cobrando importancia la violencia laboral en el personal de urgencias. Las agresiones suelen ser por parte de los usuarios y, en ocasiones de sus familiares, a los profesionales de la Salud. Objetivos: Conocer si los trabajadores de Urgencias Generales del Hospital Universitario Virgen del Rocío (HUVR saben de la existencia de un plan de prevención y atención de agresiones para los profesionales del sistema público de Andalucía. Conocer agresiones no registradas hacia el personal de urgencias en HUVR. Material y métodos: Se trata de un estudio observacional, descriptivo con 221 trabajadores (68 varones y 153 mujeres, a los que se les entrega un cuestionario sobre la Violencia Laboral Externa (VLE percibida durante los 2 últimos años; se realiza un estudio descriptivo con análisis de frecuencias. Y posteriormente, se realizará test de Chi Cuadrado o prueba exacta de Fisher para ver si existe relación entre variables categóricas. Resultados: De 221 trabajadores que realizaron la encuesta, solo 26 conocen el plan de agresiones de HUVR. De 127 agresiones en los 2 últimos años, solo se registraron 13 (no existe significación estadística con sexo, edad o categoría profesional. Conclusiones: Existe infradeclaración de agresiones y un claro desconocimiento del plan de agresiones en el Hospital Universitario Virgen del Rocío.

Film-screen vs. digital radiography in rheumatoid arthritis of the hand. An ROC analysis

International Nuclear Information System (INIS)

Jonsson, A.; Borg, A.; Hannesson, P.; Herrlin, K.; Jonsson, K.; Sloth, M.; Pettersson, H.

1994-01-01

In a prospective investigation the diagnostic accuracy of filmscreen and digital radiography in rheumatoid arthritis of hands was compared. Seventy hands of 36 patients with established rheumatoid arthritis were included in the study. Each of 11 joints in every hand was evaluated regarding the following radiologic parameters: soft tissue swelling, joint space narrowing, erosions and periarticular osteopenia. The digital images were obtained with storage phosphor image plates and evaluated in 2 forms; as digital hard-copy on film and on a monitor of an interactive workstation. The digital images had a resolution of either 3.33 or 5.0 lp/mm. ROC curves were constructed and comparing the area under the curves no significant difference was found between the 3 different imaging forms in either resolution group for soft tissue swelling, joint space narrowing and erosions. The film-screen image evaluation of periarticular osteopenia was significantly better than the digital hard-copy one in the 3.33 lp/mm resolution group, but no significant difference was found in the 5.0 lp/mm group. These results support the view that currently available digital systems are capable of adequate diagnostic performance. (orig.)

Assessment of diagnostic value of various tumors markers (CEA, CA199, CA50) for colorectal neoplasm with logistic regression and ROC curve

International Nuclear Information System (INIS)

Gu Ping; Huang Gang; Han Yuan

2007-01-01

Objective: To assess the diagnostic value of CEA, CA199 and CA50 for colorectal neoplasm by logistic regression and ROC curve. Methods: Serum CEA (with CLIA), CA199 (with ECLIA) and CA50 (with IRMA) levels were measured in 75 patients with colorectal cancer, 35 patients with benign colorectal disorders and 49 controls. The area under the ROC curve (AUC)s of CEA, CA199, CA50 from logistic regression results were compared. Results: In the cancer-benign disorder group, the AUC of CA50 was larger than the AUC of CA199. AUC of combined CEA, CA50 was largest: not only larger than any AUC of CEA, CA50, CA199 alone but also larger than the AUC of the combined three markers (0.875 vs 0.604). In cancer-control group, the AUC of combination of CEA, CA199 and CA50 was larger than any AUC of CEA, CA199 or CA50 alone. Both in the cancer-benign disorder group or cancer-control group, the AUC of CEA was larger than the AUC of CA199 or CA50. Conclusion: CEA is of definite value in the diagnosis of colorectal cancer. For differential diagnosis, the combination of CEA and CA50 can give more information, while the combination of three tumor markers is less helpful. As an advanced statistical method, logistic regression can improve the diagnostic sensitivity and specificity. (authors)

76 FR 10584 - Notice of Receipt of Several Pesticide Petitions Filed for Residues of Pesticide Chemicals in or...

Science.gov (United States)

2011-02-25

... dimethylcyclopropanecarboxylate and its inactive R-isomers, in or on avocado; papaya; star apple; black sapote; mango; sapodilla... 0F7763. (EPA-HQ-OPP-2010-0888). E. I. DuPont de Nemours and Company, DuPont Crop Protection, 1700 Market...

Activity optimization method in nuclear medicine: a comparison with roc analysis

International Nuclear Information System (INIS)

Perez Diaz, M.; Diaz Rizo, O.; Lopez, A.; Estevez Aparicio, E.; Roque Diaz, R.

2006-01-01

Full text of publication follows: A discriminant method for optimizing the administered activity is validated by comparison with R.O.C. curves. The method is tested in 21 SPECT studies, performed with a Cardiac phantom. Three different cold lesions (L1, L2 and L3) are placed in the myocardium-wall by pairs for each SPECT. Three activities (84 MBq, 37 MBq or 18.5 MBq) of Tc 99 m diluted in water are used as background. The discriminant analysis is used to select the parameters that characterize image quality among the measured variables in the obtained tomographic images. They are a group of Lesion-to-Background (L/B) and Signal-to-Noise (S/N) ratios. Two clusters with different image quality (p=0.021) are obtained following the measured variables. The first one contains the studies performed with 37 MBq and 84 MBq and the second one the studies made with 18.5 MBq. Cluster classifications constitute the dependent variable in the discriminant function. The ratios B/L1, B/L2 and B/L3 are the parameters able to construct the function with 100 % of cases correctly classified into the clusters. The value of 37 MBq is the lowest tested activity that permits good results for the L/B variables, without significant differences respect to 84 MBq (p>0.05). The result is coincident with the applied R.O.C.-analysis, in which 37 MBq permits the highest area under the curve and low false-positive and false-negative rates with significant differences respect to 18.5 MBq (p=0.008)

Iconologie des infantes (Tumbo A et Tumbo B de la cathédrale de Saint-Jacques de Compostelle et Tumbo de Touxos Outos

Directory of Open Access Journals (Sweden)

Ghislaine Fournès

2008-07-01

Full Text Available Les miniatures des Tumbos A et B de la cathédrale de Saint-Jacques de Compostelle et du Tumbo de Touxos Outos établissent à travers la représentation des rois, reines et infantes, d’Alphonse II à Alphonse X, une généalogie royale. L’analyse des miniatures consacrées aux figures féminines confirme que, dans le royaume de León et en Castille, les infantes ont eu, aux XIe et XIIe siècles, un rôle majeur, spirituel et politique, notamment à travers l’institution de l’infantat.Las miniaturas de los Tumbos A y B de la catedral de Santiago de Compostela, y del Tumbo de Touxos Outos establecen a través de la representación de los reyes, reinas e infantas, desde Alfonso II hasta Alfonso X, una genealogía real. El análisis de las miniaturas dedicadas a las figuras femeninas confirma que, en el reino de León y en Castilla, las infantas detuvieron, durante los siglos XI y XII, un papel importante, a la vez espiritual y político, sobre todo gracias a la institución del infantado.

On the analysis of glycomics mass spectrometry data via the regularized area under the ROC curve

Directory of Open Access Journals (Sweden)

Lebrilla Carlito B

2007-12-01

Full Text Available Abstract Background Novel molecular and statistical methods are in rising demand for disease diagnosis and prognosis with the help of recent advanced biotechnology. High-resolution mass spectrometry (MS is one of those biotechnologies that are highly promising to improve health outcome. Previous literatures have identified some proteomics biomarkers that can distinguish healthy patients from cancer patients using MS data. In this paper, an MS study is demonstrated which uses glycomics to identify ovarian cancer. Glycomics is the study of glycans and glycoproteins. The glycans on the proteins may deviate between a cancer cell and a normal cell and may be visible in the blood. High-resolution MS has been applied to measure relative abundances of potential glycan biomarkers in human serum. Multiple potential glycan biomarkers are measured in MS spectra. With the objection of maximizing the empirical area under the ROC curve (AUC, an analysis method was considered which combines potential glycan biomarkers for the diagnosis of cancer. Results Maximizing the empirical AUC of glycomics MS data is a large-dimensional optimization problem. The technical difficulty is that the empirical AUC function is not continuous. Instead, it is in fact an empirical 0–1 loss function with a large number of linear predictors. An approach was investigated that regularizes the area under the ROC curve while replacing the 0–1 loss function with a smooth surrogate function. The constrained threshold gradient descent regularization algorithm was applied, where the regularization parameters were chosen by the cross-validation method, and the confidence intervals of the regression parameters were estimated by the bootstrap method. The method is called TGDR-AUC algorithm. The properties of the approach were studied through a numerical simulation study, which incorporates the positive values of mass spectrometry data with the correlations between measurements within person

A transfer of technology from engineering: use of ROC curves from signal detection theory to investigate information processing in the brain during sensory difference testing.

Science.gov (United States)

Wichchukit, Sukanya; O'Mahony, Michael

2010-01-01

This article reviews a beneficial effect of technology transfer from Electrical Engineering to Food Sensory Science. Specifically, it reviews the recent adoption in Food Sensory Science of the receiver operating characteristic (ROC) curve, a tool that is incorporated in the theory of signal detection. Its use allows the information processing that takes place in the brain during sensory difference testing to be studied and understood. The review deals with how Signal Detection Theory, also called Thurstonian modeling, led to the adoption of a more sophisticated way of analyzing the data from sensory difference tests, by introducing the signal-to-noise ratio, d', as a fundamental measure of perceived small sensory differences. Generally, the method of computation of d' is a simple matter for some of the better known difference tests like the triangle, duo-trio and 2-AFC. However, there are occasions when these tests are not appropriate and other tests like the same-different and the A Not-A test are more suitable. Yet, for these, it is necessary to understand how the brain processes information during the test before d' can be computed. It is for this task that the ROC curve has a particular use. © 2010 Institute of Food Technologists®

A Stretchable Radio-Frequency Strain Sensor Using Screen Printing Technology.

Science.gov (United States)

Jeong, Heijun; Lim, Sungjoon

2016-11-02

In this paper, we propose a stretchable radio-frequency (RF) strain sensor fabricated with screen printing technology. The RF sensor is designed using a half-wavelength patch that resonates at 3.7 GHz. The resonant frequency is determined by the length of the patch, and it therefore changes when the patch is stretched. Polydimethylsiloxane (PDMS) is used to create the substrate, because of its stretchable and screen-printable surface. In addition, Dupont PE872 (Dupont, NC, American) silver conductive ink is used to create the stretchable conductive patterns. The sensor performance is demonstrated both with full-wave simulations and with measurements carried out on a fabricated sample. When the length of the patch sensor is increased by a 7.8% stretch, the resonant frequency decreases from 3.7 GHz to 3.43 GHz, evidencing a sensitivity of 3.43 × 10⁷ Hz/%. Stretching the patch along its width does not change the resonant frequency.

The recent development of isotope and radiation application in Taiwan, ROC

Energy Technology Data Exchange (ETDEWEB)

Ting, Gann; Tsai, Zei-Tsan; Huang, Henton [Institute of Nuclear Energy Research, Lung-Tan, TW (China)

1996-10-01

The Institute of Nuclear Energy Research (INER) plays a vital role in both isotope and radiation application in Taiwan, ROC. For research and development of reactor-produced radioisotopes, both Sr-90/Y-90 and W-188/Re-188 generators for therapeutic application were emphasized. For production of cyclotron-produced radioisotopes, I-123, Tl-201, Ga-67, In-111, Co-67 and F-18 were generated using a TR-30/15 cyclotron with H{sup -}/D{sup -} 30MeV/15MeV and maximum beam current of 400{mu}A/150{mu}A. For preparation of radiopharmaceuticals, a number of organic ligands have been synthesized such as d,1-hexamethylpropyleneamine oxime (HMPAO), N- (S-benzoylmercaptoacetyl) triglycine (S-Bz-MAG{sub 3}), 2-alkoxyisobutylisonitrile and metaiodobenzylguanidine (MIBG) and octreotide. R/D and production of radiopharmaceuticals have been carried out in cooperation with domestic hospitals. Some research work related to target radiotherapeutic and radiopharmaceuticals has also been carried out with cooperation of domestic hospitals. The C-13 urea breath test (C-13-UBT) has been extensively studied clinically to investigate the prevalence of Helicobacter pylori infection. The detection of this bacteria in the stomach ulcer becomes very important in both diagnosis and therapy monitoring. There are three large Co-60 irradiation plant in Taiwan. The radiosterilization of medical devices has been used in Taiwan for more than 14 years. Besides INER conducted R/D on (1) radiosterilization study of porcine serum, (2) insect sterilization, (3) treatment of condensate microphone with gamma ray, and (4) radiation polymerization for industry and medical applications. In conclusion, the prospects of isotope and radiation applications in Taiwan are very promising and encouraging. The R/D and development of the applications will contribute technical, economic and social benefits to the society. (J.P.N.)

Factorial Analysis of Profitability

OpenAIRE

Georgeta VINTILA; Ilie GHEORGHE; Ioana Mihaela POCAN; Madalina Gabriela ANGHEL

2012-01-01

The DuPont analysis system is based on decomposing the profitability ratio in factors of influence. This paper describes the factorial analysis of profitability based on the DuPont system. Significant importance is given to the impact on various indicators on the shares value and profitability.

Evaluation of computer tomograms using a black-and-white monitor and a colour monitor: A ROC comparison

International Nuclear Information System (INIS)

Rockstroh, G.; Rotte, K.H.; Kriedemann, E.

1987-01-01

Different views about the value of a colour monitor for the evaluation of computer tomograms have prompted us to carry out this ROC (Receiver Operation Characteristic) examination. The latter was based on patient computer tomograms in which lesions of the liver were simulated by image manipulation. 5 radiologists analysed the image material (a) on a black-and-white monitor, (b) on a colour monitor, and (c) simultaneously on a black-and-white and a colour monitor. The study shows that the use of a colour monitor gives no essentially different result than evaluation with a black-and-white monitor. The slightly better result of 2% more true positive findings with simultaneous representation of black-and-white and colour image relative to the sole use of black-and-white display is within error limits. The colour representation gives no advantages for the evaluation of usual computer tomograms because the window technique enables a contrasty representation in black-and-white too. (orig.) [de

[Programme review of somatropin deficit in pediatrics at the Hospital Universitario Virgen del Rocío].

Science.gov (United States)

Lavaredas, A; de la Puerta, R; Álvarez del Vayo, C

2013-01-01

To develop a program review of somatropin deficit, applied in pediatrics at the Hospital Universitario Virgen del Rocío, using two groups of patients: the ones diagnosed with deficiency of this hormone, and those born small for gestational age, with the intention of evaluating its effectiveness in the first year of treatment. Attaining a retrospective study of the cohort of patients treated with growth hormone under the above diagnoses, with cross-sectional and observational methodology, to which we applied a statistical analysis with the Statistical Package for Social Sciences®. After the beginning of the treatment, the growth rate had increased and the bone age approximated to the chronologic age. In the two treated groups in the first year of treatment were the female patients aged between 0 to 12 years with a deficit of growth hormone who responded better to therapy. We observed that the treatment instituted appeared highly effective in both groups of patients, allowing a favorable increase in height. Copyright © 2013 SEFH. Published by AULA MEDICA. All rights reserved.

Scientific Opinion related to a notification from DuPont Nutrition Biosciences Aps on behenic acid from mustard seeds to be used in the manufacturing of certain emulsifiers pursuant to Article 21(2) of Regulation (EU) No 1169/2011 – for permanent exemption from labelling

DEFF Research Database (Denmark)

Sjödin, Anders Mikael

2016-01-01

Following a request from the European Commission, the Panel on Dietetic Products, Nutrition and Allergies (NDA) was asked to deliver a scientific opinion related to a notification from DuPont Nutrition Biosciences Aps on behenic acid from mustard seeds to be used in the manufacturing of certain...... and peptides may not be carried over into behenic acid after the two distillation steps reported in the manufacturing process in amounts beyond 1 mg/kg. The Panel notes that the maximum amount of mustard protein that could be consumed from emulsifiers manufactured from behenic acid (E 470a, E 471 and E 477......) on a single occasion by an adult under the proposed conditions of use would be around 0.00119 mg, which is about 1,000 times lower than the protein doses reported to trigger allergic reactions in mustard-allergic individuals (around 1 mg). On the basis of the data presented, the Panel concludes that oral...

Serge Dassault, chair of the Dassault Group and Socpresse and senator of Essonne, participated in the Amicable Economic and Social Council of France at CERN on 15 June.

CERN Multimedia

Maximilien Brice

2006-01-01

Dassault visited the underground cavern of the ATLAS experiment together with his son, Olivier, and Jean Jacques Blaising, head of the Physics Department. The participants also toured the LHC magnet assembly and testing hall, and the surface assembly hall and experimental cavern of the CMS experiment.

European Science Notes Information Bulletin: Reports on Current European/Middle Eastern Science

Science.gov (United States)

1992-06-01

collaboration with DuPont, The researchers, Dr. C. Galiotis and Dr. C. Vlattas is exploiting the biodegradability of poly(lactides)! This (Queen Mary...state properties and crystal structures of Poly growth; novel morphology in ny’-n 46 leading to en- (L-lactides). This is an interesting biodegradable ...include ing of some spectacular movies illustrating the motion single crystals (B. Susla, Poznan Technical University of individual atoms on surfaces

The Weiss Functional Impairment Rating Scale-Parent Form for assessing ADHD: evaluating diagnostic accuracy and determining optimal thresholds using ROC analysis.

Science.gov (United States)

Thompson, Trevor; Lloyd, Andrew; Joseph, Alain; Weiss, Margaret

2017-07-01

The Weiss Functional Impairment Rating Scale-Parent Form (WFIRS-P) is a 50-item scale that assesses functional impairment on six clinically relevant domains typically affected in attention-deficit/hyperactivity disorder (ADHD). As functional impairment is central to ADHD, the WFIRS-P offers potential as a tool for assessing functional impairment in ADHD. These analyses were designed to examine the overall performance of WFIRS-P in differentiating ADHD and non-ADHD cases using receiver operating characteristics (ROC) analysis. This is the first attempt to empirically determine the level of functional impairment that differentiates ADHD children from normal controls. This observational study comprised 5-19-year-olds with physician-diagnosed ADHD (n = 476) and non-ADHD controls (n = 202). ROC analysis evaluated the ability of WFIRS-P to discriminate between ADHD and non-ADHD, and identified a WFIRS-P cut-off score that optimises correct classification. Data were analysed for the complete sample, for males versus females and for participants in two age groups (5-12 versus 13-19 years). Area under the curve (AUC) was 0.91 (95% confidence interval 0.88-0.93) for the overall WFIRS-P score, suggesting highly accurate classification of ADHD distinct from non-ADHD. Sensitivity (0.83) and specificity (0.85) were maximal for a mean overall WFIRS-P score of 0.65, suggesting that this is an appropriate threshold for differentiation. DeLong's test found no significant differences in AUCs for males versus females or 5-12 versus 13-19 years, suggesting that WFIRS-P is an accurate classifier of ADHD across gender and age. When assessing function, WFIRS-P appears to provide a simple and effective basis for differentiating between individuals with/without ADHD in terms of functional impairment. Disease-specific applications of QOL research.

Revisión del programa de déficit de somatropina en pediatría en el Hospital Universitario Virgen del Rocío

OpenAIRE

Lavaredas, A.; Puerta, R. de la; Álvarez del Vayo, C.

2013-01-01

Objetivo: Elaborar una revisión del programa de déficit de somatropina aplicado en pediatría en el Hospital Universitario Virgen del Rocío, utilizando dos grupos de pacientes, los diagnosticados con déficit de esta hormona y los nacidos pequeños para edad gestacional, con la intención de evaluar su efectividad en el primer año de tratamiento. Método: Realización de un estudio retrospectivo de la cohorte de pacientes en tratamiento con la hormona del crecimiento bajo los diagnósticos mencionad...

76 FR 69746 - Eunice Kennedy Shriver National Institute of Child Health & Human Development; Notice of Closed...

Science.gov (United States)

2011-11-09

...) of the Federal Advisory Committee Act, as amended (5 U.S.C. App.), notice is hereby given of the..., 2011. Time: 8 a.m. to 5 p.m. Agenda: To review and evaluate grant applications. Place: The Dupont Hotel.... Agenda: To review and evaluate grant applications. Place: The Dupont Hotel, 1500 New Hampshire Avenue NW...

Acurácia de critérios para vagotonia no eletrocardiograma de repouso de 12 derivações: uma análise com curvas ROC Accuracy of vagotonia criteria in the 12-lead resting electrocardiogram: analysis with ROC curves

Directory of Open Access Journals (Sweden)

José Kawazoe Lazzoli

2002-04-01

Full Text Available OBJETIVO: Determinar a sensibilidade, a especificidade, os valores preditivos positivo e negativo e a acurácia de diferentes critérios eletrocardiográficos para vagotonia. MÉTODOS: Foram avaliados 74 atletas olímpicos brasileiros (51 homens e 23 mulheres com idade entre 16 e 42 anos (24 ± 5 anos, tendo sido realizados, entre outros exames, um ECG de repouso de 12 derivações e uma avaliação do tônus vagal cardíaco (TVC pelo teste de exercício sem carga de quatro segundos (T4s, cujo índice B/C (indicativo da magnitude do TVC foi utilizado como padrão-ouro. O T4s é um teste que se baseia no mecanismo da taquicardia inicial do exercício e foi anteriormente padronizado e validado como capaz de avaliar o TVC sem influência do componente simpático. Dados de 10 atletas foram excluídos devido à presença de critérios ecocardiográficos para hipertrofia ventricular esquerda, ainda que provavelmente fisiológica. Com o auxílio de curvas ROC (receiver operating characteristic, selecionou-se o ponto de corte com a melhor combinação entre sensibilidade (Sens e especificidade (Esp para cada variável do ECG, calculando-se os valores preditivos positivo (VPP e negativo (VPN e a acurácia (AC. Foram ainda correlacionados o índice B/C e as variáveis do ECG. RESULTADOS: Há fraca associação entre o índice B/C e as variáveis do ECG, à exceção da duração do intervalo R-R (r = 0,353; P = 0,004, que também apresentou curva ROC significativa (chi2= 0,863; P = 0,002, sendo que o critério intervalo R-R > ou = 990ms apresentou os seguintes resultados: Sens - 100%; Esp - 73%; VPP 20%; VPN 100%; AC 75%. As variáveis do ECG que apresentaram pontos de corte com acurácia > 80% foram: amplitude da onda T em V5 > ou = 8,0mm; amplitude da onda T em V6 > ou = 7,0mm; amplitude da onda Q em V5 > ou = 7,0mm; amplitude da onda R em V4 > ou = 50,0mm; presença de supradesnível de ponto J em duas ou mais derivações; presença de supradesn

Ecrire à la suite de : Andrée Lacelle, Andrée Christensen et Jacques Flamand, Paul Savoie et Dyane Léger

Directory of Open Access Journals (Sweden)

Catherine Parayre

2012-05-01

Full Text Available « Ecrire à la suite de » est un procédé d’écriture courant dans la littérature, qu’il s’agisse de mettre en relief l’intertextualité de l’œuvre (par exemple, en incluant des citations, de s’adonner à un travail basé sur l’intermédialité (par exemple, dans un texte rédigé à partir de photographies ou encore d’écrire à quatre mains, lorsqu’un des deux auteurs ajoute son texte à celui du partenaire d’écriture. Ne faisant pas exception, les littératures francophones du Canada pratiquent tout aussi fréquemment cette écriture de l’après. Le présent article en examinera quelques exemples dans des œuvres de nature introspective : La lumière et l’heure : poèmes et carnets (2004 d’Andrée Lacelle, avec des tableaux de Réjine Halimi ; Lithochronos ou le premier vol de la pierre (1999 d’Andrée Christensen et Jacques Flamand, avec des photographies de Christensen ; et L’incendiaire (2008 de Paul Savoie et Dyane Léger. L’analyse montrera que l’écriture « à la suite de », aussi variées qu’en soient les manifestations, non seulement met en évidence la présence de l’auteur dans ces textes, mais a aussi pour résultat, dans ces œuvres méditatives, de dédramatiser et d’amenuiser l’intensité de la réflexion existentielle.

Sovereignty and Democracy in Global Times: acutality of the Jean-Jacques Rousseau Political Philosophy and the limits of the social contract

Directory of Open Access Journals (Sweden)

Marcus Baccega

2017-09-01

Full Text Available SOBERANIA E DEMOCRACIA EM TEMPOS MUNDIALIZADOS: ATUALIDADE DA FILOSOFIA POLÍTICA DE JEAN-JACQUES ROUSSEAU E OS LIMITES DO CONTRATO SOCIAL Resumo: este artigo visa a problematizar os (descaminhos dos conceitos políticos e das práticas sociais e jurídicas em torno da soberania política do Estado Nacional e da democracia nos tempos de mundialização do Capital. Portanto, revisita e percorre uma breve arqueologia conceitual da Soberania, desde Isidoro de Sevilha até a clássica definição de Jean Bodin nos Seis Livros sobre a República (1576. O propósito é problematizar a filosofia política de Rousseau para, então, perceber e discutir seus limites suas virtualidades, bem como a atualidade de sua noção de Contrato Social e o papel da Filosofia Política na Era do Capital Global. Palavras-chave: Rousseau. Soberania. Mundialização do Capital. Abstract: this paper casts doubt on the ways and shunts of political concepts and social and legal practices concerning political sovereignty of the Nation State and democracy at the time of Capital’s globalization. It revisits a brief conceptual archeology of Sovereignty, since Isidore of Seville to the classical definition by Jean Bodin in The Six Books on the Republic (1576. The purpose is casting doubt on the political philosophy of Rousseau, in order to discuss its limits and virtualities, and the topicality of his notion of social contract and the role of Political Philosophy at the Age of Global Capital. Keywords: Rousseau. Sovereignty. Globalization of Capital.

[Multiple linear regression and ROC curve analysis of the factors of lumbar spine bone mineral density].

Science.gov (United States)

Zhang, Xiaodong; Zhao, Yinxia; Hu, Shaoyong; Hao, Shuai; Yan, Jiewen; Zhang, Lingyan; Zhao, Jing; Li, Shaolin

2015-09-01

To investigate the correlation between the lumbar vertebra bone mineral density (BMD) and age, gender, height, weight, body mass index, waistline, hipline, bone marrow and abdomen fat, and to explore the key factor affecting the BMD. A total of 72 cases were randomly recruited. All the subjects underwent a spectroscopic examination of the third lumber vertebra with single-voxel method in 1.5T MR. Lipid fractions (FF%) were measured. Quantitative CT were also performed to get the BMD of L3 and the corresponding abdomen subcutaneous adipose tissue (SAT) and visceral adipose tissue (VAT). The statistical analysis were performed by SPSS 19.0. Multiple linear regression showed except the age and FF% showed significant difference (P0.05). The correlation of age and FF% with BMD was statistically negatively significant (r=-0.830, -0.521, P<0.05). The ROC curve analysis showed that the sensitivety and specificity of predicting osteoporosis were 81.8% and 86.9%, with a threshold of 58.5 years old. And it showed that the sensitivety and specificity of predicting osteoporosis were 90.9% and 55.7%, with a threshold of 52.8% for FF%. The lumbar vertebra BMD was significantly and negatively correlated with age and bone marrow FF%, but it was not significantly correlated with gender, height, weight, BMI, waistline, hipline, SAT and VAT. And age was the critical factor.

“I am a place”: Aletheia as aesthetic and political resistance in Margaret Atwood's Surfacing

Directory of Open Access Journals (Sweden)

Joakim Wrethed

2015-07-01

Full Text Available The article investigates the aesthetic and political power of Margaret Atwood's 1972 novel Surfacing. It argues that the novel's perennial vitality is partly explained by Jacques Rancière's theory about the aesthetic regime of art that highlights the tension between art for art's sake and art as a political instrument. By means of phenomenological methodology and concepts, mainly derived from Martin Heidegger and Maurice Merleau-Ponty, the examination uncovers an experiential aesthetics intimately intertwined with the protagonist's perceptions throughout the narrative. These perceptions and impressions are permeated by a sense of semi-religious revelation. But here they are primarily seen from an epistemological perspective through the dominance of immediacy (denoted by the Greek aletheia over verificational dimensions (denoted by the Roman veritas. These predominantly sensory aspects of Surfacing make up the aesthetic nerve that is linked to the political impact of the work. Aletheia functions as a promise of emancipation since it transcends the political division of the sensory, that is, art for art's sake and art as life. But, Atwood's work also upholds this separation since aletheia is ultimately autonomous, which in turn sustains the autonomy of the novel. It is claimed that the persistent status of Surfacing—and thereby its sustained political impact—is ultimately due to its aesthetic integrity. The novel's more explicit political concerns of ecocriticism and feminism are secondary in relation to the force of aletheia.

Validation of the detection of STEC (O26, O45, O103, O111, O121, O145 and O157 in raw burgers using real-time PCR (BAX® System Q7, DuPont in “WET POOLS”

Directory of Open Access Journals (Sweden)

Paula Mussio

2014-12-01

Full Text Available Shiga toxin-producing Escherichia coli (STEC O157:H7 and no-O157:H7 have been identified as emerging foodborne pathogens responsible for an increasing number of outbreaks worldwide. Many foods have been associated to these outbreaks, mainly undercooked beef burgers. Due to the increasing production and consumption of burgers in our country, it is important to have a rapid technique to identify and isolate the most important STEC strains in foods matrixes.The objective of these investigation was to assess the sensitivity, specificity and limit detection for the screening of the most prevalent STEC in frozen raw beef burgers, using the "STEC Screening stx/eae " kit to detect the stx/eae genes and the "Panel 1 STEC E. coli O26, O111, O121" and "Panel 2 STEC E. coli O45, O103, O145" and "E. coli O157: H7 MP” (DuPont kits for the detection of the different serogroups. The use of composed samples (wet pools, the recovery of each strain from the positives samples on selective media after specified inmunoconcentration and the detection of stx/eae virulence genes in isolates by PCR were also evaluated. We validated a technique that allows the detection of the mentioned STEC strains with limits of detection between 1-5 CFU in 65 grams of raw frozen hamburgers, using wet pools. 

The Effects of Mass Media Advertising on U.S. Army Recruiting.

Science.gov (United States)

1982-03-16

the analysis of the product, markets desired to be entered, mo- tives of the advertiser , messages to be presented, media to r -------- 12 be used to... market its products. Sales is a major DuPont advertising objective, but not the only objective. DuPont used selected panels of individuals to expose to its...center, objectives could be formed and operationalized for each advertising program. Overall re- search strategy could be planned, and specific

Jean-Jacques Rousseau

DEFF Research Database (Denmark)

Larsen, Mihail

2009-01-01

  "Klassisk og modernepolitisk teori" er en bred indføring i politiske teorier, traditioner og forskningsfelter fra Platon og Aristoteles til vor tids stadig mere omfattende og specialiserede politiske tænkning. "Rousseau" rummer en systematisk gennemgang af Rousseaus forfatterskab med vægt på ha...

Assessment of diagnostic value of tumor markers for colorectal neoplasm by logistic regression and ROC curve

International Nuclear Information System (INIS)

Ping, G.

2007-01-01

Full text: Objective: To assess the diagnostic value of CEA CA199 and CA50 for colorectal neoplasm by logistic regression and ROC curve. Methods: The subjects include 75 patients of colorectal cancer, 35 patients of benign intestinal disease and 49 health controls. CEA CA199 and CA50 are measured by CLIA ECLIA and IRMA respectively. The area under the curve (AUC) of CEA CA 199 CA50 and logistic regression results are compared. [Result] In the cancer-benign group, the AUC of CA50 is larger than the AUC of CA199 Compared with the AUC of combination of CEA CA199 and CA50 (0.604),the AUC of combination of CEA and CA50 (0.875) is larger and it is also larger than any other AUC of CEA CA199 or CA50 alone. In the cancerhealth group, the AUC of combination of CEA CA199 and CA50 is larger than any other AUC of CEA CA199 or CA50 alone. No matter in the cancer-benign group or cancerhealth group. The AUC of CEA is larger than the AUC of CA199 or CA50. Conclusion: CEA is useful in the diagnosis of colorectal cancer. In the process of differential diagnosis, the combination of CEA and CA50 can give more information, while the combination of three tumor markers does not perform well. Furthermore, as a statistical method, logistic regression can improve the diagnostic sensitivity and specificity. (author)

Proximal surface caries detection with direct-exposure and rare earth screen/film imaging

International Nuclear Information System (INIS)

Lundeen, R.C.; McDavid, W.D.; Barnwell, G.M.

1988-01-01

This laboratory study compared five imaging systems for their diagnostic accuracy in detection of proximal surface dental caries. Ten viewers provided data on radiographic detectability of carious lesions. The diagnostic accuracy of each system was determined with receiver operating characteristic (ROC) curves by comparing viewer data with the true state of the teeth as determined microscopically. D-speed film marginally outperformed the other four systems, but the three screen/film systems matched the diagnostic accuracy of E-speed film. Radiation reductions between 62% and 92% were achieved with the screen/film systems when compared to the two conventional dental films. The feasibility of designing a screen/film bite-wing cassette was shown, but the poor diagnostic accuracy of the present bite-wing system indicated a need for a new technology in caries detection

The pvc operon regulates the expression of the Pseudomonas aeruginosa fimbrial chaperone/usher pathway (cup genes.

Directory of Open Access Journals (Sweden)

Uzma Qaisar

Full Text Available The Pseudomonas aeruginosa fimbrial structures encoded by the cup gene clusters (cupB and cupC contribute to its attachment to abiotic surfaces and biofilm formation. The P. aeruginosa pvcABCD gene cluster encodes enzymes that synthesize a novel isonitrile functionalized cumarin, paerucumarin. Paerucumarin has already been characterized chemically, but this is the first report elucidating its role in bacterial biology. We examined the relationship between the pvc operon and the cup gene clusters in the P. aeruginosa strain MPAO1. Mutations within the pvc genes compromised biofilm development and significantly reduced the expression of cupB1-6 and cupC1-3, as well as different genes of the cupB/cupC two-component regulatory systems, roc1/roc2. Adjacent to pvc is the transcriptional regulator ptxR. A ptxR mutation in MPAO1 significantly reduced the expression of the pvc genes, the cupB/cupC genes, and the roc1/roc2 genes. Overexpression of the intact chromosomally-encoded pvc operon by a ptxR plasmid significantly enhanced cupB2, cupC2, rocS1, and rocS2 expression and biofilm development. Exogenously added paerucumarin significantly increased the expression of cupB2, cupC2, rocS1 and rocS2 in the pvcA mutant. Our results suggest that pvc influences P. aeruginosa biofilm development through the cup gene clusters in a pathway that involves paerucumarin, PtxR, and different cup regulators.

Le début du ive s. av. J.-C. dans l’espace culturel sénonais : les habitats de Bois d’Echalas à Ville-Saint-Jacques et de Beauchamp à Varennes-sur-Seine (Seine-et-Marne dans le contexte de l’interfluve Seine-Yonne The beginning of the 4th century BC in the the cultural space of the 'Sénonais': the settlements of Bois d’Echalas at Ville-Saint-Jacques and Beauchamp at Varennes-sur-Seine (Seine-et-Marne in the context of the land separating the Seine and the Yonne

Directory of Open Access Journals (Sweden)

Jean-Marc Séguier

2008-04-01

Full Text Available L’étude de deux habitats du début du ive s. av. J.-C. installés à proximité de la confluence Seine-Yonne permet de définir le faciès mobilier de cette partie du Bassin parisien au cours de La Tène B1a, notamment grâce à l’association d’un important cortège de céramiques locales et importées et d’un mobilier métallique significatif. L’analyse des structures de conservation et du mobilier conduit à établir une hiérarchie des établissements. Celui de Ville-Saint-Jacques, Bois d’Echalas, occupe une place prééminente dans le système social mis en place dans la région considérée, alors que celui de Varennes-sur-Seine, Beauchamp, se révèle d’un niveau inférieur. Au-delà de la comparaison entre les deux sites, c’est une lecture socio-économique de l’organisation territoriale qui est proposée.The study of two settlements of the beginning of the 4th century BC near the confluence of the Seine and the Yonne enables us to define the movable culture of this part of the Paris basin during La Tène B1a, notably because of the association of an important series of local and imported ceramics and significant metal articles. The analysis of the structures of conservation and of furniture lead to the establishment of a hierachy of settlements. That of Ville-Saint-Jacques, Bois d’Echalas, occupied a prominent place in the social system set up in the region in question, whereas that of Varennes-sur-Seine, Beauchamp, proved to be of a lower level. Beyond the comparison between the two sites, what is presented is a socio-economic lecture on territorial organisation.

Døden, ånden og historien i kunsten. En analyse af historiebegrebernt med eksempel i Bertel Thorvaldsen

DEFF Research Database (Denmark)

Holm, Henrik

2003-01-01

Berteæ Thorvaldsen, J.F.G. Hegel, Friedrich Nietzche, Erwin Panofsky, Hayden White, Jacques Derrida, Kunsthistorie, historie, skulptur, æstetik......Berteæ Thorvaldsen, J.F.G. Hegel, Friedrich Nietzche, Erwin Panofsky, Hayden White, Jacques Derrida, Kunsthistorie, historie, skulptur, æstetik...

Aurora energy resources

Energy Technology Data Exchange (ETDEWEB)

Falconer, D. [Aurora Energy Resources Inc., Vancouver, British Columbia (Canada)

2009-07-01

This paper describes the structure and activities of Aurora, a mining company which owns uranium mines, open pit mines at Michelin, Jacques Lake and Rainbow and underground mines at Michelin and Jacques Lake. The paper discusses issues such as economics, mining, processing and environmental impacts.

A modified Wald interval for the area under the ROC curve (AUC) in diagnostic case-control studies.

Science.gov (United States)

Kottas, Martina; Kuss, Oliver; Zapf, Antonia

2014-02-19

The area under the receiver operating characteristic (ROC) curve, referred to as the AUC, is an appropriate measure for describing the overall accuracy of a diagnostic test or a biomarker in early phase trials without having to choose a threshold. There are many approaches for estimating the confidence interval for the AUC. However, all are relatively complicated to implement. Furthermore, many approaches perform poorly for large AUC values or small sample sizes. The AUC is actually a probability. So we propose a modified Wald interval for a single proportion, which can be calculated on a pocket calculator. We performed a simulation study to compare this modified Wald interval (without and with continuity correction) with other intervals regarding coverage probability and statistical power. The main result is that the proposed modified Wald intervals maintain and exploit the type I error much better than the intervals of Agresti-Coull, Wilson, and Clopper-Pearson. The interval suggested by Bamber, the Mann-Whitney interval without transformation and also the interval of the binormal AUC are very liberal. For small sample sizes the Wald interval with continuity has a comparable coverage probability as the LT interval and higher power. For large sample sizes the results of the LT interval and of the Wald interval without continuity correction are comparable. If individual patient data is not available, but only the estimated AUC and the total sample size, the modified Wald intervals can be recommended as confidence intervals for the AUC. For small sample sizes the continuity correction should be used.

Atomic Oxygen Erosion Yield Dependence Upon Texture Development in Polymers

Science.gov (United States)

Banks, Bruce A.; Loftus, Ryan J.; Miller, Sharon K.

2016-01-01

The atomic oxygen erosion yield (volume of a polymer that is lost due to oxidation per incident atom) of polymers is typically assumed to be reasonably constant with increasing fluence. However polymers containing ash or inorganic pigments, tend to have erosion yields that decrease with fluence due to an increasing presence of protective particles on the polymer surface. This paper investigates two additional possible causes for erosion yields of polymers that are dependent upon atomic oxygen. These are the development of surface texture which can cause the erosion yield to change with fluence due to changes in the aspect ratio of the surface texture that develops and polymer specific atomic oxygen interaction parameters. The surface texture development under directed hyperthermal attack produces higher aspect ratio surface texture than isotropic thermal energy atomic oxygen attack. The fluence dependence of erosion yields is documented for low Kapton H (DuPont, Wilmington, DE) effective fluences for a variety of polymers under directed hyperthermal and isotropic thermal energy attack.

Is there a link between blastomere contact surfaces of day 3 embryos and live birth rate?

Directory of Open Access Journals (Sweden)

Paternot Goedele

2012-09-01

Full Text Available Abstract Background Cell-cell communication and adhesion are essential for the compaction process of early stage embryos. The aim of this study was to develop a non-invasive objective calculation system of embryo compaction in order to test the hypothesis that embryos with a larger mean contact surface result in a higher live birth rate compared to embryos with a lower mean contact surface. Methods Multilevel images of 474 embryos transferred on day 3 were evaluated by the Cellify software. This software calculates the contact surfaces between the blastomeres. The primary outcome of this study was live birth. An ideal range of contact surface was determined and the positive and negative predictive value, the sensitivity, the specificity and the area under the curve for this new characteristic were calculated. Results In total, 115 (24% transferred embryos resulted in a live birth. Selection of an embryo for transfer on its mean contact surface could predict live birth with a high sensitivity (80% and high negative predicting value (83% but with a low positive predictive value (27%, a low specificity (31% and low area under the ROC curve (0.56. The mean contact surface of embryos cultured in a single medium was significantly higher compared to the mean contact surface of embryos cultured in a sequential medium (p = 0.0003. Conclusions Neither the mean contact surface nor the number of contact surfaces of a day 3 embryo had an additional value in the prediction of live birth. The type of culture medium, however, had an impact on the contact surface of an embryo. Embryos cultured in a single medium had a significant larger contact surface compared to embryos cultured in the sequential medium.

Le Cyrano de Bergerac de Jacques Prévot

Directory of Open Access Journals (Sweden)

Madeleine Alcover

2012-04-01

que, pour éviter au roman de Cyrano une autre censure embarrassante et onéreuse, les « publicateurs » (Le Bret, Charles de Sercy, Jean de Cuigy et peut-être le dédicataire Regnault des Boisclairs ont très probablement eux-mêmes coupé et révisé le texte. La plume de Le Bret se trahit partout, avec sa pléthore de « de sorte que », et une variante de 1657, qu’une minute de notaire (vive l’interdisciplinarité ! permet de dater de 1656, se révèle donc posthume. Autre réseau, mais un peu le même, grâce auquel la vie de Cyrano et celle de ses œuvres se matérialisent et s’étoffent. Une analyse méticuleuse des manuscrits aurait peut-être permis au critique d’y voir clair : la nature composite du texte de 1657, que Prévot a attestée malgré lui, relance la question de la véracité de Le Bret en ce qui concerne sa mission de publier le roman. Mais tout cela passe inaperçu et le recours répétitif à « un » censeur imaginaire permet au critique de tout et de ne rien expliquer. Pour finir sont brièvement rappelées ici deux fausses attributions, répétées depuis 1978 : la substitution d’un personnage du roman qui fait dire à un adolescent tout le discours d’un professeur d’académie sur l’atomisme matérialiste et athée, et l’attribution à Cyrano de sept mazarinades de 1649 que Prévot continue à soutenir, bien qu’un test linguistique, inspiré par les travaux de Harold Love, ait démontré en 2004 l’invraisemblance de ces attributions. Mais Prévot ne le mentionne pas : soit on ignore soit on met sous le boisseau…In his last book on Cyrano’s life and works, Jacques Prévot mainly repeats his 1977-1978 doctoral thesis. As far as biography is concerned, important components, particularly two related to religion and to the army, are ignored or underevaluated. The discovery of Cyrano’s maternal genealogy has revealed, in 2000, a milieu of very pious people, some of which were influent in the Compagnie du

Comparison of 18F-FDG PET to CT scan in the detection of recurrent colorectal carcinoma - an ROC analysis

International Nuclear Information System (INIS)

Scott, A.M.; Akhurst, T.; Berlangieri, S.U.; Fitt, G.; Schelleman, T.; Jones, R.; Hannah, A.; Tochon-Danguy, H.

2000-01-01

Full text: This study examined 43 scans performed in 40 patients from a group of 93 prospectively enrolled in a trial examining the utility of 18 F-FDG PET in patients with potentially resectable recurrent colorectal cancer. All patients had PET and CT scans prior to surgery, where a total of 84 anatomical regions were biopsied, and 364 regions examined by the surgeons. All PET and CT scans were viewed blinded to clinical and imaging data. The scans were interpreted according to a five-point confidence scale to enable an ROC analysis to be performed. An assessment of the impact of PET over CT in patients was also made. Of the 43 cases PET and CT were concordant in 24 (56%). There were 16 cases where PET added additional diagnostic information to the benefit of the patient (37%), and three (7%) where PET alone would have lead to a potentially negative outcome. The majority of cases where PET performed better were in cases with extrahepatic disease. CT was more sensitive in the detection of pulmonary nodules, although the specificity of CT was less than PET. In conclusion, 18 F-FDG PET performed significantly better than CT both in terms of a regional analysis as well as a patient by patient basis. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc

A proposal of the diagnosis-dynamic characteristic (DDC) model describing the relation between search time and confidence levels for a dichotomous judgment, and its application to ROC curve generation

Science.gov (United States)

Matsumoto, Toru; Fukuda, Nobuo; Furukawa, Akira; Suwa, Koji; Wada, Shinichi; Matsumoto, Mitsuomi; Sone, Shusuke

2006-03-01

When physicians inspect an image, they make up a certain degree of confidence that the image are abnormal; p(t), or normal; n(t)[n(t)=1-p(t)]. After infinite time of the inspection, they reach the equilibrium levels of the confidence of p*=p(∞) and n*=n(∞). There are psychological conflicts between the decisions of normal and abnormal. We assume that the decision of "normal" is distracted by the decision of "abnormal" by a factor of k(1 + ap), and in an inverse direction by a factor of k(1 + bn), where k ( > 0) is a parameter that relates with image quality and skill of the physicians, and a and b are unknown constants. After the infinite time of inspection, the conflict reaches the equilibrium, which satisfies the equation, k(1 + ap*)n* = k(1 + bn*)p*. Here we define a parameter C, which is 2p*/[p*(1 - p*)]. After the infinite time of inspection, the conflict reaches the equilibrium, which satisfies t that changes in the confidence level with the time (dp/dt) is proportional to [k(1+ap)n - k(1+bn)p], i.e. k[-cp2 + (c - 2)p + 1]. Solving the differential equation, we derived the equation; t(p) and p(t) depending with the parameters; k, c, S. S (0-1) is the value arbitrary selected and related with probability of "abnormal" before the image inspection (S = p(0)). Image reading studies were executed for CT images. ROC curves were generated both by the traditional 4-step score-based method and by the confidence level; p estimated from the equation t(p) of the DDC model using observed judgment time. It was concluded that ROC curves could be generated by measuring time for dichotomous judgment without the subjective scores of diagnostic confidence and applying the DDC model.

Proximal caries detection: Sirona Sidexis versus Kodak Ektaspeed Plus.

Science.gov (United States)

Khan, Emad A; Tyndall, Donald A; Ludlow, John B; Caplan, Daniel

2005-01-01

This study compared the accuracy of intraoral film and a charge-coupled device (CCD) receptor for proximal caries detection. Four observers evaluated images of the proximal surfaces of 40 extracted posterior teeth. The presence or absence of caries was scored using a five-point confidence scale. The actual status of each surface was determined from ground section histology. Responses were evaluated by means of receiver operating characteristic (ROC) analysis. Areas under ROC curves (Az) were assessed through a paired t-test. The performance of the CCD-based intraoral sensor was not different statistically from Ektaspeed Plus film in detecting proximal caries.

Rachmaninov: Aleko / Jacques Constant

Index Scriptorium Estoniae

Constant, Jacques

1998-01-01

Rachmaninov: Aleko; Le Chevalier avare; Francesca da Rimini. Choeur de l'Opera de Göteborg, Orchestre Symphonique de Göteborg, Neeme Järvi. DG 453 452-2 (3 CD:444 F ou 168 F chacun). 1996. TT:2 h 53'21

ORF Alignment: NC_003063 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available in C58, Dupont) ... Length = 112 ... Query: 205 IARSIVWIRKHFRETCSVEAGAEVAGMSRSTFHAHFKAVTNMSPLEFRTQLRLQEA...RRLM 264 ... IARSIVWIRKHFRETCSVEAGAEVAGMSRSTFHAHFKAVTNMSPLEFRTQLRLQEARRLM Sbjct: 1 ... IARSIVWIRKHFRETCSVEAGAEVAGMSRSTFHAHFKAVTNMSPLEFRTQLRLQEARRLM 60 ...

Dos casos extremos : tragedia y amoralidad Comentarios a «De individuos y emociones. Algunas reflexiones sobre el papel de las emociones en la vida moral», de Rocío Orsi Portalo

OpenAIRE

Carrasco Barranco, Matilde

2007-01-01

Este texto comenta «De individuos y emociones. Algunas reflexiones sobre el papel de las emociones en la vida moral», de Rocío Orsi, en el que la autora se vale de los ejemplos del Edipo de Sófocles y el asesino de American Psycho para argumentar el papel crucial que desempeñan las emociones en la motivación y la existencia de una comunidad moral. Por otro lado, también mostrarían que el ámbito de lo moral rebasa la adscripción de responsabilidad. No obstante, las emociones a veces resultan i...

Prantsuse suursaaadiku hr. Jean-Jacques Subrenat sissejuhatav sõnavõtt / Jean-Jacques Subrenat

Index Scriptorium Estoniae

Subrenat, Jean-Jacques

2002-01-01

Ilmunud ka: Proceedings of the 8th International conference Estonia and the European Union : Estonia on its way to a changing Europe : October 31-November 2, 2001. - Tallinn, lk., lk. 124-131. Kriisi juhtimise puhul on EL roll eeskätt olla võimeline juhtima kogu erinevate ülesannete paletti alates politseoperatsioonidest kuni rahutagamiseni, alates ülesehitamisest kuni institutsioonide loomiseni

Lawfare: The Colombian Case

Science.gov (United States)

2010-05-01

of its jurisdiction. 77 75 Jacques Verges. Estrategia judicial en los procesos politicos...Publishing Ltd., 2008. 55 Mejia, Jean. Situacion Perspectivas y Estrategias Frente a la Defensa del Estado (Situation, Perspectives and Strategies facing...Theses, and Dissertations. 7th Verges, Jacques. Estrategia Judicial de los Procesos Politicos (Judicial Strategy of the Political Processes

Dewey, Derrida, and "The Double Bind"

Science.gov (United States)

Garrison, Jim

2003-01-01

In this article, the author talks about the texts of Jacques Derrida and Dewey. The texts of Jacques Derrida seem inextricably connected to the word deconstruction, yet, Derrida insists, "The word "deconstruction," like all other words, acquires its value only from its inscription in a chain of possible substitutions." The author argues that…

Distinction of gastric cancer tissue based on surface-enhanced Raman spectroscopy

Science.gov (United States)

Ma, Jun; Zhou, Hanjing; Gong, Longjing; Liu, Shu; Zhou, Zhenghua; Mao, Weizheng; Zheng, Rong-er

2012-12-01

Gastric cancer is one of the most common malignant tumors with high recurrence rate and mortality rate in China. This study aimed to evaluate the diagnostic capability of Surface-enhanced Raman spectroscopy (SERS) based on gold colloids for distinguishing gastric tissues. Gold colloids were directly mixed with the supernatant of homogenized tissues to heighten the Raman signal of various biomolecule. A total of 56 samples were collected from normal (30) and cancer (26). Raman spectra were obtained with a 785nm excitation in the range of 600-1800 cm-1. Significant spectral differences in SERS mainly belong to nucleic acid, proteins and lipids, particularly in the range of 653, 726, 828, 963, 1004, 1032, 1088, 1130, 1243, 1369, 1474, 1596, 1723 cm-1. PCA-LDA algorithms with leave-one-patient-out cross validation yielded diagnostic sensitivities of 90% (27/30), specificities of 88.5% (23/26), and accuracy of 89.3% (50/56), for classification of normal and cancer tissues. The receiver operating characteristic (ROC) surface is 0.917, illustrating the diagnostic utility of SERS together with PCA-LDA to identify gastric cancer from normal tissue. This work demonstrated the SERS techniques can be useful for gastric cancer detection, and it is also a potential technique for accurately identifying cancerous tumor, which is of considerable clinical importance to real-time diagnosis.

WE-A-207-01: Memorial Lecturer

International Nuclear Information System (INIS)

Muller-Runkel, R

2015-01-01

The Medical Physics community lost one of its early pioneers in radiation oncology physics, Jacques Ovadia, who passed away in April of 2014 at the age of 90. Jacques received his Ph.D. in Nuclear Physics from the University of Illinois at Urbana in 1951. Subsequently, under the guidance of John Laughlin, he was introduced to the field of Medical Physics. When John moved to Memorial Sloan Kettering, Jacques followed him. There he gained clinical experience and expertise in the then cutting-edge field of high energy electron beam therapy. In 1956, Jacques joined Dr. Erich Uhlmann at Michael Reese Hospital in Chicago where one of the country’s first high energy medical linear accelerators had just been installed. During his 35 year tenure, Dr. Ovadia built a strong Medical Physics department that merged in 1984 with that of the University of Chicago. Jacques pioneered the use of high energy electron beams to treat deep seated tumors, multiple-field chest wall irradiation with variable electron energies, and even anticipated the current interest in high energy electron beam grid-therapy. At an early stage, he introduced a simulator, computerized treatment planning and in-house developed record and verify software. He retired in 1990 as Professor emeritus in Radiation and Cellular Biology at the University of Chicago. Dr. Ovadia was an early and strong supporter of AAPM. He was present at the Chicago ROMPS meeting where the decision was made to form an independent professional society for medical physics. He served as AAPM president in 1976. Jacques Ovadia is survived by his wife of 58 years, Florence, their daughter Corinne Graefe and son Marc Ovadia, MD, as well as four grandchildren and one great-grandchild. Jacques’ dynamic and ever enthusiastic personality inspired all who collaborated with him. He will be greatly missed

WE-A-207-01: Memorial Lecturer

Energy Technology Data Exchange (ETDEWEB)

Muller-Runkel, R [St. Margaret Mercy Healthcare Centers, Hammond, IN (United States)

2015-06-15

The Medical Physics community lost one of its early pioneers in radiation oncology physics, Jacques Ovadia, who passed away in April of 2014 at the age of 90. Jacques received his Ph.D. in Nuclear Physics from the University of Illinois at Urbana in 1951. Subsequently, under the guidance of John Laughlin, he was introduced to the field of Medical Physics. When John moved to Memorial Sloan Kettering, Jacques followed him. There he gained clinical experience and expertise in the then cutting-edge field of high energy electron beam therapy. In 1956, Jacques joined Dr. Erich Uhlmann at Michael Reese Hospital in Chicago where one of the country’s first high energy medical linear accelerators had just been installed. During his 35 year tenure, Dr. Ovadia built a strong Medical Physics department that merged in 1984 with that of the University of Chicago. Jacques pioneered the use of high energy electron beams to treat deep seated tumors, multiple-field chest wall irradiation with variable electron energies, and even anticipated the current interest in high energy electron beam grid-therapy. At an early stage, he introduced a simulator, computerized treatment planning and in-house developed record and verify software. He retired in 1990 as Professor emeritus in Radiation and Cellular Biology at the University of Chicago. Dr. Ovadia was an early and strong supporter of AAPM. He was present at the Chicago ROMPS meeting where the decision was made to form an independent professional society for medical physics. He served as AAPM president in 1976. Jacques Ovadia is survived by his wife of 58 years, Florence, their daughter Corinne Graefe and son Marc Ovadia, MD, as well as four grandchildren and one great-grandchild. Jacques’ dynamic and ever enthusiastic personality inspired all who collaborated with him. He will be greatly missed.

905 -IJBCS-Article-Djaneye Boundjou Gbandi

African Journals Online (AJOL)

DR GATSING

7269. Galindo C, Jacques P, Kalt A. 2001. Photooxidation of the phynelazonaphtol. AO20 on TiO2: Kinetics and mechanistic investigations. Chemosphere, 45: 997. Galindo C, Jacques P, Kalt A. 2000. Photodegradation of the aminoazo- benzene acid orange 52 by three advanced oxidation processes: UV/H2O2,. UV/TiO2.

Overview of an energy management process

International Nuclear Information System (INIS)

Chantraine, P.

2004-01-01

Invista is a global and vertically integrated fiber, resin and intermediates business which belonged to Dupont but is now a subsidiary of Koch Industries. A background of Invista and its former relationship with Dupont was presented. This presentation was based on goals and work done as Dupont Canada Inc., up to the end of 2003. Details of Invista's approach to climate change in Canada were provided along with the company's relationship with Natural Resources Canada. The historical position of Dupont Canada was reviewed in detail, including their commitment to voluntary approach; participation in the national process; their goal of 85 per cent reduction in greenhouse gas (GHG) by 2000; 93 per cent reduction in nitrous oxide emissions; energy efficiency goals; and continuing growth of the company. An outline and mission of the energy management team established in 1974 was presented, with details of the 1974 oil shortage, stabilization in the 1980s through to rises in electricity prices in the 1990s and concerns over climate change in recent years. Details of the team's operational procedures were presented. Results were presented in graph form and include: total energy use from 1972 to 2003 as well as cumulative energy conservation projects and resulting energy savings. Examples of activities and projects were provided, including details of energy performance contracting. It was concluded that in order to conserve energy, top management support was necessary, as well as passion and dedication in both leaders and teams. A broad scope for creativity in finding solutions within evolving constraints was also important, as was the nurturing of capability, capacity and recognition for results achieved. tabs., figs

Targeted ubiquitination of CDT1 by the DDB1-CUL4A-ROC1 ligase in response to DNA damage.

Science.gov (United States)

Hu, Jian; McCall, Chad M; Ohta, Tomohiko; Xiong, Yue

2004-10-01

Cullins assemble a potentially large number of ubiquitin ligases by binding to the RING protein ROC1 to catalyse polyubiquitination, as well as binding to various specificity factors to recruit substrates. The Cul4A gene is amplified in human breast and liver cancers, and loss-of-function of Cul4 results in the accumulation of the replication licensing factor CDT1 in Caenorhabditis elegans embryos and ultraviolet (UV)-irradiated human cells. Here, we report that human UV-damaged DNA-binding protein DDB1 associates stoichiometrically with CUL4A in vivo, and binds to an amino-terminal region in CUL4A in a manner analogous to SKP1, SOCS and BTB binding to CUL1, CUL2 and CUL3, respectively. As with SKP1-CUL1, the DDB1-CUL4A association is negatively regulated by the cullin-associated and neddylation-dissociated protein, CAND1. Recombinant DDB1 and CDT1 bind directly to each other in vitro, and ectopically expressed DDB1 bridges CDT1 to CUL4A in vivo. Silencing DDB1 prevented UV-induced rapid CDT1 degradation in vivo and CUL4A-mediated CDT1 ubiquitination in vitro. We suggest that DDB1 targets CDT1 for ubiquitination by a CUL4A-dependent ubiquitin ligase, CDL4A(DDB1), in response to UV irradiation.

X-Ray Characterization of Resistor/Dielectric Material for Low Temperature Co-Fired Ceramic Packages

International Nuclear Information System (INIS)

DIMOS, DUANE B.; KOTULA, PAUL G.; RODRIGUEZ, MARK A.; YANG, PIN

1999-01-01

High temperature XRD has been employed to monitor the devitrification of Dupont 951 low temperature co-fired ceramic (LTCC) and Dupont E84005 resistor ink. The LTCC underwent devitrification to an anorthite phase in the range of 835-875 C with activation energy of 180 kJ/mol as calculated from kinetic data. The resistor paste underwent devitrification in the 835-875 C range forming monoclinic and hexagonal celcian phases plus a phase believed to be a zinc-silicate. RuO(sub 2) appeared to be stable within this devitrified resistor matrix. X-ray radiography of a co-fired circuit indicated good structural/chemical compatibility between the resistor and LTCC

Optimal Threshold Determination for Discriminating Driving Anger Intensity Based on EEG Wavelet Features and ROC Curve Analysis

Directory of Open Access Journals (Sweden)

Ping Wan

2016-08-01

Full Text Available Driving anger, called “road rage”, has become increasingly common nowadays, affecting road safety. A few researches focused on how to identify driving anger, however, there is still a gap in driving anger grading, especially in real traffic environment, which is beneficial to take corresponding intervening measures according to different anger intensity. This study proposes a method for discriminating driving anger states with different intensity based on Electroencephalogram (EEG spectral features. First, thirty drivers were recruited to conduct on-road experiments on a busy route in Wuhan, China where anger could be inducted by various road events, e.g., vehicles weaving/cutting in line, jaywalking/cyclist crossing, traffic congestion and waiting red light if they want to complete the experiments ahead of basic time for extra paid. Subsequently, significance analysis was used to select relative energy spectrum of β band (β% and relative energy spectrum of θ band (θ% for discriminating the different driving anger states. Finally, according to receiver operating characteristic (ROC curve analysis, the optimal thresholds (best cut-off points of β% and θ% for identifying none anger state (i.e., neutral were determined to be 0.2183 ≤ θ% < 1, 0 < β% < 0.2586; low anger state is 0.1539 ≤ θ% < 0.2183, 0.2586 ≤ β% < 0.3269; moderate anger state is 0.1216 ≤ θ% < 0.1539, 0.3269 ≤ β% < 0.3674; high anger state is 0 < θ% < 0.1216, 0.3674 ≤ β% < 1. Moreover, the discrimination performances of verification indicate that, the overall accuracy (Acc of the optimal thresholds of β% for discriminating the four driving anger states is 80.21%, while 75.20% for that of θ%. The results can provide theoretical foundation for developing driving anger detection or warning devices based on the relevant optimal thresholds.

Passive Education

Science.gov (United States)

Bojesen, Emile

2018-01-01

This paper does not present an advocacy of a passive education as opposed to an active education nor does it propose that passive education is in any way 'better' or more important than active education. Through readings of Maurice Blanchot, Jacques Derrida and B.S. Johnson, and gentle critiques of Jacques Rancière and John Dewey, passive…

La “herencia de Amyot”: La crítica de la novela de caballería y los orígenes de la novela moderna

Directory of Open Access Journals (Sweden)

Marc Fumaroli

2007-12-01

Full Text Available This essay analyzes Jacques Amyot and Jacques Gohory’s attitude towards chivalric books in the context of Classicist Humanism and that of the Catholic Reformation. Don Quixote is thus situated at the crossroads that reconcile “the contradictory premises stemming from the crisis in the narrative fiction that had arisen in the 16th century”.

Filmimaailm / Aare Ermel

Index Scriptorium Estoniae

Ermel, Aare, 1957-2013

2008-01-01

Lühisõnumid: Prantsuse kinodesse on jõudnud retrofilmid - "Couche, ühe inimese lugu" (koomik Michel Coluche'ist, rezh. Antoine de Gaunes; ), "Tapainstinkt" ja "Ühiskonna vaenlane nr 1" (mõlemad gangster Jacques Mesrine'ist, rezh. Jean-Francois Richet). Jean-Jacques Annaud' "Kashmir". Roomas triumfeeris "Resolution 819" (rezh. Giacomo Battiato). Humberto Solas (4. XII 1941 - 17. IX 2008)

Dos casos extrems: tragèdia i amoralitat. Comentaris a «De individus i emocions. Algunes reflexions sobre el paper de les emocions en la vida moral », de Rocío Orsi Portalo

OpenAIRE

Carrasco Barranco, Matilde

2007-01-01

Aquest text comenta «De individus i emocions. Algunes reflexions sobre el paper de lasemociones en la vida moral », de Rocío Orsi, en què l'autora es val dels exemples del Èdip de Sòfocles i l'assassí d'American Psycho per argumentar el paper crucial quedesempeñan les emocions en la motivació i la existència d'una comunitat moral. Porotro banda, també mostrarien que l'àmbit del moral depassa l'adscripció de responsabilidad.No obstant això, les emocions de vegades resulten irracionals i...

Critical thresholds of liver function parameters for ketosis prediction in dairy cows using receiver operating characteristic (ROC) analysis.

Science.gov (United States)

Sun, Yuhang; Wang, Bo; Shu, Shi; Zhang, Hongyou; Xu, Chuang; Wu, Ling; Xia, Cheng

2015-01-01

Fatty liver syndrome and ketosis are important metabolic disorders in high-producing cows during early lactation with fatty liver usually preceding ketosis. To date, parameters for early prediction of the risk of ketosis have not been investigated in China. To determine the predictive value of some parameters on the risk of ketosis in China. In a descriptive study, 48 control and 32 ketotic Holstein Friesian cows were randomly selected from one farm with a serum β-hydroxybutyrate (BHBA) concentration of 1.20 mmol/L as cutoff point. The risk prediction thresholds for ketosis were determined by receiver operating characteristic (ROC) analysis. In line with a high BHBA concentration, blood glucose concentration was significantly lower in ketotic cows compared to control animals (2.77 ± 0.24 versus 3.34 ± 0.03 mmol/L; P = 0.02). Thresholds were more than 0.76 mmol/L for nonesterified fatty acids (NEFA, with 65% sensitivity and 92% specificity), more than 104 U/L for aspartate aminotransferase (AST, 74% and 85%, respectively), less than 140 U/L for cholinesterase (CHE, 75% and 59%, respectively), and more than 3.3 µmol/L for total bilirubin (TBIL, 58% and 83%, respectively). There were significant correlations between BHBA and glucose (R = -4.74), or CHE (R = -0.262), BHBA and NEFA (R = 0.520), or AST (R = 0.525), or TBIL (R = 0.278), or direct bilirubin (DBIL, R = 0.348). AST, CHE, TBIL and NEFA may be useful parameters for risk prediction of ketosis. This study might be of value in addressing novel directions for future research on the connection between ketosis and liver dysfunction.

ORF Alignment: NC_003306 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available C58, Dupont) plasmid AT ... Length = 247 ... Query: 28 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMA...KDLNAELEIVPLTGASRIPS 87 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTG...ASRIPS Sbjct: 21 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPS 80 ... Query: 148 STLDTWLTDNAPEV

Mathematical modeling of CA125 kinetics in recurrent ovarian cancer (ROC) patients treated with chemotherapy and predictive value of early modeled kinetic parameters in CALYPSO trial: A GCIG study

DEFF Research Database (Denmark)

You, Benoit; Colomban, Olivier; Heywood, Mark

2011-01-01

Background: Although CA125 kinetic profiles may be related with relapse risk in ovarian cancer patients treated with chemotherapy, no reliable kinetic parameters have been reported. Mathematical modeling may help describe CA125 decline dynamically and determine parameters predictive of relapse....... Methods: Data from CALYPSO phase III trial data comparing 2 carboplatin-based regimens in ROC patients were analyzed. Based on population kinetic approach (Monolix software), a semi-mechanistic model was used to fit serum log (CA125) concentration-time profiles with following parameters: tumor growth rate...... the first 50 treatment days were tested regarding progression free survival (PFS) against other reported prognostic factors using Cox-models: treatment arm; platinum-free interval (PFI), metastatic site number, largest tumor size, elevated WBC and measurable disease. Results: The CA125 kinetics from 898...

Experience of Preimplantation Genetic Diagnosis for Hemophilia at the University Hospital Virgen Del Rocío in Spain: Technical and Clinical Overview

Directory of Open Access Journals (Sweden)

Raquel M. Fernández

2015-01-01

Full Text Available Hemophilia A and B are the most common hereditary hemorrhagic disorders, with an X-linked mode of inheritance. Reproductive options for the families affected with hemophilia, aiming at the prevention of the birth of children with severe coagulation disorders, include preimplantation genetic diagnosis (PGD. Here we present the results of our PGD Program applied to hemophilia, at the Department of Genetics, Reproduction and Fetal Medicine of the University Hospital Virgen del Rocío in Seville. A total of 34 couples have been included in our program since 2005 (30 for hemophilia A and 4 for hemophilia B. Overall, 60 cycles were performed, providing a total of 508 embryos. The overall percentage of transfers per cycle was 81.7% and the live birth rate per cycle ranged from 10.3 to 24.1% depending on the methodological approach applied. Although PGD for hemophilia can be focused on gender selection of female embryos, our results demonstrate that methodological approaches that allow the diagnosis of the hemophilia status of every embryo have notorious advantages. Our PGD Program resulted in the birth of 12 healthy babies for 10 out of the 34 couples (29.4%, constituting a relevant achievement for the Spanish Public Health System within the field of haematological disorders.

Experience of Preimplantation Genetic Diagnosis for Hemophilia at the University Hospital Virgen Del Rocío in Spain: Technical and Clinical Overview

Science.gov (United States)

Fernández, Raquel M.; Peciña, Ana; Sánchez, Beatriz; Lozano-Arana, Maria Dolores; García-Lozano, Juan Carlos; Pérez-Garrido, Rosario; Núñez, Ramiro; Antiñolo, Guillermo

2015-01-01

Hemophilia A and B are the most common hereditary hemorrhagic disorders, with an X-linked mode of inheritance. Reproductive options for the families affected with hemophilia, aiming at the prevention of the birth of children with severe coagulation disorders, include preimplantation genetic diagnosis (PGD). Here we present the results of our PGD Program applied to hemophilia, at the Department of Genetics, Reproduction and Fetal Medicine of the University Hospital Virgen del Rocío in Seville. A total of 34 couples have been included in our program since 2005 (30 for hemophilia A and 4 for hemophilia B). Overall, 60 cycles were performed, providing a total of 508 embryos. The overall percentage of transfers per cycle was 81.7% and the live birth rate per cycle ranged from 10.3 to 24.1% depending on the methodological approach applied. Although PGD for hemophilia can be focused on gender selection of female embryos, our results demonstrate that methodological approaches that allow the diagnosis of the hemophilia status of every embryo have notorious advantages. Our PGD Program resulted in the birth of 12 healthy babies for 10 out of the 34 couples (29.4%), constituting a relevant achievement for the Spanish Public Health System within the field of haematological disorders. PMID:26258137

Time-varying surface electromyography topography as a prognostic tool for chronic low back pain rehabilitation.

Science.gov (United States)

Hu, Yong; Kwok, Jerry Weilun; Tse, Jessica Yuk-Hang; Luk, Keith Dip-Kei

2014-06-01

Nonsurgical rehabilitation therapy is a commonly used strategy to treat chronic low back pain (LBP). The selection of the most appropriate therapeutic options is still a big challenge in clinical practices. Surface electromyography (sEMG) topography has been proposed to be an objective assessment of LBP rehabilitation. The quantitative analysis of dynamic sEMG would provide an objective tool of prognosis for LBP rehabilitation. To evaluate the prognostic value of quantitative sEMG topographic analysis and to verify the accuracy of the performance of proposed time-varying topographic parameters for identifying the patients who have better response toward the rehabilitation program. A retrospective study of consecutive patients. Thirty-eight patients with chronic nonspecific LBP and 43 healthy subjects. The accuracy of the time-varying quantitative sEMG topographic analysis for monitoring LBP rehabilitation progress was determined by calculating the corresponding receiver-operating characteristic (ROC) curves. Physiologic measure was the sEMG during lumbar flexion and extension. Patients who suffered from chronic nonspecific LBP without the history of back surgery and any medical conditions causing acute exacerbation of LBP during the clinical test were enlisted to perform the clinical test during the 12-week physiotherapy (PT) treatment. Low back pain patients were classified into two groups: "responding" and "nonresponding" based on the clinical assessment. The responding group referred to the LBP patients who began to recover after the PT treatment, whereas the nonresponding group referred to some LBP patients who did not recover or got worse after the treatment. The results of the time-varying analysis in the responding group were compared with those in the nonresponding group. In addition, the accuracy of the analysis was analyzed through ROC curves. The time-varying analysis showed discrepancies in the root-mean-square difference (RMSD) parameters between the

Les savants genevois dans l'Europe intellectuelle du XVIIe au milieu du XIXe siècle

CERN Document Server

1987-01-01

Après une introduction sur l'essor de la science genevoise par Jean STAROBINSKI et un chapitre sur l'Europe savante (1700-1850) par Jacques ROGER, sont présentés les travaux et recherches dans les différentes disciplines: l'astronomie par Marcel GOLAY, les mathématiques par Pierre SPEZIALI, la physique par Pierre SPEZIALI, la chimie par Armand BUCHS, la géologie par Albert V. CAROZZI, la zoologie par Marino BUSCAGLIA, la botanique par Jacques NAEF; suivis des biographies des savants genevois par Jean-Michel PICTET, avec petits portraits; notes; index; photos et fac-similés de documents; bibliographies par chapitre. Ouvrage publié par l'Association pour le Musée d'histoire des sciences de Genève, présidé par Jacques TREMBLEY.

Atomic Oxygen Energy in Low Frequency Hyperthermal Plasma Ashers

Science.gov (United States)

Banks, Bruce A.; Miller, Sharon K R.; Kneubel, Christian A.

2014-01-01

Experimental and analytical analysis of the atomic oxygen erosion of pyrolytic graphite as well as Monte Carlo computational modeling of the erosion of Kapton H (DuPont, Wilmington, DE) polyimide was performed to determine the hyperthermal energy of low frequency (30 to 35 kHz) plasma ashers operating on air. It was concluded that hyperthermal energies in the range of 0.3 to 0.9 eV are produced in the low frequency air plasmas which results in texturing similar to that in low Earth orbit (LEO). Monte Carlo computational modeling also indicated that such low energy directed ions are fully capable of producing the experimentally observed textured surfaces in low frequency plasmas.

Presidential Green Chemistry Challenge: 2003 Greener Reaction Conditions Award

Science.gov (United States)

Presidential Green Chemistry Challenge 2003 award winner, DuPont, developed a genetically engineered microorganism jointly with Genencor International to manufacture 1,3-propanediol, a building block for Sorona polyester.

Fiktionens sandhed

DEFF Research Database (Denmark)

Rösing, Lilian Munk

2009-01-01

Om forholdet mellem sandhed og skønlitterær fiktion med Imre Kertész, Dorrit Cohn, Felman & Laub, Adriana Cavarero, Jacques Rancières og Hans Otto Jørgensen som referencer  ......Om forholdet mellem sandhed og skønlitterær fiktion med Imre Kertész, Dorrit Cohn, Felman & Laub, Adriana Cavarero, Jacques Rancières og Hans Otto Jørgensen som referencer  ...

1289-IJBCS-Article- Saizanou Jacques

African Journals Online (AJOL)

KODJIO NORBERT

énoncées par la FIGO et les neuf éléments tels décrits dans le Tableau 1 ... été fixée à 0.25, afin de ne pas être trop restrictif et de ne pas exclure d'éventuels facteurs de confusion. La recherche d'interactions pertinentes a été réalisée. La.

2045-IJBCS-Article-Bagalwa Jacques

African Journals Online (AJOL)

hp

attention to the effect of land use on water quality, in particular the ... soil erosion within the Lake basin (Bagalwa. 2006). ... severe threats to biodiversity, the stability of the Lake basin .... (Whatman 589, 185 μm pore size) and dried at. 105 °C.

1301-IJBCS-Article-Dougnon Jacques

African Journals Online (AJOL)

USER

RESUME. La présente étude a consisté à évaluer la qualité microbiologique et physico-chimique des poissons produits et .... Tableau 2 : Flore microbienne moyenne dénombrée dans les échantillons de poissons prélevés au niveau des bateaux. Bateaux .... entre 6,04 à 6,60 à bord des bateaux et 6,6 à. 7 au niveau de la ...

2251-IJBCS-Article-Jacques Sawadogo

African Journals Online (AJOL)

hp

Dans le cadre de la valorisation des matériaux d'origine artisanale du Burkina Faso, deux (02) types d'échantillons d'ustensiles de cuisine (marmites artisanales) en aluminium prélevés dans les différentes zones de la ville de Ouagadougou, ont subi une série d'analyses chimiques. L'artisanat pose le problème de la ...

Jacques Lacan and Feminist Epistemology

OpenAIRE

Campbell, Kirsten

2004-01-01

This book outlines a compelling new agenda for feminist theories of identity and social relations. Using Lacanian psychoanalysis with feminist epistemology, the author sets out a groundbreaking psychoanalytic social theory. Campbell's work offers answers to the important contemporary question of how feminism can change the formation of gendered subjectivities and social relations. Drawing on the work of third wave feminists, the book shows how feminism can provide new political models of know...

2294-IJBCS-Article-Jacques Sawadogo

African Journals Online (AJOL)

hp

2006-02-17

Feb 17, 2006 ... conversion of solar energy into electric ..... File: L5b.RAW - Step: 0.020 ° - Step time: 15. s - Anode: Cu - WL1: 1.5406 - Generator kV: 40 kV - Generator mA: 40 mA - Divergence slit: ..... of quantum confinement on the electornic.

2045-IJBCS-Article-Bagalwa Jacques

African Journals Online (AJOL)

hp

TSS, nutrient and other chemicals parameters load analyzed were high in agriculture effluent than in industrial effluent except for NH4 ... the natural processes, i.e. precipitation inputs, ... activities via point sources, such as industrial ... evaluate management practices that would ..... Quality for the Maintenance of Aquatic. Life.

2118-IJBCS-Article-Jacques Dougnon

African Journals Online (AJOL)

hp

production animale et en médecine traditionnelle. En effet, des résultats probants dans la détermination des composants chimiques et des propriétés biologiques de Tridax procumbens ont été obtenus. Le présent article se propose de répertorier à travers une synthèse bibliographique l'utilité de cette plante en élevage des ...

Bringing the DuPont Profitability Model to Extension

Science.gov (United States)

Roucan-Kane, Maud; Wolfskill, L. A.; Boehlje, Michael D.; Gray, Allan W.

2013-01-01

This article discusses a financial training program used by Deere and Company for almost 10 years. The objective is to describe the program and to discuss a pre-test/post-test methodology to test the effectiveness of a program for possible duplication by Extension. Results show that participants significantly improved from the pre-test to the…

Development of High Temperature Superconducting Josephson Junction Device Technology

National Research Council Canada - National Science Library

Myers, Kirsten

1998-01-01

The DuPont program was successful in generating useful knowledge about thallium cuprate materials, photoresist reflow processing, and radiant heater technology though it did not lead to a new junction technology...

77 FR 51739 - Approval and Promulgation of Implementation Plans; Tennessee; Regional Haze State Implementation...

Science.gov (United States)

2012-08-27

... Tennessee: (1) Aluminum Company of America (Alcoa)--South Plant; (2) DuPont White Pigment and Mineral... reductions than BART (i.e., dispersion modeling is not required to evaluate the differences in visibility...

Field to fuel: developing sustainable biorefineries.

Science.gov (United States)

Jenkins, Robin; Alles, Carina

2011-06-01

Life-cycle assessment (LCA) can be used as a scientific decision support technique to quantify the environmental implications of various biorefinery process, feedstock, and integration options. The goal of DuPont's integrated corn biorefinery (ICBR) project, a cost-share project with the United States Department of Energy, was to demonstrate the feasibility of a cellulosic ethanol biorefinery concept. DuPont used LCA to guide research and development to the most sustainable cellulosic ethanol biorefinery design in its ICBR project and will continue to apply LCA in support of its ongoing effort with joint venture partners. Cellulosic ethanol is a biofuel which has the potential to provide a sustainable solution to the nation's growing concerns around energy supply and climate change. A successful biorefinery begins with sustainable removal of biomass from the field. Michigan State University (MSU) used LCA to estimate the environmental performance of corn grain, corn stover, and the corn cob portion of the stover, grown under various farming practices for several corn growing locations in the United States Corn Belt. In order to benchmark the future technology options for producing cellulosic ethanol with existing technologies, LCA results for fossil energy consumption and greenhouse gas (GHG) emissions are compared to alternative ethanol processes and conventional gasoline. Preliminary results show that the DuPont ICBR outperforms gasoline and other ethanol technologies in the life-cycle impact categories considered here.

78 FR 5774 - Materials Technical Advisory Committee; Notice of Partially Closed Meeting

Science.gov (United States)

2013-01-28

.... Remarks from BIS senior management. 3. Presentation by DuPont on the impact of Australia Group and.... 5. Report on regime-based activities. 6. Public comments and new business. 7. Request for volunteers...

How should we screen for depression following a natural disaster? An ROC approach to post-disaster screening in adolescents and adults.

Science.gov (United States)

Cohen, Joseph R; Adams, Zachary W; Menon, Suvarna V; Youngstrom, Eric A; Bunnell, Brian E; Acierno, Ron; Ruggiero, Kenneth J; Danielson, Carla Kmett

2016-09-15

The present study's aim was to provide the foundation for an efficient, empirically based protocol for depression screening following a natural disaster. Utilizing a Receiver Operating Characteristic (ROC) analytic approach, the study tested a) what specific disaster-related stressors (i.e., property damage, loss of basic services) and individual-related constructs (i.e., PTSD symptoms, trauma history, social support) conveyed the greatest risk for post-natural disaster depression, b) specific cutoff scores across these measures, and c) whether the significance or cutoff scores for each construct varied between adolescents and adults. Structured phone-based clinical interviews were conducted with 2000 adolescents who lived through a tornado and 1543 adults who survived a hurricane. Findings suggested that in both adolescents and adults, individual-related constructs forecasted greater risk for depressive symptoms following a natural disaster compared to disaster-related stressors. Furthermore, trauma history and PTSD symptoms were particularly strong indicators for adolescent depressive symptoms compared to adult depressive symptoms. Adolescents and adults who reported vulnerable scores for social support, trauma history, and lifetime PTSD symptoms were approximately twice as likely to present as depressed following the natural disaster. Findings from the present study were limited to post-disaster assessments and based on self-reported functioning 6-12 months following the natural disaster. The present study synthesizes the extensive body of research on post-disaster functioning by providing a clear framework for which questions may be most important to ask when screening for depression following a natural disaster. Copyright © 2016 Elsevier B.V. All rights reserved.

Three-dimensional nanometrology of microstructures by replica molding and large-range atomic force microscopy

DEFF Research Database (Denmark)

Stöhr, Frederik; Michael-Lindhard, Jonas; Simons, Hugh

2015-01-01

cavities. We investigated cylindrical deep reactive ion etched cavities in silicon wafers and determined the radius of curvature (ROC) of the sidewalls as a function of depth. Statistical analysis verified the reliability and reproducibility of the replication procedure. The mean ROC was determined as (6.......32 ± 0.06) lm, i.e., with 1% accuracy, while the ROC linearly increases by (0.52 ± 0.03) lm from the top to the bottom of the sidewalls. Nanometer sized surface defects are also well replicated. In addition, the method allows combining multiple features from differently processed wafers into a single...... sample, accelerating characterization in process optimization tasks. To access the sidewall shape samples needed to be cleaved. The method was applied to study X-ray refractive optics, whose performance is crucially affected by their three dimensional shapes....

Containment technology and the success of a joint initiative

International Nuclear Information System (INIS)

Campbell, H.J. Jr.

1997-01-01

This paper describes the efforts of the DuPont Company and DOE on containment of pollution. A test program at the Groundwater Remediation Field Laboratory National Test Site at Dover Air Force Base is discussed

Palliative radiotherapy in addition to self-expanding metal stent for improving dysphagia and survival in advanced oesophageal cancer (ROCS: Radiotherapy after Oesophageal Cancer Stenting): study protocol for a randomized controlled trial.

Science.gov (United States)

Adamson, Douglas; Blazeby, Jane; Nelson, Annmarie; Hurt, Chris; Nixon, Lisette; Fitzgibbon, Jim; Crosby, Tom; Staffurth, John; Evans, Mim; Kelly, Noreen Hopewell; Cohen, David; Griffiths, Gareth; Byrne, Anthony

2014-10-22

The single most distressing symptom for patients with advanced esophageal cancer is dysphagia. Amongst the more effective treatments for relief of dysphagia is insertion of a self-expanding metal stent (SEMS). It is possible that the addition of a palliative dose of external beam radiotherapy may prolong the relief of dysphagia and provide additional survival benefit. The ROCS trial will assess the effect of adding palliative radiotherapy after esophageal stent insertion. The study is a randomized multicenter phase III trial, with an internal pilot phase, comparing stent alone versus stent plus palliative radiotherapy in patients with incurable esophageal cancer. Eligible participants are those with advanced esophageal cancer who are in need of stent insertion for primary management of dysphagia. Radiotherapy will be administered as 20 Gray (Gy) in five fractions over one week or 30 Gy in 10 fractions over two weeks, within four weeks of stent insertion. The internal pilot will assess rates and methods of recruitment; pre-agreed criteria will determine progression to the main trial. In total, 496 patients will be randomized in a 1:1 ratio with follow up until death. The primary outcome is time to progression of patient-reported dysphagia. Secondary outcomes include survival, toxicity, health resource utilization, and quality of life. An embedded qualitative study will explore the feasibility of patient recruitment by examining patients' motivations for involvement and their experiences of consent and recruitment, including reasons for not consenting. It will also explore patients' experiences of each trial arm. The ROCS study will be a challenging trial studying palliation in patients with a poor prognosis. The internal pilot design will optimize methods for recruitment and data collection to ensure that the main trial is completed on time. As a pragmatic trial, study strengths include collection of all follow-up data in the usual place of care, and a focus on

Smear of duodenal fluid aspirate

Science.gov (United States)

... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. Dupont HL. Approach to the ... eds. Goldman's Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Fritsche TR, Pritt BS. ...

Testing Consent Order for Sodium Cyanide

Science.gov (United States)

This document announces that EPA has signed an enforceable testing Consent Order with E.I. du Pont de Nemours and Company (DuPont), FMC Corporation (FMC), Degussa Corporation (Degussa), ICI Americas Incorporated (ICI), and Cyanco Company (Cyanco).

Fecal smear

Science.gov (United States)

... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. DuPont HL. Approach to the ... AI, eds. Goldman's Cecil Medicine . 25thed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Haines CF, Sears CL. ...

Culture - colonic tissue

Science.gov (United States)

... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. DuPont HL. Approach to the ... eds. Goldman's Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Hall GS, Woods GL. ...

Shigellosis

Science.gov (United States)

... Nelson Textbook of Pediatrics . 20th ed. Philadelphia, PA: Elsevier; 2016:chap 340. DuPont HL. Approach to the ... eds. Goldman's Cecil Medicine . 25th ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Haines CF, Sears CL. ...

Fecal culture

Science.gov (United States)

... Management by Laboratory Methods . 23rd ed. Philadelphia, PA: Elsevier; 2017:chap 64. DuPont HL. Approach to the ... AI, eds. Goldman's Cecil Medicine . 25thed. Philadelphia, PA: Elsevier Saunders; 2016:chap 283. Haines CF, Sears CL. ...

The Democratic Future of Museums

DEFF Research Database (Denmark)

Holm, Henrik

2013-01-01

kritisk analyse af brugerinddragende praksis på museer (med eksempel i projektet "gipSMK" og en generel diskussion af demokratiske samfund og deres institutioner som oligarkiske, ikke demokratiske, med referencer til politisk teori og især Jacques Ranciere: Hatred of Democracy.......kritisk analyse af brugerinddragende praksis på museer (med eksempel i projektet "gipSMK" og en generel diskussion af demokratiske samfund og deres institutioner som oligarkiske, ikke demokratiske, med referencer til politisk teori og især Jacques Ranciere: Hatred of Democracy....

Pediatric Palliative Care: A Personal Story

Medline Plus

Full Text Available ... has been rented. This feature is not available right now. Please try again later. Published on Jan ... duPont Hospital for Children - Duration: 3:34. Nemours 1,093 views 3:34 Portraits of Life, Love & ...

Process waste assessment for the Radiography Laboratory

International Nuclear Information System (INIS)

Phillips, N.M.

1994-07-01

This Process Waste Assessment was conducted to evaluate the Radiography Laboratory, located in Building 923. It documents the processes, identifies the hazardous chemical waste streams generated by these processes, recommends possible ways to minimize waste, and serves as a reference for future assessments of this facility. The Radiography Laboratory provides film radiography or radioscopy (electronic imaging) of weapon and nonweapon components. The Radiography Laboratory has six x-ray machines and one gamma ray source. It also has several other sealed beta- and gamma-ray isotope sources of low microcurie (μCi) activity. The photochemical processes generate most of the Radiography Laboratory's routinely generated hazardous waste, and most of that is generated by the DuPont film processor. Because the DuPont film processor generates the most photochemical waste, it was selected for an estimated material balance

RESONANCE----I--Ju-ne

Indian Academy of Sciences (India)

work there emerged the concepts of functionality ... Copyright 19S0 American Chemi- ... hired by DuPont, and assigned to work in Carothers' group. .... In the Flory model, the application of stress, e.g., ... research institute, and academic activity.

La ley del deseo como esencia ética de lo político

Directory of Open Access Journals (Sweden)

Farrán, Roque

2010-06-01

Full Text Available In this article I propose to interrogate the ethical - political statute of the law in its ontological difference concerning the merely normative or countable thing.In order to do that I comment some theoretical contributions of Alain Badiou, Jacques Rancière, Jacques Lacan, Giorgio Agamben, Slavoj Zizek, Jean - Luc Nancy and Roland Barthes, that allow us to think closer than the discernible by the language. The main idea that involves the crossing of these affine references is to circumscribe the fleeting act of affirmation of the law qua difference that enables the constitution of a political subject remarking its essentially ethical dimension

En el presente artículo me propongo interrogar el estatuto ético-político de la ley en su diferencia ontológica respecto a lo meramente normativo o contable, para ello comento algunos aportes teóricos de autores como Alain Badiou, Jacques Rancière, Jacques Lacan, Giorgio Agamben, Slavoj Zizek, Jean-Luc Nancy y Roland Barthes, que nos permitirán pensar más acá de lo discernible por el lenguaje establecido. La idea principal que conlleva el cruce de estas referencias afines aunque disímiles, es la de circunscribir el acto fugaz de afirmación de la ley qua diferencia que habilita la constitución de un sujeto político, remarcando así su dimensión esencialmente ética.

End of project report on degradation processes in hydrogen fuel cells.

Science.gov (United States)

2008-01-01

Proton exchange membrane (PEM) fuel cells are one of the most popular types of fuel cells. They operate similarly to others with the electrolyte material inbetween the electrodes being a patented polymer called Nafion, made by DuPont. This polyelec...

Dupont Analysis of An Information Technology Enabled Competitive Advantage

OpenAIRE

Nustini, Yuni

2009-01-01

The transformation of business caused by e-business and e-commerce applications of the internet and related technologies demonstrates that information systems and information technologies are essential ingredients for business survival and success. The most often cited benefit of IT are integrating business process, increasing efficiency, sales, productivity, and competitiveness. This study is designed for determining where managers considering investment in information technology (IT) projec...

Dupont Analysis of an Information Technology Enabled Competitive Advantage

OpenAIRE

Nustini, Yuni

2003-01-01

The transformation of business caused by e-business and e-commerce applications of the internet and related technologies demonstrates that information systems and information technologies are essential ingredients for business survival and success. The most often cited benefit of IT are integrating business process, increasing efficiency, sales, productivity, and competitiveness. This study is designed for determining where managers considering investment in information technology (IT) projec...

Sigmund Freud: más allá del principio de modernidad/Sigmund freud: beyond the modernity principle

Directory of Open Access Journals (Sweden)

Marcelino Viera

2010-03-01

Full Text Available La propuesta de este texto es seguir la línea de pensamiento del filósofo francés Jacques Rancière al abordar el trabajo teórico freudiano como dislocado de su tiempo histórico, es decir de las formulaciones teóricas absortas en el positivismo que hacían de las humanidades una práctica científica. Rancière observa que el trabajo interpretativo y teórico de Freud se ubica en una lógica estética que rompe con la definición clásica de ésta e inaugura un pensamiento más allá de la lógica moderna. Consecuentemente este trabajo abordará una conceptualización de modernidad, la desarrollada por Michel Foucault en el texto The Politics of Truth (1997, para pasar luego a los Cínicos griegos como vía hacia la propuesta de Jacques Rancière en El inconsciente estético (2005 donde plantea a Freud como pensador estético. This paper proposes to follow the french philosopher Jacques Rancière’s thougth when tackling Freud’s theoretical work as dislocated from its historical time, that is from the theoretical formulations captivated in the positivism that would make humanities a scientific practice. In others words this work understands Freudian’s texts beyond the very extended positivism in the humanities at those times. Jacques Rancière points out that Freudian’s interpretative and theoretical work breaks a classic aesthetic logic creating a new way of thinking beyond modern logic. Consequently, this paper will focus on the conceptualization of modernity developed by Michel Foucault in his work The Politics of Truth (1997. Later on, it will approach the Greek Cynics as a path towards understanding Jacques Rancière’s proposal in El inconsciente estético (2005, in which Freud is presented as an aesthetic thinker.

2760-IJBCS-Article-Jacque Boco Adjakpa

African Journals Online (AJOL)

hp

many diseases including injury, wound, sting of bee or wasp, snake bite, ... to a lack of coverage in health needs and the ... used not only as foods (Codjia and ... investigated that a total of 205 plant species ... codified and entered and processed through ... is a significant threat for the conservation of ... Non rabid dog bite. 4.

2641-IJBCS-Article-Sagnes Jacques Akpa

African Journals Online (AJOL)

hp

medium by reacting benzyl chlorides 2a-b with the ... (K2CO3). The reaction generated an amide ion ... by column chromatography on silica gel using .... and dried over magnesium sulfate. The ..... the detection of antifungal compounds.

A Novel Class of Small Molecule Compounds that Inhibit Hepatitis C Virus Infection by Targeting the Prohibitin-CRaf Pathway

Directory of Open Access Journals (Sweden)

Shufeng Liu

2015-11-01

Full Text Available Identification of novel drug targets and affordable therapeutic agents remains a high priority in the fight against chronic hepatitis C virus (HCV infection. Here, we report that the cellular proteins prohibitin 1 (PHB1 and 2 (PHB2 are pan-genotypic HCV entry factors functioning at a post-binding step. While predominantly found in mitochondria, PHBs localize to the plasma membrane of hepatocytes through their transmembrane domains and interact with both EGFR and CRaf. Targeting PHB by rocaglamide (Roc-A, a natural product that binds PHB1 and 2, reduced cell surface PHB1 and 2, disrupted PHB-CRaf interaction, and inhibited HCV entry at low nanomolar concentrations. A structure-activity analysis of 32 synthetic Roc-A analogs indicated that the chiral, racemic version of aglaroxin C, a natural product biosynthetically related to Roc-A, displayed improved potency and therapeutic index against HCV infection. This study reveals a new class of HCV entry inhibitors that target the PHB1/2-CRaf pathway.

De la frise magdalénienne in situ … au centre d’interprétation du Roc-aux-Sorciers : l’usage de la 3D

Directory of Open Access Journals (Sweden)

Geneviève Pinçon

2012-04-01

Full Text Available La base de données 3D réalisée dans le cadre de la recherche archéologique sur les sculptures pariétales magdaléniennes (il y a 15 000 ans a pu être exploitée également pour une reproduction grandeur nature des œuvres à destination du grand public dans le Centre d’interprétation du Roc-aux-Sorciers à Angles-sur-l’Anglin (Vienne, France. Cette réalisation originale est présentée par les différents acteurs du projet (maître d’ouvrage, maître d’œuvre, scientifiques, prestataire 3D offrant ainsi le déroulé de la mise en œuvre de la restitution à partir de la base de données 3D et faisant part des éléments du cahier des charges pour l’enregistrement laser tridimensionnel dont l’exploitation s’est avérée répondre à des utilités variées. Quand les problématiques de la recherche conduisent à utiliser la 3D, il paraît logique que ce même outil puisse aider à la restitution au grand public et puisse être partagé avec la communauté scientifique ou avec les restaurateurs chargés de la conservation de ce patrimoine, comme le montre cette réalisation. Les implications du choix d'un mode de restitution à partir d’une base de données 3D sont également évoquées avec l'exemple de la frise sculptée magdalénienne de la Chaire-à-Calvin (Charente, France dans le cadre d’un projet de valorisation.The creation of a 3D database within the framework of archaeological research on Magdalenian parietal sculptures (15,000 years old has also been usable for a full-size reproduction of the figures for the benefit of the general public in the Interpretation Centre of Le Roc-aux-Sorciers at Angles-sur-l'Anglin (Vienne, France. This unique production is presented by the various participants in the project (contracting authority, prime contractor, scientists, 3D provider, thus providing the whole story of the reconstruction's implementation from the 3D database, and providing information on the specifications

A Decomposition of Hospital Profitability

Directory of Open Access Journals (Sweden)

Jason Turner

2015-06-01

Full Text Available Objectives: This paper evaluates the drivers of profitability for a large sample of U.S. hospitals. Following a methodology frequently used by financial analysts, we use a DuPont analysis as a framework to evaluate the quality of earnings. By decomposing returns on equity (ROE into profit margin, total asset turnover, and capital structure, the DuPont analysis reveals what drives overall profitability. Methods: Profit margin, the efficiency with which services are rendered (total asset turnover, and capital structure is calculated for 3,255 U.S. hospitals between 2007 and 2012 using data from the Centers for Medicare & Medicaid Services’ Healthcare Cost Report Information System (CMS Form 2552. The sample is then stratified by ownership, size, system affiliation, teaching status, critical access designation, and urban or non-urban location. Those hospital characteristics and interaction terms are then regressed (OLS against the ROE and the respective DuPont components. Sensitivity to regression methodology is also investigated using a seemingly unrelated regression. Results: When the sample is stratified by hospital characteristics, the results indicate investor-owned hospitals have higher profit margins, higher efficiency, and are substantially more leveraged. Hospitals in systems are found to have higher ROE, margins, and efficiency but are associated with less leverage. In addition, a number of important and significant interactions between teaching status, ownership, location, critical access designation, and inclusion in a system are documented. Many of the significant relationships, most notably not-for-profit ownership, lose significance or are predominately associated with one interaction effect when interaction terms are introduced as explanatory variables. Results are not sensitive to the alternative methodology. Conclusion: The results of the DuPont analysis suggest that although there appears to be convergence in the behavior of

A Decomposition of Hospital Profitability

Science.gov (United States)

Broom, Kevin; Elliott, Michael; Lee, Jen-Fu

2015-01-01

Objectives: This paper evaluates the drivers of profitability for a large sample of U.S. hospitals. Following a methodology frequently used by financial analysts, we use a DuPont analysis as a framework to evaluate the quality of earnings. By decomposing returns on equity (ROE) into profit margin, total asset turnover, and capital structure, the DuPont analysis reveals what drives overall profitability. Methods: Profit margin, the efficiency with which services are rendered (total asset turnover), and capital structure is calculated for 3,255 U.S. hospitals between 2007 and 2012 using data from the Centers for Medicare & Medicaid Services’ Healthcare Cost Report Information System (CMS Form 2552). The sample is then stratified by ownership, size, system affiliation, teaching status, critical access designation, and urban or non-urban location. Those hospital characteristics and interaction terms are then regressed (OLS) against the ROE and the respective DuPont components. Sensitivity to regression methodology is also investigated using a seemingly unrelated regression. Results: When the sample is stratified by hospital characteristics, the results indicate investor-owned hospitals have higher profit margins, higher efficiency, and are substantially more leveraged. Hospitals in systems are found to have higher ROE, margins, and efficiency but are associated with less leverage. In addition, a number of important and significant interactions between teaching status, ownership, location, critical access designation, and inclusion in a system are documented. Many of the significant relationships, most notably not-for-profit ownership, lose significance or are predominately associated with one interaction effect when interaction terms are introduced as explanatory variables. Results are not sensitive to the alternative methodology. Conclusion: The results of the DuPont analysis suggest that although there appears to be convergence in the behavior of NFP and IO

Natural Phenomena Hazards Design Criteria and Other Characterization Information for the MFFF at SRS

Energy Technology Data Exchange (ETDEWEB)

Wyatt, D.E.

2000-12-01

This report is a comprehensive complication applicable to the general Savannah River Site area, developed by both the original contractor, the DuPont Company, and by the current plant operator, Westinghouse Savannah River Company, over the full plant lifetime period (1950 - 2000).

Translating DWPF design criteria into an engineered facility design

International Nuclear Information System (INIS)

Kemp, J.B.

1986-01-01

The Defense Waste Processing Facility (DWPF) takes radioactive defense waste sludge and the radioactive nuclides, cesium and strontium, from the salt solution, and incorporates them in borosilicate glass in stainless steel canisters, for subsequent disposal in a deep geologic repository. The facility was designed by Bechtel National, Inc. under a subcontract from E.I. DuPont de Nemurs and Co., the prime contractor for the Department of Energy, for the design, construction and commissioning of the plant. The design criteria were specified by the DuPont Company, based upon their extensive experience as designer, and operator since the early 1950's, of the existing Savannah River Plant facilities. Some of the design criteria imposed unusual or new requirements on the detailed design of the facilities. This paper describes some of these criteria, encompassing several engineering disciplines, and discusses the solutions and designs which were developed for the DWPF

The information value of early career productivity in mathematics: a ROC analysis of prediction errors in bibliometricly informed decision making.

Science.gov (United States)

Lindahl, Jonas; Danell, Rickard

The aim of this study was to provide a framework to evaluate bibliometric indicators as decision support tools from a decision making perspective and to examine the information value of early career publication rate as a predictor of future productivity. We used ROC analysis to evaluate a bibliometric indicator as a tool for binary decision making. The dataset consisted of 451 early career researchers in the mathematical sub-field of number theory. We investigated the effect of three different definitions of top performance groups-top 10, top 25, and top 50 %; the consequences of using different thresholds in the prediction models; and the added prediction value of information on early career research collaboration and publications in prestige journals. We conclude that early career performance productivity has an information value in all tested decision scenarios, but future performance is more predictable if the definition of a high performance group is more exclusive. Estimated optimal decision thresholds using the Youden index indicated that the top 10 % decision scenario should use 7 articles, the top 25 % scenario should use 7 articles, and the top 50 % should use 5 articles to minimize prediction errors. A comparative analysis between the decision thresholds provided by the Youden index which take consequences into consideration and a method commonly used in evaluative bibliometrics which do not take consequences into consideration when determining decision thresholds, indicated that differences are trivial for the top 25 and the 50 % groups. However, a statistically significant difference between the methods was found for the top 10 % group. Information on early career collaboration and publication strategies did not add any prediction value to the bibliometric indicator publication rate in any of the models. The key contributions of this research is the focus on consequences in terms of prediction errors and the notion of transforming uncertainty

Optimal cutoff values of WHO-HPQ presenteeism scores by ROC analysis for preventing mental sickness absence in Japanese prospective cohort.

Directory of Open Access Journals (Sweden)

Tomoko Suzuki

Full Text Available Sickness absence due to mental disease in the workplace has become a global public health problem. Previous studies report that sickness presenteeism is associated with sickness absence. We aimed to determine optimal cutoff scores for presenteeism in the screening of the future absences due to mental disease.A prospective study of 2195 Japanese employees from all areas of Japan was conducted. Presenteeism and depression were measured by the validated Japanese version of the World Health Organization Health and Work Performance Questionnaire (WHO-HPQ and K6 scale, respectively. Absence due to mental disease across a 2-year follow-up was surveyed using medical certificates obtained for work absence. Socioeconomic status was measured via a self-administered questionnaire. Receiver operating curve (ROC analysis was used to determine optimal cutoff scores for absolute and relative presenteeism in relation to the area under the curve (AUC, sensitivity, and specificity.The AUC values for absolute and relative presenteeism were 0.708 (95% CI, 0.618-0.797 and 0.646 (95% CI, 0.546-0.746, respectively. Optimal cutoff scores of absolute and relative presenteeism were 40 and 0.8, respectively. With multivariate adjustment, cohort participants with our proposal cutoff scores for absolute and relative presenteeism were significantly more likely to be absent due to mental disease (OR = 4.85, 95% CI: 2.20-10.73 and OR = 5.37, 95% CI: 2.42-11.93, respectively. The inclusion or exclusion of depressive symptoms (K6≥13 at baseline in the multivariate adjustment did not influence the results.Our proposed optimal cutoff scores of absolute and relative presenteeism are 40 and 0.8, respectively. Participants who scored worse than the cutoff scores for presenteeism were significantly more likely to be absent in future because of mental disease. Our findings suggest that the utility of presenteeism in the screening of sickness absence due to mental disease would

Characterization and noninvasive diagnosis of bladder cancer with serum surface enhanced Raman spectroscopy and genetic algorithms

Science.gov (United States)

Li, Shaoxin; Li, Linfang; Zeng, Qiuyao; Zhang, Yanjiao; Guo, Zhouyi; Liu, Zhiming; Jin, Mei; Su, Chengkang; Lin, Lin; Xu, Junfa; Liu, Songhao

2015-05-01

This study aims to characterize and classify serum surface-enhanced Raman spectroscopy (SERS) spectra between bladder cancer patients and normal volunteers by genetic algorithms (GAs) combined with linear discriminate analysis (LDA). Two group serum SERS spectra excited with nanoparticles are collected from healthy volunteers (n = 36) and bladder cancer patients (n = 55). Six diagnostic Raman bands in the regions of 481-486, 682-687, 1018-1034, 1313-1323, 1450-1459 and 1582-1587 cm-1 related to proteins, nucleic acids and lipids are picked out with the GAs and LDA. By the diagnostic models built with the identified six Raman bands, the improved diagnostic sensitivity of 90.9% and specificity of 100% were acquired for classifying bladder cancer patients from normal serum SERS spectra. The results are superior to the sensitivity of 74.6% and specificity of 97.2% obtained with principal component analysis by the same serum SERS spectra dataset. Receiver operating characteristic (ROC) curves further confirmed the efficiency of diagnostic algorithm based on GA-LDA technique. This exploratory work demonstrates that the serum SERS associated with GA-LDA technique has enormous potential to characterize and non-invasively detect bladder cancer through peripheral blood.

77 FR 3774 - Formations of, Acquisitions by, and Mergers of Bank Holding Companies

Science.gov (United States)

2012-01-25

..., Dupont, Indiana. River Valley Financial Bank, Madison, Indiana, the existing thrift subsidiary of... FEDERAL RESERVE SYSTEM Formations of, Acquisitions by, and Mergers of Bank Holding Companies The companies listed in this notice have applied to the Board for approval, pursuant to the Bank Holding Company...

Non-invasive optical detection of esophagus cancer based on urine surface-enhanced Raman spectroscopy

Science.gov (United States)

Huang, Shaohua; Wang, Lan; Chen, Weiwei; Lin, Duo; Huang, Lingling; Wu, Shanshan; Feng, Shangyuan; Chen, Rong

2014-09-01

A surface-enhanced Raman spectroscopy (SERS) approach was utilized for urine biochemical analysis with the aim to develop a label-free and non-invasive optical diagnostic method for esophagus cancer detection. SERS spectrums were acquired from 31 normal urine samples and 47 malignant esophagus cancer (EC) urine samples. Tentative assignments of urine SERS bands demonstrated esophagus cancer specific changes, including an increase in the relative amounts of urea and a decrease in the percentage of uric acid in the urine of normal compared with EC. The empirical algorithm integrated with linear discriminant analysis (LDA) were employed to identify some important urine SERS bands for differentiation between healthy subjects and EC urine. The empirical diagnostic approach based on the ratio of the SERS peak intensity at 527 to 1002 cm-1 and 725 to 1002 cm-1 coupled with LDA yielded a diagnostic sensitivity of 72.3% and specificity of 96.8%, respectively. The area under the receive operating characteristic (ROC) curve was 0.954, which further evaluate the performance of the diagnostic algorithm based on the ratio of the SERS peak intensity combined with LDA analysis. This work demonstrated that the urine SERS spectra associated with empirical algorithm has potential for noninvasive diagnosis of esophagus cancer.

The moral challenge of green technology / Aarne P Vesilind, Lauren Heine, Jamie Hendry

Index Scriptorium Estoniae

Vesilind, Aarne P

2006-01-01

Autorid leiavad, et rohelise tehnoloogia kasutuselevõtu ja ettevõtete kasumi teenimise vastuseisu korral võidab kasumlikkus ning reguleerimata vaba turu süsteem ei toeta jätkusuutlikku arengut. Käsitletakse ettevõtte DuPont tegevdirektori Chad Holliday otsust jätkata tulutoova toote Teflon tootmist

Elastomeric Materials for Acoustical Applications

Science.gov (United States)

1989-09-15

fluorine . The classes of materials marketed as Fluorel and Viton by 3M and DuPont, respectively, are copolymers of vinylidene fluoride and...Street Sullivan Varnish Co. Chicago, IL 60632 420 N. Hiart Street- (312) 523-1412 Chicago, IL 60622 (312) 666-8080 Testworth Laboratories, Inc. 139

Taking Care of Business: Walter Carpenter and the Management of American Enterprise.

Science.gov (United States)

Cheape, Charles W.

1996-01-01

Evaluates the life and career of DuPont corporate executive, Walter Carpenter, and uses it to illustrate the rise of the managerial class. Neither owners nor entrepreneurs, managers like Carpenter used their intelligence and skill to reorganize and expand the companies the companies where they worked. (MJP)

75 FR 68802 - Secretary's Advisory Committee on Heritable Disorders in Newborns and Children; Notice of Meeting

Science.gov (United States)

2010-11-09

...: Renaissance Washington, DC Dupont Circle Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. Status... workgroups: Communications, Health Information Technology, and Evidence Review; (2) a report from a National... make a comment are requested to register online by Tuesday, January 25, 2011, at http://altarum.cvent...

Hot topic - fire resistant clothing for electrical workers has no Canadian standard

Energy Technology Data Exchange (ETDEWEB)

Douglas, R

1996-07-01

Fabrics which could be used for protective clothing for electrical workers was discussed. In Canada there are no stringent clothing rules for the electrical industry, but in the United States, the Federal Occupational Safety and Health Administration (OSHA) have made protective clothing an issue within the industry. Dupont`s Nomex, Westex`s Indura, and Hoechst Celanese`s PBI fibres are among the materials which have been through a series of thermal protection tests and are based on proven materials which are now being applied to work wear. The testing standards cover the ignition of the basic materials, untreated cottons, wools, and the thermal protection of flame resistant materials. The final tests are based on high current arc tests conducted on the fabrics used in the industry. These tests are now being conducted at Ontario Hydro`s High Current Test Facility preliminary to a Canadian standard being formulated and proposed in the very near future. 2 figs.

Microbiological test results using three urine pretreatment regimes with 316L stainless steel

Science.gov (United States)

Huff, Timothy L.

1993-01-01

Three urine pretreatments, (1) Oxone (Dupont) and sulfuric acid, (2) sodium hypochlorite and sulfuric acid, (3) and ozone, were studied for their ability to reduce microbial levels in urine and minimize surface attachment to 316L stainless steel coupons. Urine samples inoculated with Bacillus insolitus and a filamentous mold, organisms previously recovered from the vapor compression distillation subsystem of NASA Space Station Freedom water recovery test were tested in glass corrosion cells containing base or weld metal coupons. Microbial levels, changes in pH, color, turbidity, and odor of the fluid were monitored over the course of the 21-day test. Specimen surfaces were examined by scanning electron microscopy at completion of the test for microbial attachment. Ozonated urine samples were less turbid and had lower microbial levels than controls or samples receiving other pretreatments. Base metal coupons receiving pretreatment were relatively free of attached bacteria. However, well-developed biofilms were found in the heat-affected regions of welded coupons receiving Oxone and hypochlorite pretreatments. Few bacteria were observed in the same regions of the ozone pretreatment sample.

Local Strain Measurement of Kevlar Strand with Fiber Optic Bragg Grating

Science.gov (United States)

Banks, Curtis E.; Grant, Joseph; Russell, Sam; Arnett, Shawn

2008-01-01

1987 DuPont manufactured 4560 denier Kevlar/Epoxy Strands were instrumented with nine and three sensors each. Stress tests were performed at 30,45,60,70 and 80% of ultimate strength with dwell times of 10,000 seconds. FBG showed uneven stress levels which is contrary to conventional observation.

75 FR 17929 - Secretary's Advisory Committee on Heritable Disorders in Newborns and Children; Notice of Meeting

Science.gov (United States)

2010-04-08

...: Renaissance Washington, DC Dupont Circle Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. Status...: The meeting will include: (1) A presentation of the External Review Workgroup's final report on the... of the meeting. Those individuals who want to make a comment are requested to register online by...

76 FR 81496 - Product Cancellation Order for Certain Pesticide Registrations

Science.gov (United States)

2011-12-28

.... ID990017 Starane Fluroxypyr. IL080001 Tree-Age Emamectin benzoate. IN080001 Tree-Age Emamectin benzoate.... KY090029 Tree-Age Emamectin benzoate. MD090001 Tree-Age Emamectin benzoate. ME080002 Dupont Coragen... Pirimiphos-methyl. Insecticide. MI080001 Tree-Age Emamectin benzoate. MI980002 Transline 3,6-Dichloro-2...

Cobordism Obstructions to Vector Fields and a Generalization of Lin's Theorem

DEFF Research Database (Denmark)

Svane, Anne Marie

Atiyah and Dupont have studied the existence of linearly independent vector fields on manifolds by means of K-theory. They obtained the complete conditions for up to three independent vector fields. In the thesis, we try to copy their approach using certain spectra related to cobordism theory. We...

我國侵害營業秘密與競業禁止違約判決之量化研究 Quantitative Analysis of the ROC Court Decisions on Trade Secret Infringements and Violation of Non-Compete Clauses

Directory of Open Access Journals (Sweden)

洪榮宗 Oliver Hung

2007-12-01

Full Text Available 營業秘密法生效迄今十年，其對於營業秘密的保護是否已周延？實有待觀察。又離職後競業禁止約款之相關實務運作現況為何？亦為探討營業秘密保護議題時，無法切割之問題。 本文利用司法院之系統查詢我國地方法院自1999 年8 月1 日起至2006年6 月30 日止，侵害營業秘密或違反競業禁止約款之民事判決，並以量化分析方式探討司法實務之態度。 本文之量化分析顯示：營業秘密與競業禁止訴訟之勝率均偏低；主張違反競業禁止明顯比主張侵害營業秘密來得容易；兩類訴訟之平均審理時間恐無法因應其急迫性需求；未約定違反競業禁止約款之違約賠償罰則的敗訴機率極高；競業禁止約款之五原則在法院實務上並未被遵守等。本文希望透過上開發現與確認，能期待找出改善之道。 The ROC Trade Secret Act has come into force for 10 years. However, whether it has sufficiently protected the trade secrets remains unanswered. In addition, the current operation and practice of “Non-Compete Clauses after Employment Relationship” are also important issues while discussing the trade secrets issues. Through the database of the ROC Judicial Yuan, we reviewed all the cases in the ROC district courts in connection with infringements on trade secrets and breach of non-compete clauses from August 1, 1999 to June 30, 2006 and conducted quantitative analysis of the courts’ opinions in this regard. The results of our quantitative analysis show that: 1. most of the decisions related to trade secret infringements and breach of non-compete clauses are in favor of defendants; 2. it is easier to claim violation of the non-compete clauses than infringements on trade secrets; 3. the trial period is too long to protect the plaintiffs given that the time is of essence; 4. it is quite probable that plaintiffs will lose the lawsuits if no penalty clause for

Circumventing Therapeutic Resistance and the Emergence of Disseminated Breast Cancer Cells Through Non-Invasive Optical Imaging

Science.gov (United States)

2015-06-01

Investigator (1992-1994); National Science Foundation Young Investigator (1993-1998); E. I. DuPont de Nemours Young Faculty Award (1995-1997); Alfred P. Sloan...address of the Funding Agency’s Procuring Contracting/Grants Officer: Amber Stilh·ich U.S . Almy Medical Resem·ch Acquisition Activity, 820 Chandler

77 FR 47047 - Biomass Research and Development Technical Advisory Committee

Science.gov (United States)

2012-08-07

... Committee Act (Public Law No. 92-463, 86 Stat. 770) requires that agencies publish these notices in the.... ADDRESSES: Renaissance DuPont Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. FOR FURTHER...: In keeping with procedures, members of the public are welcome to observe the business of the Biomass...

76 FR 17140 - Secretary's Advisory Committee on Heritable Disorders in Newborns and Children; Notice of Meeting

Science.gov (United States)

2011-03-28

...: Renaissance Washington, DC, Dupont Circle Hotel, 1143 New Hampshire Avenue, NW., Washington, DC 20037. Status... Act of 2008. Agenda: The meeting will include: (1) A presentation of the External Review Workgroup's... individuals who want to make oral comments are requested to register online by Tuesday, May 3, 2011 at http...

Tumedad tungid pilkases öös / Andres Maimik

Index Scriptorium Estoniae

Maimik, Andres, 1970-

1999-01-01

Pimedate Ööde III filmifestivalil Tallinnas näidatavast kolmest mängufilmist :"Püssirohutünn": režissöör Goran Paskaljevic : Jugoslaavia ; "Inimlikkus" : režissöör Bruno Dupont : Prantsusmaa : "eXistenZ" : režissöör David Cronenberg : Kanada - Suurbritannia

Mechanistic insights into the hydrocyanation reaction

NARCIS (Netherlands)

Bini, L.

2009-01-01

The hydrocyanation of an alkene is a catalytic carbon-carbon bond formation reaction and the obtained nitriles can be converted into a variety of valuable products. The investigation of this reaction has mainly focused on the DuPont adiponitrile (AdN) process. This process is so far the only example

Integrated Multidisciplinary Design of High Pressure Multistage Compressor Systems (la Conception integree des compresseurs multi-etage a haute performance)

Science.gov (United States)

1998-09-01

development ONERA and SNECMA and is described in [Nicoud, 91]. This methodology [ Karadimas , 1997]. The aim of all efforts method solves the Quasi-3D...computer power, 1994 2-11 BERTHILLIER, M., DUPONT, C., MONDAL, R., KARADIMAS , G. : New Ways for the Design the BARRAU, J.J. : Blade Forced Response

Jumalaga, ainsus! : (Postmodernismi väljakutse eesti kirjandusele ja kriitikale) / Rein Veidemann

Index Scriptorium Estoniae

Veidemann, Rein, 1946-

1995-01-01

Ka Harald Peebu artiklist 'Arvustaja teeristil' (Keel ja Kirjandus, 1993, nr. 10), postmodernismi klassiku Jacques Derrida seisukohtadest, tema terminist 'différance' - 'siirdus' ja kirjanduskriitikast

Lennart Meri Prantsusmaale, Pierre Joxe Riiga / Aadu Hiietamm

Index Scriptorium Estoniae

Hiietamm, Aadu, 1954-

1993-01-01

Lennart Meri töövisiit Prantsusmaale, 26. -28. jaanuar 1993. Prantsuse kaitseminister Pierre Joxe kohtub Riias Balti kaitseministritega.Prantsuse suursaadiku Jacques Huntzingeri'i pressikonverentsilt

Prantsuse-Eesti vaheline koostööleping sõlmitakse järgmisel nädalal / Jaanus Putting

Index Scriptorium Estoniae

Putting, Jaanus

1993-01-01

President Lennart Meri töövisiit Prantsuse Vabariiki, 26.-28. jaanuar 1993. Eesti-Prantsuse tippkohtumine, Prantsuse kaitseminister kohtub Balti ametivendadega. Jacques Huntzinger'i pressikonverentsilt

Three-dimensional stereotactic surface projection of brain perfusion SPECT improves diagnosis of Alzheimer's disease

International Nuclear Information System (INIS)

Honda, Norinari; Machida, Kikuo

2003-01-01

Alzheimer's disease (AD) is diagnosed by either inspection of the brain perfusion SPECT, or three-dimensional stereotactic surface display (3D-SSP). The purpose was to compare diagnostic performances of these methods. Sixteen nuclear medicine physicians independently interpreted 99m Tc-ECD SPECT in one session and SPECT with 3D-SSP in another session without clinical information for 50 studies of AD patients and 40 studies of healthy volunteers. Probabilities of AD were reported according to a subjective scale from 0% (normal) to 100% (definite AD). Receiver operating characteristics curves were generated to calculate areas under the receiver operating characteristic (ROC) curves (Az's) for the inspection as well as for an automated diagnosis based on a mean Z value in the bilateral posterior cingulate gyri in a 3D-SSP template. Mean Az for visual interpretation of SPECT alone (0.679±0.058) was significantly smaller than that for visual interpretation of both SPECT and 3D-SSP (0.778±0.060). Az for the automated diagnosis (0.883±0.037) was significantly greater than that for both modes of visual interpretation. 3D-SSP enhanced performance of the nuclear medicine physicians inspecting SPECT. Performance of the automated diagnosis exceeded that of the physicians inspecting SPECT with and without 3D-SSP. (author)

Application of photopolymer holograms for the anticounterfeit protection of banknotes

Science.gov (United States)

Markova, Nina V.; Yamnikov, Leonid S.; Turkina, Elena S.; Semenov, Erick G.; Bulygin, Theodor V.; Levin, Gennady G.

1998-04-01

The article analyses holograms counterfeiting techniques and presents grounds for the choice of the optimum type of holograms best protected against counterfeiting -- volume holograms. There is a description of these holograms registration process on DuPont OmniDex photopolymer film and the analysis of the perspective of their use during banknotes production.

Energy policies and politics for sustainable world-system development

DEFF Research Database (Denmark)

Czeskleba-Dupont, Rolf

politics, put into perspective by (b) R.C.-Dupont 1993 as the movement of the US in a field of tension between eco- and geopolitics; and (c) a 2006 declaration of ten former environmental ministers to end the nuclear age and to reform the UN mandate of the International Atomic Energy Agency....

78 FR 65344 - Center for Scientific Review Amended Notice of Meeting

Science.gov (United States)

2013-10-31

... DEPARTMENT OF HEALTH AND HUMAN SERVICES National Institutes of Health Center for Scientific Review Amended Notice of Meeting Notice is hereby given of a change in the meeting of the Molecular Neuropharmacology and Signaling Study Section, October 7, 2013, 8:00 a.m. to October 8, 2013, 12:00 p.m., The Dupont...

78 FR 60296 - Center for Scientific Review; Notice of Closed Meetings

Science.gov (United States)

2013-10-01

... Review Group; Prokaryotic Cell and Molecular Biology Study Section. Date: October 25, 2013. Time: 8:00 a... for Scientific Review Special Emphasis Panel; Eye Diseases 6. Date: October 25, 2013. Time: 9:00 a.m..., Dupont Circle, 1143 New Hampshire Avenue NW., Washington, DC 20037. Contact Person: James P. Harwood Ph.D...

Systematic Characterization of the Immune Response to Gluten and Casein in Autism Spectrum Disorders. Revision

Science.gov (United States)

2013-08-01

tremendous effort on our part, we were unable to acquire enough serum volume for these assays. The price offered by AGRE at the time of acquisition (50 μL...1. Dupont FM, Vensel WH, Tanaka CK, Hurkman WJ, Altenbach SB (2011) Deciphering the complexities of the wheat flour proteome using quantitative two

78 FR 66752 - Center for Scientific Review; Amended Notice of Meeting

Science.gov (United States)

2013-11-06

... and Imaging Technologies Study Section, October 10, 2013, 07:45 a.m. to October 11, 2013, 06:00 p.m., Sheraton Delfina Santa Monica Hotel, 530 West Pico Boulevard, Santa Monica, CA 90405 which was published in... Renaissance Washington Dupont Circle Hotel, 1143 New Hampshire Ave. NW., Washington, DC 20037. The meeting...

XVII 'Jacques-Louis Lions' Spanish-French School

CERN Document Server

Alonso, Pedro

2017-01-01

The first part of this volume gathers the lecture notes of the courses of the “XVII Escuela Hispano-Francesa”, held in Gijón, Spain, in June 2016. Each chapter is devoted to an advanced topic and presents state-of-the-art research in a didactic and self-contained way. Young researchers will find a complete guide to beginning advanced work in fields such as High Performance Computing, Numerical Linear Algebra, Optimal Control of Partial Differential Equations and Quantum Mechanics Simulation, while experts in these areas will find a comprehensive reference guide, including some previously unpublished results, and teachers may find these chapters useful as textbooks in graduate courses. The second part features the extended abstracts of selected research work presented by the students during the School. It highlights new results and applications in Computational Algebra, Fluid Mechanics, Chemical Kinetics and Biomedicine, among others, offering interested researchers a convenient reference guide to these l...

Jean-Jacques Rousseau's views on adult education

Science.gov (United States)

Dame, Frederick William

1996-01-01

Although Rousseau describes in Émile only his scheme for childhood education, he presents us in this work with some direct statements which can be applied to explain more fully the nature of adult education. The author surveys Rousseau's ideas on the role of the general will in adult educational philosophy, subject matter, methodology and negative education, as well as the relationships between the family, student, teacher, community and the state. He concludes that the modern Rousseau would not limit education to males and would recognize that the four Rousseauian periods of educational development — infancy, childhood, youngster, adolescence — is followed by a fifth: adulthood. Adult education is the logical continuation of the four previous phases. Throughout each phase education must permit intellectual and moral growth and always allow for creativity and diversity. Only then can adults become positive contributors to their society.

XV "Jacques-Louis Lions" Spanish-French School

CERN Document Server

Vázquez, Carlos; Coquel, Frédéric

2014-01-01

This book, based on the lecture notes from the XVth Spanish-French School on Numerical Simulation in Physics and Engineering, covers a range of advances in numerical simulation in physics and engineering. The main subjects addressed are: biomechanics, stochastic calculus, geophysical flow simulation, and shock-capturing numerical methods for hyperbolic systems of partial differential equations. The book is mainly aimed at young graduate students in mathematics, engineering, and natural sciences who are starting to confront numerical simulation, either at a research level or in the field of industrial applications. It will also be helpful for researchers or even technicians who are working in an industrial environment and are interested in the state-of-the-art numerical techniques in these fields. Finally, the book will be useful as a textbook for master's or PhD level courses in mathematics, physics, or engineering.

Phenomenological futures in dispute: Emmanuel Levinas, Jacques ...

African Journals Online (AJOL)

In an inconclusive summary, the paper returns to the point of departure, the first version of a relation of non-relation, in a disputed connection to be set out between philosophy, a politics of exclusion, and psychoanalytical accounts of political investment. The paper seeks to locate a relation of non-relation, both in the failed ...

Jacques Derrida’s (ArtWork of Mourning

Directory of Open Access Journals (Sweden)

Antal Eva

2017-07-01

Full Text Available Derrida’s highly personal mourning texts are collected and published in a unique book under the title The Work of Mourning edited by Pascale-Anne Brault and Michael Naas, two outstanding translators of Derrida’s works. The English collection is published in 2001, while the French edition came out later in 2003 titled Chaque fois unique, la fin du monde (Each Time Unique, the End of the World. In his deconstructed eulogies, Derrida, being in accordance with ‘the mission impossible’ of deconstruction, namely, ‘to allow the coming of the entirely other’ in its otherness, seems to find his own voice. In my paper, I will focus on this special segment of Derrida’s death-work (cf. life-work; namely, on his mourning texts written for his dead friends, paying special attention to the rhetoric ‘circling around’ fidelity, friendship, and the other in his textual mourning.

Introduction Robin Melrose The French philosopher Jacques ...

African Journals Online (AJOL)

and presumably based on the present participle diff erant. (from differer), which in French means ... grammatical items that can fill the determiner slot). But ... or opposition which gives them form [ ... ] Here the ..... Here is a simple example from ...

Determining health expectancies

National Research Council Canada - National Science Library

Robine, Jean-Marie

2003-01-01

... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Jean-Marie Robine 9 1 Increase in Life Expectancy and Concentration of Ages at Death . . . . France Mesle´ and Jacques Vallin 13 2 Compression of Morbidity...

Marvels & Tales, Journal of Fairy-Tale Studies

OpenAIRE

Perrin, Jean-François

2007-01-01

Numéro spécial en l’honneur de Jacques Barchilon Articles Ann E. Dugan : « Une interview de Jacques Barchilon : du soldat de la France-libre au pionnier du conte de fées ».Jack Zipes : « La signification du conte de fées à travers l’évolution de la culture ».Lewis C. Seifert : « L’hybridité animal-humain dans “Babiole” et “Le Prince Marcassin” de Mme d’Aulnoy ».Philippe Hourcade : « Merveilles et contes chez le duc de Saint-Simon ».Catherine Vellay-Vallantin : « Le roi Herla au pays de Galles...

Hospitality within hospital meals—Socio-material assemblages

DEFF Research Database (Denmark)

Justesen, Lise; Gyimóthy, Szilvia; Mikkelsen, Bent E.

2016-01-01

Hospital meals and their role in nutritional care have been studied primarily from a life and natural science perspective. This article takes a different approach and explores the idea of hospitality inspired by Jacques Derrida’s work on the ontology of hospitality. By drawing on ethnographic fie...... and management involved in hospital food service and in nutritional care to work more systematically with the environment for improved hospital meal experiences in the future......Hospital meals and their role in nutritional care have been studied primarily from a life and natural science perspective. This article takes a different approach and explores the idea of hospitality inspired by Jacques Derrida’s work on the ontology of hospitality. By drawing on ethnographic...

Renewed (M)antics

DEFF Research Database (Denmark)

Elias, Camelia

2011-01-01

This essay looks at the poetics of visual art as represented in Tarot cards. It combines strategies of 'reading' with a Marseille deck with a perspective from storytelling in the manner of novelist Italo Calvino and philosopher Jacques Derrida. The focus is on death as art and as a form of derail......This essay looks at the poetics of visual art as represented in Tarot cards. It combines strategies of 'reading' with a Marseille deck with a perspective from storytelling in the manner of novelist Italo Calvino and philosopher Jacques Derrida. The focus is on death as art and as a form...... of derailing traditional epistemic knowledge from its 'reality' or its basic condition for articulation and representation....

ジャン=ジャック・ルソー『対話』の四草稿をめぐる歴史的概要

OpenAIRE

土橋, 友梨子

2012-01-01

En 1772, Jean-Jacques Rousseau (1712-1778), hanté du délire de\\persécution, entreprend de rédiger une oeuvre extraordinaire : Rousseau juge de\\Jean-Jacques—Dialogues (1782). Dans cet ouvrage, l’auteur, qui s’estime\\défiguré et diffamé par l’hostilité unanime des ennemis et du public, fait dialoguer\\« Rousseau » et « le Français » afin de prouver désespérément l’innocence\\de « Jean-Jacques » et de dévoiler les injustices qui lui sont faites. Cette\\oeuvre a longtemps été considérée comme un doc...

El concepto de locura en la obra de Jacques Lacan The Concept Of Madness In The Jacques Lacan Work's

Directory of Open Access Journals (Sweden)

Pablo D. Muñoz

2008-12-01

Full Text Available Desde sus primeros escritos Lacan distingue el concepto de locura del de psicosis, contradiciendo el uso común que los toma como equivalentes. Esta confusión produce efectos en la clínica psicoanalítica, por lo cual conviene aclarar y mantener su diferencia. Si bien los comentadores de su obra han reconocido esa distinción, no se ha destacado todo lo necesario la transformación que sufre el concepto de locura al final de la misma, ni se ha establecido con precisión su índole, sus alcances y consecuencias. Para hacerlo se propone explorar las diferencias entre locura y psicosis con el recurso de la teoría de nudos que Lacan emplea en dicho período, donde la psicosis es formalizada como una forma particular de anudamiento de los registros distinto del de la neurosis y la locura como su desanudamiento. En este trabajo se realiza un recorrido que enlaza las primeras referencias de Lacan sobre la locura con las recién mencionadas.First Lacan writings differentiates the "madness" concept from the other one of "psychosis", contradicting therefore the common use in language that takes them equivalent. This confusion can carry adverse effects in the psychoanalytic clinic. Thus is better to clarify and maintain its difference. Although Lacan comentators have recognized that distinction is not enough outstanded the transformation of the concept of "madness" at the his latest works, nor has settled down its nature, its reaches and consequences. In order to do it, we will explore the differences between "madness" and "psychosis" with his knots theory support, where the psychosis and neurosis like particular different form of knotting, and also defines "madness" like a registers untied. In this work is carried out a journey that connects the first references of Lacan about the madness with the last ones mentioned.

Jacques Krynen, Jacques Raibaut. La légitimité des juges. Actes du colloque des 29-30 octobre 2003

Directory of Open Access Journals (Sweden)

Guillaume Métairie

2009-05-01

Full Text Available  « Au nom du peuple français » : grandiose et lapidaire, la formule suffit-elle à légitimer l’existence et le travail des juges qui tranchent en son lieu et place ? C’est à propos de cette question, sensible et d’actualité, que le volume dont nous avons à rendre compte présente une série diversifiée de regards croisés qui font son intérêt et sa richesse. Diversité, d’abord, en ce qui concerne la nature des participants, juristes praticiens (magistrats pour la plupart ou théoriciens (universi...

High-flying visions at a conference in Pärnu / Henrik Roonemaa

Index Scriptorium Estoniae

Roonemaa, Henrik

2003-01-01

Pärnus toimunud viiendast rahvusvahelisest infotehnoloogia konverentsist "Visioonidest lahendusteni". Visioonidest rääkisid Jacques Lafitte, Andrius Kubilius, Christian Fonnesbech, lahendustest Kristjan Otsmann ja Ülo Jaaksoo

The Coast Artillery Journal. Volume 65, Number 4, October 1926

Science.gov (United States)

1926-10-01

THE PURITAN CONFECTIONERY PURE HOME MADE CANDIES AND ICE CREAM Home Made A/ter.Dinner Mints, Salted Almonds, and Whipping Cream a Specialty PHONE 856...fish hook, which device is shown on the coat of arms and portrays this event. In the battle of New Market , May 15, 1864, in which Captain DuPont (later

76 FR 12939 - Granular Polytetrafluoroethylene Resin From Italy: Final Results of Expedited Sunset Review of...

Science.gov (United States)

2011-03-09

... participate was filed by DuPont within the deadline specified in 19 CFR 351.218(d)(1)(i), as extended due to... producer of PTFE resin in the United States. On February 11, 2011, the Department received a substantive... extended due to the Correction Notice. We received no substantive responses from any respondent interested...

Dislocations and other topological oddities

Science.gov (United States)

Pieranski, Pawel

2016-03-01

We will show that the book Dislocations by Jacques Friedel, published half a century ago, can still be recommended, in agreement with the author's intention, as a textbook ;for research students at University and for students at engineering schools as well as for research engineers;. Indeed, today dislocations are known to occur not only in solid crystals but also in many other systems discovered more recently such as colloidal crystals or liquid crystals having periodic structures. Moreover, the concept of dislocations is an excellent starting point for lectures on topological defects occurring in systems equipped with order parameters resulting from broken symmetries: disclinations in nematic or hexatic liquid crystals, dispirations in chiral smectics or disorientations in lyotropic liquid crystals. The discussion of dislocations in Blue Phases will give us an opportunity to call on mind Sir Charles Frank, friend of Jacques Friedel since his Bristol years, who called these ephemeral mesophases ;topological oddities;. Being made of networks of disclinations, Blue Phases are similar to Twist Grain Boundary (TGB) smectic phases, which are made of networks of screw dislocations and whose existence was predicted by de Gennes in 1972 on the basis of the analogy between smectics and superconductors. We will stress that the book by Jacques Friedel contains seeds of this analogy.

Does Capital Structure Influence Company Profitability?

Directory of Open Access Journals (Sweden)

Herciu Mihaela

2017-12-01

Full Text Available Every company has a different structure of balance sheet. Some of the companies have more liabilities than equity. Considering the industry or debt-to-equity ratio, the balance sheet structure affects the company profitability measured by DuPont system. The main objective of the paper is to analyze the structure of balance sheet and to identify some optimal levels in order to increase company profitability. The DuPont returns like ROA (return on assets and ROE (return on equity will be used to measure the company profitability, while the debt-to-equity ratio will be used as a measure (reflection of capital structure. The samples consist on the most profitable non-financial companies ranked in Fortune Global 500. The companies will be grouped in clusters (based on industry or debt-to-equity ratio in order to identify the signification of the correlation between the profit and the balance sheet structure. The main results of the paper refer to the company profitability that can be increased by using an optimal structure of liabilities and equity.

Sequential accelerated tests: Improving the correlation of accelerated tests to module performance in the field

Science.gov (United States)

Felder, Thomas; Gambogi, William; Stika, Katherine; Yu, Bao-Ling; Bradley, Alex; Hu, Hongjie; Garreau-Iles, Lucie; Trout, T. John

2016-09-01

DuPont has been working steadily to develop accelerated backsheet tests that correlate with solar panels observations in the field. This report updates efforts in sequential testing. Single exposure tests are more commonly used and can be completed more quickly, and certain tests provide helpful predictions of certain backsheet failure modes. DuPont recommendations for single exposure tests are based on 25-year exposure levels for UV and humidity/temperature, and form a good basis for sequential test development. We recommend a sequential exposure of damp heat followed by UV then repetitions of thermal cycling and UVA. This sequence preserves 25-year exposure levels for humidity/temperature and UV, and correlates well with a large body of field observations. Measurements can be taken at intervals in the test, although the full test runs 10 months. A second, shorter sequential test based on damp heat and thermal cycling tests mechanical durability and correlates with loss of mechanical properties seen in the field. Ongoing work is directed toward shorter sequential tests that preserve good correlation to field data.

Raamatututvustus / Rein Põder

Index Scriptorium Estoniae

Põder, Rein, 1943-

1995-01-01

Rousseau, Jean-Jacques. Üksildase uitaja mõtisklused; Hill, Susan. Proua de Winter; Kõrvemaast põhjarannani : Kuusalu kihelkonna kirjanduslik-kodulooline antoloogia / Koost. Helmut Elstrok; Tead.toim. Oskar Kuningas

Kolm etüüdi frankofiilist presidendiga = Three moments with the francophile president / Toomas Kiho

Index Scriptorium Estoniae

Kiho, Toomas, 1963-

2003-01-01

Värvikaid meenutusi Prantsuse Vabariigi presidendi Jacques Chiraci ja Eesti presidendi Lennart Meri kohtumistest. Vt. samas: Käbin, Toomas. The Lennart Meri Europe Fund. Lennart Meri Euroopa Sihtasutusest

Surface excitation parameter for rough surfaces

International Nuclear Information System (INIS)

Da, Bo; Salma, Khanam; Ji, Hui; Mao, Shifeng; Zhang, Guanghui; Wang, Xiaoping; Ding, Zejun

2015-01-01

Graphical abstract: - Highlights: • Instead of providing a general mathematical model of roughness, we directly use a finite element triangle mesh method to build a fully 3D rough surface from the practical sample. • The surface plasmon excitation can be introduced to the realistic sample surface by dielectric response theory and finite element method. • We found that SEP calculated based on ideal plane surface model are still reliable for real sample surface with common roughness. - Abstract: In order to assess quantitatively the importance of surface excitation effect in surface electron spectroscopy measurement, surface excitation parameter (SEP) has been introduced to describe the surface excitation probability as an average number of surface excitations that electrons can undergo when they move through solid surface either in incoming or outgoing directions. Meanwhile, surface roughness is an inevitable issue in experiments particularly when the sample surface is cleaned with ion beam bombardment. Surface roughness alters not only the electron elastic peak intensity but also the surface excitation intensity. However, almost all of the popular theoretical models for determining SEP are based on ideal plane surface approximation. In order to figure out whether this approximation is efficient or not for SEP calculation and the scope of this assumption, we proposed a new way to determine the SEP for a rough surface by a Monte Carlo simulation of electron scattering process near to a realistic rough surface, which is modeled by a finite element analysis method according to AFM image. The elastic peak intensity is calculated for different electron incident and emission angles. Assuming surface excitations obey the Poisson distribution the SEPs corrected for surface roughness are then obtained by analyzing the elastic peak intensity for several materials and for different incident and emission angles. It is found that the surface roughness only plays an

Estimating Typhoon Rainfall over Sea from SSM/I Satellite Data Using an Improved Genetic Programming

Science.gov (United States)

Yeh, K.; Wei, H.; Chen, L.; Liu, G.

2010-12-01

Estimating Typhoon Rainfall over Sea from SSM/I Satellite Data Using an Improved Genetic Programming Keh-Chia Yeha, Hsiao-Ping Weia,d, Li Chenb, and Gin-Rong Liuc a Department of Civil Engineering, National Chiao Tung University, Hsinchu, Taiwan, 300, R.O.C. b Department of Civil Engineering and Engineering Informatics, Chung Hua University, Hsinchu, Taiwan, 300, R.O.C. c Center for Space and Remote Sensing Research, National Central University, Tao-Yuan, Taiwan, 320, R.O.C. d National Science and Technology Center for Disaster Reduction, Taipei County, Taiwan, 231, R.O.C. Abstract This paper proposes an improved multi-run genetic programming (GP) and applies it to predict the rainfall using meteorological satellite data. GP is a well-known evolutionary programming and data mining method, used to automatically discover the complex relationships among nonlinear systems. The main advantage of GP is to optimize appropriate types of function and their associated coefficients simultaneously. This study makes an improvement to enhance escape ability from local optimums during the optimization procedure. The GP continuously runs several times by replacing the terminal nodes at the next run with the best solution at the current run. The current novel model improves GP, obtaining a highly nonlinear mathematical equation to estimate the rainfall. In the case study, this improved GP described above combining with SSM/I satellite data is employed to establish a suitable method for estimating rainfall at sea surface during typhoon periods. These estimated rainfalls are then verified with the data from four rainfall stations located at Peng-Jia-Yu, Don-Gji-Dao, Lan-Yu, and Green Island, which are four small islands around Taiwan. From the results, the improved GP can generate sophisticated and accurate nonlinear mathematical equation through two-run learning procedures which outperforms the traditional multiple linear regression, empirical equations and back-propagated network

Dust Storm Hits Canary Islands

Science.gov (United States)

2002-01-01

A thick pall of sand and dust blew out from the Sahara Desert over the Atlantic Ocean yesterday (January 6, 2002), engulfing the Canary Islands in what has become one of the worst sand storms ever recorded there. In this scene, notice how the dust appears particularly thick in the downwind wake of Tenerife, the largest of the Canary Islands. Perhaps the turbulence generated by the air currents flowing past the island's volcanic peaks is churning the dust back up into the atmosphere, rather than allowing it to settle toward the surface. This true-color image was captured by the Moderate-resolution Imaging Spectroradiometer (MODIS), flying aboard NASA's Terra satellite, on January 7, 2002. Image courtesy Jacques Descloitres, MODIS Land Rapid Response Team at NASA GSFC

The Coast Guard Proceedings of the Marine Safety and Security Council: Spring 2016

Science.gov (United States)

2016-04-01

management system designed to manage safety elements in the workplace . In practice, an operational...winning DuPont family of workplace safety training offerings. Management Buy-In Even if an organization embraces nonconformities as a call to improved...PROCEEDINGS Spring 2016 Vol. 73, Number 1 Safety Management System Objectives 6 Safety Management Facilitates Safe Vessel Operation Vessel

Migration et commerce de distribution dans les villes ouest-africaines

African Journals Online (AJOL)

La migration et le commerce de distribution agissent en synergie sur la structuration de l'espace urbain. Ils apparaissent comme des instruments privilégiés d'analyse des questions relevant de l'économie spatiale (Dupont, 1986). Leur impact sur la dynamique urbaine participe à la création d'activités et d'investissements ...

Kuulake, Rosseau! / Toomas Raudam

Index Scriptorium Estoniae

Raudam, Toomas, 1947-

1998-01-01

Varem ilmunud: Postimees, 1995, 4.okt. Rets rmt.: Rousseau, Jean- Jacques. Üksildase uitaja mõtisklused. Arutlus teadustest ja kunstidest / tlk.Sirje Keevallik ja Kristiina Ross. Tallinn: Perioodika, 1995

Maskeering : uus reaalsus = Camouflage : a New Reality / Jean-Philippe Dore, Urs Keller

Index Scriptorium Estoniae

Dore, Jean-Philippe

2001-01-01

Šveitsi arhitektide Jacques Herzogi ja Pierre de Meuroni ning nende koolkonna - Peter Zumthor, Annette Gigon, Mike Guyer, Valerio Olgiati - "sõnatust" arhitektuurist ja selle sotsiaalsest tähendusest.

ROC Analysis of Visual Assessments Made in Gated Blood Pool Scans of Patients with Coronary Artery Disease

International Nuclear Information System (INIS)

Lee, Kyung Han; Choi, Yoon Ho; Lee, Bum Woo; Moon, Dae Hyuk; Chung, June Key; Lee, Myung Chul; Koh, Chang Soon; Koong, Sung Soo

1989-01-01

Visual assessment of regional wall motion abnormality (RWMA) by gated blood pol scan (GBPS) serves as an useful parameter in thc diagnosis, functional evaluation, and follow up in various clinical settings, but are still subject to some inherent limitations. On important problem may be the interobserver as well as intraobsever variation that may well be present due to the subjective nature of the interpretations. This study was carried out to determine the reliability and reproducibility of visual assessments made in GBPSs, and to observe the degree to which the results would be influenced by observer variation. Fifty two patients with coronary heart disease had resting GBPS and contrast ventriculography within 4 days apart. Contrast ventriculography showed normal wall motion in 6 patients and the remaining 46 had RWMA in one or more segments. The anterior and left anterolateral views of all 52 GBPSs were analyzed by three independent observers, who selected from 5 scales, their level of confidence that there was RWMA in that segment. Receiver operating characteristic (ROC) curves for each analysis was plotted and the area under the curve (θ) was used as a parameter representing each observer's performance in his interpretations. The findings of contract ventriculographies were used as the standard for RWMA. The apical and inferoapical segments showed the best correlation with contrast ventriculography (θ=0.90-.094, 0.81-0.94, respectively), and the inferior wall showed the poorest correlation (θ=0.70-0.74). The interpretations of the inferior, septal, apical and posteroinferior, segments showed no difference between the observers, but there was significantly better performance in assessment by observer A compared to that by B or C for the anterolateral segments (θ=0.87, 0.78, 0.76, respectively, p<0.01 for A vs B, p<0,05 for A vs C), as well as when all segments were considered altogether (θ=0,88, 0.83, 0.82, respectively, both p<0 05). This was also true for

Solar Effects on Tensile and Optical Properties of Hubble Space Telescope Silver-Teflon(Registered Trademark) Insulation

Science.gov (United States)

deGroh, Kim, K.; Dever, Joyce A.; Snyder, Aaron; Kaminski, Sharon; McCarthy, Catherine E.; Rapoport, Alison L.; Rucker, Rochelle N.

2006-01-01

A section of the retrieved Hubble Space Telescope (HST) solar array drive arm (SADA) multilayer insulation (MLI), which experienced 8.25 years of space exposure, was analyzed for environmental durability of the top layer of silver-Teflon (DuPont) fluorinated ethylene propylene (Ag-FEP). Because the SADA MLI had solar and anti-solar facing surfaces and was exposed to the space environment for a long duration, it provided a unique opportunity to study solar effects on the environmental degradation of Ag-FEP, a commonly used spacecraft thermal control material. Data obtained included tensile properties, solar absorptance, surface morphology and chemistry. The solar facing surface was found to be extremely embrittled and contained numerous through-thickness cracks. Tensile testing indicated that the solar facing surface lost 60% of its mechanical strength and 90% of its elasticity while the anti-solar facing surface had ductility similar to pristine FEP. The solar absorptance of both the solar facing surface (0.155 plus or minus 0.032) and the anti-solar facing surface (0.208 plus or minus 0.012) were found to be greater than pristine Ag-FEP (0.074). Solar facing and anti-solar facing surfaces were microscopically textured, and locations of isolated contamination were present on the anti-solar surface resulting in increased localized texturing. Yet, the overall texture was significantly more pronounced on the solar facing surface indicating a synergistic effect of combined solar exposure and increased heating with atomic oxygen erosion. The results indicate a very strong dependence of degradation, particularly embrittlement, upon solar exposure with orbital thermal cycling having a significant effect.

Assessment of early-stage optic nerve invasion in retinoblastoma using high-resolution 1.5 Tesla MRI with surface coils: a multicentre, prospective accuracy study with histopathological correlation

Energy Technology Data Exchange (ETDEWEB)

Brisse, Herve J. [Institut Curie, Department of Radiology, Paris (France); Institut CURIE, Imaging Department, Paris (France); Graaf, Pim de; Rodjan, Firazia; Jong, Marcus C. de; Castelijns, Jonas A. [VU University Medical Center, Department of Radiology, Amsterdam (Netherlands); Galluzzi, Paolo [Neuroimaging and Neurointerventional Unit (NINT) Azienda Ospedaliera e Universitaria Senese, Siena (Italy); Cosker, Kristel; Savignoni, Alexia [Institut Curie, Department of Biostatistics, Paris (France); Maeder, Philippe [Centre Hospitalier Universitaire Vaudois (CHUV) and University of Lausanne, Department of Radiology, Lausanne (Switzerland); Goericke, Sophia [University Hospital Essen, Institute of Diagnostic and Interventional Radiology and Neuroradiology, Essen (Germany); Aerts, Isabelle [Institut Curie, Department of Pediatric Oncology, Paris (France); Desjardins, Laurence [Institut Curie, Department of Ophthalmology, Paris (France); Moll, Annette C. [VU University Medical Center, Department of Ophthalmology, Amsterdam (Netherlands); Hadjistilianou, Theodora [Azienda Ospedaliera Universitaria Senese, Department of Ophthalmology, Siena (Italy); Toti, Paolo [University of Siena, Department of Medical Biotechnologies, Pathology Unit, Siena (Italy); Valk, Paul van der [VU University Medical Center, Department of Pathology, Amsterdam (Netherlands); Sastre-Garau, Xavier [Institut Curie, Department of Biopathology, Paris (France); Collaboration: European Retinoblastoma Imaging Collaboration (ERIC)

2015-05-01

To assess the accuracy of high-resolution (HR) magnetic resonance imaging (MRI) in diagnosing early-stage optic nerve (ON) invasion in a retinoblastoma cohort. This IRB-approved, prospective multicenter study included 95 patients (55 boys, 40 girls; mean age, 29 months). 1.5-T MRI was performed using surface coils before enucleation, including spin-echo unenhanced and contrast-enhanced (CE) T1-weighted sequences (slice thickness, 2 mm; pixel size <0.3 x 0.3 mm{sup 2}). Images were read by five neuroradiologists blinded to histopathologic findings. ROC curves were constructed with AUC assessment using a bootstrap method. Histopathology identified 41 eyes without ON invasion and 25 with prelaminar, 18 with intralaminar and 12 with postlaminar invasion. All but one were postoperatively classified as stage I by the International Retinoblastoma Staging System. The accuracy of CE-T1 sequences in identifying ON invasion was limited (AUC = 0.64; 95 % CI, 0.55 - 0.72) and not confirmed for postlaminar invasion diagnosis (AUC = 0.64; 95 % CI, 0.47 - 0.82); high specificities (range, 0.64 - 1) and negative predictive values (range, 0.81 - 0.97) were confirmed. HR-MRI with surface coils is recommended to appropriately select retinoblastoma patients eligible for primary enucleation without the risk of IRSS stage II but cannot substitute for pathology in differentiating the first degrees of ON invasion. (orig.)

Kõnnivad köiel ja hoiavad kätt / Iir Hermeliin, Jaanus Vahtra ; intervju Sven Karja

Index Scriptorium Estoniae

Iir Hermeliin, pseud., 1973-

2000-01-01

Teatrikunstnikud Iir Hermeliin ja Jaanus Vahtra ning nende looming. Kunstnikud lavastajatest ja lavastajad Mati Unt ja Ain Mäeots koostööst kunstnikega lavastustes "Jacques ja tema isand"; "Laulatus"

Testing of the scintillation sandwich prototype

International Nuclear Information System (INIS)

Vashkevich, V.

1995-06-01

The 3 m 2 prototype of the surface detector using optical fiber readout was completely prepared for testing measurements in February 1995 at Fermilab. Two 25 mm thick, 3 m 2 acrylic scintillation plates (1.2 x 2.5 m 2 ) are used for light collection in the upper (above the 25 mm steel plate) and lower (below the steel) counters of the sandwich. The light is collected with the help of 1 mm diameter wavelength shifter fiber loops 3 m long inserted in the grooves on the top surface of the scintillator, 3 fibers per groove. We used Kurary Y11, 200 ppm of shifter dye, and double clad fibers. 1.5 m of clear fibers spliced to each end of the shifter fiber transport the light to the phototube. Spacing between the grooves is 5 cm. The counter's edges were painted with BICRON (BC620) white reflective paint. The scintillation plates were wrapped with Dupont Tyvek. The glued bundle of fibers is connected to an EMI-9902KB 38 mm phototube through the simple light mixer bar. Used PM has a ''green extended'' rubidium bialkali photocathode. The report contains information on the testing of the scintillation sandwich

Spontaneous excitation of a circularly accelerated atom coupled to electromagnetic vacuum fluctuations

International Nuclear Information System (INIS)

Jin, Yao; Hu, Jiawei; Yu, Hongwei

2014-01-01

We study, using the formalism proposed by Dalibard, Dupont-Roc and Cohen-Tannoudji, the contributions of the vacuum fluctuation and radiation reaction to the rate of change of the mean atomic energy for a circularly accelerated multilevel atom coupled to vacuum electromagnetic fields in the ultrarelativistic limit. We find that the balance between vacuum fluctuation and radiation reaction is broken, which causes spontaneous excitations of accelerated ground state atoms in vacuum. Unlike for a circularly accelerated atom coupled to vacuum scalar fields, the contribution of radiation reaction is also affected by acceleration, and this term takes the same form as that of a linearly accelerated atom coupled to vacuum electromagnetic fields. For the contribution of vacuum fluctuations, we find that in contrast to the linear acceleration case, terms proportional to the Planckian factor are replaced by those proportional to a non-Planck exponential term, and this indicates that the radiation perceived by a circularly orbiting observer is no longer thermal as is in the linear acceleration case. However, for an ensemble of two-level atoms, an effective temperature can be defined in terms of the atomic transition rates, which is found to be dependent on the transition frequency of the atom. Specifically, we calculate the effective temperature as a function of the transition frequency and find that in contrast to the case of circularly accelerated atoms coupled to the scalar field, the effective temperature in the current case is always larger than the Unruh temperature. -- Highlights: •We study the spontaneous excitation of a circularly accelerated atom. •Contribution of radiation reaction to the excitation is affected by acceleration. •The radiation perceived by a circularly orbiting observer is no longer thermal. •An effective temperature can be defined in terms of atomic transition rates. •Effective temperature is larger than Unruh temperature and frequency-dependent

O processo decisório em Charles Edward Lindblom e a vontade geral em Jean-Jacques Rousseau: reflexões acerca da participação política e da necessidade de educação para essa participação

Directory of Open Access Journals (Sweden)

Roberta Aline Sbrana

2017-08-01

Full Text Available Na obra O Processo de Decisão Política, Charles Edward Lindblom tece reflexões acerca desse processo, destacando a relevância da participação política dos cidadãos em geral. Entretanto, esse autor alerta a necessidade da existência de uma educação que tenha como compromisso a formação de homens e mulheres para a participação social, pois somente a partir dessa educação tal participação poderá se efetivar. Do mesmo modo, na obra O Contrato Social, Jean-Jacques Rousseau apresenta considerações acerca da importância da participação do povo no processo de elaboração desse contrato, a qual ocorrerá por intermédio da “vontade geral”. Mas essa participação implica a criação de uma educação voltada para a formação do homem como indivíduo e cidadão, para que este participe de forma ativa da sociedade, tal como expõe em seu tratado pedagógico – Emílio ou Da Educação. O intuito desse trabalho é evidenciar que em ambas as reflexões esses autores discutem sobre essa relevância da participação política dos cidadãos, a qual, segundo sua visão, será concretizada apenas pela existência de uma educação que valorize a formação para a participação.

Plaadid / Berk Vaher

Index Scriptorium Estoniae

Vaher, Berk, 1975-

2004-01-01

Uutest heliplaatidest Jacques Brel "Infiniment", The earlies "These Were The Earlies", Jim Black Alasnoaxis "Habyor", Jadakiss "Kiss Of Death", "Robert Rodriguez's Mexico and Mariachis", Hope Of The States "The Lost Riots"

Rousseau kolm korda kaks surmapattu / Toomas Raudam

Index Scriptorium Estoniae

Raudam, Toomas, 1947-

1995-01-01

Järg: 27. okt., lk. B2. Rets. rmt.: Rousseau, Jean-Jacques. Üksildase uitaja mõtisklused ; Arutlus teadustest ja kunstidest / tlk. Sirje Keevallik ja Kristiina Ross. Tln.: Perioodika, 1995. (Europeia).

Pärt, Arvo: "Summa". Collage sur BACH. Fratres / Patric Wiklacz

Index Scriptorium Estoniae

Wiklacz, Patric

1997-01-01

Uuest heliplaadist "Pärt, Arvo: "Summa". Collage sur BACH. Fratres. Cantus in Memoriam Benjamin Britten. Summa. Festina Lente. Tabula rasa. Tapiola Sinfonietta / Jean-Jacques Kantorow". BIS-CD-834. 62:30 DDD

Methodology for quantitative evalution of diagnostic performance. Project III

International Nuclear Information System (INIS)

Metz, C.E.

1985-01-01

Receiver Operation Characteristic (ROC) methodology is now widely recognized as the most satisfactory approach to the problem of measuring and specifying the performance of a diagnostic procedure. The primary advantage of ROC analysis over alternative methodologies is that it seperates differences in diagnostic accuracy that are due to actual differences in discrimination capacity from those that are due to decision threshold effects. Our effort during the past year has been devoted to developing digital computer programs for fitting ROC curves to diagnostic data by maximum likelihood estimation and to developing meaningful and valid statistical tests for assessing the significance of apparent differences between measured ROC curves. FORTRAN programs previously written here for ROC curve fitting and statistical testing have been refined to make them easier to use and to allow them to be run in a large variety of computer systems. We have attempted also to develop two new curve-fitting programs: one for conventional ROC data that assumes a different functional form for the ROC curve, and one that can be used for ''free-response'' ROC data. Finally, we have cooperated with other investigators to apply our techniques to analyze ROC data generated in clinical studies, and we have sought to familiarize the medical community with the advantages of ROC methodology. 36 ref

Tribological Characterisation of PBT + Glass Bead Composites with the Help of Block-on-Ring Test

Directory of Open Access Journals (Sweden)

C. Georgescu

2013-06-01

Full Text Available The materials involved in this research study were produced by diemoulding in order to obtain bone samples type 1A (SR EN ISO 527‐2:2003. These composites have a matrix of polybutylene terephthalate(PBT commercial grade Crastin 6130NC010,DuPont. The valuesfor theglass beads concentrations were established at 10 % and 20 %(wt.Block‐on‐ring tests were run in order to characterize the tribologicalbehaviour of this friction couple (PBT and PBT composites with glassbeads on steel. The block was manufactured by cutting parts from thebone samples, having the dimensions of 16.5 mm × 10 mm × 4 mm. Theother triboelement was the external ring of the tapered rolling bearing KBS 30202, having dimensions of Ø35 mm × 10 mm and was made ofsteel grade DIN 100Cr6. There were analysed the followingcharacteristics: friction coefficient (mean value over a test andscattering range, wear (wear rate. There are also presented particular aspects oftheworn surfaces, asinvestigated fromSEMimages

Evaluation ofrapid enzyme immunobinding assays for the detection ...

African Journals Online (AJOL)

Abbott. Clonatec. DuPont. No. tests/kit. 40. 30. 200r100. Neg. control. Yes. Yes. Yes. Weak pos. control. No. Yes. Yes. Pos. control. Yes. Yes. Yes. Internal quality control indicator. Yes'. Yes'. No. HIV-1/HIV-2 detection. Yes. Yest. Yes. Reconstitution of reagents required. No. Yes. Yes. Stability of. Equal to. 1 moo for. 6 moo for ...

Reducing the Use of Force: De-Escalation Training for Police Officers

Science.gov (United States)

2016-09-01

73 APPENDIX B. SURVEY RESPONSES .............................................................. 75 APPENDIX C. SURVEY STATISTICS ...That Influence the Use of Force,” Crime & Delinquency (January 2012): 59, http://cad.sagepub.com/content/58/1/57.full.pdf+html. 17 Figure 2...Influence the Use of Force,” Crime & Delinquency (January 2012): 59, http://cad.sagepub.com/content/58/1/57.full.pdf+html. 69 Ibid. 70 Randolph Dupont

The Manufacture, Properties, and Testing of Napalm Soaps

Science.gov (United States)

1943-11-17

prrcltio’n. Tests at 1000C. a.nd 100 p.s,,i. %Inhibitor Induction Addod Pcriod, mins. N one 0 20 Eydroquinone 1 5 duPont #19 1 150 Lecithin 1 SF0 1 45...acetone tends to hydrolyze the soap, liberating more free acid which in turn is removed by the solvent. Table XXIV shows results obtained with a

Ah, Euroopa! / Bernhard Peters ; tõlk. Ann Must

Index Scriptorium Estoniae

Peters, Bernhard

2005-01-01

Euroopa ühise kultuuriruumi kujunemise võimalikkusest lähitulevikus. Jürgen Habermasi ja Jacques Derrida üleskutsest Euroopa ühise kultuuriruumi loomiseks. Euroopa ja transatlantilistest kommunikatsioonivoogudest. Kultuuriajakirjade rollist ühiskondlike muutuste kujundamisel

Physicists bag Chemistry Nobel for microscopy method

Science.gov (United States)

Johnston, Hamish

2017-11-01

The 2017 Nobel Prize for Chemistry has been given to Jacques Dubochet, Joachim Frank and Richard Henderson “for developing cryo-electron microscopy for the high-resolution structure determination of biomolecules in solution”.

Euroopa kohale koondusid mustad murepilved / Jeroen Bult

Index Scriptorium Estoniae

Bult, Jeroen

2005-01-01

Brüsselis toimunud Euroopa Liidu tippkohtumisel arutatud organisatsiooni eelarvearuteludest, Euroopa jagunemisest kahte leeri. Kommenteerivad Luksemburgi peaminister Jean-Claude Juncker, Prantsusmaa president Jacques Chirac ning Poola peaminister Marek Belka. Lisa: Kahes leeris euroliit

78 FR 2687 - National Register of Historic Places; Notification of Pending Nominations and Related Actions

Science.gov (United States)

2013-01-14

... ILLINOIS Cook County 42nd Precinct Police Station, 3600 N. Halstead St., Chicago, 12001236 Strand Hotel... resources: ARKANSAS McCaskill County Jacques, Dr. Thomas S., House, NW of McCaskill, McCaskill, 89001940...

Ethnobotanical study of plants used to treat asthma in the maritime ...

African Journals Online (AJOL)

Ethnobotanical study of plants used to treat asthma in the maritime region in Togo. Holaly E. Gbekley, Gnatoulma Katawa, Simplice D. Karou, Kokou Anani, Tchacondo Tchadjobo, Yaovi Ameyapoh, Komlan Batawila, Jacques Simpore ...

Weyerhaeuser Export Facility at DuPont. Volume III. Appendices R - T.

Science.gov (United States)

1982-05-01

0 a 0 lo Ř 4 - * a . 4a 44 -1~ a1 .. . 4 4 00. * 4 14 P 14 4 0~~0 6 4 44 14 a 1 4 w 4 Id . - ’U A U44 44 0 U C ’U 4 4 A U4 4 443 4444 %A 4 .41 F6 A...W.4) C) C. 0 -C4JC CCC),)."U! CCA ISC-a~ C" 0 , U 3 C - 4. 0A 00. L .UA.C L O L U CL- C0 .=0 0 0) .-C V C, a 2 0 ) ACCa LC1 LCC0C S C.0 a-. UU~~~ A Cz

30. III avati rahvusraamatukogu VI korruse trepigaleriis...

Index Scriptorium Estoniae

2004-01-01

Näitus "Euroopa XVII sajandi sügavtrükigraafika Eesti Rahvusraamatukogus". Avamisele eelnes kuraator Jüri Haini loeng. Kunstnike hulgas on prantslased Jacques Callot, Claude Vignon, itaallased Salvatore Rosa, Stefano della Bella jt.

Imaginárno a pohled (Lacan, čtenář Merleau-Pontyho)

Czech Academy of Sciences Publication Activity Database

Fulka, Josef

2007-01-01

Roč. 55, č. 4 (2007), s. 537-551 ISSN 0015-1831 Institutional research plan: CEZ:AV0Z90090514 Keywords : Psychoanalysis * Jacques Lacan * Maurice Merleau-Ponty * the imaginary Subject RIV: AA - Philosophy ; Religion

Külaliste kaalumine : Draamateatri külalisetendused Tartus / Margus Kasterpalu, Andrus Laansalu

Index Scriptorium Estoniae

Kasterpalu, Margus, 1961-

1995-01-01

Andrus Kivirähki 'Jalutuskäik vikerkaarel' (lav. Mati Unt); Jean-Jacques Bricaire 'Tulumaks' (lav. Lembit Ulfsak); Mihhail Lermontovi 'Maskeraad' (lav. Mikk Mikiver); Jaan Krossi 'Doktor Karelli raske öö' (lav. Mikk Mikiver)

Garden of Eden – Paradise

NARCIS (Netherlands)

Ruiten, Jacques van; Collins/ John J.,; Harlow/Daniel C.,

2010-01-01

Jacques van Ruiten, “Garden of Eden – Paradise,” in The Eerdmans Dictionary of Early Judaism (ed. John J. Collins and Daniel C. Harlow; Grand Rapids, Mich., and Cambridge: Eerdmans, 2010), 658-661.

Rozum občanství

Czech Academy of Sciences Publication Activity Database

Kuneš, Jan

2004-01-01

Roč. 15, č. 26 (2004), 1a-3 ISSN 1210-0021 Institutional research plan: CEZ:AV0Z9009908 Keywords : Jean Jacques Rousseau * Immanuel Kant * Georg Wilhelm Friedrich Subject RIV: AA - Philosophy ; Religion

75 FR 69158 - Quarterly Publication of Individuals, Who Have Chosen To Expatriate, as Required by Section 6039G

Science.gov (United States)

2010-11-10

... Lenore Louit Nicolas Paul Low Elizabeth Lowrie Marcia Lu Chun Ching Luntz Reagan Mather Lusser Christoph... Chi Tan Yenny Jacques G. Yenny Monique Y. Yokokawa Jun Yu Pearl Zang Wenyi Zedan Mohamed F. Zeinalzade...

The Team Approach to Pain Relief

Science.gov (United States)

... Navigation Bar Home Current Issue Past Issues The Team Approach to Pain Relief Past Issues / Fall 2007 ... Roberts is seen here with some of the team members, (left to right) Dr. Berger, Jacques Bolle, ...